ELFa( 4?4 (  77((?__ V_DO! "&@00Q_: 0/?\@/ XX@0 6QQO @@( @0 <  B00 RР -Lⵑ _43d_main() returned"d   ),@@(LQ 0/p_l#d - 0LP@p``VZ -LM`P@p@D0D 00``@ -LM`p@P 0 0 0 00|v0  hbP@XP 0TN@TZFX 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i  -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0P?(U@ PU*00 ,*00" 4 )x0$(\ \0@D P g$p00 P 7 7 7 7 7 -4!L01 M, P@0 00eS4 Z0p , 0 Z 1!R,00 )  㐯P,00  @0S0 0@` V t)H0'P$ 0lP, 0 04 7 7 7 7 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `upQP* 0 P(U:p p-QLM0@`  `別pQP* 0PXU:p p-QLM0@`  `僥pQP* 0P\U:p p-QLM0@`  `7pQP* 0 P,U:p -QLM@p0 ks5s5 -(L  -(L  0-" _  P0L @ 00hS p-LM@ YP` 0O00PY YR` cUpp p-LMP@`V0 pd)p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P?XP 0s UP(0S{p(00PS 0U 0 0 0P 0UPp -LM0pS 0S 00 47 0P%PK% [)0S ) %0K ! 0@&@K& [)0S ) &0K xUUTT Z   Z8,0X12hZ(1,@0X 0KP0 0000S 00  000 @000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000O00KM 7 p-LM@`BPn;p -2LM PR|2   Jh0S`2`h0 ]0SL200l0S 2 2  B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ5"00,0K,pK!0(@ *pK+KV 0< I8P202"202" ,P2$00$0h0 ``000P w4Q_ 7 ( 7j70 s5tb p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@PO`W@Ep p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U Lu    (k he 7jt5`:6 t5,t5 0-L@LP w0( o0( 0hf' -0LM@p V00 ` E00 PZpd3 <# R-00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pW0++'0K 'K$0 a0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PL4p`V 4h$0( 00]ZW$ 0  $00 $00 DPT$0 0$0k5XM68t5@t5Lt5\t5lt5 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \, 0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 5P0 0  0 S   50S0`00`0 5P0 VE00@p x0 5Pk40Sh@@j0H 00OK ,5,5P000/꼯bt5 7 -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|P00 `0 0T2 <201$2t5t5`:6t5t5t5 p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0 t5u5Lu5 -0`10#0LP8pJP@/ 00 0000  0 0, 0 004 P`0 0@ 0  @0$ q0  \$ & & u5 -LM0p ` P_?0ST  0 PE0 @ @00$00$0 00/A#bJi  i*  0 P(0 0S  0 Ph ,000i? YMb7 -LM0` @2c1RP,p 00 P 00 0 (0000  dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph:000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,鼯bu5 M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,m鼯bu5 p-LMP0K`Pc @X_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@|P(@rT` >0tb p-LM @00P _$0`0$0 @R 0$ 0 00  0 phJ\tb -LM4@0S @440S -L M$X @R0  l0@ $@ hu5u5 - L  -LM ե@^ 0S@0 @tb -LM@ R000 hN 0-LP,0@T 0U @T0tb -L MPP@`x &6`&`006 &006 , &6`&`d006 )-006/`P@K05K$KP\6X6$[  y=QW BQ/ +>4K5 05KP4[S:0:  ,(dw Tl5%#K #K<KP5  [5\# P6K 00 Q0N@H%H59 0> 09* 4 4 w4 N4 K ღ! s Nl:$0:0tܺ3l$ 0 0(*   0 0 0* 0ٴ* 0Ҵ 0ʹ*  d0 0L廴* 04崴* 0᭴ 0娴* v 0᜴p 0喴* 0叴* 0ሴ 0bヴ* M 0wG 0<q* 0$j*  0c/ 0"]*& 0V*1 1@ \`0*:Ŭ1\:0:Ŝ1Q|11 P0*:l1 P:0:L1 41*@1@ Q81}>$:1* 2R 1R* * < :0:0 Q: ;꼯bT!w5x5x5x546v5+ , * 2 4 . 6 : > B F 8 D t `:6؄ &7L!D_e(!Na'(j) -*8 L#8 $ʐ R2 d XH -*8 L#8 $ʐ R4 h XH -LM:`0 5Rʖ R2 d 0X JR4 h 2Xxrʐ R2 d 0X :R0 ` (ʖ 0R4 h  X2Xo_  :R" D ( ʖR@4 h 0XH:$HT@ 0  `1ʖ R4 h :X41ʖ R2 d $1X1S0ʖ R4 h 0X0ʖ R4 h 0X ʖR4 h 0X  ʖR4 h 0XHp -40Lʐ 0R ( H -LLMu0 @4 0`R4 Rd PP 1Ql00l0`Dp0p P <C4S< S 00 0S /S <p0 S#0 Pp p<P3 R3Q  0 そSDl0KP6[5[ IPP 1  Y00C b b`2 Rz 6[* RO s RL $[QD X"0. Pdh0@"0h00S 5[  20S S 2 RlK 5P)= 0p G P 88 _  G> Lt8)$[Q>K  ^8K Z *K V 0 0D Pl00l0 O R[>0Sp 6[´p   lK4p0 <0 < P :8 Tp <00 0lK 6T!( 4!0x5hx5* |x5x5y5Ty505;505t0p000t0p0 p-0LM`a (0@b5K pL0,0P@@T  ph7T!ty5 -LM|A0P 00K  00"[80 01R; R 3[pCX#wmW`ʕ   20K!0ʕ R8 p (K#[0 R3K#[101pW0 0 80xH@H0[ [=   T!H -$JL@DtpP ʗ (0  @D@tTeaʗ 8R  #8X JR8  #8X 0ZR8  #8Xʗ 8#8 XA ʗR0 ` (0P@DtT8< 0 :R  (ʗ 0R4 h  X0X  8 Hy5y5 p-L My= PR`0 PEu @0@0 0S PEuU:0:T`e\01K02K01K40 K p(op:PT!y5 0-y= LRP :*$@ ʕ<<*0Tl ʕ@*0T0ha0 -L My= @RP 2R 2R 200!P 80Phr: R8 p (0 hVu :R8 p (0 Pe`\0  R L8 p 凔0? SG y= R 1R x1R 1R P P 0 00 0,1R 41R0AS@N LN TN \N tN tN dN lN tN tN tN tN tN tN |N  0P 0S0S\ (PK?2K02K]8 80(PK U T!H*D* (!#(( -L8MP`? Q y=\ 3P [2P7  80Pp.Ԃʖ R8 p 0X JR08 p X0\  R L8 p L2 Dp0P0""K0 2K"K )= R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kd!@0p2PTKPK&U?G  K5K0 Pp@W 0"K0C "K SR (R 0R 4Q 8R @R HR 4Q 4Q 4Q PR 0[,PK2KX0000000S>D0,PK0K2K HT!!(* #(! 6S-L@p6 8S `,Pʔ0S8 #8X0ʔS8  #8X|Pt0ʔ R (0  PEuU< Z `Hz5 p-LM@80PP`0 (  R8 p ԒpH -LMPp60 P a 0?  R6 l  ʕR6 l 0X JR6 l 0X 60mP@ :R6 l (P0 S :R6 l ( 0 SH4xV -|1LMp00  @PHQJDaʔ R0 ` (0PEuU4 :R" D (  ʔR4 h 0X 60Po?PPl0ʔ R6 l 0XP?U<  T!Hz5 -LdM⌐Kd 6108K0p8K05 -BTP @ 00`W W0S PTp`@00X 8K0 5<5 d0 T! p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@ :~D@0 *  &1R 1R 1R111R 1R 11u 1RM !ʄ1R x1R p1R)=`1\1R T1RL1@@1 @ v= $1 1R" 1R 1R10 0R 0R} R0`y Q0u p 0v D >v 0 4 8 . 2 > : -%*< C* 6 B F Dz5| -LLM]p@\ ` :h l  0` \0勦P`p=T &d=T\=T*T=T IH=T @=T h\ lQ `}ヤP \ hxP\1S ` 3Xh h ?0\ hP5 =  (<T> <T 2 = S! =@S <  8C8 : :  X< R ; 2KK"K`<0K  : < R X;2K03KK@ @ 505\ 0S ;  x;  \ohPi \w r \14P^5@Y \ጩ\:T )P:T H:T;hУPB  呙h \0*hP' h5 "\ 9. @RA\0S\$9T2 $9T㥣P : R,\:!  00v-0?K2K 9"K 0K9T〣P \ hvP@ l 6dh \0T)hlPh \ t8P* Y8PP  P  P H 0hP hP5 0 h0 w7P7 Q7 P! 7R 7R 7R 7R |7R\: } : y :u :@q :m h7f7P 6P 66P \7Py= RRy= R D7  h!(7 @&0<hТPB6 R> 52: y= R6  兘h h6)00 0 |6  hP5LU   0% ?A1c バბ 0s 2c0<p%T%04% <5Te45T]*,5TV $ 5T 5T \ h T0Lh h4,085  hP\0h 4T& 4Th h \$hEP5@ y= R hH P\ h\$m. \0ᯩ \ \ 3T 3Te *3Tt3 R}\: w Ɨh O h <03 hPVhv= R \ 101M2TI5 2 R(  垗h ' h2,02  hP.h0 S* !㆗!l  hl  \ l! \ ! :/,h姡P !h\0l l! Pl  Q10Sl;@% \:P  @X`K@&@ @`1@5KEK A%K RK0 5 0 l;@ Pl0  0T A0T&#di2i 1i iii i i i i i i i i8-%C7o gffflz5i i iiiB5i i i i i i :Ai86i(i|* 8171( T!@0Tu` P{d0 R  TƖ\h O h0, 0y-0S 0  hPRh0SO >\0 d  h00iZD\0|S@:Vp h  pPf @| 0 p0  p0@R0S@00 t %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p  Px00x0\d | P\ 000hd0 |0 iZd0  |0R*V Ȗ |(`Bh0 [  0h20l \|h (0h \0@#hGPh0 Sh3 RL  R 3R 3  hh 3 ᳠ᴠh w T h0+ 4R$ 4R  P hD\ v hD \4Ry= RtDh [ 0h04h 峠0㴠0h0y-0h0S00h 墕h + h4,05  hPh0\0/ - 0-M0LM PcR  y= R :AKA A 8s <0  0|0 ,t0t@p0 Kh ̠0KPL0K  R808 Ca᳽0tz5T!7gfff -LQM: `! 0^d 5@G7য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK >0 5K?5K%KTK 070'5K K%K\K 7'6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK: @tetvPK@&@G @lP6@;`@K KK;KK 0@T 5 R- 0S R' UAoK@@@&@ @K  @`P 04DK3K0 M ?0K ; 4K84 R 5 ll4( K-K00QK3 :Fo$4PCP 0nK0  P+`!0*  P:`! *d%5 @05%p3+%(aV<0((3( K$S0BSKR/K00"2(K UK >K 0 2"v#00  y=P 0S P W_KVoK )=0\0X2(K!0p424"Q1"W_K(KVoK01( KOKN/K00 0JPK&@@(1@K@ =KMKKZ  0X10K8KKK 0(1(!8K 0(K8K 0K:|v=0/K7K'K 0|K:l. T!* 6 4 2 : > :[8 , : 7z5z5 |*D!F -B -LGMA0Sp!, 000Y 1 Rx10 S<0K o 8K k 18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[B90K 5KO  B=BM0 B@] $[H4[Q04KD 0  0000 <  BM@ B0;  DPp 0 P0 0C0 0 c0 R 0 R 5[ C  0T!t4{5 DQh|546|5P|5v'N$ -LM9`P(0Bp S?ꠈ \ d t l t t t t t | 0H S$Ԉ L Ј 4 L T  000NP@){P Ԡl0l 㳀pT0 R   * 4 6 p-LM@!0! 1P` y= R x1  , RT BRP1   R p41 00S l x x x x  0 8 0 \ 0 @dp0 ^0 V0 t0 h0 \0  R  R40  R: 0 0 * 6 4 T! 0-MLM@P800000|1 R9  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽 ȋ ȋ ȋ  ȋ ȋ ȋ ȋ $ 0000000004 * T!D -ML M:BKI0 I| 000CSuv  D 0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# jP`8 0(K 0$!  0  P`   QP` 8L0  @ T P`@ T! p-LM:v̀@ ( 0 P `  000店 0S`V@PpR 0 S)P ppp|#d -<0(,0L0 : > T!0 0  : > p-QLMPC  R:`:: :!::`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@8p, 0, : `p,!T!8t|5 0-LM:@+P"0 00> Ph0ʔ R  ( P 0,0B=C1: 0000-0T!H R-L  0 0C SEꠓ h h h h h h ̓ ؓ h  h @ L h h h p 0 00 0 0 0 0 00 0 0 00 00 x0 0-0X 00 L00< 00 00.!0!2!4!6!8!:!!B!D!F!H! 0-LM0@PShP P D ԕ p x P h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 00= x 00p0=\0 @ P 0@P<0< @P.!T!0!2!4!6!8!:!!B!D!F!H! p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L 00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S B0鼯b|5 0-8yMLP @t0 R 0s? X0  @0p  R0Z0x0 20h鞳 * L |5 -8BMBm(P L@"`p"`0     밠 '阙|5 -8BMBm(P L@"`p"y`0     밠 i|5 -LM8yp {s/000, V`V( Q8c@0S91!@P@dDFA 02 S&h1b1 R0``00`Y `0:,o@ R }2e@TZ @ @dPDFA@04 Sʄ1d|A R@0 @000@0 @@,  ~PbTbDb97|5}5 -LMy]f P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  o2m00 1+ 8`  1R010000 0 !0*0!00 0@@" A`d 8` 101! R00:`E w7(}5X}5 p-LM0@y] PR0000 0` !*!0S00@@@P2 ph0 Ca7gfff -LMC0ID`y}@D pD20u? @$ R00000   R 0 0 0 @0S(("@P}@dDFA@04 S1d1 R0``00`e10C1̉ꔀ匠@@dPWDFA@04 Sʄ1dXA R@0 @000@0 @ <@㦉TbPbDb -LMp0! 1?2c!c2c!p@ymP0 `P0L UF Dn @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101  L H0–  D 㘈P~HbD 7-0  t0 a1a2cP  0Q P 0S!0S~H -SLMy]` 0 P ʴ80N0  0A 0  pK0K@K @y0 SK 0K@oPZ Pp 3• P P; (3 p,B]P3   M   B-" 0Z $ Ӳpڨ K0 KS&  ()= R RF R (pZ (p@\ 0  @K!1@RTں1D"01@82P @dDFA@04 Sʄ1dA R@0 @000@0 @0@0(p}@0@0S @ H@00K@Tڴ( PF(D20H" 0J -3L $ -LÐ00 T0 ꤻ4 -LM@ 0@餻4 Q-L@0 ?-#@?Zc?!NP  ARN`PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-LM0 00 PU`00S PU@ 0@- 0-8P<vTtl߳pn_4 (\_ -LP@Tp` T 0@`(R 8S h - LMş0 0 P)((, @4 p0qWl Ʒ8PPa ᾷp5% 0 l[   0 0S㭷00 p0 00 ᡷh 5 ᘷ, 0S 0Sp) `p$4P@ p  0Sp0 p0 HQ@Q Np 0p0 R, 0 0 H0S H00 lK H @TP0 @TT000 T0   0T0Hp0eH꼯b7Ă5 N -LM@p0  0p0 p-L M@0pPt`x0p0t0880V @U 0@@upt6465 -PLM@D 0R@ 8pƲP堀`U UJ +<W0  p0 o魲0 0& ᥲU*嬠`0 x p0 0RTp0x 00 h `P"U:@0a῟0400 T7(77 -L M`84PP㈠ $8 ,    $g  $@\  p $0  ,p@;0  , 0-  , p0 0p0| R,0H⇛, h0@"20S  $ 0  `0`S  0Th0!20, h0!,2P0 000 Tlp @0 0SA 0  $ 0@.0T:x t0 0Rt0x  $@l0Ta0T, 0 0 000 TD0 R ]000 0pp0囱(77T'7 -LP `Ꮁ0piP $  $ @$r@ 0Ttb -LMP`p_}N $0 @T ,P80 T00 0 }N $0 @T  P|@ m$ $0@@T Է 0T 0Ttb N -LMP `p@ 0Tb@0DD @T0 T 0T 0T @0T0 T $iİ p-L M0 K `0  PP pW@ T \0\@PU HPH0 0Q S00 4 0tbn_tb(\_4 p-LMt`t0lP P0P@HH D0 0S0b$0@p庽tbtbtbtb 7tbЂ5 -LM℠Pp@0 `V 0 =8808 40P( (0ptb7dbtbtbtb7 0 tbtb0 0 tbtb(0 R 0 Rtbtb 0-@L 04 00P0 T0h -0删S@04p@@00  LT5 Qb  $  0P T  0T0  T 0Td〶 R$ R  0 T R R<$  0 8 90 S0 00 0 T  $0@  T@0  T0@ ,0Tğ$00 S Q0Q3 r T ᘜ< ᔜ Pl 8S080m80$04 40\XTLQ00ͽ000( Q 00 徽0@ 00 ~崽0 002  R m0 00壽  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0#0  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 90 @0 0 lɻdƻtb5n_4 (\_db5 < \ 5 545P5l5555܃5tb`:65tb'55 -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T Ĵdp}N $0 @T 0S\ ሼpT  $0PPpT W<5 Q0- L@P Q 08S0@f  0-8PS@L "L4QKK0߉꽢PP&7 p-L Mh@V PK 0IP ,0"  000(^ `08 M00pp80 -L MX`U(pK 0qIP@)aP(,0 0@00(PU 0HZLKH 080$00h : p-LMP@/`f 80Hph$ -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 @`p`B0 Xp0C$ 0P8 R <0 ,4 0 P@ 0P0NPP`  0 0B@$B -LMxPW$`K 0HP@)㞬p$ ,0#  0@0(0(?^ Hቬ㈬H 0p8P040 0w p-LMP@l`8 0Hpha p-LMPh• lp2  h2l ,` B\0 @`0 DںT8V Ӻ0\2p0X6546`5t5 -LMh`plp2 p h2l , K T81SM h–lp2 p h2l ,hRlp2@ p h–@0l \@ Jh–lp2 p h2l ,@cT\\hBlp2 p h–l 1\UD`hBlp2 p h–l 1\간5 -LMp 0PPU $0Z 0PPU &0Z>o ($8 0GP@ t2 |,][03P @ 090P @ 090P@ 0P900E?0P! 0U90"$P0>U 0ڔP2|"PUh—lp2  h2l ,h—Plp2  h2l4 ,h—lp2  h2lH ,0 h—lp2  h2lL , \4 ,P ~dIhBlp2  h— ,0l\d IhBlp2  h—l 0\P 㝱h—lp2  h2l ,P Ute @P1PM>UHEBGh—lp2  t2 hB,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h2l8 , I$I00<#N>C 0ChR0l , Ȅlp2   h—4 l 0\2hbA$lp2  h—Q0l@ \hBlp2  h—0 :lH \hBlp2  h—P 8l\HhBlp2  h—lH 00\hBlp2  h—l40L \00#GP `Gh—lp2 ` h2lH ,P U P 1@T!0040THPH嵅0L8 Ֆh—lp2 ` hR3l1 \hBlp2  h—l ,0\pPUJAPU@DZ@7؄5@%I$7 !&70 oEE -LM HTe | H0S 8$T| n@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPp$UU U mteh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2 G00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\FhBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\FhBlp2 ` h—0H l\2E 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 R4Q_= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 (N@g᪔x qp1@`qXɵhB lp2  h•l 0\ 嵵}~:`\80\8S?P`\(堵0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pL5!7545H5 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L㤦(PM0h陦 -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p帳d5 -LMT2p0T2Y0H0,08,8RT $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200灏3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0`<0S R000R0 A60S!0\@PD R 00c0C20000#2w㾥`t<ḥ$0S` 4 00hB lp2  h—0l \Z0 00㚥`P<ᔥJ@Y$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 m;Tph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P C0 QhBlp2 h2 l,3 `VZ00h;/0S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`+P, @ %P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0O,0P @, k4040<0<@   1140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $p408 08hBlp2`  h˜0l \0S 0 R P@~` EX0 P0 ,!A ,(0=$!7Mb0 0  Q-L 0S S 0SQ 0 0 )댅5-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@3$! 0-L@mP0he -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y 0&!&!&!&!0!<00  #?P @ 00S  X 000oz000, 0r00  o* 8P 80(S"ˠ ʠ0S80 S0000 \777t7,7D7 -LM04p@P`@ᶢ0 0004i6 -LM@P0pl14 RO80 TXH1 R<㓢`Pጢ090 @モ0 ` 50 JtsL0$ `R 090 9oc0 #>XS @ $0S Z00N`P⷏#d5Ѕ5 p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@K9P 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳,!X-!8+!8+!8+!8+!8+!-!8+!8+!8+!8+!8+!8+!8+!-! .!H.!.!.!hB lp2  h—l 0\0ISh— lp2  h2l , ~hB lp2  h—l 0hB lp2  h—l \3\  Q]hBlp2 h2l ,` \ R\hB lp2  h—l < R ʁ R 2R2X` 0 `0 ?X=0` 0vp2R0 RX  ` * RU 8UXh— lp2  h2!lP , )4)Ƞ XK W0KVKUKXKh— lp2 `  h2lH ,`( TKP1  )40#R K@  )08 0 Sj`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0>P`$ @ 0A,(0"A 0 P `4@  D 00pќ(04 0,08`090oƜ0  o[ 50 0P  -LMP@0嫜0pSS 004`090LP40S ᙜ:㕜pK30( 90 i鉜 P40S ꃜi<5 - 0p`L<0@@psP4{l 0-0L@P80h -`V`V` pP0UL`p` a@d 00S APP U ˪ha7ub@ubd5l5 -LM@0 00@ hq$7 -LM (0("t0'Q0@K0 0Q0KU 00KR0@K h 8P@0KR0(p0tP@`%#7"00K@ubub - 8h LM8#0!P @0 A0T S  0S  @ubub -L M @ 6@c"hD! -L M@ 0@b"hD! -LMD0P#((0"tL1'ATM \0SJ<`(P 04000@`;00p@ii0S  ㋖P*ڼ0SSS <`00$0P$0S i駄<4wtO&(0("4400$ 0 0 iꌆ55WEVhD! 0-D0P @L 0㿞P 0000P0G7 -LM0s@S* 00 0000 - qL`PU  0ցP6PU $00<0$0@X0 P:00 @s004;0000 `\ @1@!0 H P@00d@0 H Y(75 p-LMPK@` D10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: fE -T LM@HT00  (0R 07,74b5 0007 -Lp`P7@T@ h R(( `@ pp00 Ć5Ԇ547 -l`L@PTp P 0S `@T$hƧ0T0 h475 p-T0LM@PT` P 0S @Tpp47 -LM@h 0-pPL0S`0@T P@T00020#J8747 0-XPL0S H0@T P@T000 .8747 p-LMP60@`TL  (`0#p?pԆ5 -LM@ h- -LMx@0Slh%d#@T BLP0 @@ 0 ,@T475 5x5>6(5#`:6 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QG70G7 -LX P00@-SP@  0P PR  0S0P 0P 0 -LM@Q墦  0S85 -LM$0p@$0  P`y Pq P  $0S $嫈T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K 꼯bH5@5b@bpDKP@@PK P  T@P P0*p$ P 555 5H5 - Lal -L\lI -I LVl -LQl H -LKlH -LEl X -`LQ 0R 0 PS00U@ hp P 000T@"0@S 0U Hba0 -LMB# -LM@, p  Ǥ `P4` 0S !崤1(S! 0#!!0 V000 8` <` <P0SI <0000S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0K p ,0 db <000P0 `P 0 11` R0040  $5T5\5h55555ĉ55 - ` 3p11#XLP@0XS (PP 3X0011 頉5 -LpPPP T*0 S@T:) P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CS _!L_!T_!\_!+00 <0 @ @T:`*0&0/0_ 0-L@\Px $t@ 0h17 -LMRP J0,0 @pT ,`ZZ2PP I0D1S3$a!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!8a!`!Ha!xa!`!`!`!a!a!`!`!a!`!`!a!`!`!a!a!`!#H5R- R 0S0 \R000Sa@\ 0-LM|P* uP@KP~0@vP KqP00 cP \0 0  0%0 K]PhNP TPP5PP 8</PP ()P d5x5L5\5b556 -L@PT`p@Dt @ PGP TP@Dt0P8bP@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0Pbbxb؊5557b5 -LM||`P0Ulp@0T UPe M PUP0U00 B P777 0-@PLP 4 0S! cP  P h 00C0\@P ! 0SU00h}0 qPP<57H5 0-H1L0@S4!0CQF!0D]S& T T T T 00h 00000P@z00 0 0 0n p@x0 0 S 0CRL000 (00  y77777707 0 0 lQ 77`:6 -LMS@ \00S SL L0L L0P 0^0?l 0岛 07l5t5|5555 p-LMP@PLU` phX8`U0 ,$0r9LPp_55#46$5 -L MP@0T(*$K(pK,`K3$0  $f , @Q h0( \$0T\ (0DS<0T:,0HN_M_܋5755`:6x"d -PL`s%HpDP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 w4 S 1!0S 2!8S  d1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@叚,1@@DT$@D⇚T_ 做 00CS0 00CS0ڸ0 RkEg00  0 00Sv h00S 0So P00S 0Sh Hpfb bbb56`:6b577 -LMp0@SSHP S 0S iX 0  xP~i/ T`0 Q00 28 6S Q 000bb 0S00lbP0pQr  8 80, ,0 0b bbDbbbbD0<08 pQ(0 0bb bDbbb-L0H D0pQ, ,0 0b bbDbbbb 80cR   (0 0 0bbDbbb p-LMHP@ - D T h0\ `` T` T0V D0\ P00p37P 077 0-@@L08PS0S0 000077 - 0L@TT xP\ lp`bXd0 4P 0S<00h-p h&43d7 7b 55$5 0-\L@P 2S P(0P2 00745 p-LM`P`@2S@T<phޘRPT0"2 000p7X5 -LM@ K;40S0:00A0 R0  _ p-LM`@P%P  0S  pP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$P7b5 -LMP`@V 0FS \o9P o4p0S  SQP頌55 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP xW0`p0@2S @T:0T0 P0(mWP75!5 -0LM pR K >TP@`2S@PT P Wp 77 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5b7 -PLPM`\p 0K@  0SV 000b -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (dyl RW xK| K0P x| P@hK0@@ 7b7\65̌5،5 0-LM(P@ 0@?0b-00 Cb -L\ b - 0L0S b -L\   b -L\b -LM$@Tb -L\ b -0L0Sb -LAP MK!P 0Q)0S~H0@0U0 R0 Rx3Pxgtelbd X04LWHH0 @Qx"db 55@b4Q_pb(5x5`:6#46܌5bb5 p-LM`P pP@0T:tPt@0T*dP 0 @T:@p0P 0 @T:5h7 7N_M_b -LM@KP -LM KPK -0 SL 0  -L \   00 -L MSPhRKP K PE@KPP CP,B<95H55R0 0 0  -T LM@HT 00  (0R t7p7\b5 0 0t7 P-PL` @T pP 0S @TP@ 0P0`0 000 $mU0S,5x7l785Ć5 -p`L@PTp PP 0S0W: ` @Th0 00hx75 0-LMl@0S`0hXPU ;@P@D ,, @ PU0x7P5d5x5>65 -LM@"h 0-LMPKP@@ h0 0-pPL0S`00S @.0 . 0eO @T0~Q000l7x70 l7 -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@x7l7 -LM0PhS` /S+ bS` `$pK 0S #@x $ hi$ 4PX @ @0f0P,`lSꔎ5#58bTp2i 1i i i 5i i 6i( (0-"(L8@UPP h0< 0\h0 0hO>l00l00 -5L,p`0 <5 00 R0 RQU@ P5<5 0S 5Q 0  U@P5 <500 R -(L"hvPp80% V0`P@ V1T$ UP! Pš\   0 0e8#h 0PP@  0a0 000C b b(0"Xq1 [ -LM@dr`b2"002PU" $2PU bt5 -LM`Rdr` $ $ $`@ $@D@ -LM8#x2@TP 0`bd  0pD@@lH$H@ @dHD•$x@ -LMQ@Pd`r`  \0 P `t@T -LM2@S3S020S ܊鸏5 -LM2@S 3S02 0-@L 3S8PDSOD0 -L p-LM8@@?0X”PPh"0`\TX2\t"$$0 0X”h"\0Tp#00X”\"$@ 06 -8/P@0XB``L\h"0TX•\l"0TX2|"\$ ?00S SX•0\|"TX2\"$ 0X•@0\"TXB\l"0TX•h"\0T -LXP\0 TX2\ $X2@\ @$@T# T pX• \0_Th h0Qd`@ 0@QThQT T$p0@#ppL!|!7# -LM B{tA/0l00p 0X0 0 @`00 @0P `p`${@bb -0!LCM0KoK,0 %1IK AT@# {A/0萟0C0 0p@P000$   0 0 0 P0U 0|0`/@0P`0`  1z[PU0 ,0S ,k鼯bb@bȗbԏ5 -< L0S 0ahgHb7pb0 Hb -LM`@^LHZDW@ 0-@PLT:0IT: p-LM`PU p@ g g 00 0   PP˴PȴH0   R00lbbb!pb!bbb@b 88#PG-Ax= p0 0C`[%[0 bvb3. P+pg "+!U! ˠ  @ 0,ˠ . 0# 0# 0#0#0#0&, H!0x 蠙b4 -2LM RpbR0K@p$ 00 ,*Av4 00ca bP`\lQa P P!88S Q4  40@040 4 @ 4  40@040 4  4 40aQ040  00bC2S0c0S 4 P1P@  y0 R0+A"R`1 Q8 > @40L000  p:#04 0qcp=@0 x0S! $@0@ 4 0 4@ S1#$4S; !!!!!`V00Y00S'V0S1!@Px @dDFA 02 Spʸ1b1 R000w e=   XS``L0S, #`0A0$1` @0P`A0` _P`0@0 X [0/"?CQPEu ڷHط @APEuPZ @*_T:|  r<\bPbTbDbbb 5b - 8LM8A#4@ S @0 RhꠙbLb 0-1Ls@LP sDP@0 08040 <0hw00@cw0긩bPb7b7 -LM@ TwH 0S00  Q0 0 0S00h?wPb< 0 0P -LM@ 1wH 0S00  Q0 0 0S00hw긩b - XX%$00R0LMSp_0S wd@P0`0J v0S(%4SZ(1   1 !@Pv@dDFA 02 Sp1b1 R0``00`v ;< S:#8#H *RP 08#H$jZ0S  ~;`bHbPbTbDb -LM`P&(@l1pUR 8\1U& P1U p(EP p }v 1pyv1U}EP ov@ɰpEP0 ?R#p ]v0p0U :00SXEP @Iv< 00 S090 ?v0 R@R R bR bHbR - LP0\ 0@0`pV 0p  G*@h0T Vh@8PS'00P B  -LdM 0l  h PD0 Fx@ `@ p` ht 00 0l@8 `0<` @@ oD@P H X T   8@T0$  lP00CSP8hl P@l@`lX1` Sd \  0=S2 p0@@S@<P@ hPZ40ST` H0X 0R, 00000( RfQ@ RP 00] fP`T `` T<@_  X 0S8h0S T `0 @ P T 0<`0 0R1`P ̀T,K PL000@P @dPWfDFA 02 S`ʌ1b1 R0P P P00=faP+ +P P80^ l0 4 Pp ^PU \e*!l!P2@0P8 Y 400 00U \F*80!l!1@Ye0P 400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 34 00,00S0c,00, a08 c@8D"$E"XF" p-L$M@P0`   K 0`<P0Sp -LsM, `Dܡ  ! 1 儀 |` Kp6PPȁ ́ @80S P104 ,0S |, Q0 0PPT0$ 0 0PP`@K 40PPgP  KPPC[B $D 0@uPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1$0 jK! . . R l>K! \33 5 Ƞ FmP!>Kn kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS04"4"4"4"4"4"ȑY; 01 bpnKoK  m?KP H\5!:0\*  b 0 0b$10#[1 @T 00 X $ܡ $ lP PlpG0!>0kK1 ̑  c. . j?K!#[ ̑ ,꼯b5 -L,M 0 D 0 ) K3S`@  ^P1D RBB#p  0@pP@01 1PP"0PS@ U3 414  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[402PU52 0C4 < 8 @S%7"(8"(8"(8"X9"9"8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R f#]@@@ )K@\0 S*d]eD   D0P@( ) K zP X75P7 c -LLM@Q@D1U d0 ` 8d0K00pW q#Ef0Pp@ `K _#3f0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 ]p c0S -L MBpBP ,0 "` 0@ P@"@2V*0S @T:@W ## 0 PP: _"p  0P@0 S 0R , P -L$M (14 D @H `p 0S0  P 0 @S@R*0 S  R:R*0@ S S8  Q Q 0S< 4 # S S 40040 0S S SQ 00 Q Q Q Q Q @ 08S8 0!0;L0  H  00 0  L0 0Q0 R0S .,Kk P0 (1, 0(100,0H, $,0, (00(0,,00C,0,(0<0  (1B0(1\ PR00 4 @\? ! P< @0S 8?@ x!@ Pߜ? o!(10y+Pc00 0Y0 P0D4"(10(1 Dd(1! 0(1,L0 001H  L0 1000 (10(19 00(1 004dZ P% P ?!0S0 @PE\ @dDFA 02 Sp1b1 R000-\?0 ?!00 01H Pj? V,kE@꼑5d-7$b cPbTbDb5 p-LM@P0c0?  Ad`A ὚ 0P?[!`p p-LMPU`% *@0 PR@ U: @0\0 ?=!00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV Pp $@ Ȍ qΌP00 ``fP@0  -LMp. .\@0  `P`$@ @fP@0`P 0  00P 0R  $ . . m -LM@. .\ 0P p`@@ ȌqΌ$ gf p-1!LM1!0@ 00>0>0^`P 1.*!n!00`G/ 0B!0b0!P PPP0^*!n!00` 10G?  B0 P0PPpXF" -5ԥLDM0GXM41i\V(Q "gHr `  ``0`PPş0P0S <0 0 40 < R0< @0 @ 0S00 0$0D`0H  !0 ',0  !4x4 15 h xX mGP iGDDP0 @H)0 P.4 (0Y/ 00O0P000#3@p@A Q@Q0@0P K3PK@cFF_Pp00 0fLP@0`*144``|p ß$3$ > 00S P0SY@HPKA Y "@11@TtrhJpŸ0 @ @pMPH @0S @0 $"iA0S5PQ $09$00 P@ a 0!o0 @ 0 0 x0 @l1Z 00@@Z׉1 DP ]1 <PU0 4PM0 ,<#d$b46bbb|b8bb"7̑58V#Lc#bbb 7bTcbbPb%d#d 7bbO"ԑ5(b5&75 c c5tb\bPb_,5 5054R"85D5$R"L5\5R"d5p5`,|5b &7 bP(000 P @:f@;PPKPK^_PK p0@t@50@+BZ -@ LHM0, X 00 TK0P0 T ( P0 S$ PgNgDl鴒5Ē55 -L ,0P  -L M`0  P@D   0S<0S90 V5*Y/ ,0(p0,040V, K PP ,0( 0C,0 U pC@,=,0V0  0P00` a 75 -L,M@ @PpL OP`s ,00,0 RJ,b"`c"tc"c"c"|d"d"Pe"hf"g"0 0S70S4\5 X0*(0P0 D K P P  ,0( 0C,0P,P=P   D06P,0( 0C,0 ,:=,0( 0C,0,.= 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0@0H0  0P 0 00H 0 P0S$0<   0(H KH00c0S P0`0P 41    0 $< 0 @0 0D0x0S s@K $]Pk2[S 2[8SS C8S S]@  @0KwPT@K 㽅@ K 0S40S00@0K@K 8Ks @K0S@0S@pK $P&2[S' "[R R0 0  !0 0 !L 0 &}R0 0@@ K 0S40S00 8Ks 0S@PL  7~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ 00T   1 2 1 1s 0T@1 21,;,0( 0C,0 ,; -LM0 ! @ Q 1Psbp 1 81 U <0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U 00Uip   1 0 1  -PpL(`0S @ @ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 0 0S@P p IP; -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,:-`$@ 0  `~  -L M, p0 , 0!  Z PP0b\! Y!04   Vg0EEW  c03PP JB@Dx8 X0  R@0SB4  c03P- 2B@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T 7 -L Mp 1Qぐ2 A' 0a ᧏f8`  ត f/ RH02 0"2 SA' S', 0 00202a ,v,0@f00202c0 g00Pf00202S,00000''' -LM@`p PK 0S Szhh1 Q100LWXPẊ0(0 R 0S00P P0 0Q 0V  000PW 00,00,0 0S0@  0^ R1s 1 11 ^ Pm]1 11 b 7Dbb5 0-L@&WJP]T @00e 0S 0(d`00@2000@ 000 @2 @0F|b57 202 -pL<VP@ ㍎P P0\2f@0 `P0 20BT0Ҩ 0 ' v'0 0pB @B`_ [!CV R00s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 }x|b -pL2`0C(2P@U R ,00,0 ~PU@Z000Sl0202S_PZ PU4Q,<Q|hEWp1p!@P@dNDFA@04 S`ʄ1d8A R<0 <000<0 <N<I0 @P@dNDFA@04 S`ʄ1dA R40 400040 4N4#nl'''0|bPbTbDb -PLMP`; Q 00 0SU ( K 00CS 0,00C,0,0 S( ,@0H!L6,0Sʸ0  0S 0S@ R000  00C0V@p0K$8K @㲂Kp@ 0 㴂K,0,0C,07p0K$8K@@㲂Kp@ 0 㴂Kiȓ5 bDb p-LM0@6P3 R.`P(0K$``0KaK`P`01K!K 090 0 8p 0 02pp`aK0 90 0-p p (("` -LMŸ@0p \`P 7 R `0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 VZ1 211 21 #d p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<P>S, (@0P@5S0'7Г5bܓ5ܶb -4 L014 s$ 08000$740$ 0S00 Q0 0 0S0040$ Q  0-L@PP 0 0 0^ P 14P 01! 0 00  10 A 000  #d(04  1S0 1 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  iP000(0!0 (0p -L M( 0 0@ 0(  1K 0 D0ϠAl2l1!Bb!!  S<e9Mb -0L M PRЀ 0(K)00 0ϠAl2l1!Bb!!$ ( .1p 01L0`S@ 00 K< (9*9<@ @$7$7\bMb" -<`LH90 @PK@dDFA 02b SpT0 S0``00`K 00C0#PbTbDb$7 P0 0 -LM Kp$ K`PU0  0 00 0R@ 0P@$@$  00S0P `(00(0 ,00C,0 (0,04b$7 -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 U}PP?4p P" @0 :0GPUp  0<S< ' 90 P } 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,R40@K }PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 J80` P (00(0* J  (0  (0W  , J(0` R0(0 J  J(00(0zJ QPP( W`4p8 ,0( 0C,00p,0 0 p p00fP,   ,3 0,0  80  0Vq1RnU rmGPp ,0 0 ,0 00R]*40QUY 0V PUR!0S $7ܶb -LlM Q$P  S% 4 P,/A#bl p p@K \0 0  % ]6Pip T4RL$002c2c30 xK t0p$x0P 0p 0 =9@ =C  0p I0pS`XQ#0#00F01IYAp0Sl0S x@Kqxp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! |l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 9I1G 0`01 ' 0 (0 0(0 00C0ZHI " { IYp ` 00 0 @(  ( 00C0H800 F Hp80 P(00(0  B H X, Z ⌐ p l MbQ7?B5 -LM0 @$P`HA@p 0 S Hk000 p-LMP$`p08O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:lP,0$80HPP4,00,08  4 PPbܶb -LM0@  t h )k ~10 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT  0 P!4ᜆ0`+4P 0@4P40Q000p(0* 8\ 0< #4# 0Q80 @#8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40hO40,  , 4ܶb 0-@L PmG00  0@(00(0   ]G0h 0-@L PTG R 0 0 00  0 (  ( 00C00hBGP(0 0 (0!P -L$M`"0$0( PP@8pW@ W @4h\Oᳺ0 0 P@T0$0!0@;00 0 P@1 I 0 0TP@  0 @p 0,KP@/, 0@0b 001 Y$$q0S  p*0TYT$1 !S@#@3R 0! $0S: 0S* @T  0 ,4`NP418 (1TP#2@0T00S D cL787 -LM0D H" L P0  !0 0 !D"L0? p1 1 Q Q Q 匑 ' 0̟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Pph<KH0P `: D@P R   R? 0`SD;+@P@dFDFA@04 Spʴ 1d1 R D0D0D00D  EH00H0 D"PUp H0#KPP2 @f7 42 wPp?KP 0"Rb 4"zP42p` ?WpWKH0M0QG8QL" 0pV Nx:P' J?l% 0  !0 0 ! : *@P@dEDFA@04 S`1d1 R 808 08  008  E8 M0@ H0 ?D"0PT2 U 7  42 ~wPp?KP0"R T" T" 4"/zP42p`P2@f H0 `R #T"0<  P"0100b0P 0S42 pm !P0 \h0$P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00UPp~42OKcT2( 2 K P2<$Po = wPi O|1S0# 42 ƒp42  0> Pp pXp @!0!!0 0)0 !!0  Q} 0  !0 0 !2 0  !0 0 !0  0 000 v &P'HLL"p 00Cy Cu<,0S KPD< H2 K( <P800 1?l 1S H R < S <H0 7  @0S@0[70@0S0  !0 0 !K < l?  0  !0 0 ! 1D@10 0000 0 0  0\Dj PL 0 !0 ',0  ! L@62  0 202 0`  20082 0S/KK 82 4_VPpH; KDPpD 0t @ 4Pp#H@"D00D082帀8"0082@"82$ 8(00(08",00C,08(0,`Vź-<@ 8@W"{0Q68Q KL"p 0!P'G;1!@P@d~CDFA@04 S`\1d1 R 808 08  008  cC8K< 80Q~ 0Qz0Qw0!!0 0'0 !!w0!!0 0 0 !!L,U?|00C ?D%꘯b7$Q_PbTbDb c%7Jd-7 -LMp$K4 ,@P  `@u PT4(  01 B10R,0 P@( ,K }uQ'00K@8,wP4( 0,0 B0RP,0 ( 4K  cuP@"`V@J,K XuQ'00K@,wP0 ,0`V0P,0 Z  Bu@P  -LM40H0nÃ0g`ƃ. B0p!0 0 >PP D!D0 0cC61 Vp ಐ 0 f R0 f 0S P00,: ,:@Ppp P P pp P p p P  P P p p PppPPppPpp PbTbDbD%7h0@-0`S\PX0 Q?#/0 IS0B!@R !R %50H%7L%7P%7p_ -LMp|`00 Kl !@6$ K@J=LPP @ 4$@0@>0G7H%70_D%7Pb8bTb -L0à PP PP @P@ P P   P   P  P P   P  PPP -0L5 -LM0@ ;Ph? -<0LM   @)0Sh,#d -LM0@ CPhp -LM @ Ph`0S00 00 -0L88!M11p *`@0 PP0S 9"@ @ 0@ 8PK0R<0 " 0 < P Y @0 #r!P 4!H4#d p-LM@P`@V0D  Ppph! -LM00 3`0 P0Q&Q< , 40 0 ~800@00000t80D`404x0, 80 Sl 08 a R` 00X 0@ D 0D$;D H 0S8<0 @ @7|r 000 c!Ce -LMd0@Sh?꙱ c<0S8<0 p-L MQ/A`"1) ``@tA?#)h1 @uPQ?# D1@)j00!S 0SDP A  0@@= 0@@= 0H@@= 0P@@|= 0@@t= 00@@l=| x0@`c=p7bbbblb8bbpb5'75b5tb5pb 5b(5b05 > 0<$ p @ h2Ll p@000P< Dꄽ4t65T5"!x555Qؙ55 -LM0 Sn0Lr0 R 0R  R RmPPx 2nP@h _aPU T 50LPS 18 T *xC0nS& aS @0*T00S1@T<1$l ^CwSt0S! P((04!5U8`P000t R 0S΄ 0 1C 0)CwP 0d 0C|CxCtCpm C45b#d<5bD546 585d5l5|5555ؖ55555 555 5P5x55ȗ5080L800400 0-LQ@P 80Q P 441 R 0004 0-LQ@P 80Q yP 441  Q 0 0P 8000040000007000 000 0-0L0\0P   0@\!:lfP@0 p-LM418@ Q ` -PU  p87800p p-LMP`U6P1 80P. P@ Pp441  Q p00  0 R U8P 80U phP 41  Q p4@p -L0P` Q@p epT  e`X  eWV  -LMP0u@] 0UZ u 0U 0 U 0U BPHv 0V 0 V 0V 1P7w 0W 0 W 0W  P&u U >;Pv 0V :`w 0Wp0  !0 0 !v 0 Vw 0W -L0P`Q  @p \epT  Te`X  MeWV  -LMP0u@N 0UK u 0U 0 U 0U P9v 0V 0 V 0V P(w 0W 0 W 0W Pu Pv `wp0  !0 0 !v 0 Vw 0W 0-LMP0|@  0\   K0~P U00 0 U 0-LMP0|@  0\   K0~P U00 0 U p-LM0@P`0S 2 T 0T 0T P$0T P T @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U P 0P  !0 0 !p p-LM0`P@0S + T 0T 0T P0T P @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U OP x0P  !0 0 !p -0Lp`@/PPUU!'cP P0!!0 0,0 !! 0 R*0SR:0 00S 000 JP -LM7P@4k00b 00CS0 9b 0-0LSP P @o000 0-L@P Pzo000 0R0 41 ,c 0-LP@P0 04 \e?P00  0"R   0-L0QP)@3 Q 0P P0@ )T 0D000Q^0 000P 0 0S P 0T@P4 P ( 0DT@PP"b -LM0SP`p7 S P@ T  >[@S0S0 000@T 0 0S @TW pP4 @T   D@Tp9Pb p-LM0P0@^ `V 0 0^ V0 p\0T@ T@@ TP 0$0 @/@+"/0" p-LM0(@KP `aP0  p0 -QLMpPI0 @ R  0R`0S  0RnP-` Qڐ0V 0GSHx"x""""""X10S0S0P 0R W   Q0 PQ0ba>0>0$ 0A0ab0P\0HL0 /<00A0@0 @`%7h%77 7\ 0 ua -L$M@ , 0 40 .0 @@0K.@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% Wj. pRj0@R/ 6j"M2 0S @##mSPU`!q p0奎 @K3' 4j /j,@  j4X 8< @K@KP à ]C@TPa`~ pà & j@K( j4@@K i@B0b7 0-LP| 0\ @ IH 0h`0 0H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L 5@ l0 0 pP 400_ S> (0!1S S  t50`0  !   !80S  41 RR?Z8Z ' 'RZ %Z0`  P 0@!à 0!! 0 !! & & x%7Ԛ5 0-50L`0 , !0 0, !@@$!0 "0  !  VhoX0 @P&0pS &000 0@@0&bLb 0-0L@T P00@T00!!0 0"0 !!L 00 L b -|1LMP @0r`(@0 !    !1$!,0 0R00 ,1(40 0140 00 ,0S5 ?&1011  !1 1V 01 0!10101!& 0<  < $ Q001$1(1,140000,0 0 o#dx%7 0-0LP@ , !0 0, !DD 0001 0h(0$QPPJx%7 -`#LMM0 ,0 00 @`$4 006:D R @0S 䒟,0 S ,hPPK~" 0p"p4!P 0` 00 K0- 0P 0 @ LPP 0MK<1   0PP<80S P <u0 <@U,\8 016 )FK 0 <h!<0"00.d<7L |KP e(P $1pKh0 (!`P d 06\0 <&X  Ơ0T "PP< 0]PP8 8[<P p`@òPPPL 0 = 8 0S9 0S$5 D꼯b4655J &75 - L~N -LM@P`pF_T0EP@S######################p $ 1 014 10 #d4 1S0 1 Q0 0 0S00 0S 00 0 P -QLMp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SgWP D0  0S V YV#d 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` VP 00 P0-LP@T*@T:P 0S* !0S:0D00C15 -L@`p PP0 Vp P  00 00S0@ R0000 0 , p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@P\P( 0 S600(&7 $0R0000 0 (&7 -PL i#Up ``@T @ThW#(`@T @T(&7 -LDM0`SP\` p 0B S|!XKGUP@MX00C Sj&#t'#|'#'#'#'#'#'#'#'#T0尡 S PH\ P@.X t1\ H  a R2: 0y$P@'\`0 \KA0TK 0 @Q XT  Q  pU@ _$ \K TP@d`\XT-HDP@v'#4&7Tch,%0$X1#.!l% -LGM⠨\, P`p @ 0B9S9X)#4)#X)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#4)#X)#4)#4)#4)#4)#X)#4)#4)#4)#4)#X)#4)#X)#4)#4)#4)#X)#4)#4)#4)#4)#4)#X)#X)#X)#X)#X)#X)#4)#X)#4)#4)#X)#,0 S h, 0BFS*#*#*#*#*#*#*#*#+#+#+#,#,,# 0#@,#0#P,#,#0-#0-#X,#x,#,#,#0#0#,#,#-#-#-#(-#0-#D-#D-#D-#X-#-#-#-#P.#h.#.#.#.#.#.#.#/#/#0#0#0#|/#/#/#/#/#/#0#0#0#/#/#0# 0#40#d0#0#0#0#06 66 6Ɵ 0sşş 7ȕ0 0K _PPW 0S0\80Sro0|iDş0 L@P00W00SP5 D0MK 4 (41P0FB =944 b/pğ0 L@P00W00SP ,4 0u 0p4cßqßoßm3 ̠ße 0[ 0V0 S<0U KOKᮦ SPPd3Q T3R  04L 0@C[3S 1 01Q2 2 (2 z"0L 0Yx"t"p"D2^ 42R  0ZL 0-BNK 08 [PPz8!0BSR pnL 0@e!!!1 Ϡ&L 0SL 0LL 0E  0@ 0PPx]L 0 --+L 07" (꼯b 50r58r5r5c7 7bbbba tbbb#$>#8>#<#80S$ @T< R < <2 ,0S D  0cR0  080S 4 R D00 O=0H0S @0 WSD0 0D0 4Z 1/#4 OP@   Bpj@ W*D /D 8M .OP8/OPG00 41 R41 0S80 00 41 0Sl00 00 Q~Q Q0SSPS ``@ 8 S0bb p-LMP41`  0 @P 0[5 0BRS^@KA AAA8W > 0K0 1 z_08 K10, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T$!P=9@ =C, 0 ,0 ,00  "$20 $ 41 !01 !0@ <1@5  00 0 1.`0` X0Qt0V/@< [00"3J6?B1!2 -QLTMQ0DSP Y 500CS00   V$0 00 p 80K`0 \ H D T P0K =p`KX @P < $ XKP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt LP`sxP K0@@ h0K `0 `0KH \ X0 T D <  $XKP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 $XKP`@P@*0S @T:0l00S0*d LP`* d0 T h0d 0h0   `LP` pd0A0 d0 p x0t0Qx0 t lR:0l S: `$%1P0dKt d0 iL`,0  TT070- -LM@Pw0Sz b PU XPUPfP_x2p"@`@  @fD2  `P@U`@ p 0 "S0f"X(W0 @ `Y   $ 0, $ 4 ,0< 4 D <0L D T0L PTpUV00PC00$  T 0PU ` 0 @jY  0$ 0,$04 ,0<40D <0LD0T0L PT`U<&7DbHbD&7H&7Pb465 -LM -LQM\@@Tp`W\0/ PP'  @@@3S W$0 ,0(4 0 80 40<08@@<P#PP  T{T@S00 X< jWTPTPP 0gP p-L M\@` Q 0 %ppQ0 \"\ 0 1PU P P 80K00,0 0080pp 0ppL747@-QMX@ ^@ L|\0( Ѝ@Ѝ#d p-LMP^@ 0(`K^  0@pf3e@0T0P00Sp4Q_pbb -@tL  pP`H>"/P`嘀tp 0 S0 00#db 0- 0RQLP@Q t0 < 0  !0 0 !0  5 @00@0j #d!Q0x#d -p LM00K0x0  !!0 0+0  !!##d 0-0Q@LP) 0  !0 0 ! R 00 10 P t0S0 50 0QtP0#d 0-0 SL@P P  R 00 10 P  ( @0000#d 0-@L t0PS 50S 0  !0 0 !0h8 t0-SL 2?\ 00S00 0Rt0b -LMP p2 ?`@T t0S @T o t 0pGS50S0S 050嘀L$0$ W b ob"d -L( 0-LM $1B1/AbP  PK0 R@@0P1 0P0 b%0 u0  b$ 0cQ=9 B =$  0 0$ h0QL =9A =C 0R00QMb~5bPbtbH5tb?B 0-LM0@S S 0PK H0SPK0"c11PK 0 0-LM@#PKP  0HP0ShP 0-LM0PSX@ S0 D0  1S0QK 0 00tHPʚ;7 p-L,M `K@ GP p 41(PK 0@a(0 $ <P@0S:P00 p0#PS 8KV4 ,08c00Pc0 A00 , 0 ,0  ,0 c00Pc\0 A@ 0@ < <0 @0@KS0@0 <0  H0K.pMb_x5ʚ; 0-LM0PK S@ 0@S  0G GP7 -LM@ePP P0S0S Kl00(K"c1 1( $0 P K HGPK BGP7 -L MQ0S 'P0K 'GP l00K `?OT0P@0404 Po5(KG"%$  GP7$b -LM0PS\ P $K FP$ P1RH1Rq2b3c1 CpW00Q00S5 q10W0cW0` 01`QP QW `f 0@`pQ|0Ϡ$KBl2l3c13D 0 $ &GPW00q 0@cL&7 7bbC -LM0PS@9 x0`S ,@KŒk F4pK/,@K$ R Q 4R $  0 `cQ$  =9 B =$ 0 00Q -L M0PSp`@T 4K =FP6\DT@ ,@KP4`KP 0S#P<Kݾ,0S(0S 2D( 80, <0P=9@ =C, ( , (0 |  @ 0$K $0 XP?B -LMPZ`^0S@$pK0  0=BR L0 0ှ0$ S ,K ( 0,cP=9l A =( (0 , , ļ00@Q   0R?BL0Q R 40RQ R 00R0 ?B70S0 0R070- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KP  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@(KP`ḽ$00`( S a,0 =90 = B0 ,0 U QP 00S K0000UQ000000!0 Q00,b,b00  0-PL@0  0|0  0 c0cR 0 0 PP$0h00 PPP&7Xb,b -LM@<00 0 00000hP&7 0-L  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @5@T@0P&7Xb,b,b,b -LMq0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@,bP&7,bXb,b -LM@PT 0倐0c/a"|,K0K 1 U0H0\0  b,G$0@T,bXb55 0-L0LD@<]84PK@TP0h_Xb55P&7,b,b -LMP@T0@ < 000M0 !0\&74bn#`&7&7o#Lb -P0LM D@R80(0 h+\&7d&7`&774b -LMH@0DSK40$00 \&74b`&7d&7h&7 -L MaPQY P= P9X0 6P@0S ,Q0S" PU qQ0S PQ00 P 0tp K00, 0P@U4 440$-\&7h&7Lb4bd&7`&77&7o# -@ ML400 @00@hܛ5Pb&7q# -LM8@440 4P000 l&7dt#\65 p-LM `P@P0 8 00 P`   W0ps# p-LM@ 0 0R`0 PV0 $ 0Sph[5 -LMP`U Pp@ T0 0` 0000 @  0pR0R@ Y0l&7Pbs# -LM@<0< 0S$000h.\6dt#5 -PL 0`$ @T p0Sp0000z  u00C`0P@T0 4 9000C0]Pb@5 -LM@[P  -LH5 -@@LM 0t,0, /C!b0 h%_v#7gfff$b -d0LM @T0< R@ @000000000$b#d ob"d -1LM|!`0Vダl1, `d1@T X50 0CS0 00 p Q5p0 @T(<1,o dVpPl0p  lK h00p l0K^hK1Q |0 T 50S d0.H 0#1!S D 00D0bd,bb&7 b7#d! p- LM0 P1R@0hh00BP0 0CS0 kKP 00CS0hphd 0-P0L @o@0.0P50D @00@0$0h]#d! 0- `0RL PRH0 >@5 D D00D00h@#d!\5 -1LM`$PK@0$pQT 0 c$ 0 cR=9 = A$ 0 $0!Q=9A =C 00 P/0S0S @0S0S 000  qD⠸q 0R 0R 0@ 0S#d?BTc( 11 R00 (bb -LM50@S{#{#{#T|#`|#{#{#{#050C0S0 S > <0S 00000  R? R  B0 , !  !ꈜ5#d ob"dT h00 0S0#4 P,0 <0S0 "!#d ob"d 0-PL U h0@0$S$0#h001S 0 Շ Ň0hC !-000 00 00@&7,b0S,0S00S7  0PS0U 0S PPpq0Sih0h 0T0S <4vp03&75Ԝ5555 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP08,`4@08JC8 1!Q4K 08SV,b&75,5 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00,b -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0"GP4K 08S, 7l7 -@Pp L4`V 0 h$W  0&7 p-LM @`PU 0 ph|pD5 -PLMp 0 QP @@\P` Q0S00F 0@@00 PW5  HZ  0P @0S S $@0SP:] i 0R0 S0 0R,0 S004bd5,bp5 -LM`@/PpU 1PPN E0 S0 (0 @00B 0d! "P7$` 0\V@@Tʄ@T@ P fAEV 0 !R0,0 o I0V|_ 2S00S \0 !R Q|55ȝ5Н5555$5 -LM @`P0pS[ 0S-RP WdA0S S2 $@0S R 0,10  0P , 0Q % U1S RR 000070S Q0 0Q B 0 R00$P  l74bL5\5 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'{댞5G?QP' @0 0 p0XW}^{ P @K 00  000S' -S$ S @ 0 0 Y @ 0SS S x0@KS0x  K00 > 0 07S  0CSS S0 0%t04St@00ğ55U55 -L$M80PS,  (0S KKT re 1R0S PZJ *E,@@(208 40 R00 Dڸ`帀0p 0@Q6R40 4@ 8@ 0H0 0@@K H0@K@@ 0H@ 0@RQ 0S0@ R 0  0Z (,e/Ce/CWEV -L,M, <,4 D ?08p ;4ᔀWHp Po0 a 08<0 (pT @K T# 00$@@p, X 8 8PK"PK'!0@T S<0, @@K0@# P0K"`PQ`p4,0@" V",4<0(T 8H 0Tp0 @@0`pFH X,8%0@,0@, 004 ;000 -LM`D 88#0| 40 , 0 a@̡ 00!1  0,0  X@<  R TUş d <  B?+$0O@ 0 W5 U44 20 @8 P0 t>0,0  8 0>,@P0 `>0 p` =@0@ X < (0R 0 #4X#45\6<5T5`5l5550  0 PbHbDb -LM@000 -LM0@  enPe =DIL00@ @0 00$0@  HbPbDb5 -LM@ LR 0@00  0 $0 BR  PbHbDbԠ5 00SL0 -LM0@0CsP0B ,KL(0, 0aLS00  `=94 = B4 00 T004 0TQ=9A =CTT 000K Z U4<$` p@0ʏ 40K*,0P@ ?B5K -LgM 0,0 B!1 Ġ "88 #$$    $LdHA  0*pP;00-K0PP*0*KK "0 @@ & .K 2 S0 S A0h,0 S p,PS`000 0H0 040_b#d(\_edA`!5_*@5P8+P5|55 -LM  GP@- ?<0 00  $#,#d#5, R  00SSAπ " 0 R$0|$0\| -LMP@ PLLH0@T 0S$ @T55&74b`:6 -QLM`P6 0 SaBQ00`R00SppPE<P@ 0@T 0S  @T@P00SrP 02$04 40 ,&7&74b5 -LM0 ,0  PtܔW00 `KRW M0S HF Pi~_<@c~`<P  0W0T00ST0 S*R PK0 EP p0S W 3P#   rP0~&<@*~f|`<P 0W0T00S 0Sw[ ((0"4400$04 ă\ #3C 0S  ,0S ,R2  a 0b!((0"4q!$#@9 0" S!$ "^P@uP( ,B0U00p  "88 #$0a0""p  "88 #$0a0""}AS   0KPM 0S \@DPK 0|Pp ,  @?@aG5PP 0 2$40 $`0ā T@L0 P`봯bb&7_ 55&7\5?65(55465___505̦#85H5X5`:6 6 p-` LM0`S@ P> ?P @1Sp1p阀_@ 0S 0 S1Sᘀ_-  0_Tb0s5 -LM`@pPP  9 pP0D 000 0  0@&7_ R0 00  0 _ -LM`Pp ^H QDP?1@ T 0S2 @T0NS @#`### 0 -T 00 PT 0 FT 0S 0\_Tb@@ R4 000 S00 __ -L M8@4^ 0 P00_tb45 -(0LM@T @T_ -L MV, 0 XP. ,PG9@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  P@ 0-@LTP  @T000@RT R000   00hq -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP)  R 0S 0S * R 0  0000 0JP  # @5 -L4M@`p`P, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  )<R0#03^0S< 8@ 0P L<0 0QP8@0P  000 0WP' ,#,0 p0@4 L , @5 -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp0000D 0W ` U*00 U R000 OPp   V H5p5 -0L@`p# PPp0U W P  P @R000 WP$@T00@5tb p-LM P@* 00  00 R 0  @000ph`h0 p0 0S0 0  @` phtb -PL M@ L 0@ @T  @T 됢55ܢ55 Q0-L@0PA 0R 6x0 0 PR0 R P P0000 0S0SS RRHba0Db 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-$M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000$Ѝ0\ 0^ : 00  0S   P0@-0 M @00 Q \ 00  0S  0000 00 0000 Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 phh0t( @ _ -LM p@|WpP`0S:000 0`090@0 0V`UP@6 0  40 Ph 0 `0L 8,0d$`TpDH000P0 RU 0 /">CXh05%03h05 5P% PB2P5t% 6`(6`60<0`6PlP 0S0x p0|PPPPPPPPPP 0PP00 X@@XP0\0 @X 0 Pc<<L 0 P[ z'7hb_lb&755_$5 -LMX @R\0T \0\00X \0 P PQ  Q R0 00  0 &7 0-Lh0P0 P 0@P_ -LPpH L0Rx `V,P@  `VT  8000T Pd0` 0 d00z000@T[ R0000 0 D H0 B0D H0 R00C0 R000  R 0``0 00 S  R000 R 0` 0 `0P0D, 0Q0:"0Sd0` 0 0S0P `6@5 0-L MT0h @ 0Pt0tS _\f 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R000\0P04 0S0T0  0 R000  R 000<00CP 0 R000  R0004K:t0 S:`\5| -<@LAP44P`@P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p`@h0) |x 0Q0||Z0@ 0j@<D00AqD0 0A0 q@@ 0@0 S80p0S800tg -D ,0LR@p:4PP  5`VU  0D, 0Q0:U" p0S000 Q0-LP, <@@24/4D ,0R0:0 Q0-PL <@@4440 p-LMPH`Q`3:Qq 0L`` <@@334p p-LM@0T`0  V@TPU 800\ K@D0<,0lS:PTP P R000 h0t PUp @ _ -LP`px@ ho 0-@LTP  @T0連5 -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH꘣5У5ܣ55D5h555Ȥ55`:655L5d5l5x5 -L* 0S p鼯bt6Ч5 -p-LM P  0@``,0 \0 p`@b -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShTdT0(PW  0U00pb7Db\'7 --L0LM0  4!0 \ #d --LM 0 --00LM Q0r|7 -p-LM@XXP 0`@^00@ R `~p@'7L'7pb p-LM@\PX``  0PP=00@ R P]p@'7L'7pb --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSU8#$$d#$$$$$$|##$##$l##########$$$$$$$$$$#$$$$$$$$$$#$$$$$l#$$#$$$$$$$$$#|##$$$##$$#$### $,$$$x#$$\$$h$T0  0` 00x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,0\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm``  [cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  .,D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D .0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 ?,h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 L)P00cP0 0 X)`PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D K꼯bا55555 57 5(5H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  'P PaPh hp ` P~*h l  S -L6 -@LM 6 -LM @pT0T}0 P  @ 0` 0  0070p@- `0Q c: 1P#(80S$H*   0!!0 0)0 !!0 p ob -LM00P20#0R0Sp ` 0Qc : <"K#80S $H:@@0S 2[02K P  E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0l7h'7d'77l'7 p-LMh`@qP T0T Q 0QUqU@@0pg0@Pp'7t'755,0, 0$ Q 0÷x'7'7|'7b -LM0(h h`h)\@\ 0 0S<:])80 )U)000t6b|'7'7b000 Q 00|'7'7bx'7 0 S-L< 800( S $S WhSt6`'765 -t0@LMA \B0S,$H$T$,$T$,h5$3h/l7\6t655x5 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi65`:655,5X5|55ī55 545T5555 -h`hP0 @0XpTL@000S@@]0 0Th'7 7p'7 -X`@0PpTL@ @P0S 0@h0T00l'7p'7876 -LMX 04 D! Z0 , p((@ P 0 s ,0 Ƞh8 V W@ P8sW 0$Zڤ000 R 00 RE4 peR dR `4 840sS8L ,80pCd'7p'77l7 5 -L M |0p S S0 @ SQ SO 0 8 R R# R R0 S S<0 S S S `0VܐP$0HS ! 08#x hF8SP0 8CXu Q ,`KPXs F&P&h0`  Sl'787$5d5 -L M8#8cZ00 (<2"(@4@, 0Sp `P0G$PE $`0@S$Pa@0T0 Ё8CX H&PUc0J 0@TcZ1  S $$$0$d1P E<1e$! !@ 0  &P0 8C(R R% R0, R0SS=Pc0JS$$$$Y\ *@0SS p'7l7 7 7h'785 5 p-LMP0 S S` S S 0 S S S S0 S S0 S S S PH @K P0@ \pp SX5d5 -L Mp`0A,(0P S S= 0 S S S R`V ,KP0, Rڰ0!1 ^%P aY ,0 `0n?P QPqP Hf  0 S cx5d'7ܨ5l75d5 -(L4M8"(`LK$T # #3 pQ Y C0S P0#0S $0$@SW$0PpKa phP0s \# PLK@0@T@4i p岤KDKQP0s aJY@VITPRxŸPp@Wʼ"1Q$@D0W0$PEڀBLK @ h2 0T XŸ @p PT,2@0T Ÿ @p PT0001 R P@0w"0S I $0$@StA0pS P0d"0S ( $0$@S(p0S P @0Q"0S  $0$@S[O0X$P0S S2ḠSrı0I$P0S S0Wp0;$P0S S0Z0-$Pp,d'7h'75l75ح5577 7 7(5 -L M0P S S@` P P 0 S S S S `0 S S S Su 0S !0S  ] P1| R0 S SN0 S S S x@ 1 D B2R*t&$*$*$*$*$*$*$*$4&$*$*$*$*$*$*$*$*$*$*$*$*$*$*$*$*$*$*$*$*$|&$&$'$p'$($($*$($*$*$*$($*$*$*$*$($*$)$,)$*$*$PH 0KP0 04   P  0K* K,0K3P"[2[0CP 0KP0  RR R 3P 0PKP0* K,0K P"[2[0c0P 0PK3P0d  P0|* K,0KP"[2[0dVP 0PKP0e P0* K,0KP~"[2[0eP 0PKtP[k* K,0KPf"[2[0f\P\hXqMPOLPlQhE0KFPB0S 004Q0 0B RS R  0B RSR P P P P Pt%#I0KP0000 R@@R@t0 Sd S"P'7T5t'7d5h5x5`'7557Į55&7c6555 -Lz<84(0S JP h}05D5tbL5N-  0`1Q_  02(\_-T0 $\ <0 \ 00  Ƞ 0 Ƞq n_p_n_-l0 $ RT00QD1R  Q (04(n_p_n_ -LM`@PpᘌP  0 P  ,00,0 -L,MPUP0 P0K4 0 H0 D , LP 8P !0H K P80 80S pP #P 0Hc@0 Po` 0,0( 0C,0 , -LM`@Pp4P  0 P  ,00,0 -LlMp`WAa W] åP 0 40 ,` HP Dp 00 P5P8 08 8 0PS;^9Q80@ H K P8 8 ^ pP! #P 0@0H  n Po` 0@T ,0( 0C,0 ,W㌠ PK -LM`@Pp᠋P  0 P  ,00,0 -L,MPUP0 P0K4 pH0 0 LP D 8P , "0H K P& 80S pP" #P Y 8Pc@0 Po` 0,0( 0C,0 , 㲷80 -LM`@Pp5P  0 P  ,00,0 -LlMpW`Ak Wg ĤP 0 00 4 HP Dp , P9P8 08 8 0PSD^BQ80H K P0 8 ^ pP+ #P) Z" 080nP0 @0 Po` 0 R ,0( 0C,0 , 8W㌠ PK -LMp#@0,0 啊PP 0 `43V ,3V &8yy W9,0W0,000 嬐KV&?0W00S 002Vd E2V/  0 @T&?0W00S,0( 0C,0 R 㛤2 ,0S ,,|  @0S$ @<00 0 0@0c01V 1V00 S00000 K 00L0 S00@0@0 0S 0R0cҰ0 .P@ 41 $@< 0 @0 0D0 $rWn   P@i  ㉣ T 000 00 w꼯bf f |f{f@\5wt@}f~fvt -L\M0@P!0⣢ Pt x | Q`p R@| 2  P` 0H DP X` T0 P L@ PP PP\ ` p`0  !0 @0 !|@tLX x0P@Kt0SG0S" hPKh`0\u <` KpKl 0pcPl=9 A =p p l p l0 2R[ژ"002c2cs 00P@ 0S 0  !0 @0 !$"F0@T 0  !0 @0 !t@#T@TQQ QL@0KPFP| bP@T| \P@X| V@p\ d0S`K P@`K(P@hK|\ d0` h0P=9@ =C` \ ` \0 ?D| P@4 H| P@* L| P@ @K<0K8 KH0 40KD X0 0 K,0K@KT P0 L cQ7h5c?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2aQ0S0CP8c% U#hP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  餽4E 0-08PLS@ SP0WP t 0R0000c 0-@LP, 0*A0PP0# t 0@R 00@0h0  !0 @0 !50S 0(0  cc -LpMW,0 P`*0 S0!ÇP@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -LLM0@d d0p S 0!HKp h W! Rl d0pl wPP *p0 R0:z 3 PKBa2a11J"c11L0 P PrXKL T0PX0"PP L =9@ =CP L0 0`  !0 @0 ! h0pdh 0SGz" XPKXP0\o =PK`K\ 0`cPl=9 A =` ` \ ` \0 1RUڴ!002c2c 00P@ |!0S 0  !0 @0 !PP@[|P@Q,K0 KP@J,0, 4K,00$P,00 K000يP@040 4 0040$4 000<,W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81P}t 6@0@0U@(˃0@0<@0e ᣴp@ < @0l <@0g<@04!0Pt@ m(0#p@@ 80P4t @00@0 0Pp@0} p~@0@0@0@0P<@0K"<@0, 0P@ cx550Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||57;p05 + R @J 0SU 0S = )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU Wg x PU WX 0xU U U|Uu 05 0=  (0r05i UZ   ^;8p09` (0S.@J 20U0S 6 ?   y0PD 0@$  $ cc4(\_c - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HSPe$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$Te$f$f$f$f$'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0Slf$`f$Xf$tf$f$`f$f$QA0 0(!)^  so 0@d 0 d  0=`H V PPT JO  L-0c Z0 =PH @ 0`0Od  d -c46 -P$LlMUp` r:U9k9U95g:4| 0S 0 x0\ 11F0S )9@ P@ `9U8 T9U l09Uc 89U 09U cp0;p0^[p0;8U 8UPp   5,0p   4 0S 0S||^ ^^ 00CS0 4 0004! 0|04!x 41 0 !0 0 0  !|OP@ 7U; 7U 7Uh00d7U! X7U41| R PxPy006Uh  k<dH0pzm0&0p" o6U9 et6UK / 6U \6U<0Sp0p000p0V0 Q U 0 Q 41| R00 h 52D5U' 5U 5P lU*h0U iheh02 P@hP h0  QQ4U 4U 4U垚41| Q]00Z P 0SxO|4U :p40S\40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  `(p@x PKK020 D 0<p0 P@WP@P|2U@  0 P7  ax 㽧.t08t0 @8t0  t07t00@t08t00 t07t0P/ q0S S p0(0(S# @0H0 1P pKl p0 LP D` !>P@\ `o_0`0 a@ `Hc`DT  0X , U0U 0U 000St{t rtzt ^t b(7t,@ot t t at nt P(\_ -LM0@  (0 P0SM0 p-LM@P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP p(7 0-L@PP 0 p-LM@P` (Q,Q&p0 >;-p0.(php0m h< p0ŒHQHPHP((\_ H d(7 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L=p0P0p00h3 -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =?P@ ( P@0p 5*0p -=`b0V``V=J `VZ0@   p0  X:p0\45 Q0-L@PA  UPE0 -LMPP2 {(`$pKP@ $! P@`P@ $ P@p0:p0Q0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^zU?@0htU0 -LM@p0 jt hx50s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`}P,"0$"111;/"b111A8|0St xQo @TPi zPPD@T50S8 S1 1R0 0l $K0, Kᦚ HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, p05c1 @R  1P2;P$0 <0/0"bT uDdQԯ555 5(545<5?BHhP5\5h5t5P0@-0 5@5P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S0  000 8 80R000 R8 80R0Ph h0RS p-LMP@p0`(0(S U  pp 0-L@  0^ᆰP>U00  cc p-LM`P0> S@0B0" B ( H P00 D @000 0@嫵pB@L 0 S0``00`h1ꞍccPbTbDb -0  L0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qccc -LMQP`/00CS $<$D$L$T$000 Pi-p0l0h0PpT0T@ 0 囩 p0cccccc-R Rt0t0\ \t0t088Q   -P@pL >f0E/>1 `W>p 0 0P0  M -LM0@S0S000A?>ˌ>Ō p-LM@P0`SC  ^P` 00c!R!l0PU00\ 3p -LP`*Vp&0S 0\@l0% @l T@ 00S 00`d d0Vp 0SS 0 0h0 -L@P`\p U, 0 ` \L 0 1S>0`Q\L0 Q` \L0 0H`F V0`b 0-@LP U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h p-LMP@ `R2 R0S$ 0 0 0P 0  B\   00  110 0 0Q00  0Xp, P0 Kp锰5Rp@-@) 0/. PaCPN  10C00& 0b 0 R 000 Rp0a # B 0!0 0p1 ! p -QLM`PpF R- R0S1 0 0V$ R! 0 @cR@cT@ `dPp  00S 00 0V  R 0 A(d (P0鬰5-0S0| x 00QSCT0P0Q R 00c!0R#<0_@- T0R   \ 0L0c!R!@ _ 0-@Ly PR 0S0 0 0 0 Bn \P 1S>\0S0 0Z0 -L MpQ0S# 0S 0R Cp @@`KP@K ' -`00p41P LP@U @ /T 0yV @ X -LM`00p41P HP@U T 0V @W -LM`00p41P HP@U S 0V @W 0-LM0@41P P" 0\ 0\  0PV041 Q 0  !0 0 !000at qt @-00@41 00S   @qV@b 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ၱll }LP0h{ c<7*7>7J_cc_c$c_$,0 P 0SPc -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Amd -h0LPpU` @ T*0S4@  T:PUc p-t0LMP`U @ T*(04@S T:PU(0ph骰 c7 p-|0LMP`U @ T*$04@S T:PU00(0aph酰 c7gfff p-t` M@Lh 0\P@dL 0@\,0 0phc5c 5(7,7 -,0LM$@ <0*h)7$7cc p-LMl0`PU @ T*,04@S T:PU 000p cc p-LM@`T"@@PLH0@P  1 0a1pcc p-LM@`T"@@Pt l0@P4 10#3 a    $ ( , 12 pcc -LMP@  T p-LM`@zT"@@PH4o40S !0 ;@0<H`8L`!pc 0-@LZ P 10C1( HPL0L0L H 0 1@ x@<0 80S 4@< 4D噇4lIccc P-L P Q-PL`%*@0fT 1*4p)  !!0 0!p0P0 `0 ;5 -LM -LM -LM`pPJQ1V Ut 0V:`cVP0W,0 ,K9U  P@x Z` 0!0fS0! 0S 0S,04004H0!H01H@ H0LP1L@1W   0`pbVP`W,PP!000 !0 00`<  H0S 0W01 0  fR ! "40@ 00` 1:)01T04 W p,4 0000W yw05ʚ;cD5h5 Q-LP`p%R!Q U 0\: c\PVU @@lV@1  `dVpPDA넱555Ա5 -PLM`pP, @Q R`d/ @PVW 00fW@1@!pd W@` R WPʲ1 0 SP W010# 0P0 S0# 0 p-LM0@SP @0SU !  H0SQ `"  H0S V    < 00 0 PPpPp40@ 0 0bV 00c<P@-@ Q 0Sa0 0c 0\Qʲ1 0 a0b0a0 SR:1 a 00a1a^࠳\ 0S %*c\\ 0 0\ -1LPF0,0SA* R> 0S 5`1P1l0:L 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XPf 000]PXP` 1p  p :)014@p1 01@cc Q-LpPa1; 0+0S6* R3 0S 5`1P1pl0: 0S@1@! B 00 0 pd dR0 00 UW WP= 000P WmP` 1 1@  @ :)0 01@1 01h$cQ 0S cP QQ 0 -LQRQp`Po@Pk 0\@ cTd 0\T_ 0 SSQ 1E  H0S04 0b: W+PP 1 p000 0X0j 0  0 S  0S0S  0S00PX 0!0 000000g0S000a0a40C0C  0P -LM@PpP 0Q@PcTx 0UTs 1 e8Z` P`  0j0    / 0 P044UH0!H01H` H01L@L`H000 P` 1:)010000h004  ,0 Z0j0Ó00<0 P@,00 -LRM(K@0`0*0ppA`;PPM 0W@ 0p(,0S7 0fS1!P@% P@! *,0S0 R0 00 0S  ` Vpd`WP, ;1 @  TK# @PP 0 0,c -PLM@ 1 4@ 04  a@T -RL@`P0p%Q" T S:0bS@UT  cU 1PbP0U@ 55505 -PL M`,0  RQP \P`lUVU \PU \ U  0   H0S 000 , 0R0V0S  0  0" fZ00S\ pfZ@ gT  0@ T0 S, 0R0V0S 0 00c<  H0S{ Yi, 0R0V0S 1W  H0S04 0bL W5PZ@%T   p 00g 0 0 0 0 0 f0`0@P,0S`*1G @00S 0 S:0g 0 a 00`0g 0PS000n0n40C0C00S0 00 ^ 0 0 0  40@ 0 0b S|J 0P@ 0 S  0S0 `0`1D5 - RLM`Pp:Q1X @TV T 0  `1@^P@ 1:)01p`40 0 0-@0TLPòPP@ 0000 S00  Q0 0 0S00oH -LM@P 0o0<PRP 0SP 0-PL @T0 x00 -@LpP`U P@ V0000P`U00 -@ ML 0@h5c -SL Mph1@S `P` 0S+0SDZ, zP0 0 @0  Q00 0 0  @ @@@8 `P@ 000W,,P)#dc p-LMP@  0`@p -LM`P0 p 0P@ 0S000U H 0UP80 UPSѺ ˺*7*7 -LM@Q0 0S h Pc -LMP㦺0p` @T  Q@T @T F @T R 0 0 0 B?BS  6@ FDP`0 R 000^0  0V`{P` 74p5 -LM0  0  -LM@`30pP  0   0 5PP 0Pi넲5 -LMP0- p 0` 0 8@ #P @ 0@ p-LMP@  0`@չp p-LM@͹0`9P  0%P Pṹp -L$M0 00 , 04 0P0D0 R< 00`p`W00S~ 0@  0000@0 Y 0S 40040Q < 0;0 0; # P00:0l0P J03SB 0 7  < 00R0S9'00 B0cR D0 SH  0@WV<^<0O/RQY00S DQ0 <0XX<,K8 aY ,@TP̠P@@W00 X00SDZ 00X@@^d ,  T00R00S 0d0   L @8ZP, `p000;W8P ZD0X00S@ R0000ɸWPAH 00R  , 400ᵸ@ P0000,0KZ , < 80 00X00S/0; 0;;* ,P Rl i0;ߡV00:0V, 1011i D0S ,0S <1+`R@@do V@KNVLJm젠PA p` 0;0;; 0 00:04Z 0;0⇡#((40S'0#  } c -L`,M, H Q @ , 0P L0 0 PP0S0040 4 0 44 4R0  0St707 4jLPZ׷8 d@T 4L R*`0R:4 @ T0Q 0S@03S  T 0S 80080@04p 4pL  , R 0 ,0@T~ 1SZW  R 0 0@0SL Te 1SZ T_ WXl@Q4 H  4 1 4̌4  4 4 T< D  Z00R00S 1S6 H0S 0H @00PRp <0lUP! 0D0P 0`UP!QR  0e0 D0`U 4 pD00D0 0\  0?0 0 e00 L0P 0e eL0P H0S W0eSH00@00> 40#s:0T00SL( 0S% 00#0X00S 3S0 PPd@T70778޶07|3Ti  Z00R00SuT^ @04 p< 4p4 5 L 0P0P00S 40  70778娶0|7P 0RS04 0070778吶 0|7LWT @0 0S 40Xdlh 0Sl4p<  R< V14  4 40p@D @L  aL 1SS P00bP0X0,CX 1@00cX00P @0@ @d@0pT Xl@Xdhld@8*D0 ኑP "P8 \ H R KWXdhl L00bL0!RR P00bP0X0,CX 1@00cX0\ @0 Q 0 R  @0d0 d@c@ 0Q 0 R zd@P L00bL0!RR P00bP0X0,CX 1@00cX0,\ @0d0Ld@T@d4C  T T 1S, 1)@T 0 90 SR  407077L#8Z 0|7Ҟ#@# 0@@4 0   @Pp Q! ᵐpZ00W00S@ PT  p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033 `3033#TK@040T2[03,0(00 00S<0036 -LMX`p,0 P \ 0 S*U` ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@S $@$\$p$P 7jPT|PL0T@0T0T`@`00RU 0S@000 00{04  ` tQ!k401#8S#00Sd0W  H0WS 0S 0S S d77 -LM^P@p \ 0S*p 0 0 T` 0 &T T T |0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0@T0 3 003` 77 -LM@@ D0<Cp@hl 0-!40r@L$ r 00LP<0<080U(  3(@03M 0P*7*7*7 0-40@$PL>t0S0t0  Q0 0 0S00t0S7070h%40$ L 0  191# 3S,000`0Q 0-40@$PL0S00  Q0 0 0S000S;0;0h-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6LZ0S 0hQLI0S 60h镛 -LM0@00 68 ,L)0S  -LM0@00 6. ᣛL 0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤAPD Au0 @0 0 @0 @D@刀   -LM @40 0Q 000!RR 000 0, 1@00 0 0S 0Q0 ! !101 Q-Q 1S/ S' 000!RR 000 0, 1@00 000 0R 0Q ! !101 0Q -LRP`p  10Z @W 0R@0@ N0aR P\:P= 0 0 Tp`Wp @ 0  1SS 000 0, 1@00 0@0S 000!RR 000 0, 1@00 0 0S@ -똲5 p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1@00 00S 000!RR 000 0, 1@00 0 0S@@ @pϼ먲5 Q-L@`Pp 1 0\pW 0S0 0@TW U 101h0S] !1R U5 1 \  00c<H  H0S< \!1R U@ @ 0P00!RR 000 0, 1@00 01010@0@0   00 0 0  1SS0 0040@ 00a\U0긲5 -LM 0@S 0S p-LMP\` `U@\ W 0SE Pc c 1SS 00b0 0,C 1@00c 0WU\* 0S  c 1SS 00b0 0,C 1@00c 0;P 0S \` \ 0S p p` 0e  000e0!RR00e0V`ƻв5 -LM0@S 00 0  c 1SS 00b0 0,C 1@00c 0P0S  00 -L @M Tp`SPP0 T1@ @  0 0 000겼0ز5 -LMp`(Pt(K, K]P@0K (0 ( 00(0 @T0 (0$ ((00(0( ,00C,0((0,,00t7,x[(6_H(7 0-LM@ K(PUK0 0PP  ,00C,0(0, 0$P 0-LMP KP@ 00$ @,00C,0(0, -LM0`Sp  ,KP@0K P@ 08 p00< $P @S   3S 3S0@3G  PD 00 ( @ t 4 K\P@V40tu0 te@ 00 0 00! 00$NPP@ Q% ,  0R,0  P@ 4Z0v^(s<8,0( 0C,0 ,a,K @T0 (00(00,00C,00(0 ,KPD 3 0R3( D (00(0,006 , #@5@3Sn3Sl 0T 6F P@3S_3S [5 50#W H(745 -LM0P K$0 P@E $`0A?AST $K0P@'$P@!0A?AS4 ㎬0p 3S6P!F0TP@ 0 3S T0C3q000 ,00C,0 (0$Pt>,ⶕ 0,  B, (0$0$,⧕,00C,0 (0%,⛕갾4 -LM `P ,KpP@  0KP@t( 8Kr4K [P@d804 D0 0040 4 弑<K, 40$  [P@G<0 < 00<0DK<00 $ 80,0@0 P@+0SF  |P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 r,',$dY<"]000 D\Y4]0,0 0P r,P~0,P@ H(7 -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  P@8 P#PPKP !<}P@0 PP 80S pP #P U U80L0c08 0@LP / [P PK0PP -L,M`0pS8K 80 2DK `< 4 < K0 D@ @P , $` L00P0 -LdM0DKPp P@"8 P/P`K#0P,0  !<P@  00c0Q P0SX0   X RX PP)X0X0 XK PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP, @ V05@1 0305 C0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$Q @,00C,0(0, ܒ p-LMP KP@`*0 S@ 0S 0`S$V  qP@ 0 00 $0}`@V00,  B, (0p,⟒7@1 0-LM0P K 0 P@) 0S 20$ 0KP@ Q  R 0S R P@ 0,  B, (0 P0,XK @K P@ p-LM K`P[@T(K  p 0(0 $ hP@ (o(V$V(o -L M`$ KPPp (K PP$0$@p  P0PP (  0R(0  )PP $0,  B, $(0W k, P -L M`$ KP@p2$!$P0 R5 (K yP@p  @0P@ (  0R(0  P@ $0,  B, $(0",♑ @,00C,0$(09,⇑ -LM` K~P@  0$P 0S4Pp7@  @0P@  0S-@@TP P@ 0,  B, (0,B q@ 0,  B, (0-,/ -SLMpP`$  RV@;1  ` PPW@0`JF7R -LM@RP  0& S,0 0,0 -LMpX5 Q@`P) QX 0S%0Q0U00S3Q4@%|%%%%%% %4%%%%%L%T%\%%%%L%%%%U8 X4Z 1 !N }0S  0S 0S    0i0S Sk P `, X0 a00,L(0 0` (X P0S= S9W2 0S8 XY  P `QL@ 0P7W 0S   P90p  P X`& L0 ,0 P X,0 0c c 0,,( L0 b0b0 (Y0S L0 ,0 5" H 0S 00 R1  0 (0    P`L00H0--0S 0  0 0S 0S0c8"00   #d*7555 c 5 0-0LSP T0S0Sx0x Sl0l P 8 jP@ 8h0@PP070T+7+7 +7+7,5 0-0LSP% 0SP 00t0 R Kk0hw0hEk6Q0S@|@@ c -LgM`pV0,0 ` 0BSPB[FOK `0qK1 A 堡 嘁 iP`AT8_OKc 0|1  ˠˠmK.K0x 6P` 0 ,0S ,7A0 |0 0@ 0P 0P 0@P$@f8K$8P 0꼯b85ʚ; -LTM @T`PD0 H0 l p LP D` P\ pKP@`P80S&@ 0 06P@|pW? 0R)@ 0 ) 03 P- t P0  p0 0 0 0$  t t0$ 00 $@4 0x x=@0TS (ʚ; -LM@ 0)R  0S S00 D5 0- @LT P P0S S 00S00 @S 0S00  0000? P0h;T50 R P0S 0-@LP0S000R0hi -LM0 4 0 0C#q!18  `.i40 0<0 (kZLZ<@ P,K  !RP@)0 P,0U1W<@ P0PU,0   B A8 <8 0 4000 (ji PUJQPUZZ( (jSPU<@P0,0 ,nPU#d c -L MP@0S 2R 0 S 0L# q 00cl0l m  H0 Sa ^ H1 P 70` 0 Z0 @& ,Ky,N0PK\q 0 @D1 0s 0s e0  0 Z0 00`F000   @Zڀp0PK K0 J 0Z0C 00`00C0  B  @40@ 00l^^ c -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &h@`TP R Q@@@TPp  0S @TZ@WPrT@TZ&{h00$0S 0R0 @, 0 0 0, $Q \0 R0 d < Q  0Q cb c b*70(%P |(% P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 *  cP-,, 0 0C0, 00C0S c -0 0CSL0S R B02P0P  岯尯d5|5 0-LM0PS@ P0U* 0S PU:U- 80 >0C&B 00 08 . BA R0000 0 080K0 8 D.0 B6C0080!>0C&B!h c c c c c5 -LM$`KN&|Pb0 000 K? 0D }d0x0\`\p\P\@DF 10\ 1 !Cepb c c c c c -LMp`С@PȡU|0+ "0P @K/X0 0 @00D x@8H`4@<lhtp姡D @0SP0 Ppᙡ0 cpb!Ce+7 p->0L>0MK0 1`!0@Q6垨0 @0PP$ ^ :\000008 HP0 @R0 0 X 0S@@0 @pጩpp c,Q_ c c c c+7 -LM @R0h00 H R Q 0 0 80 >0C&B$0 H8 ch] c c c -@ML,|0$ @;00Q* Q:0`00 K !@6$ K@@@ 0p_%Qe @0Pp@|0P/"?CAx0p l0Q 0X 0 H0R @ 騳5 c cG7,Q_gfff c c c c c c c c c 0-LMP00@  U0&00060040 ,00,0#d -LM@h -LM p P@`U @P PU@ o1 p-LML@`PP 00 00 ;00P1Se0H0ph -L,M@@8 >0>0X    00K84@K@63PP400 @r4@ TZ\  < dPp < `U0 @_@P 8>0S 8P <` V<@< 0 A PP <0`TD@@ O8",1D` !H` !006000"P000!R !|2|BP000! !T2LŸP000!,BP0( 00! 0KH /XH08 0CƂ80Q!>0C& Q!0 S0 00000@00 10000S00 00500z0C 08 8 4.0 B608 K 00080> 0CƂ80!P>0C&0 Q!000 0S0 000 0@00 00  0T @0K?@08 . B c c c c c c cpb c0@-0 Lt0P@h0  P P0P S P00Sd0S00  c c - \L MPP`P , 0 p""#10AT P0P S= @TWT 00:00 R 0 0p p ,0K ~Pp,0sSW 0@0S0 0 00X0P @`` @4 490Sd0S04 00 00  '0000004W 00:00 R 0 0p p00L 50000؄04,0 ,0Sx  c c c5 -LM@ 0P 00(:00 R 0 0  c -LM0 4 8 <0 Ҝ\2\"0@ QH2H"0Q800,K,0 C@,(PPQ Q@TU UI`pA0!R&̡凁 PU! @Fx0@DS` 10SZ0000000d0SON`1!0R PU tpWVU$4@80@!@ @D<0S P @h 00d 0R00@\000^@0PX 0D 0@ 0 0<@p`4@lht20 c c c c c c c c c c5 - 2LM 2 $qaP0K@K R 0R!0S !0 F@T 0R0S 0000000 Lx0S 00D!\ <PT8KF 408b00Pc=9 = A@ @ 0@0SӛP@T00300ɛ80> 0C& 80 >0C&0 0  0P@00000  +#d c c c c c c cD5 c c 0-@L㖛00P  Ꮫ00 00  40S000;0000 N00  ij5 -LM00@ +00x <R00 00S00 00@ 00 h00500h鬄00@000`00d4001唨 c̳5 -h4L MpT4PQ`  0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q rPT    YA0S X#000\ 0<0 00 @#000\0 20 0 R000 R 0S  0 "000$, P0QT" 00 0Yy *0 b  -0 60 P@0"0 R? Z8P0, R )! 00 00Z0Y0S0!0 R  )P060L!000\  0 0   0@  000 i)P060   U P0 0 R 0 2-06 @0   090#d+7 c c c c c c -LP\` 0P 0 Q 0S Q $00$000$0S@T T  P0R\ \ 00 0 p( pb W)p@0"0+7 c c c -@2LP`P^ 0S[r"0Su@TQ  R0000 0 0S R00 00 0S  R 0 0 0 0 `VP0$0P0)0 ( ( W00  0P@ @2p1!00 R 0@0VV@0 0 80S ( RR*0.S 0P 00S0 0 0@ R )0.S@fH@000+7 c7 c c c c c c p-L MP@ @t0u``? `P0 uDPP<< 8H0@=p c7 c c c cܳ5'7 c-000P0 R`` 0Q :0S $  0S0AQ*000P0 c c c -pLPQ `0@S TT0ST000 ``0 0 0S R00 ` 0S  R 0 0 ` 00C0 c c c -LTM0 P0K 0 d < ` X  0`0 0 @X X ` RD 0 X0<d0  X`P0@W0@X<d  <T04D @R0, \0   0OS a &80 nU@ V 0\0 0 @<0P0<`PP 0O`"8@#!P7 d,K< 0:+P0X0s ,0S 0@00\@0Xd` \0@d0s0t0 0d `@ \0`X@4 Q4@VX0@WXD@ Q 0 < 0 `!<PB0+P @T : +\ ?]\000< NT:@T +/]Xd `@ TX0X<d B`0p K<0pKX$0OPK0^Xd -0S*P KPKD 0OW{Xy T0<0P@@@00@ ] M-LM0000K0 p` \  0. 0@U( W00@0P`pG@0P`pGY  W 0 00, VW @0P`pG -L M@0, 0a + [ 0@0 Rp`0  @<0A ,@f@0Pp` W 0-@0< L P  &< <0<0 | 0P | 0S P<0 <<0 088 T00Q0S <<0 0~#d5 - L0; S  c 10S080,7@Q1 0 ! 0- p-LM0`PU Q \t0 \ !0SpH@ :[P0P 寣-7 c55,5 -\ 0L!R @0Q1S0!!0Q口-7 cH5 0-`P@0LS HP@0S0@1S@1S+7@-0S 1 1SL 0DS  @  0!0R0+737 c 0-LM@hhh 0PD0D T@@P@z@T(P0逴5'7 c+7+7 -L M$$@ 4 0@鈴5'7 c 0-L@P^UT T 80 Q0(0Ȝ0P0 0 Q0,7 c -LM@0|^00C0hѝ c -L M00 1\ 0, 40 \X\ `P`V 0 =p,PY 010Y 0P@% 0`0 ,0Y000 0 400 Y 2PYo  @0ppVʹU`#d -L M0SPIJpP`] V @ 0@  tQ 0CS,  @T! `(p 0 (, #P0|@Q ( R,0,0,0$0( ,0 pT ?00@0W 0@  0R tQ 0S0^ #(pK'`@0K 0GP0`P @`%\`%`%a%a%@b%T,0P0  0 S 0 00S/ 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 ,7,7 -LM0P@T`K0&$pK  0pP@ $0DS c% c%c%c%c%$0 $I$ 0S B $0  0R 0P@ $0 $0@'@0$ $0 0 @ @0$  -Lp(P@A 0@1A 0 Ps `@0PU`P``0@008 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scgꐴ5 -LM 0R ) 0 `R 0 4 POp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00]{ \0 -L,M,0$ 0  0 `P 0S 0+P@ R@@T Z000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @@^T0S @P@v i <204"S_ 0S0 0X0SpOP0K P@KH0 @00HK00 4 ,P Pp L D 8 q$P@680[c  R?@# *\0×000I@0/S_ @ fݙpR ֙J+00˙ 㥘p>@ w$ ;0 p峙d寙P嫙pGWa:0/S W0+4 y' c c -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < D , 0 /S I  , 5R  /R  2R0 /R, KR, ,0 lR ?Ò00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@n<P 00@060 !P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00Ml00CS<<0S;T0$ 78 R2 T0$  3#0S 1@0S00& f#P  80S   U#\20S 0 0 j 0 ( |`V   0S  8 R|`V   !#00K  X0@@ @ p< RT0$   <f@@aX 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SW0S8 0Q0R00SI@090& c @ -LM80@0 p,0   `0SlX 0 T PP p *00ZT0$  P0  0`0CS ZT0$ ,0S T0$ 0 ,0S 0  W"0@ < RP  B" 啜55 0-h0MLP\@PTT 0L@\8808 @0 @ 0h6 7cش5'7 c cxc c p-LM 0PS`@<P @ @@@UPpU5KV -0LM`@Vp P $`VV vSv@P3P ` 0$0 P0 00$0$(0$0p /Y 0t@+7 -|0LM0Sh0@T 0S$@TP0 $ /_+75H- P L0S PP 0R c p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0pn__ c0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00,  0@S Hq R!@!T@0\ 0   0V0P@@T@ 0004P 04014N0 R 0S  R0\7@ \ $ \` ᷺P@d0 Rd0 0Dzc -LM@0  01M p-LMP!`@4T  M00`VPZp@% p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  WP @  0S 0@ 0S 0 @  -LM`@pT P R0 U@W L|X @x0 CP  pk c5̵5#dص5 -Lȇ@^<0< R  0S hQ5pb$b55 -1LM 1R  jp 0`PU 0 00S00`PUV YB'Z@t|@00000sW`pGY#d$b'+7 $5(50@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@gb,7 -LMA\-P   -LM@pPp `pPH00H0 0nPp0S P- L p00Csp0 H Sp HhXpP45 -LMPp@`e`hP 8 V T0SQR1 @R VP T0S00y000000  X00:00JU@ 100500D!0nP@ ᰆlQ  V T0S RVQP ᙆ R T0S R T0S㈆0p Rl0S |0 P@sp0Sl0S  gvL5X5p5 -L`p]l@PT 00  @RW 0| l0S FhB00 000008d0WS 偓눶55 0-d0LSP@d@800CS|00 D0D h0h S0h0hP 0a묶5 -Ld\8  R R000 H  l0St0QH0x0x0x00d0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 !Cexc c5 p-LMd`@VP0 P00S  R000   pp00p0!Ce 0- @RLd R000 00H hP l0St0QH0x0x0x00S0 00@P0H0lP80SP 0? S 40|0 R 0 C!Ce,7VUUU p- LM@`T PLP$  $@TL0@Q$@`0(0Spp+7+7 -pL@`T P$P $`$@TT  R$00@T 0$@R T0 +7+78@P -LMP0@`XD,p400 `xd` p\ HLPx``p88PP `p h ж5`555 -LMP8P1p ^0T|@10` @Lp@@ D0@Wh@T  @T\l@T < @T,75,755X5h5p5 -L M`$Q @p0!P 0PP<@@0@DH t`L`X\ Lp 080@PT ^P !`\#100E SP`@TX@T `\#10l0E SppP`@T<ꀹ55 5T555غ55$54585@5`:6H5X5`5 0-0P0@ 0L_0 000,7__ 0-0 L0@L Q@ @P@ăH0pt t Rx0x0x0 H00H0 1t0S0!x Q01x00h駃,7-7__ -<1LM 0100 p(!啃1 P0 S000@`T  0S 0S@t0S0C0ʄ0 S(| 0x:kc0 0Y0PS( #dc-7,7tb,7_h5 b,7 -LM Ah0@P t T0R 5D0D +@Ka p0K 0<PP  0 (00(0 ,00C,0(0~ ,f{ d-7 -LlMp0`$0 @sLPUK $0 S $n D0P dP `0 \@ P@KUx@娷T0L0T 8K0$PU į꼯b5 -LMC0,0 0 P`pP )LP@ 00  \( CK K,P@P HPK P@`nPF@ 0@K K P@` 80S-@ 20S 80S@} L P@y 0aP@q  @KKP@ 00rP@` 0&P@X D0P0D000 P0! 0$#  X0K`PK0 $K4K DK @0@0 @P@)  090 ~ @ (00(0 ,00C,0(0  QCP,0 S ,m,e0S ?C)-P  0 P@_ 꼯bd-7Ļ5 -LMԀ0p$0 `@KP@ $0 S $l@PK 6P@PF 08K K P@PK q @Tp 㕮꼯bл5 -L$Mp0`$0 PKP $0 S $l@@K PXP@F 08KD K PDT@u,0 P$048,0 U꼯bܻ5 -LM`PJP@0 RC 0K@ 0 夀 P oP@pW@ KbP :WTPKZ 20:#: Q0 <   Q @TK K0K @00  Q㄀ 0 p-LM0P@0  0K 0  @ "P0|`KSK0|0 " ʠ,ʠK K0x p 0R p -LHMd@K` p@0<0 ` d @ 8p PUT@80Q0 `P @ <0 d 8p PPT0S@ KPN P@KP P T0R TP -LMPp`+0ᵯ@TK0 @  p 0 P@0@KSK0K K ˠ0ˠ| `L @H| 0R Q@ki c -LLM040 0XK0 T0 X , aP H@4K<0DH4 K DN D0S $"< -L|M0`P p%PW 0SR$80SN  S0R0D 6R pYX0@@ 0@ K0 P 0(P@`@ 5K01#5#S0 0SRK 0 Pp0Kp0 hd -LLM 0 p`P000 0pK D0 H0 l p L Dp P@`Q `l`@` TP@0 i @y -LM` PD0K0  P pKP@ 0 @VT0H0S<@ p ;0 -LM` P0K0  P _pKP@ 0 @*T0H0S<@ p 0 p-LLMD0``K@80 \ ` 4 < 2PP  pP PP -LtMp0Kh0  l dp PP `HK80SP 08 0b00K @@KH0 D 0 4P 0P ,p 8 0 P -LM` P@0K0  P P@ p 'T0$ @0s#  HP㄀K0 @0  0 @0儀K 0 P@00CS@ -LlMP` KP@ 0$p T0S $0@0s/ GP㄀K0 @0  0[ @  0,  B, (0 ,a0儀K 02 P@00CS@ -LM0P#Q`0K  @00   ` <P@ 0 p儀KT0@$  0(0 :#:0  0 @ -LhM0P#88S`4 K6P@ 0$p ST0S $0@@K0 :#:|0  0 @  0,  B, (0,na -LM` P@0K0  P P@ p T0$ @)0s, FP0 R 0儀K 0x P@0KT@ 0@ x0 t 0 0t @b@㄀K0s,7 -LM 0PK`0 0 0 P pP@ p T0$ @)0s, FP0 R 0儀K 0$ P@0KT@G 0@ x0 t 0 0 @@㄀K0s,7 -LlMP` KOP@ 0 $pkT0$ @)0s8 QFP0 R, 0儀K 0P@0KT@ 0@ x0 t 0 0@  0,  B, (0 ,o`@㄀K0s,7 -LMpKP`P;,@K{} 0K40040  @0K0  ` P@ P T0$ @ x(0 "c1, ah $ 1\ d0 ` 0 0q@,K ШP@,0s0,0 $0s0$0  -LxMpKP`qPC,@K#} 0K40040  KP@ 0$P T0S $0@(0 "c1, ah $ 1\ d0 ` 0 0@ l 0,  B, (0 ,_,K pP@,0s0,0 $0s0$0  -LMp P@0K  0 P P@  `@Q80S @T0  匀K @T p0K0 @ -LlM`P KP@&0  X "00  @$P  80S@ ZP@  ,00C,0(0,4_@Kh0K0 0z@ -LM` KPPx p  0$@ 0  P ,00C,0 (0, ^ -LM0!P`@0 dK0< `0 d 8` RP@ATp18!Q K0@ 0 ` @P@LP`U 80S> 80S@% W@W@TU ᄳPKT@ K0@x}\P0}tKV U@KPP80S@@KPP,, c p-LM0 `P0 K0 0  P P@@T|@K0|0 "0ˠˠK Kx `P@ pKP p 0-LHM080 0\K4 X0 \ 0 P@ LP80SH@ 8KHP _]0vHP@ <0@@T8 K'@ -L5`P@ K`0 40 D0 0KH ؠ p 8p 0 ,0 ܀ 0HK 0K@ KQP@``P 0S @00 5P80 cQ ڴ Rb@0 S Q0 PPbU"@ @P@ PP0.6 -L M`p, P@P p PPPP0 00  P0@0P00\ l0D0 P@ ~00,  #d -LMP Q8 , 4 <0 0 @ 0@ ,, P@_<0,S8 040 \j 80S@80U<0  R. T0, ,0S@& x ,P@9, <0,`K0pK4K <0kp@" T 4IQ0A/ 40  A000@ SY,0 80S408 00P,P <0@,, 0 @ 0P@-,@ 4Q0A/ 40  A PU0Pu c0 P 0 S 0 RS00 -LM@ TpJT"" 3P$ K0E0"`E0p+P@(0`0 k@F4 -$ LM  40K-7 -L(M    40 K-7 -L,M   0 40 K.7 -L,M   0 40 K0.7 -L,M   0 40 K\.7 -L,M   0 40 K.7 -L,M   0 40 K.7 -L,M   0 40 K.7 -L,M   0 40 K /7 -L,M   0 40 K8/7 -L,M   0 40 Kd/7 -L M8 0  0 $  0 ( 40 (K/7 -L(M    40 K/7 -L$M   40 K/7 -L$M   40 K07 -L,M   0 40 K@07 -L(M    40 Kp07 -L(M    40 K07 -L M8 0  0 $  0 ( 40 (K07 -L,M   0 40 K17 -L(M    40 K417 -LM00 0  0 $ 40 $K`17 -L M8 0  0 $  0 ( 40 (K17 -L(M    40 K17 -L$M   40 K17 -L$M   40 K27 -L$M   40 K<27 -L(M    40 Kh27 -L(M    40 K27 -L M K40  0 $ 0 ( 40 (K27 -$ LM  40K27 -L(M    40 K37 -LM00 0  0 $ 40 $KD37 -L$M   40 Kp37 -LM d  40K37 -LM d  40K37 00 -LM@P0< y5 -LsPyн5 -LM@eP 0 04 0/7 0- Pd0LS LP  00;001l@+l00h 0-0P@L 0.0S 04 0h27 0-LMPP @0@ 0 - Lz5  -LAy5 0-<0L @P P<<00 S<0 05 -0 L c 00 -L Mp`|@Tb  00S0P  00 0 0SP! 0S6   PU  PU  0 "F `S P U 0  y0!FISP U0 Q¿T0  Q TWkDP0S@00A Lk|@,K 0үPP 00|0,000K0 PP ,偰0|0000,IPP  00, ,0 00Z0g,e}0| /@5$5$b -LMP@0| S`p 0 0<0  0в PL 0 0#U<0 00| R#PP -LM 0| `P0<p0    0 @  00<0 -L\M0@^ 0 0| hKD pP0 |0hKD dP0~f p-L\M@P A|0pK0 `|0 RL |0 `A 0pK| \L p 妓P 塓P - L>0- R000S000 -LMp|`@VI 0 00CS0> 0 00CS 03 0S 0S X\Y0 p@Pj@dDFA 02 St1b1 R0``00` i0|0P/ldPbTbDb -LMp|`V$ 0 @Pi@dDFA 02b SP0 S0``00`i0|0/PbTbDb -LM@5x 1x,5`:6|0 (x850S S  (00S 0 < - -Lv`5@-| q  qL@H0 800@< (  3 03( 06767P0,qB $0S<00<0(0 W 0* @.P@ 0 W*|0 R 0s 0 d 1g!Q P@0Ag*$n_b(\_n_Q_ -LDM@PH D 0`S D 80S S D1D0ß| 0 0HŒ PD<HT 0SD< |2  Q92!a1 \3 0@K `0 PD |(,0 0 R00C S0P 0P 00C |  )0 U  Q  RD0| P DD< ||<H4/PKTPK0 ?ĠKۡ`vp0TP K`p0@ 0jPX!T 0 D) @KPDH |00@<0@0aS@1@!UH BP@UnH0STD|<d UP0K8K0;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$LrQcc4о475@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S0044E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM40@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S 4p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 M=07cc -0LM0吐pP`,0 ࢂx 0  AT 0U @$0V0W00S , @P#dcc@- @ $ 0 201 R 0\ R R $0^0T00S cc0S R00  -LMpx<0 3Qp`@` PUh,0K\ @T`0 SP0@=0 `@0<"@>$,0P, @ @8@00 `$ ,P@ ,=T 4p 0V 00r x0sl 4K 00K P@ \4 M40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8P0@6 P0 X 1P0600 ` v 0 P@Nlt 0\0R00S gT?pD P0KP@7\ P0R T0 j X 060 p$@XUPp0 0tH  LLLIHP E| *?| " R R0.Sbl DP 꼯b5 -L,M(`x@ \p4:d 0a0X03 04 P@X0x 4(#x X40K<8K0 KP@(40D S\0D 00K80  㟎P7x0 qD0 4Ht0T$p T q! (0$r (0K$p Pp( $\ W (0SvDob V@0T$p@0R55 -L MQ@p`d%X` 0D 30nR\050@ 70 0 `PP X 0\ H 00`X H a0N 0-LM$P 4@0  @0 -LM00(P0C4`p00 P,K0KX PE5 0P@600K4@K00@ŲP@-4\0H0 R (0U  P 0 PE A\0 0S 4P@ 0\ 00U00S鮴4嫴 -L$M40@0 < D <0 D0PJ 4K 0 K0APp<@00K408@K@hPp+84H@ `0T*PU  0 @ H0 `0T: fWD00D0  rP 848pT8PPD\ -LM4p`0K4K 0PP-00K408@K@P84H 0R *@T T 0S H0 0R:` 8 -LM⤐Kp  | P僄P@$  ԁ0S   @T:$0@-@T4PQ @0(0$ , P@z`80S|0" 0Q{0 0S $0 LMF0 0P@  $0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  S0@'P000@KY 0孆Za70Y 壆Za- M| 㕐00 05@ws K@\ 0 0S10S`` 0 0%P@  q n_ -L,M|0`p 4PP @P87 V, 0@ 0@@kP `U $0000  0PP(KP!4 4 ;寰PP, 00;000,0iH@ iᒋ  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2?S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00cƍD80 4Qt0LP 3R3 H0 x0l3H tR880l0婍0P R*l0 4p0g4 C@`\ d0_d @0RX OP|0@@,P0 R0 Z P ;A<Ʊ,ñ0,0 |Q-P00B dPP< P ` PP$00100P0010h0 0ԡL P |04 "!;42 lPP,0\H@ ᐊP 0|0,v0,0 y$ ナP }P wP{/0  4 8<0@Cf^P@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0ܯb554500 -@L pP`0 A|`PQ`7<;$0 :$0! -LM0K"@tP0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` Z MB|  D /p p-LM80@SP0 0<l0S 0S 1`V p 050S0  -LMQ`0(  $0 ,` h0@Sph, K 0STL  0 P$  $2\u&P5 -LM0@ 0KP0 00  00 00$   0-@P L@_P00 4 0 0 -LM䑟0 ,0 @`t0 pS( x0RP#N*K \ KgPPC04 K0 !P0 PK  DP @P 0  < 0 0/&00  K0PP0  0  ,0 S ,>VpVLKN KO0KJK00FKH KP0[ 0P0K꼯b|5 c -LM 0@bV c p-L M@0@Sp3PP `K0 004 0  0 00lj i0Y00nS00rp Lh0 0h0 -LM 0hh4`0  0 $  10 !   0m -L M00PKp450 004 0 00000h t` Px0s@h0($240 h0 0 !1@00#!  "  004 ` 004 0PH` x0 @0F40 (8 Dh0@ 8D040Ld $ 4x0\ 00@ 800(0 "i 80x0S 1\X `H@0L aP` 1$E,$P` lj i0|0r0nv0j0rp oh0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0yP(0s] 4 0R P \00 5P 40 (0s (n0 00s 0rp 0h0 0 h0 p 40 Q Ph0h000h00 00Dp 40 Q PDh0h0 0 0h00 00hd00s0s -LTM@P 0ST 4` X 0ST h0ҥ0D0 TpXx0 R0S*XX 訊P@0K0\0d 0L0 TpLx0 hDQ!0`Q!\H zp`0pX `K c @pKT00\ p S; X`  b8@Kd0 P@Z@0K\ 8d0@ HP0bSP1TL H A'@8\T0SUD0SPpT0$  T000H,0STXx0`K pƋXʵW`  b་dd0 @pK8KPp 4K00 K0P@00K8@K40@@ -L  P.\ K P'@ PK K 0@ PKD @ P nP0  娺0  0 ,0S ,7>O 6O卺;[0 [ 740w 5 @0QLKN KO0KH0N0 JKA0E0FKH K:P0[ 0P0K5꼯b8745 c -LMP` V$  P 0@ B`TNL-P`ᣭ@ 0 S@`ᖭO0 -LM@ J$- -<L[ML 0 ,0 d! dA P! h0`! 4l! p! >K @h |A  KK€h ! P 0@ 0 7 ,0S t,7h1 `LA0X S 20A Tp1 T T 'T80BPP3F `Rl! 00 )FLl0 p10dA1t 2R\1 2 x0s, h`V# `>K/>KX X`P@ld\d0x a0`V`!\T KOK\ `1QKd =K'PP >D1ROK@PPP HD1@ H0bT!S0!P1 0U*0S S0|1  Q > | >KH T1  @ 0 PU:7hA0S`LA R0p0l0!h0XA00dNKx XxQL0 0P;PL0 x0 pĂ0 4ȌS \p@$4 (@K 4 |!R<  KK(@KA?A/(@K0K0000h0 S|! :h!MK >KPP  lAT p 0Lp \0lA H}H¦H忦x1s KtAtA?(K K?K 0 48<S@1\SX `H@ a0C`p  1HF,`$`\2 (K 0<|!MK| 0@ HNK0Hu]`/>K<@0R@@0@ T` SbV~KA_x0 s@041 14 (@KV 3 V) (K00000h!0S:MK% PP @ 0l1S pA@DpA Tl1 `Vڑ @0@ NK 0(@KKK,0ڄ0(KKK,0c l b @TS Tt  TNl  TK T TT  TDL  TAT< T<4 T9꼯bD5\b.6\6b2T:@2 82}@T @/0S0+ 0) 2T 2T1T0S 0S 1 0R R   Q  0P DP 0T 0T 0T 00T 0T :00S0T|0T*`0Tl0|0T 0T|0T |0kB @sB@vB hB iB jB@fB@qB@f@xB@tB@|B@nB@wt@oB@77~fyBrBpBuB}BzB}fwBgBvtmBfBlB {B97 -LMP0R,(Sp@T?ZP,@(N?Y 2` VA  qP[P?ZP,( -0L@pTP`/ 0S( zPV 0R`@TV 0SPz?0@V Sl? c( +~ -APL` 88#J@Q? pR:0S 0S  0Ps $0S 0 $ \%b8?Xb p- 88LM@#P!1`s  p 0<@80?`00`P? 97 0-@<L 88#P ?`0S0`0  Q0 0 0S000h> -LM@< 88# :0S00 0 P -LM@pTP` 0=  00 @T(\0 y<0Sح4 R-L`Pp U @V@1 p}`VPpK5 -QLM`p P 0 PR@T 0=00 0 @T(f\0 1<0S101з& -LM@0 0 $K01K $@ 1[!0 ! -L@M 0(K( 0 $K01K $@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @9`0K@D000,0 j0  尡 4:0S$P X 00S* P0  $    Xb -LM@ P 70  0P00  =70 -LMX0@0CSX0P(P,Ph# P P  -LP`p @j00P, d 0 `0J c5 -L@T 0` S V@0<00`PU 00S PUQ dp0S S l0SQ h 0 cn_&(\_$c 0-LMQP-P P@K00, 0P0S000-0T@K00, 0PQ0 Q097|97,0 P h0SlP$c 0-LP@T t0 0P@t Ew( hP0lSl00p@p 0$cl \p0p0p0> -0 @LT`P p 0S @T p0 S 2! 0W*@oPp  c p-LM ` 0S 0 PU 0S PUp 0SU <@<pp c@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱h&p&x&&&&&&`&`&`&`&&`&`&`&`&`&`&`&&&&`&`&`&`&`&&&`&`& &`&`&`&&&`&`&&`&`&`&&&`&`&&`&`&`&X&l&`&`&`&`&`&`&|&&`&`&&`&`&`&&&`&`&&`&`&`&$&,&`&`&8&`&`&`&&`&`&`&`&`&`&`&&`&`&`&&&`&`&&`&`&`&`&`&`&`&&`&`&`&`&`&`&`&&`&`&`&`&`&`&`&&`&`&`&&&`&`&&`&`&&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&&DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 x0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S &&@&@&X&&&&00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P97 - @LM 'h,_(& -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  TPsP11 0AP EPsP0P0@0@0a !R0 0 ! Rou% x  x 0\0 F97979797597c 5 -LMD1SA(PwY0Z0J0@(@`  p(@ss000 (w0Y%X00` q l0R0 000  0DAV@ @@ p `F0V 974& p-P0LM`%QU 8@ 0D1ph8p97 0-L8,0P@T @T0h8,c -L`8pR sH0PU ,0SPUh8@AHc p-0LM0`PS@ 00P  `V0S 0 0`L0S  0 0`BPP $ 0`S00@ ph E974c,c45 p-0LM0`PS@ 00P  `0S 0 0` 0S  0 0`0SD$0 `0`00 @phO nE974c,cL5 p-LMP85T";5L2 0D"D2 0`$@xwfᓉ R0 10  0 PA A R0000 0 0SP 5 P 0R 00B 0B PQ Q0  0 0S0C 0% %01 $ 0@T 0 R 01HQ@T#ph7< R@0@ <0@0 < @0 & &(&0&h<7c!d,c97cLc -PLQp` 0@S` TV@0@S0 0C0` ,u000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@p7@6-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T 5u0S  @TquPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S 97gfff, ,00S0 00097(c Q00 00C0(c -LM܀`0 V$0  % P"0 @PPPTU 4pKp v hP`PU@00T00S$0 S $&鼯b(c97`5 -LM0@S  P, _# 00ah[#@&7Q 00 p-0LM`PV @T 0  R @T`Vp pP 5 0S 0 S pPp,c p-0LM`PV 5 @T 0 R @T`Vp0S ZpPp,c -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  P  P 00 P$0  Q 0 ,c979797H0Q P 0 RPQ,c -pL W`4 @T 0S @T XR 5 oP Q oP0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   4& 0-5P0L5e; @T 6q@TQ 0 S11 10C1r0h] -LM5@05A;Q h -LM@H h 0-@PTL @rT00000 p-LM`4p0P@T %5R0C @T480ph!(50S ,c7 0-@0L@PT (koP @T00,c -LMPU, `@ 7U 7U 70SRP7U ,0 S |,$Pp L7%U p W87Ul ,7Uw c 7U- 7U \ p  0  0,:5 4@83-P0`0 P%   ,&q< 00\5   3@33@3 50SPr0S  Pc<%5ATO PUL 0SI0FX0S ;S SK@s Qr Krn |35L@K05 P3Kp5 05P3Ke3 @TR 0S 0S @TFS`S SS 3Ua 43U 3U&IPPK0K@ hP"@@ l@ hs\@/P0S"  \0S ᗻ3U 32UP ~P U<P P@K0K gP- 2U2U*1U 1U 1U!1U1D XEe`001U" 1U 1U@K@ r0K@ g\0`1U T1Uy<1Ur@K r0K 1U 0UD60U>20-uP'?$% 꼯bi$ii$zi p5FixIi i i i qϖ97i i i i$Fi@i$Hi Gi i Jii i 5i i ~i i 6i(i$KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,"P0pD1XU.LK(  p 0S7 U@` 0S<Kc$ PU {dZ 00pZ@ PETUXUP0 0eP  0 _dp pWd<K"l NdP PE p 꼯b,cx5 -LM@Q 0 S11 10C1o 0-@ L,hPP 0 q80 $000 $0(0P04c -LM0`SMPU klP7 PU  7PP5  0Pp+ 0@T OlP& $@TP@ 000@00 pp  0P  To0P/So0P9S4c p-LM@`TP lP @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0HEpP R000 0 0 6 4c -LMȀ 0R$0 0@T 00@T$0 S |$^!@`TP 4pKV`Fj p #cPP@T꼯b5 -1LM@ T$ P ykP $@T$0 S $#!T  R0 @T 00@T@`TP 4pKV`Fj (p bPP@T4cb5 0-P0L@PT 0kP $@T0T 0004c p-0LM@`T kP $@TpT  0 RP U 80 SPUp"p4ci$ -LM0@S SL ~jPT(  vjP h0S4 0-T1L0MLQ@ T  8jP< $@T(@Kj0 (0K'K;P@ <P$q P@D@K pn &P@ <P \ P@0 S XA 0 T @T @gT4cb545 -L$M@0Q0  %2 800S80 0 S h <55P2K4 K 800CS80ʴ5<55 꼯b5i -QM 0P P -Ѝ0 ЍP0  Ѝ -L$M@A`AVD@ H@ @ p2@ Z lPS 40 40 \0S P40  TQ 3 R*UA@@@@0 R&(&&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&&(&(&(&(&(&(&@&4`K  @0` YP 1  5  3Qs H0S02K H@ 0 1^  H0S 400cN  lZE 1000@*K  Um QmD0 S<KsImQ@{.! 1`R001S000 00!005  !@ ].  5l101P.77@C S 0 B0 0   0h0h40C0C!0RlH @0@4`K l@BK@04`K  `nP02Kz ( 3R: R1 00C B 0 !  H0S400c  dk@T 1000 >l S0 0C 0 0d0d40C0Cbm i5k0 , ! , !2 P`C-0pS! <-lR:- 0`R 000S@0@0@0i'-000k0S000 0PP0-1U) 1Ue0, ! $ , !h1 P`,0pS ,LQ000 0PP0,5iY50, ! ' , !0 P`,0pS ,P000 0PP0,s HgP TiJj`Pl97/d/dc5݆!dh<7@-@@:@0\#" 00  @Z00_97 0-s/0L@P0S0 Y 0X \ZPtl0D& -LM!@R \0700!R\@-@ *,  0!\ "0! ":<4@-^p`*#!^ ",!1 #: 4|4 0-0LSP@/ S /0 j j0S0S 0S0S0S 3000  00 00l jd0ST jL 0^ 0 000  0 97979797 -LM@p+@,`K4K P@Q,0[ 40[A +T  #f0S  @fPP0 00z+7 GP@"  8j 4j00 p10S!00u?A0! ! eP1 01P+4 L+7 H+ -LM@?+@,`K4pK 1P@A6T - e0S  @ePP00CS0 + R0700 |10C1 eP10C1+4** -@LMhV97 -LMp*`P0S@0 s01 *Ts 0% /e 0(90 \0%0 0 0 WPX0Z Y@5~0 < 0Px@noV 0S80 0 0pV p 0S 'e--P@ 1_ @ P -5 -@pL %PP ZX0@T L` R@TP0$\ccc 0-LM@P0 l@V&"~Zd0d0P0 0S0 0P p 0\-5c<cc\c5 P-L@P p0PP1P P` HZT`p`P `@1Sh~(p(P ! ^=;7XcP0 ,0 0P0!R00;7Xc -LM@ \ <0S 40 -LTM@P`pl@ P0X P@Q 0NWl  40 80080 }l0 lK `Pl@ 80080"l@T 40  hPK@Y 0d0  \ 00`0 <0S 0 T @0 P <04 ` W 0S h@K@Y 0dP 0S  00 0`c -PLM@+ 800CS8040 00  B 8Q @P 0S0C 0 c v0hI' h-Q,5Pc<c55 P- L 0SC hW<,$5 -LTMpp `@Pt@ P3@# 0 t0 '&30#0P00Sl 8 0 0R* @\  T00R00S T !000hK@YphK\  t0d `p L  Z000 c *YPll@0StPl9Tl\ 0S 0S40+  \hK@X 0l p`l KhK\ 8` 4P d `p lT\4`@ '40 040l0 l `A@`cdchc -LPM\`Kp@` X`@` K 0X0 0P 0T 4, ZU"@T 80@ 0CR80 )@0S$ 0S0C 0 @` 0<0 0 S  0 H1 ,0S <,   @080PPK@"0U"0NK P0KOK[dP Y0S P@z 80@ 0CR80t XRXY3AWP7 @ 4p꼯b@5d5 0-LM`P@\ T 0L@ @@0 <@40$000';7tcl5_TcM'7t5 0-0L PR  >P@0 TH 0QP  00@0;7Tc p-L M@PT`"  R 0 0 0 R000 0 0V  \  po"0S0C0 @T R000 p0(0  0Otc5 0-d@LTP  tR 0 0 0 R 000 0 0  0S0C0 ."d@T0~(5tc -P1pLMD!P0d@0TT0` 0S& @T P@ !Tp`Pd00Sd 0 0d0d@ 00@@0007 R 0 0 0 R 000 0 0  0S0C0 !$(pbtbtc5-00! Xcc 0-L@P0P   0 -<1L M`^$1pPU0 @T* 0 0S% R 0 0 0 R000 0 0 \  |!0S0C0 @T 0 0SPU%L0i^<'0  0TpbTctc75 -LM0`SPp@T SP: @T0S `2S& 0W0 P@ 0@S Y,0V0r,0  ` 0@@`00 @@`08V#x 2S ,00,0;7P40 R  2S R;7 -L lP 2 S R,00CS,0R00000;7 p-LMP`P@ $ #P `!VpP' -L M<0S 0 0 4L PT# -L MQ, `Pp@V 0T0V00S P00C0 Ptp00C000C0,V2D1 R p(@0T0V00S W1S000 S0000 0   Ye0@00i mp,  0XP0@0 @V0S0+p0  V W0p@00Y @00 08  uP0S p7PK@Q 0 KL0  0R`0 0 S0S 0 SPnP 8&!P p0@S񟗎V'W'X'X'X'X'X'X'0S K K0Pp R L $ l 800C800D <0500 KKP㔐p80080 00 0 00 D 6SA x | 00 <0S0  0 | @0x 50@0p0  p  % 0K0@P  ~P@ oU`K 04 00L$ 0 0:7p8P@K"P"0P0KP NK Vd@ -p&0P /p  P@ 0 p)P 0S 8P 80080Q 0 S00R0#S0Sl SKPp R|PixPa RUZ @ P P 0SD 0S0C 0= @ 00 0 < P20S 4 0 0 4 $L <050@0S 0S0SD0d@T  0L  L  0 L @J K   K@4 P  PP 0S0 xP0S Pa 0 PEpw ^S\QS M |P@  0 S:7PP 00 |UPP7 "뼯bc;7;7;7@5#d@500 00 0-@PL(O00  0 0 $ 0 p-0LM@`,POT*\0 T0#03 P00Sp@ 0B00R@@ 0@-L`SD]']'^'^'pyRPWP/U+ @ pp@O1P 0$ 0A0Q0  p,T@ T0S0p0RR1@RPLpTpp -L`M, P Y YpYTp LpUP@1P 0$ 0AQ0U p PS@ T0X0U00S ,0S 00S 00S 0S P }Pp0SP, 0U00p -L`^@P?P@ Z p@04 0尥U 0 0P  0m*c;7;7;7 p-0LDM X@KRP@pNP`XD @505,P0S 0c;7;7;7 -LPDMh@l \p P `hK@NWV WVWP 0   hKT \ H P@2 $00  h00WV WVZ!  00hK\ `0 d P@ %0 4 l00h  X4 0,0  0`Vc;7;7;7 -0L@M \@KR`p@-NPP( @e`T$q  0qc;7;7;7 -LlMⰡ0 SP, @p_ `K@N< 00 D\0  @0|0 x 50p0 6S30 0S `V 0S,0 S ,'40L$080D0< 0 0E P0p00PK"M"0P0KP NK Sd 4 0 꼯bP5 -LDMhKP @M1`V  R 5R `V @T 0 T '0 SpT  X 0S8@T Z  0Z @T0P0 H0 \0 P 0 \0 0 H 0pS P 0 S 050$00hlEP0005X05D 0Qh00 XEP000,c -L$M@PPp 0AS^DK` M 0`U80 D @ 0 < Q D0P0CSTh'Th'(i'1`a!6hqU 0 (P~ 00g0 00 = S000 0S000 0S000 "=" S000 >S0 00(@<7l5t5 -LM@5#"!sR111 hQ 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMg.S@ 0`?C0CQCD0T T(0(0 0 55 P P111< 1N P PP1N  -LLMß0sP@`,0 d!0 h IdKh J녯hP#0S5UPUd0[pWTK8eh R2b3c13d0<3 ,0S 0,dK0  @T@p0d0[Wǖ 0  0 0  B0 ǖǖǖD2 1l0 0ǖ|rh _U 0pWp p00  t0 {P@pp0Wl @ 0ǖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0 0ǖ 0ǖ 0ǖl B0zl0 0sǖl 0kǖl0 0cǖz꼯b54 Q00S Q -LM<P8S ySp S p  Wp!0S7 B `<` ` ``VW x1@ R4p@TT1 R P4\7 S 7\4S gV t's's's's's's's's'7<7547<P` W@0\Ġ @Tyrpp iS Sppp 0-0 0 $7PS00 7L@Su'8u'du'u'du'du'u'du'u'T1 0XB000 00CSu'u'u'u'u'080000808070:00;0<0<0: -LM7@SC \ ǀ 0 S057A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWP4 -"L0PS1` QS1/A Vn00S^ ^i HυpVL 1i R000^XQ-1i>0 R!1?0X7^XQ (1i>0X@!T@XN0`W4 1i>0X@T@0!0i.S 01000S5t45 0-<7L P|000 Rd0S 000S20S@N00d0 `0Q00R0S>S "=" S Rz'z'z'z'z'z'T 1S1 RP 7S 40 1 SRd40 0000  p@-1 @^PT * ^0 0S0:W0!0CR  101 ^00S0 00p00d0bT00!R 0S00 000S10C1 ̫ -LM@'N@ h -LM8@S08 -0L'0 S# 00CSL}'|}'d}'|}'|}'|}'p}'|}'|}'|}'|}'|}'|}'|}'L}'     = )K802}. -L0$0 S 00CS ~'D~'4~'D~'D~'D~'<~'D~'D~'D~'D~'D~'D~'D~' ~' ` cJ0#302}. -1L`pG  H0S 400c7  J`VP- 1P000 K 0@  #$<0 P#  #(80!<4>0@"S 0 B0 0  0a0a40C0C -L M,  00 40 0 P= 0@pP`$#L4(P`'0@ x ̠ )pP`4@ p0 dP0 `S P:0 0S:,WJ?K,L,L40`,IJ -1L`pH  H0S 400c8  KP)`*< `KHK @HLB -K@LB @0@L28BS@ :P^P ZD,0 S 8,Pb4H5 -LM@"`P 4K, @2 NH0@1 @QX2 AH K%.K000T2 @X"00C\P D2 p*4K K*H%K%K@8Kp`\L0\@o_`%KL$  @i_` 0'0| P`^? )p !4 P `"$' =t%K M_`" p(@ p K$< =KP)`*D `KGKKD K⠑DK 4KG<K DG%.K@0P0P \DLD :TPT Z` 4KWIL,0 PS 8,b4`5 -LMp0@W,0 0`0 儠KJPK@C G@060#0@?T@@ X @e T' 嘑@B fG@0\0#0@?T @@=  K G ||,0 S l,21  @4 TꄠK @K ) ^p꼯b|5 -LM K  -LMp0@W,0 0`0 删KJPK@B G@060#0@?T@@ \ @m T' 嘚@B F@0\0#0@?T @@A  S O ||,0 S l,1  @< TꈠK @K 1 ^p꼯b5 -LM K  -L$Mؐ`pA0K@0  0V,@ A0K@PpV ,0S t,o @@K 0@] ~F 0 PRA0[`F0VA0KP꼯b5 -L8MP@0 T0 P GP0@ L@ D @0 H0 GP4  @` T K0<` 0@ P8@ 5 -L8M†|`p 0TK@0  R!8087  P Z 7S 808 00 / P 80\ Pp IPp 7SU j?  TH Y80S 6Q3  #t?0 0)04l?\ H0D ?0#l0L0@7T 0rX s < @W 7S Z 00PS1S  7P60 A:80 :?@ R $7S1Ss0X S 1 R 767X T7s 3D0,  1 R   G&76Ppp u808S S!7S" R8087SR0 1"0P B4T L0 .S  S@ *SR X 2S 0SSRT ,K>,K a@P0S PS0S@P 4 -LM@ PPp $7S ` 0SP 00SR0S JS0 RZ= 0SY8  R808R T60R 8087 @P7 0S T7U p00 0WP 0 PP8082S808 -L M L\808p`P@t D 0Ȑ ^ 8 Ȁ P@< -L,M@ `P $7S 00 S00 ppL0 PL W0e ST# ?P 909 W0PPp$4WD H0 @ 8 < 4 0  00S0.S S0P  S4P  P0Sp40S 4 0S00S 00 R808R T60R 808007:?P10CSW< RL YP:D   0L 9094 80t00H03D #T7l l TǔL T7rrY0L z 90 90 mH90H9@0S   P`   09098082S8P d 0SP0S@P 808S4 -LM 7@S 808$7S 0p`P0eS 0T8 P 5Z101808i000S"0 ( T' 0S< P4 0 s 00S0 S4P  lS0P RY_ 0S808 00 K4 1 <  803 4 0Rt9 4`P X3 eP.j/000t1 R 3 77 777D1 R 3  #1 R 767  s076j/00 90 98082S0P  SR808l ,K2<,K =PP{0Sx0St808J646|5R4 p-LM 00CSP@ $9  0^d9 ^ pT7U 5ph( 00 p  p808p5 p-LM 00CSP@ $9  0^d9 ^ pT7U 5phT( 00 p  p808p5p@-@SMP@`@ S S 0Ѝp@909Ѝp S 0S 0Ѝp@S PS S 0Ѝp@`S S 0Ѝp@S 0Ѝp@+ 0Ѝp@ 0Ѝp@ -LlMCT 7S, X \ 0S? XPpK 0@ p  X,H P`0Xp  `Phpl,0@\(d (P) ` p$\ #LP` 4 P:0S*\X孠  p ;X`a b0c@4Pe RPpK 00S0S} 0@ RV 00CS]XpX0  pK 0@ P` XH,0d @pPK0t@X`Kx <0 @ P ,8'x4!,P`p\@0P`0LpK` p\T \P@p`!> @`d` p&\P>PT% T\ 똠,0 S ,et( h0?  ^H|m: <P0S`p n꼯b505854 -L,M0 0P0P00S80 4 9 P`  @K 0@ p`,8H P`0p`P D8Pab0c4@e R,pK 00S 00S P S( 0 RU 4Q  0R s;P0504[0 l@(d 0@ RD 9 R;P0S P 05854 -LTM4 78 S< y8PK P` 0@ p  `, P`H08p  `PHpL,\(d (P) 0@ p<`$А #LP`P  4 P:;<0S7*< 8 :P/8@8`a0b c@$Pe0SD `",K0K 00S 00S2 S 0@ RV DpW 80 <Q  0R  :PT 8`K p  0@ P`,TH8d0 @0pK pX@8p`K\  R d PD d0@,DH$ZP02}4 0 DH0 0H 2$HP00@ H@P'Wd07 0H`4p40d  dRc 5dPKDH G0@FP`,DHd0 @0pKCpELp`K0 PDB < @ P.8'x4!,P`ApH0@P`~.`,2SN p`K  0@ P` pPK ,DHd0\`p`X P@< L.T8'@P 4x )P` 0 @@ ,5,04 oe0 ,0L@( @0@d 04 Pd1l585 -LM, 0P0P^0 6  0@ p,0KH P`pdP4p,80@ \.d( P'$x #L4`00P` P 0 0S,0p5 H 0 0(0tl585 -LM 0PpSp`s5@0S i3 0R 0 40Q:a b04c0Q: 0  > R 0SH  @ 8          b      0S    4P cP 0S -LM2PS@ pP`\  &K4"[9 S 5 2[ (LD0R 5 [ 0(xX+ 0Sx0|000  B @R0 00 5 006S606d( l5 U 8(5 K x5R555<5 -LM%@: 0S%  $ 00P 4 -LM`4@Kp)0 , 80 3`XW@T#0# <0 5Pa T HP ,0 S ,D 8KP77 07  W@T 8K P<( H 8K P01 T p4T#( <<(@ 0 ` 8K ]P t t0T (@P@TP0PPpWP@@y꼯bh5555555546605 -`LMPp @2# 260 072ll0X0C4W B  2t0R )TS  2353576r0b0s c t0 d0 U?&0p 6 &1l0!>p  i?t 0 7x  Z.Px00x0T7Wx00x0xRV 0-@PL {2 #w20760 m2B0 W0CXg2%#53&'b0r0c s d0D t060&U? 6( 0l01p !t01'!0RV -;LYM:, \@P` :\ :\ j:\: :\ `: ,0S , :[P`@l 3P7;7 7S $7S 7  T #  3P 4`7 ; 7 19.P`1p ȠDž \9i>0  R! 1?0X77$7S 7ST7X l R@9QT7,9\ $9\ 0`8P`7@ 108%S84`|z8P`t!8  R 7j 7 ;g4`7d7 a ;L8\ A@8\ 88\T8P`N 7!S F74`207P`; 7S8 52`4 ' 07 $7 S'  h' 02c0T'MH7\4 #<7\6xP`  7S Pp x0  Pp`6\$7ST7l 7SX86GP`Pp T7P` 1S S S 00 15P`70SK +Kp 0HS  0 00S$P`ZpV0CZ002C R* r$ P7<7<}N.K7` P@F 0S  S00F0 0 0 0Z0@0`0PZ0'RP Q44 @R\$4\ ,4\  4\ 4\=7@3PQ867#500#00/3\ 3\( 7S >1"s.  0x3\ $l3\ d3\ # PpK! 7+$7S (3z P KP [OK*0! #fT607P0K2\U *2\7 00`8p00P0SZP0p02:`V70'#P` 02\w `J Pp 0|S:cK | #`V0|00 Pp| 0S*Pp  0P`PK! "P`P0[ S}zN@ *P ['OK/$7S 'R! 7   *_ /\T#꼯bii iiiH5#d4i i i8i i 7X5i|i|ii !i ii5i i 6i(i i i|i8i| 0-"|72h'l7"2LŸp't7 2d' QP'2 2Q0t"002a VVw VrX"V80B@@f0pS(700^ \(GTT1@7 ( !00A TI3T) T$!T80B``@0pS900 6ITxI))`12 @!@T T0! T(! T T T! T! TT T T ) δ( @V V  V  V V Vp  V|h  VyVX VtP VqX''|'',<<7\bd545 (b(Q)Q<10@cT@ 7 0  T7l UhOAKkN@0T'00lP  -5L`@TWG707l@k !NWb-#p ]- Y- 7S7 #00#0!0z 6 6 7H-) D(t003037  037Sr007  )-( 5 p-LM`lP1i>0l@T@'0@@R l0S@ 7S,#7@ # @ Z7@S 6 R @7 p #  .P @z7~.P  # -L$MP5 `$  74#03( ($3wN @R707 7PSu PpB 1@S ^ S!YTPW0  Tpl|201 'R T T7W R ' 07 $0S $U  7S7  7S7P '0S !000 07X"PWp 0 RpPP DpKllA 0  bPPDK0i>0  R! 0S1 \\ r1i>0  R! @p \꼯b5L65 5\7T'sX $7S1 p-LMT`P0S@0 k0 Tk/&p̱@*p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP 7TǐP@ S`` 0SF S p 0PQ Q 7S # (PP (PS00S(((( 7SS# 'PPP00 'R# 00 'RPPV 0Sp97 -LM@PAAP`p Q23% +P 0iSS  0i'@! 1`R1SP1Q0Q10  1 0005  "$101(7\5 -QLMp`s 011f  H0S 400cV  $`VM 1000@0pU000P21   % ! @%# %5 7S  PZ *lPTl@0*!(0N006S`6f060f5 S 0 B0 0  0f0f40C0C <4455Q0 7SP1>0 RP((( (P1>0 R4 0S 00S @S S`SSʠSS -LMpP` i*P? 0iSS;0@S)0&00S!0((0((Pp 01pTG000 pTl( H09009U#W 00 0 S%PP 8K $Pp 01' j?  "[2R i@< r%0U  "[ 1|  H0S 400cq Ti 0 d0 0U] 1000@ 0Y0 I <0 w00 V021  7S((((((0(((0#0 J$2K  F$ B$7 0@00W00 5$2K  1$T#00 '$#  #$2KU? "!,90,9D *#PS*  0e0e40C0C@e5- 7S S  l0  ˌ,40 0-0@0 LP#@0 0-0@0PLUP#P #@0 0-l0P @L 00 p0<0 '#3"$ @00@r000 -0@LM0l0^0@ 0-)^L@ * 0SQ*0S Q3R )0SQ 0S n 00 > P0  P 9S9S000@ Y#0 0 0 00 0@- 00  x0 p0B0 022 00 0 " 0^#40 4*00 40 Ǒ R  R    .00  00 -SL$@K(@K MP` "0 0 P "00CPS"("("(#("("("(#("("("("("("("(#(|]00pP@E7*$4@0pP@ $40@ :#40P " (P00"H "P00@ " (P00"H "P 0 8#H P"@@000445 -00LM0 @ 0b0d0C0 -"0LMP(@K0 `pL V" R"00  B0f0C04 0-20@0PLPEP  8"@0 p-@LM T` PTPp 1 P5 p-LMlP`2'0S   S00C0 zP@ 000'0 S00c0 0p -LMPTp'W60WQ00R 7!S00 0Q S00C0.0  2 P` 3 @00 T72 " TǕ 3#4!0T6 77S0  7S' 0 R 0S7 0 0c0 0T'/7T'7-M  p-LMHX P%$ `$H%X 0  `P@p -LM("HP0  0 000L -LMW0@S 1 #60 T00W  0pS`00C0.0  2 PP9 0Ǘ   l0  3  ˌ,4 0 T 0@#40@1 6 7 0@S#Ǘ j?  00c0 0T'e@Ǘ@T'IǗ@v@T# @ -LM`W(Q010#0Q0p"X C 7 ePW@( 00 0U%40P  00#4000 0S7 j? 0 0c0 0  R -LM("HP0  0 000L Q-L`@P} t000n@Up 2U' " U 49P049 Pp 0 @PPZ㜧,9 P0,9 U 0U("(XPpU* PUU U("(Pp 5 ⃴ (08#8((yPp 7S("(qPp 5 c J5H55 -(`L"x+PP0  @0 0K00p @   p-LM@8#h !NPP 0 @0 0;00`p -'W0PS 1 #60 0 7WS 7  S00`1L 0RS000C.0  2 !PpG @00x 岀J! F# B ⶁ?2  3 #4!0"577 6 G R7S2  } 7S)0 R 0S' 0`0c0 0 ' ' ` )97 -LM1`p{  H0S 400ck  `Vb 1000@10!  P0 0 00 0RD@@$40@0 0C8#8Cc0C#$@a b0. (! 1@R001S`1a01a0%0 0 1017.  S 0 B0 0  0a0a40C0Cꈎ p-"0LMP00@K0`0h P L  0 000000P00 ;p4 -"0LM@`0 PK00p <' #@00 @4 p-qPLM U`PU@000p1@t5 -LM R  `pPPc 3 @0 0  f  < 00 Sc0 0d0 05 mT0 0 (( 0|0 055 -LM, P2 P0 ] c 0B/0 $< 0@"  $4 0@8t p`%<T P #Ƞ80`cp%4\P0$H0r0&dS , p00 j , 5,0 ol,0\@(T 0@, pX < 0 055 -LM0S,0B : P0 pc ($< 0`@&X P` $4 0@`6T P#̠4 0`?40 %8XP&h#Ġ<0$D < 00cS T' 4 0h!$ 0 0 0%0 ou@( 0@T' Y,n, 0"40 H $8G0@"F 42E0!<D#(8C0$H!4B, 0A0 055 -L M pP`c G P0/0 $< 0@"  $4 0@2 #,4 0!8#$<0 $D 0S c  5 iqH 0  0(40"d < 0 055 -L M0S00  "P{ Pc 5N-$<, 0@"  c`$4 0@2 #,4 0!8#$<0  0S> ` e$ D D0D! \'00 Z0007! 0 1! P'b* K(4',( -LM@Q 0 S66 60C6Q 0 S66 60C6| -` V `PULp@0@ 0C^SPUU dV@PLPU<V@(h PPUh56l5 6 -PL`@pPPE(xF(F(F( ⹮⴮⯮0 2 Q, 0@%Tt!t1 dWTPV@T4h(  @T #2 ojc^\ WR, M\HLp5x555460545<5`:6>66D5L546T5\5d5l5p5 -L$M@0 ,  \7s 0 l, W0< , W` ㅏR8 4 p[0 00 0D0 @ 000 0 H0 L @0Ss 0 \oP@  0R\D 0R ,0\' 0< 0P < H0S 0\  00 P0 \\3 L R- Y' 0J0 W 0 \ 00 W4 0R08 R0S0 0< 0R00S 80@8@ pY,  7S 0S40040 @ -LM 76 700|0 \@  \ L0 R 7 77 777 7S7  -Q77 8871LS p-LM$G`$TWQ8PK(HM(N(N(4O(T0 L(K(K(M(pK( 7Sl SL SC S) 07Q 0 S66 60C6Q 0 S66 60C6PRp 08@w PP  0PP 0{@w PP d3 P0tPPc 7 0707   #l W2  T񟗚M(M($N($N(LN( 7S h2Q 7@ 0 ~TP1P015T#s( Tc L(N(N(N(N(R0Z 0R RP0$GITF L( L(O( L((O( 0 T7 L(TO( L(TO( L(W0!R6507%#+ ǖ0\ ( WT671l0X@FP0@@0 lCǖd0d  P0P0D5<<R9755554605555 545T5T4@- \Pp`@@ P0 R2u  00S  @ RJ 0 0S  ^ZW 0R* p-LM@ 0 1 1pP00 0 kL0`V<@c00 Ba2a3c13LL0Hp逖C -0LM4n 0@ ED<7 0- L  @W0T* 0Q1 R0 0 PA4 e@ 0D<7 p-LM0@0P @0HW`P" 0P 1R 0S* 0^ , P0@0l, pD<7 -LM`Rp @t%  P`F @pT` -LM4@,Kt 0@  @ P1P P .  b D DK: 5PKd d2   PKT T) D D$ 5 T TF h900YF@0 X 40QG0 ] M 뼯bii5i@ii x5 -L$M`, D0 @DP\" <0%@`V 00S DX R 0`V 0S <`V100V@`ЎP` V@00`V`sp Lc -PL` R 0 0 0   1S0 0 0  0 0 Q3 0P!0 00h  J (p(C< .$4 <($, 4,<"0!Ƞ  1S0 00!P(p(<4(<"4!<0 0 0Q(  <4<.$!4(, <,"8  !80!  m&(p<,$4.<( , 4"'<0!Ƞ  1S0 00!P(p<4(<"4'<0 0 0Q(<4<,$!4(. < ,"80@-("HP$$,(%Ġ,. Ƞ"̌ , P h0  P0(0S3S3S80S0P R000 R 00 -P L.("hp&$,('Ġ,. Ƞ"̌ ,@T h0  @TP3S3,S  P0T R000 R 0@@G-SMⰡ(<"4(7>7 -L`MVp#,0 000 20SA# 0V0R00S 0R:0SS S S S S S S S Sd"000 1   !P "48<#8SPPXP@* 0@TP:UP! 1 RP'P@ 0S^T 1 0b  0  (VpN\!V! 00 0`,   V00 VZ0S 8#8#$0$ 0 14 0@S": 0 @0 000P 000@0 #$0$0 0 2020020d41Y @c@5L5 -LM#P h --L M`@p "48<#XdU%մ00Ҵ0՟ 0$U$S *@P\%`000 p 00d 0P%000 0 0 d 0 0(Sl1  @(Qb갯(((Ȯ(`(p(((p(((((((((P((((((((((((((((((((((((TU((((H((P(X(X(P(X(P(X(X(X(X(@1E#U(0 0U"R 00S3 0)S 0tß0l3 h3!10S   CU00U0000P0`00  00000@@ @T@19p2 R T#U  10UR000 B  00P(K, P0,P 1 RP&1 q,t1 R1 001 000 ! 00 0SzZ000qT@ҍGT@1 Rf 0 R1 U00( 0 RS U r R t0 QF `奊PB 00h  0S 05 X0 0c ?78c<7>7,?7?7>7>7d(>7>7>7 -3LM p, 001 CP  0S 2 @T H0Q 0% X0Q <@T@@K 0< K;0K 080 @ R X0@@0X0@80S0C80yH0Y 0Nڢ 0PD0 `@` @QP Q TPU00U0S DQQ @e`@ Q> T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD1 <1.X0 ,0S ,0  00 0pP  0 0@, T00T0Tz`꼯bLcX5Tc -L M 0@p@A`0d` 0p0#!dP0 0d0  0ppg  -LMKjX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`郟*xp0 p0``P PUVPOP#>7>7>7 0-LM PP@ 40P00 KPP彠0SL L@@808 劤P04010?74( 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0hJT:<0\ T0L0P0SSP@0 ?77>7c - LMR 40 S 0 0 5 -(!XL"x H` P  hU H -LB!!Q#7011A!1 ȠB1 B0A0 x!0hp00 cT1(0000 c( B ! a c0#7%c!c1c X@0r08 #HT 00 0 R 900T| ?A7c%c!c1cW XEنd_V_T_X_\_yZ_&t4tbZ?7^_X?7`_ 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0X?7/utb`_T_Z_\_EنX_^_V_Z?7 0-LM0P [[@[0[ P@0h_5 -L(M(`KD 4pK|4 x@$Ÿ$ 0@ Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ2[S@ ` B1 2P13[@S `,@"!@00Q@0 ~ z v0廡0\ eB!2b2c621b1c1\ 0Ttz4450c<78c>7?7P@7Lcccxc5c5c58c?7?75 p-LMdP0S `@T 0 S00 00C0T 0Spc -LMv0@S e000 RqP "2SX00X0 o0X000 0XQ0SF 0SC : t 0 00t tP000 "48<#Q000 R000 0S  b;4X P.P 0%0S q Q \4 R(00(0  o00S 1 VP@P \#0S#00T3pW 0Q pWp0#$0$ h("( "4 4Z0 "48<#8  `00`0+,#00&S!$)-"("4 4Z00SY 쒟2  Q I0P: 000 @PP@) l"@00@0P "4 408#8#$0$ $"0040$"040 Ÿ0 10 Һ!@oͺ!d00d0Ⱥ1d00d0W L 0Sh 0Sd 0S`c 00 0 R 0S < R 0SR t R 0S  R 0SR|00|0 $R(00(0 t00t00%p00p0dP@P000ZP@LcTcT@7?7cc?7?70c8c<7@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0RLc ?7 -L M p0 01 cQ c 0  0 RT 0Q0R  R> @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V  l "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `k R0@00@ ,$00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP``r0V0C0@  P`g00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@P @dDFA 02 S`(1b1 R0000 0 0! 0 0 0!B W P 0P U  9~`! h00h0V 0S0 0 0 0\!000 00C0Q Q00㡸P@P00 ᖸY 00S0<0 0 0 0 0 0  00 00 J}0c?7PbTbDbTc\bc - @LTp ` PB R000@ 0U0C0 R000 0@PH@dDFA 02 S`T1b1 R0pp00ph/}?70cPbTbDb -L"`p0S000 R P00C0@ T h@00P 80S0C8000hØ 00 0ccTcc p-LMt`0S pX@00۷0S׷00phҷ(P000^0SccTc -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@Tc?7?7Tc -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( =P H 000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0 P, PE0S P T P 0 0H000  R H 0D0 P P 2Tx D XPi4@K 2 [R3[Q0S 10[#0 210K[8K@  10[0S% S 2[0<KA <0 20[020K@0iPpS20[3 [0Si t rd吀P. 20[020K20[3 [0SX0L0@ 06P H  Y?7X@7\@7Tc?7 p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 尖P@p4 cc p-LM@0`+TP p!0D #10P}_T@7 p-0LM$0 (K0 (K'K1KᗖPP+ 4 10 S 80S0C80p00 R0`V @T 00 Q @T`V80S0C80pږP80S0C80pǖ,c -PLP&  P` 0@10 0 pD00 P@PE0U :0U0*00T@7|_ p-LM` 001PC@ c 0!0e 000e00 000p -LM1P `@,P 0P  l$(00(0otYP 0S8tX  0R $P 80S0C80ß000 00 0 ǒ\3  0#$(,"(DRD #0wPp 0#!DQD#Gp00C0< 0R 8#0 S0!0# P"(00(0 ",0S$00$0p ,00,0WN APA( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (( ( ( ( ( ( ( ( ( ( ( ( ( ( (( ( ( ( ( ( ( ( ( ( (P, , 00j1 R lP 40 80S0C80H(8(\(((T 0S p@T 3R ,0 S ,75r@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R< 2Q6 H0S <Q0 H0SQ P* U 5S@T 0 R @ TT0pT;p~ 1P7pv 000r 0RP@ 0 <0K; K0@K80 :@Q 919 S6 0!0S.*!@0` P``z9!09100S00S000P T!0?0 FiP$ 9 P0@)QD0 )0 01 000Q000 D001  B D| 00C0P P 80S0C80D |]@7c$A77A)XcccC) 0-L@㮛P 0h馛c -LM㟛\AT: q 9R09D0 0010`  0P 0Q000 D001  B 00C0P P 80S0C80 Hឈ㠈V@0 \1oZ'|ccC) -0LSp; S* ` 1fQ@A00=@T H0TS @T. 0Sp  Pl0l P@  !a000 0 0#!A7c|cc -LMPp , K@P`\ 0 0R 9  0bS@000c0CS 9R09D0ş 001 0 0ğ 0Q000 040 D0401 0  B $00C0婚0mP 00@h @,h00 h0s0s0030S S,0S H0 0Pp 0 0 ?P P  00D@D0t t 0S \#!0P00 R?"" 43` t 9t0=t0Pxg P0RP1 0 0062 ! ,!0"?08i"000:S?9 S7 100! 00&?0I@Q  10cS1X!P@ P P 80S0C80ڰ 4#4% z7F P P 80S0C80 ,44@0 z[,PE S 0Z _h0 S H00080P00ጙccKJI7 A7@7cPcC)c -LMP@`vp KPPJ 0 0bSE 9R09D0 001 0 0 0Q00`0 D001  B ᴆ 00C0@ 0@P P 80S0C80< cey cchcC) -LMP@`p KPP <4<("4!<S ) 9S090Q9D00 01 000Q00`0 D001  B A 00C0͘x 0@P P 80S0C800 yPccpcC) -LkM PLT\`P@F n Tp p! ßD W pU`@ #t0D SD K1nK @P 0S o/K PP@ b@0a X Pl0L0Pd @0 0@0d tnPP  !  T pI᠀a0\0r U 1o@p l0L0D= SY `0`S6 000  10dP P P 80S0C80 L6881P@ x{0d@  @ dm0[ 0 " 000  QʐT0S0 000  QT0S909PD XV=DQ 7A7ccC)c -LMU0SP`0  S(  04 ,0 0)0Spp4 p0VjP` 00SV 0  DU0S S @ <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R 30(,!$#, 9 2"0P<4(<"4 <0L<4<("4!<0U 0S_ SI 0S|0S8 S# 0S S /, Q< ,  0 "0S;0, Pe4 0`  !4 8<#` #8 0U 04^01t000 04 d0b!$(," "( 4 U 40!c 0"4 40t\ xx t00(@/0 X0@0t 0 0 % 71!7 1@f`Qa/ 4 , c A7?7?7 -LdMtp`l | 0,0 @Pp =1S9 6t0&(= r 0 Q1 !0npP\0 tp $ Z S2\ Z h hX0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R;!;xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00^ 0S7 J? dh `Xt ɃXh  r X00R00S*h00h0 0!0bSHD0ODPp( xh 00SW  X: 0h h00c<  H0S Xژ\ 0P \ 0Sz h 0 | 0 x0Se ?x 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,^ 5 T0x#Q7Q8ȟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 Pt0 0t0 1 0cS 01!S7 40!0000@ 0R p'0?0 400t1SW vST `^/d1l wRd!@00@0tpƟ 00 0tpZ1 0cS0Xt0 t^Rp,0 S |,Z0t07^ `(P `2QAQ6S06ót0`6Ɓ||7 1!"4 400| l0 t00| m0%00 |@S;0 0H @` S!@( B"40 0l 0| |00H  0 o` ⦁FY 1 0cS!R 0d0 0 8#8#$(,"8SX3TsTP0OP'(d00d0t00t0  00bS"l0p000l0p0Pp8 Ÿh00S W0 0 h0 0)'1@p0 S   <2P!LAd,T0K$ 8,#,$ 2d.TK 0$, d @pT@KSpK  44 VKRK5K9@dp tp  T @ |1| 8<("4!<d P0 yl.S<h h  Y 0SV \ 04006:Z⣀40 㺦  * ▀t` ,00` Sp 7!2! 1%0 p6pp <e뼯b@7Icc A775F c?7 J5 -LMN? @0A9O?d 1\  Q xQx< 0?0&6 R06 *:$A775 0-LM@PP 0@@ 0@x0 h0ϛd0d\\0 ;Q<0< 0R@C0h,c5c5@c A7A7 cccy)5 -LMx`PV|pV tP6 P # 0 0s 0 0 P p1 00 00@, ; 7l0P:0`0#$##   0 P0(@Q@ 0+ 0 8 "8((<"8 8!("(!0QA"@A"MP` t1S S 0\ 0 00(0S10 0S(0c -L4Mğ`VH , pPD  |t@0HH T L\L aPD W 0Y0@0 Y 00Y Y<(@@ @0 00 00 0 , 8$#,0 $#%,P V2  D2PD DQ("("4 4Y0< Y 2 ,0S |,O`000V0|J@0( C"<0  04(  V$"40 |00V00|H 07 @!@ "4 40ᰁ@@l1$ \1 R;0V|H ( @@ f<0 L 0@L <K L<K (@I(0 0 0@ 0AaPpx 0Y@ Y<  .( 0#2S꼯bI5?7?7c -LMDPPL J,1@0JϠ @70~q`@ `~V@^ ~ 020 0(B)&QN?  P0O/t0|6ڀP ü&h0 `1d1X 00 t1H0H0$! !  s t DPc@7)4q)@7:A7?J_?7 p-LM6pS0| 0@`@P0 <U Sph40 RP f| <at1S  | 8W|( RK0 : 0P!0\ d 5~|,;| (!  /008cbccc5- P y̌ Ƞ,8 0  ( "(4R! ,Ƞ`PKdK(0D@XK0808( 꼯bc:$A77?7 5Fr ?7z) c -@Lɋt0`0p h龋, N? , O?Ɍ LQUP1 Q 0r030r0P0,H0l <^*40  ^:00000c: A7cXA7 p-L M@ㄋt0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LPK` `0 ?08xphK<00<<0 cc A7c7c 0-@L6t0P6 S \0P\ L0,  a R 8 80 ?0Wx0hc A77cMЍ -LM Q`Ppj \ 0S`, @0V0T00SJTD0@ 0 VbP)H)))\))H)X))))))؊)D))) )T8 Y 0,̊00A 0@P0 0Sx000Dh0    iQh0< PW0SF S) Px70T:0 #08000#60 ?0w 0 0010P 0S ,PQP} Pwt0 S0S0S 0S 0S 0SQ0s QvPS  0S 0S P F@0= \P:02 /J 5f0,H0H0S0@ 0 QϠ 0# 0 01  00# 00 B0aR  rE 0 0 0r M0r0h0    0h0    8-꤉U V V { xU 0 Q  0o颻 0oؖc@77E05 -L M`@pPt, 0 S_ UD 0 R R/ ,a  0 0V, V ,J W W *P P 0S0 Rڰ7R'P 0S0 Rt0t000t0 <0W 0 W* 70t0 0 V 6 P p-LM0PS T0S0 P@|P@ p`P Fh0 00t1@000@070p\A7`A7 c 0-6| SL@@Pڲ0 0S KL P@C0@A -LM6@S $)$)$))))06.@T 6S|0@=6P S000 0όu0607c -LM⬒X`, P P0SR9 Q㍯K"!: /tP@/D2(K0S S| K 0P@t 0KMKP@lH1X ( K0SZ SM X W DP @0  @X1,0 S x,x5W @ 0  000 @ 040 X/ ᢺ040 00 0(K 0 S S Wp K`@X , 8 b0>Z S 0 B0 0  0e0e40C0C0'(0S9@sA7?0@0c80 !<\ P!TP 8PtU"\@P P<?!0@?PP@ eiq@Pn k?0S:@P?0S: -Lp M0`,0 @4K  b!@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,]T꼯b545 -LMPp`@0@@T@000` 0@0CT000@-@T`pP*000  000000 !@T:Q0@-P @00 PU@  0 000;p@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q E]p鼯b5  0 00 -LM`, p40 8p 0040 \   R<  8`?` }-<0`O8p+, !0d ֦ @ 00S@T\4,D 0,PM80`<4/S8p84S0 0\>,8 h(0 40,P,` 0 R h00h0 ,p00`P@0,p000 ,0+  < 8`x@< l0y`az800:S 0Sw00<0 \*555 -L,M ^0 4 8 <0 , D 0L P@  ?@0` ܫ@-<0`O+ ,!0d 5 @ 00S@T@0 0 R00044 11(pY& ^ @0400,@K /@P@,0<<< aT00@+P@@  H  0<0dP`DP : 0 0 R h00h0 0D00 @_00 0P00 @d0,3X @_RX00S xx < ,00<00, <0Hࠥ,0 0^`@8<4 /S84S8@ @ R R<@T=_0 ,!@  4S4S0@0|ŸH8 0 0P`E0% /0<0 R20 0 R h04h0 0Ġ /0 0Q00 @ d0, 3X O,0<,00<00, <H-,0 0Q`@00T 0bR/\  L @00@0L  Qxy@,P D\0  0]*$0,0 @001yF@<@=@D_0d ,0!@  4St4Sp:0l00@0 08y0$S05\*555L5p555 -LM  00 $5S% `dp X0P00C 0 @_0 ὤ a0X0賨0 ᱤXY X`K0K "PK0K "P0S `0( 0 i0pS 0!0 Sv@FTŸ 0PZ pW!` 0W `p80 W`0(0Y5 a0S. 0T0S#  p W`d 1X0D00 a d03!OX p80 W`a000Q 0 T0(0Y 00@`K/P @P0H00 x@A 00K/PP0 @D`HW ;<*$B70 R(B7 -L M000 00 Pp 0, S j V@ 0,T@#x V H#0S 0C0Ÿ 0P 0  T 0P@q0p` 0S  0 wqv 0Sh0 0S 0Sh0Po0`0 `w 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S ,P 0S``l0P0S 0Sl0P0s  0S0l0P0ll00Sl0  ,0`@ 0PHvD wH#0S0__@L!*555055@5 -L$M ,;@ @ @_0 ?p`0 0` ?>p`0 4`  8 <0`P L 嚥pL8/">C2"/P!@8H 0BPC4?#@Q< 40C8$尤< L\D ,0  004, `T@,zP@1@#ZD rP@1@0T@WL2H`"S 0 S0< SH3 R5@ PPL2H`"S 0 S0< SH3 RP@W L"00@ S@`PPL#00 SPL/,@0PpL0 PL"‘\00`S04`S ࠡPP PL ‘\00@S04`S ࠡPP  - PL\`@pǤP 1PDt0 0Z¤8 0# T 1P.崤@ `,@ᣤ?` ?VL3"0 S\\L#0 S\8 0…喤`80 -LMPp  P,P ,@`VPUPa 0 P` ,@V,0R`VP 0 PP`,0UPV -L$M P@L`8  T 0cSP 8 \q0 B0C0 R4 0 0 !d0 @0,@K/@LP@,"H`Y<  3S W1 0O 0 T X \@ <0S00 0?`0 000S2@U \8040`WD< 00R 0?`0 000S2 \@\X L!400C40 g!40040T0Xà\녲!0 0 !Y0`00 0! $00C$0@0 80L\ 00C 000, ,,^U tb -LM PL 4 `P0 00V 0 0 !d0 0/,@K@Pk,"Hp0S 3S Q8 00V "0O00V T08 VZ ` !40 S`VV? 0 0P5 ^A0 S0`0 002 ^0$0˅0j$0L 0QO40 00j 0 40Z0C j40!400400,哉$,80S,<80 ,=آ0 8 Z@00 S0`0 00208 ^$0j0˅$0L0O4 00 0 40040,0 ,U tb -L MH@2@Q`0o`T p Pᢢ 0Pq (@80 P(e`@ZD  0l  B  0@L# "00C0\h1Q7 d@Pq, @1 RP20 0/ 0 RI@P]0 ?0` ;00O뀐00C0 0,RT000T00C000 0哢 P%0 0, X000800c@` Z"oP U T -LM0 `Pp 1S0 0 !0d0 0/,@K@#P(,@!H0S 3S /h$% 0WP0SPU 0PG0UC0SPEUP3 Q,@UʼPơ P@ l?>pP1 HX 0   R 0 S\\0 b0O`0 sP#U*( @,0 P80PU,u8`e`0PqU tbl5 -LM PpL@4 `P00 0 0 !d0 @0/,@K@{P, ,儒H Z8  3 S  0S L2 V0O@ @ Z\0!00?0`0S1= 018 a^ Ϡ\0.aA00/ ᏝP  1@R\0/ `ゝPN P1 Z\0`000?0a0`! P`@rp0Z\000/ 0 10  B  0@40L#0 00C Q0 ,0g Z ?   0@L#2 020 0rU tbt5555 -L4@408 `0/0 0 S2@00 @!>408 5^4@`00 0 1X8 048$0[ 0$0PL 0O<b 0 0 0@0P@ H5R40`0@0P08?.a 0S1 bPT  0 44 `RYA4`0  P00,k4 8$0 4@0a$08LÚ0PO 0 0n 040F4    0@L# 000\4Q d@P@J8 3 RPŚ2X 0/ X pR@0!@P50 0` X@'p0004<3 8R  0T0004T00P48 X X0000 0 Wpr` 32@X44`0  P 4d2 R4`0   4040    0@L#<@"000\1QI dP ᒡ@ ?41 8 RP2X 0K XD0 Q6 | ?ၛ PK0OP@K ڛ@p`_ ᖄPK 镖,)k`P@K FP,% _Xp`@_ ,?!ෛD倐D D00040 8R4 0Q4@T00UPŚ48 X X00000 0o(5 585P55U tbT\555 -LM Pp,0 W**0 0 !d0 0,@K/@PP@, ,!H`X4  3S Zx1 0O L14AQ\000?00p S28 3 18X\000 /0100 W 0p5 p0@L#00 "0 Q00 , ? B L0S@ " B "0< o=S0 mmU tb555 -RLM`, p{ @ጝ?Q1 Q`000.,0Ae8崁/.  b  B020!Pp1 @R, `08P/.  b  B020!ϚP5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` nXJm, 0@ n8,0, @/>QU 0B74485L5l55G-M$P0il0h PQ00`  110 @$?p > 1^ࠡD T! 0  S \ pd@H? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1W10l1$5S!0SL\ P3Ѝ -LM P@P 0 ;00 ѝ85 0 00 0 @ R@  PU00\pP@ ၙ` VV V 0 4R@_ 0S:0S:0 @T00 T00SF  Rʰp0(`VP@Pd P@P  0S:0S: 0S @ P00/PbP PsV> 8%0@@0L 0`@V PU 00 /P>P P0<@ (0  P0@ xK P`@ PP 0x0(    Ḟ 0S:<0S9*@5L 0`(0 @ xK 0PP# \ 00/PP 00V<` 0d x0@1X O 0H<˘ 0@P0`|0Kd KPP | 0` B| 1X`t KV A   pd G 00/@K@嫽PPR`G|0H Qa V p0S @00xK  PP6x`` d G 00/PP| d0X3O0 00 H<g0dK@P @PP ?Q00Sa 0 B  оl tKPR0s @0t@K 0 ` T *0 0 /h00T`:Q00 V 0 0 LD 0 jh00dh0   R0qd0G 00/@K@P @`0KH n廾 0 T  1VD@P`K0! 0 @ 00 xK PPz x`\` @00/PP徿 d03XO0 0 P0`@K!a "LoI0<H嗗0@P긾 \>  @00/@K@叼PP60 0)P00/{ d0X3O 0 ]@ 00xK  wPPx`Xt` 00/PPZ d0X3O pK H<F0@PŽPP` 01X` X0 0  (0 &xK00 @  @PPXP ͜@@000x1( P U  刽 S>00K L0 R-PK ?@K 00 KKK K0P00@Z0S:0Q Rii#d55- M Ѝ -LM`< Tp$ 80  000    0 08 00R00S 0K  0 R 0V 000O 0 R V0D  0 R 0W( 000O 0 R} W0  @ \0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RG `p 00 0 0$@x `0d CB_00 4@K@5P@@0Qix40 H ㆚8P < T0$ @ 4߼4勼4*,5Sʰ0 70W0   W 0000qV0]V 0000NT5 -LNKgMTQ`U@|a &8 0BRS p 0S XQ0S R PP >K ᝙p`,0<4 DP 0 pSlq  0~K0``T\OX!QKlQTa45S:05XqS*NK P aS?K P0` 0PP 0 R 0^K000nK O )q L000  0La0K0K 0lX850p1  0 R 0~K0l^K000P `PH~K@ 00@.K@`Klq8Kt 0KPSo`t0尀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Skt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pհ000  0PRoK p 0S㰀1( ? 0p0 0 S0p (0P UP@K p 0S㰀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0  XK@ 0 l`PtS/ PKt0 p0QO0@H K㰀t 0S t.Ka00h1dA0e@K0 RXtQt Z\!@ 0T PQ 0SG 1p0.Kh1dA0PE\0O T`S\Q5 0S `a.K1p0h1dA0( \QUlQ0 0S ^K000\aVAlQ0QT @aT pհlq^KT0`Q3/nK 0*| p尀Č| 0S ^K000 0 R |qg /0 00| 0) |ah00fh0K0`q WNKlP d p 0 S# 0S:0S*la LS>R-`0 .K a0000Q가 0S:0 K0x`a VkNKlP " 0S" 0S:[0SX*la LS>R-`0 .K a00E00Q> 0S:0 6`!^K1( 0O' 0S!0(0 1p0p` U pl P01R/1 0S:0S :l0@>K 0S|a pdఀ|a lKS>0 lAL R-NK ?  K00@가 0S:0 1( >K`aSlQ~Kd 錘@FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l!NK00 |Qx p尀 P|Q b0t 1X t^K1X a0OOXqW0K0 ta0R00X0  p尀0^K000=l>KP 鍖@@A NKPp` S?K 0P0 PP 0 RX 0^K000Wl0@ 80S L1pqHg@L1<@ L弸LD VlP ܗ p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@가 0S:0 0.K00.K0MT 0( S/& 0S :0S:(0Sh0S 0S 0(pS  C 0 R 0 0f00` 0S:0 0TaS鰀Xq0S0TSd#d 5 -L4M0 L P 4 80 \P@ D t0@D@TD 8Y Dh0 0@p40/0DH@ < 00 m3 ,00,0<0 <80&Q0 <0OX d<bPP8 <0rH/ 0@ TT Tl#T80BPPV`Q@ 00 V<0 H@奕t0@T !t0@TT0$ @<嬷PPP @t D0@B4 T0cpa@DVVD Tp8QPD֓aV1@P( L2L"@P@dVDFA 02 S`1b1 R0@ @ @00VL  P@<00:00d 0,KC" 00%L,0PPPP L  0R0d ",K P0P0LP0 ,0PL LH00 /0L <嬷v  @ V @TG T  TB  T? T Tp  T8h  T5TX T0P T-<坷`0hc#d\bPbTbDbb-0ȟ00` 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ0B744800CS4]*\]* ]*]* ]* ]* ]* ]*0S0 #Q00 #LQ0 R0S800CS]*^*]*,^*]*]*]*]*000 10B0  2 R0  00800CS^*^*^*^*^*^*^*^*000 10B0  2 R0  00800CS<_*T_*(_*t_*(_*(_*(_*(_*0S1 S20#B1  0S 00 -LbD5 -h1LM`Q`!00pP@<10 Q ? 0` Kp O4 `KP05S`KX R 0 0 $0005<<  \07PP L_H\,X ,HEL|{^OPlv^PH\009004h Rh 4 xܯbhdL4T5P55E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎G-HMO<@C@C80@?K4,$@( @@\ 0Q: `$ ?(Pp 0O/ 0 @? 0O@<0o 8@Ǐ 4ɯ`0 ,0 (0  $@ 0 =0 5\#HЍT-80\%R0$Ğ4 0T -L M$0Qp `< =P@ҍ X 00#002 PP@р HY|  0 0Q S@LA>;$0ԑ:$0  -$0L Ppԁ  P@`@0 S@`V P@P D 0 0 @ M -LM, \0d Po740@ 8@_<@_,!`, ,0T0C0,Ě,0YZ  ,0Z ,BMl ,D  ?[T5 p-LM80@SP0 0l0S  @`V p  0D0S0  -LMq@@ -RP` =S=T8 K8 4P , 0@  8` $0 #=0T00S<K /<0P`ST    00S  ` @ =SP`^\ [y*t55 -LM4 Q8  8 `V4,0K`ß 剿@TTp0"h0 P,0p,002 0P@ ,?T `ᭊ0 0 0$@x堊`0d CB_00 0@K@̬P@ ,0ޮ8  wT@xp00 H 0Ȯ0xt1 4,0KP@A 0S@@l0P0S 0S1 {P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʰ 0p00t0 0S0l0P0Il,80080`|cc$5TB7ccxcT@-@1T0, T:F@ 0000 0S00l0P00 -LM, p0 40@4 QL+- 808 0 S408 h0`,Pd ଌ 0 PH Z0 RI 80 X4`V,dT ? l,4` h0``ڮ `0COPHh 3L5HsP5,5S,pS.>,30pW ­434P4 SHŐ 021HX 40P040 tb p-L Mp@P0Td``  pH@`VR< 80`@MRZph _'7c55c@-QM@ 00CS ꬂ*܂*** P0 Ѝ@x,-@Ѝ $  D7D7(B7$B7 -L4M0 8 04 H0 <  45R805 R8 P 08D0 ,0 \} 4H0 L L 0S404000@TPU}<0H P0 P0 T <885 0p T`b V `!@  ? SR`P 嘋L  0SP 0S 0S4 $0 S$05 ,@K0 0@֪D DQ&4 $0,@0pcWW `H@08 &PD ,լD8, 0SP4 D000Ŭ,0S,K0 0 0S0 T~ -L\M0 08  4 00PL 0UT0 p4@80S S _XT8l  8 0l R0000  0Sx6d p6X 0S 0lS00S 0 Sl@ 0< S&4%R :05S:848 0P0R00S T 0l@0 S:0S*9" X 0S@ 0@ K0T0`0\0 0^P0 <l@P 8850  lX!RH PP0@P P 0Pl,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000薈L 4n, Z` @0P`<  P0  #Q 0S:0S:<@00e`HHX8 %P`\0S<@H0 0Sf ,JX00V0S8P0008PUlXP00S 0S 0 R? 0;080PX@T4y LZV T0@0K@\0@8@l X b0P@88X0P\Q  0` 0;08 P1 R 0, $R0000 ,,倪,0H Hr< S>0LR-pK`@K ? pK0 0@ @`K eI 0S:0> ?l  0S:0 0@K0 SR8  l ~TK 800l0 v5D75 -LMp80S 0S @I`lP@ 00300@TlP@ 0 1P0S+ U@Xl 0S!0I ]PIl0`S YI I 0S00 00@ X T0S 0S x0S 00 00SP00300ᇦ003000HYDHlP` 0SᯩP  |00Sz $0w s V5 c 5 p-LMP`P@0$SP@pPcc -LM@h -L M@^ 0    Q -LLMTph h@` l T`@Pd   h04吅@l TXKU\PK  0P@\\ Q d@ 0(SE 0 1p0Q` 0S` 0S p WlXd  ,0 @PR 1h0 0S 1p p0R0S@00 1( ?R 1$ 0 1( 0 R 0 1000LS\0 @ 0`y V8 Z h00h40/ @00 J  H\`1@_000V00S Q dp$0W * l0^1 ,1 S 0FS\0 Z /d0( 嶇@` 00dp$ W*l SH,!0 0Q d( ᕇ00X 600 l0 ,00,0ګP@ / ᬩP0 1X@_n#d -LM00 T0, 01P<0 00 \b0 \8 D0 Dp@ L@  ɯRe <$0@' "p X Q@  g B@ 80SG@0l0`  c4 @ ,0bR 0 4 0 D0 , .@ 40 @ 8 S% <0D $@ PD 0 ခp0  y0 0OW@ Rc",0'&4 Pe P 04P ,0 00SD8@ 0`0l0bc4  -,0 L 0"0 0 7ccc-X0X  00P0\ P0^Pcc -0LMxxpP@`0 0P 0T P0U  ᝹P #dcc -hp@L `P 0 0!R 0U R00 R 0@@0V cc0S R00  -LMP@`Q 0SN 0S 0S0 'Q 0Sݺ 0T $0pP! 0 00 0 R0(p 0 p00 00000  0S 0-PL@٬ 0P0錹 -LLM p\ 0&l  ` d  ,0 h \ 00X0 P8 T 0: S 0@` 2P@lp  T0$  00CS\ WP@d 0RR<0 4 D0 @0 pQ 0 004 D0 Td0S1 4A^ / 0S 0Sc0S_`H ` 0SL 0@; DP \ 0\ @,P=,0K /00P@|`40S;;S48 @ ,0H @0S 2 R 4 R P  T0( R00000cCQD0Q 8 < 4 P T0( 0R  R 0L0 0L00 PRP ` \ 0HQ0㐠AH 0,Pid RRp0S 0S0d#70P00S\  0` KP@+4P+ 0C R    0@$;D0P 0P ?0/;?00 T0+S  Th 060dQ 8 <P0QP 8 ;;S 8L@0a0D7$5<5 cPi H0 S04 0000T (0 S000000 0S 0 S:0 S* c 0 RT0T0((    Q00Ŕ0000@000,嬥ld70Q00S0?00d R X d0R0P00S pQ\l ,0S# T0 K0P@ T R p0Sh 06000\00 V\  N\h 00 K60T0P@TQ p R h P0@6 0Zh P0600` 6P@0S T0 K0P@ T \0R0  0;0h 06p0Sm 0`  P@ ;;SL0`00S6 T0 K0P@ 0 ' `0^# 0Sp00^ 0 0 R00p  R T\P Th A0600ᨶ\ 0 S:0 40S#@08 0r@0 @ D08 R08  00b4 <0  KP x%/; ;L@DK 0 `@~P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPP'P@@T0( R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @PN@..5- -LM@ KP 0 0 0-@DP L@ŷP00 4 0 0 -( L0S 00*_ 0-LMP@ KP  0S 0Sl0P0S F0000 0- D0@L PP0s0`,7 p-LMP0 @B 0  P 0s 000Hp @_ 0S0( 0p0080@8@_@p`,70 0S00D d< X R  0S 000 p-L M0@ `Rp K0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 tb -LM`P@2 80S*********T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0垶  -LMp0P$K`,0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KKtb -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R  P R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0$ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0$ C  0S00p  P . P \0  0P(q00000(s00 000Pq T0$   0Bu  00sT0$  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+b -@P 0` R00p  LQp  P,Q 80S  % 0 R00tw P   0!:0 000000<  0  z O -L M`q@p  w 0 Sp00R ^ PP   0St 0, ,0  0, S 0pShZR0 PP  00   0 R00tpp 0 R00p@@PP00 0PP( PPPa,0SZ000Z 0S 0;0, R 0S 0;00 0 0 R0, 0, t   0 R00pwP J00 o og 0Sp00Tc 0St00We  P^W 0StppK 0Sp@@AH5E p-LM080S 0 R00 d X R  0 R00 d X R `T p 0  0u` ,t ' -$"LEM0`,0 8 Rpy T T0RpW  HPcP1 RW 0Sd X 10S W  ᮮT1 ,0S H,+000000000 0P 0 0C000C0000+Cv w MOK A 0WP }꼯b5 c -TLMM`0 P,0  0H1 HQ9 H1L 0RD0R `GDH!0SH L 0S L10   R 0S 0R H!  0SH1  p00S@( HPL7YD!000@!8PD0 0C0 RD  00C0D!000080: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u ᛬KPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp ? 0 Pݪ ۪2 ,0S ,'0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000%uT1H u 0Pp3T@PpMOK 0TP 0EpW y  P10>o0 0C000C00000000P:T  0S00t00t07꼯b c5D7D7 -LMPp@` Vv |0S 00S Bu E gP 0 R00D!d*55 -L0M0 `P0Sp: : S@ (@@m 0P@' T0 Pp0@Q !R"j0 0S00505 0d0 L D>(@0ˆ >=*ctb05@55$5 0-FLPRm\ ,0Sq 0 S R 00 -LMP @ 00Q ^ 0RP 0SZ(@m 0" -LMPp  P,P F`VPUPa 0 P` FV,0l`VP 0 PP`6UPV -L M P,r0`P 0ƕ6 ,@K@P,60 R, $@,0iHlP`VC il1 S2`@ P7 il!0bR0S) PP0S P  VP@ 0# 0,0C 004 0C0,m$0"A  -LM `,劂PBP00  0Ɩ6 ,@K@倎PZ,0UH(@ (@-l0 S2P  e?> Aq hP- 0lQ0  PP=9<020 , B 00*  R0C 0,& 101,(0Z"p @hP;  $T= ,:t5@5h55 -L M Pp``$k0V: 6= , 6 $@K@P$0$`H@k`0 S2  0,0 00D 00$垏$; <;5P5\55 -L M P`A \00\0SE(yk,6倢0 0 6,@K@复0S-,0(H`TkAp Q ;  ' 0,&0 00 00 Q,& 10C1X0,B<< R,剏; T; R;555 -RLp`$P@ $P`kA0Qd gP 0l1 P0PmK0\ Pd l1ğS t@t Pl1 xU:h!1!@Pq&@dDFA 02 Sp;1b1 R0``00`Y&0@{h!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,0 0$t  l 0t!p! i `^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5꼯b\bPbTbDb5bKWP@`Q0 0R@`pd0S0@ 0Pp@d ` p/a0V`0MKS >K>Kp @Pl!ad0P0@00S h0`P/VUh1 0e@ J H F D B @ > A?(K <꼯b555 -L M@0K RK/P 0u000Kb0K/P)000`000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S++++,+++,+++,+++,+++,+ ,+00$*0000000000 0  -L+5 -L$M|0R 0<0 0p ƒP@ ґP3 W 0P@$00@0  0[P@0 KT0ȭ4K ;4@ 8@ J{P@40@HOP@ VV/8 U c8c.U408 H+Z4@}804@ @`<8 \ 3S X2# C 0 c@X[\0EOa.6 0Ɔ& 6V@X3@($6 FX( S 6PU,6 S 4K/zP@*&4,0H1Z4|4@ 6PU8 0< L $ *<0P(0$ 80<p68#1$0&0,0( |0,4P O@ 0R ᧬ (80S 801 |ܯbhd -LMp=P@+Q<` R% 80 S|00< Q0f@凎,TQN$0 :$0!P303 -PL aP@L p ԩ0 0 ֬@ 孭 -1Ld1#pR@R(6L 0R&H d0E PU0S: RP6SS!/ Sa, RPQ0S6 0&U  0`0f 0 , 0T c 00   TZ +YZ 'Y D RTPQP'S5 0-80LS@P0 0l0S 0S  J0S 00  N0P0č -LMq̠PܐY@8 K`'8` 00 , 4P U 8` #  0'0S `T 0S80 0 -P`(='I+tbt55 -LM4 ԁ@8  ,8 Z4,0K Ÿ 孋PUxp ` S0hP"PA,0 `,0 0pP p@ +PP ,cU (PD V,F0 BV$V66 0@K@xPP ,$0{80  $ V00 H@<C  @X0z! '0807!( 0S-0 ,0K4`PP ,80 0弌d0S,0 0S005050d0,T0$ 0008 PP e(cc$5\c,c$cctb p-LM`0\0 \@@TP (0&\Fp0  KP @p00 R Qd 0R 0F0pp 0000 d00- -LMpP ;pp@8{`+HWU 4zyp -L MP, 6Y pƕ ^0`/0 {&,@0HmW,0S z 6pV0Y0X00S ly -0#LRL R0SR T0 S5S L '`0 Qd0 S55- 0`,7 p-LMPt0!` 0 wP@ 000Hq0(ы08@@p`,70   0 0S  -LM      ُ -L Mp0P(K`m0\ 00 (00\ (0\0@0 H!0 0000@ 0:#:0 10 00 (0H00 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST04 $  L0T@$K48 8$0tb -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0$  0R yPM 000 0D0 100 0 0000D Q 0 0  qk T0$ T 0P"0sX 80SS PSI 0pUP(q; T0$ 5 0R .P \0 0ᓨP (q T0$  00000(s00 000Pq T0$  000sT0$  S0s0s -@P0 LRp` P$ R 80S   P    0:0000   <0 0   TO -Pq@p@`0  v`SL P  QR0`00R@ 0S 0;0Q 0S 0;0TV VP -@L80SpP` 0 00   U ډ؉ Pp0! B! -P p80LS`P T T0RGV  /P:@1!R/ 00' !000 0P 0! B!8V  ቉ P ᠨᛨᖨᒨ፨ c -L\MP@H D `T T0RpX \ `  oH0T FHP d [DY9S \ T0R0 0"0   P X 坤PD L 0T0 8!R 00T0 0 0d0  X i0: S H0 T P S0LP0 0L! !L L0 0Ph 0 DͦhX D|p -LM @p0`0i(0K (PPQ(0@ 00041`!( 80 ! 0 , 0EPP }PP 0  &(00 000( 8( iP P 0;0 ,7 c -LM @Q 0S00 h 0-PL@:x 0P 0,S u0q\cc -LM@JhN -L 0!&R0d5 -LM@! 00CS hON5 p-LM@ !VU`"S  Px P 0ap 0!R  0! Q0 00 5@5`5 -L 0!Qh 1S 01 0@^ 1 ! 10@0x55 -P@0L` 00Rp 0V  Rr   0h -L@L\p`P \ RU 0V  Rr U  0h000h` 0-8PML@,, ,0Pr0hF0c5'7 -LM! P@  !I$ $0S$00(@( c -LM@bbb} bPphKs0c -LM$0  CLPH0"v!& `Q 0Ss0s0S Pp W a\0!011 ` g0Y  : 0 Ss, , 0 Ab b b Y00X0S@0 bP` 0 40 , @! @dmN0 <0 !< eN A@ aI 8 !8 WN  @TI0  R !0HN 00@ DI 0W aP0000 !0011,  ` 4b8b<bXxb g0 X bY bZ b Ab P0 l b0 0f -LML`$ 0C#6PH SpP@ 01@ST0S @ T0!@R00R0S TH0!P  0-0@L#$PQ(0(0( 0P0!P!R 0SC Q 0U0000h05 -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH _PL 40040 $  z$ 0S $ 0C#v$P@ LP0SK \ H0 0! ! !R/\  l!/H00CS0 0Ss40 040H L@0S$0 $0(0@($0  CH"&0000000 0 ! 00040040  B ic -LMLZ?0 1,0 Q@TO 0S04\-(0`4 pW0  ```b2\W  0 /00C0 ,0q0!!00( A ( !! .ZWX80!!( 0 ( !! 0 555 p-LM"V@``  00b0eS 0S 000  p 5D5 -LM@b ^P  !UG0 R01 0 0 -L@ MT, p PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!11P000 l55 -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@`F -T1L\M@pT`P9 TK0K K(00@ ,0 ( $0S\0 $ \0K((0$0\X0 $ ^ 1!0SV ^0\Q,0@(0,0\QX0(0U00P00X S000 0RP0 Plc -R00LM@po@PAU0# Aa0 b0  @0S b0 0S0 b P0b bZ00c 0-HPML@<< 0P7$0/"A0hc5'7Tc -L P00 c 0-@LTP 40S%T 0S 40 0C 40l0h(0 0  !(  ( !01@c -LM0@SA0 S p00Cp0Tc-\ 4^ 0S(0 0!!( 0&( !! N4  p-LMP PP` P p@A`0  !( ( !qM+ -(0AL0$1@TPop 0S @TP \a0@S000@`p@ D0Sc p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 4 >c55 -LM @R)(0 Z$$ aV p@P0S@PUZ0` V$ Zc+|o@p00Cp0@T  P@ (08 ,=0  !!( 0 (  !!- 8IP8012$5,5 p-LM@`P 0!6V00]-0  @T  p - LKPh= -d0L@pT` W PU,0@RTM_ -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@P0  S =0 , !( I(, !?'0 000__ -LMtŸŒ p, WP@` L2W D2W UV   ,0p} @ PjVqPU 0ZV PUQ@ R0`0D PU 0Z PU1 00PP 0PP0HS 0  0$0`$U $1$!@Pd@dDFA 02 S1b1 R0``00`L(`U  0 00 000004 0(\_,+$T+$_bG7PbTbDb85000 -L`\ 04  R$0$0$0  !0 @P@dDFA 02 Sph1b1 R0``00`hH20L0D5PbTbDbM0Ѝ -LMp4, 00 (Z,00 p14  b2 0 `P<0 0 ^8 p0#20# W00 S @:0Pp`WZ a04, 08|  < p& 08 0 dP Z >04o04 Z /(\_P5 0-LMPC P0 4 U 0 00h@ {40 U 0 40~\5 -L℃M000 0R`00 X3 <01001P@0T,0 40ST (0! !!(0 0(0!!000 Ru V ",0Vp 0儢00   0R0p00 p,0S (0L0!!( 0C ( !!( ,00S}%W V  0Hc P000 v :00t*W V e W V W000V J ,  0(P@ 0V,0  3000 :0 nV %0H00V/c @>0 <41041.Tc#dh5t55 -LLMD R * < @ 0   DKP 0@8P0SD0Q  S 40R0 0  (0S  8DKX000( L Q00RP b0SYP @ $0  0l ` #6P`1`!0CS00Lp Q   0Ka0  H 00@P 0V0R00S0 P PUPP U R 0 0,0cp @_0 P0Q  0! 0 fp XP@ĐKT D0 KiP0 1@ TZ0(^00S  0S 0(R00S0 8 0@000̠ ,00 @0K40 b 000P0@ ĐK 0 0 0 S  \ @P`1sS@ TZD0bX aDK PP P04 0R0 p 0p  0S W 0SEl000 0R0  D08 0 Œ@0P 8p h0R  - P #8D0 "0  ! (( !T@101P` 0' RVV8qV 8p h0R000 000#0  ! (A( !0@ 0 cH0{00C0x 0&P : #S@P 400C400P0 !( 0&(  !#`0!!0( &( !! , !(0 A0(0!!#8E U P`  ` 004 ``@Tg 6 <01001V&1010 40 000 40S  jD00 8 Œ@0P (00  ! (C( !8p h0R|#Q "(00  ! (C( !8D0! (0 0  ! ((, ! !6 (0 0```%P 6 "@0!!0( H ( !![(00!!( 0 ( !! 00 &0 & V (00  !( ( !!8 # 000H +P` @| 0@@~% Q00V@@T+ | (0! !0 , !( (, !8V[ 2Bp h0RU 000 ;p 10 1 !101!0 (00  !( ( !@ ~!0@ 0 cH0 0 <410418p 0000 ,00 P0K0@0@4 0lp000P0 0 0K PP PN, 0(DHG7555#d5555 bTc 8000 840 4S000 #0@( 40PS(T;(0(0  0 00 $ 0 , !( (, ! {0@ 0HcP T@8T0  x0 00040 D08 0Q 000 !( 0 (  !@0ĐK p 0DK PP*^ 1S0ST01O aP 40S(0! D0@| "000D0 00DR\8 00@T (040S00S`@ p8X8SY Q-Lp@`: 01PPJT: T    -pL@P` h" -LM` KP@3 P3 T *$pK -PJT: $0T: $0T*D0S d$0#&R :0R *0a !b(0 P ad d5 -LM0 P 0 pWP @`4  P 0$  cR 540 W(@ 0 @4  00U W 0  P 0  P000 X4 -P`p@N@RN^``LP@D 0@aG7- ^$  0>0>0 S  $ -L MRP`0>0Sp1x#  n0X< `80  40,K<  P8   W00 P00S 0~p Wz3XP8@e,T@!  8 Pd0` @000 0 9P0000,d0 00K H0 0P8 R 0 pG74 -LM1` 0 Pop@  |@0s `@^ K0 n @`P `@@dP0p> _c%d'G745 -LM>\0ǠȠŇ@`P'0 ` p P`:P000U 0 0 (00 05P(  PP d555 -P`LMY'p  \P@ (0%Ơ  0!!( 0 ( !!@:P`YXF"X -PLM`@ * pKt IPdJT: 0 #Q:b 0QQc05$ 50P " %dd5 -.L$M 80 0 8 0(0K#̌4 @# 40`P `@@PZ8` ,4\T \1,0  bp 0^`/ P  04j @T( 0!!( 0 ( !!40 S0 08 @:pj,0 0Vx,8H8 \0 h p0S &,0 0M,pG75%dTc 0.  0; -L M0@p` P000 n0 P0000 . .$0K PP 0 $P 4 -L$M0|(K!Ÿ@00 P0 p`@ PPl1, X004  c`p P |P@0 ! (0 V 0!!( 0 ( !!4!0Xe00S,,4` `4|@@@@T 0!!( 0 ( !!8 044@:ʌ`4 pH\0@0< Q %,4p  a0u9c'G7$505#d<5 p-LM΁T0|0K! 0@`P `@7Ppc' -LMPN4A@Tp`0l,K, T|0   \ 0,f0c'`50 -L`@PT@@0p*<@v p-LM@Pm`*phd -`L0S 0 !,B$ R; 00S000@T `p`P 00@0 T0,  S(<@0h{(cp_G7,c0c+0 & +l5 -LM⼀弐张p@T 0R 0@ 0TP`P @TPPU  0P000S N0c(c,cG7x5 -LMPt`tp@0Td \U D 0S)0 0C 0,c0c5(c -LM@  0@00h,c0c -LM`pTP0 S@00  0d@b 0-@PL0p4 0x P(,hPlPP r|PtP05 -LM@p`0 P000| 10 UP000(0K 0 (PS4p00p0 -p 0 BRL`p 04 0 @P$@dDFA 02b SpD 0 S0``00`h vPbTbDb -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P 0Z0PS 0h0 p-LMP@ `0QV php p-LM00PU* `P`@T P10P1`0T0pP  X0,P0 0tt? @P `pX0 P L@TP80@$4Q_cTcPaG75G7Lcc5 -LM@T0<<h((`  P1`@0CP1hcLccTc0T d4 $ 0D0 >-$0  CHL0"& -$0  CHL0"&  -HH!LM@  R0ԑ00đ00 R010201000bTcG7NN -L$M0 0 4 S@P` 0QT, KpP`>,0 $@0\A $0 S:2\7*Z`!>20K0  0 @DP $00 >2Q2^:40`, R ,00C,0,(0,Z ``0K  0 0,0 @p` -L$M`4 :#:S$@>0. Q< "&0@ PD  H )0 KeP 0D0 8 0@PL@  1 0<S-*$<0Q*0 S^ 0S[$04 <S1$ (0 $Q0V)0K*)K jVp:00L00 S  0<S:H 4@ DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )KjpV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::K q   `PS8 6 $0 0&P 0SR  R ,0( 0C,0  ,  0 ` 0`K ?P000$儎P r ,0 0R,0 $ 80SS SPT P: QS@@S. 0   000  : 0K 0 tPH 10S     0@ |0 ̸P80 J,0( 0C,0 : M,W VʥU]  R  /$0R+* A & -LM`P @75 0S2 *S"*`R 0T)@PbT >0N@T 0UT$p  00 V X( KP(0 $ @D PqX -LM` P  0RL ``R >0. RB 0V?X<:SV8:$@0p P000 >0 bP0000 0P (0K 0 (PX☩0 ␩4 -LM0S *"*R 0Q bQ >0Q 0\ $ 0@-@ *"*R  P b.P  P \ $@ -L *"*R 0Q& bQ >0Q 0\^ l+,l+,l+,+,+,+,+, 0 $$ 0 f$ 0 0-LM*"*R 0\.@b\ >0\$ 0T!0 H,&R$P 4d 6R:`0S*#0  0P 00Tc -LM ʠ,ʠ\ 0R lR >0. R 0^ $ 0P  -0LS    $0` P P #  -L $ -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < YP@<R0Q6 `0 @000d"0 ǧP000@, $2 H)&R R 46S  @ ,  03,0 0P@,\ 0 80S 0 @ T 0 < <\ Trp 80S   |0@ 0 P 4 00 T|0 0 ~, :#:S 0*4Tc31 -p| '6JX0@@P`LA"@HVT 0 S @T 0S0Sc@-00S@(0 A R0  10  0  !( ( !@00C0(0 " R 0 000 0 !( ((  !  B 00 000000 R  0Tcccc-00x0CSp00000 000   !!(0 7(0 !! 00C 0cTc 0-(0LP R0  10  0  !( ( !00C0(0(.00  @ PP0!!( 0(( !!` 000d(0 D0 0!!( 0 ( !!0cTccc-(0 H R $1@ 000 0  !( ( !00C000S(0 R0000 0 00  00  !( ( !44000 R  0cTccc@-0 .!( (@.!@*0@-0 @@$!( (P@@$!0@^880 #Q:0 Q: 10b1d -LM , 0 "X00 ZY"0@0ŸT0T0\ XP ^ hY0  a0D"6!@AdA4  8 40YDQ< <0 b40Zj801cT0@8 04j Xf4 "*p@0&08`  0>00 00>0 0 0P  P00( ,0d 0 @\00`T@004PXL@L  00 0 c84:ccG7Pa$5d5PaTcPacG7P5|5 -PL R: 00B 0 0 P Tc5 -LM,a> 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $T:Ũ|SPh5*DD@@0>0>0 0G7PaPa5Hc%d5 5 -LM␢0^@xRxŸ00ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UT` 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0UG7cd<5h5 -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0XT 0@P<0 4m(Tc55G7dd5 5H5|55 -2L M0Z ! 0CZ pWpWaT1Ό 00 PPP00 T Z !0Z0"0G Z, PPX0Tp3qPU,  Q 0 0 00   #&X:P !0 0X P01 P#&:XP P!UDF Z,<0X ,00 o!opG7dcG7Pa5 - LM a0\ , 0` @,pP 000 pG8 00\,>(<$0$To7G75d05T5`5ch5 -L Mp,0 `@US0  <0R4 @0R D0RPZ 0s , 0 Q00S(0QP 22< Q 2 Q 0% T T 0!` V `Q00000  B (0 $00C$0Y (0 00 004 04 00,,0 0I^(,0$ `0  !( ( !Y 0  !( ( !4^IZ '&:X PP00P%,HF  0`,0 0 000`  !( ( !0001` VtTY<1`V ka VgM4Tcc#dcc5 -LMp\`P7X4 , 0` , %&:X PP00P%FF``  0py ` 000p  !( ( !000 #&:X P00$R R 0 0 00 0  G R0 00 0 0  !( ( !00C0, 0 0, c -LM(0P4` V 0  !( ( ! | #:X P $ R 0 0 00 0   R0 00 0 0  !( ( !V00C0, 0 0, (0 b R0 20  0  !( ( !4b00C0(0 h R  2` 000 0 !( ((  !  B 00@S 0  00C 0 R000!!( 0,( !!H00p000PP0!!( 0(( !! , !(0 8(0!!0$ 0R00 4 i R p0V @T 0  !( ( !WcTcccG7c -pWL `At00TPPU pW(0&  0S 0$0!!( 0 ( !!0!!( 0 ( !!=(0 -dadqL$0 PS040L@T014@G R0000 0   B -P# 0  !!( 0,(  !!x0 0S0@@@ 0$ 0 0$ h`0 R `00S0@@@P 0 00 hPTccb -LM KHgD0 #Q :b 0Qc*0 %dd p-L MP`@ 5@@@qt0l l0@@mX0X ET`@@1@0STpcG7(d d,dPaPaH7 -L$Mp0 0 4 00 P$,P Ǡ,K 0 PP\`0 ܠ @< T 0  ο\x0  , X,@ 0P4D 04 8 00PќjVJ0,(d5PaPa#dc5,d -4!LM0pP? @0` P000 剿0 㭞P0000 (0K@@ 0S|0  t ᩞ(PX̢ޞ@(0@@(@ Pa(d4,d%dPa -L4MD0 0H0 8K@ < P @00K@,0S00S*0K40 S80S0K0K0KP KPK 0S@pǏDf#VZU@D 0 0HPK0S@#&:@ D@A H1Y:`P Kp@YW,0S00SY< PP (0   0S) 0!!( 0 ( !!(0 0!!( 0 ( !!ˠY0P(QPK0`0p0D0 0!!( 0 ( !!40Sʪ80S -LM@p 0PP`  0S0P0hV^ 0PP@> U00R0S 0̠ W0U0V00S (0T 0 TV U0P0UA  V z 0!6 +P0 U00R0S  0 0  0 0 -LMp0PU`% \ \ XJ (0C(0   0  !( ( !10PU0  $@0!!( 0C ( !! 0 !( 0 (  ! %(0  0   0!6 000 `0 0$A0 0 0\,c -LM800Cf!  , b p 4Y00P#:0#USHPU@0Y0 0 0!!( 0 ( !!PUGZ 00 dP,JN(0 @ Y00 S gW0 !( 0 (  !0 !( 0@ (  !HPU c$P,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^, -L`XPX0< pQH@ 8A 0,嵼hw0 Ac#d5dc7pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0TcVUUU p-0LM 0`P< `@ 0s1 0V1`0 t @ ?CSD00D SD0\ ,00R0S׽#dcTc5cVUUUdc -ܐLMp l0`S' PS00aU 008 0B6C0@V``OTP,0X@墽`0坽 $J 0cTcdccp5 -LM pW     K W̠  pVl6@0@0S  \  R  Q 1 pW V 10 1 D0u(6 RcS 400C40   !!(0 6(0 !!(01001 PpURP%$10$1( ,şp00p0 1R0100T0@ 0S h p0S  4l h0R 0  !!( 0 (  !!\Tኝ0X00 \ P0S P0KU q 00 PPP X W \0KQ0  @|SX41 `041P0P@ 0 K0KPXPP`P Q Wp  (0H@0!!( 0 ( !!(  R 00M'  RM (0J@ F0K$ V  V+(0!!( 0 ( !!^08! W8!  (0  0a } th0K @0 u 0@0!6 X K P 0  !!( 0 (  !!@@ 7  . 0 !6?' 0P  0!60(0@@(a  D@01001,P(10(1N,10,1Tc -RLM101C@C@0T1A d0Sh5P1d0S@D 0 ^c@dlh0Pk 2@T YX `(  Z @ YX0S400C40 !!(0 6(0!!( pY 0P& X<1H0<1 0!6 P 60!!( 0 ( !!I& p0!!( 0 ( !!( Ip T00R00 S n8x,Pti101]Tcccc -LM @00 8 밡4 ( 0 S< * TP'*0%Q :c 01cQq*`, @(0Z U:<Q0 < R@0RD 0S4Y<0S<0(0#40 0Q!0000 00C0(  $00C$00(000008, Q 8 , 0 0000 @@8 < Tcdcc -`LM Vj3PP >0^P%&@< m 0<S V# R 0SS:눒0 ( 0Sa 8 4 { PxL$&R:0Ra03, 5:| 0 &R:0R03:0 S @,< 10lp1Q01c1(  P8 0*R0#  R 8 Q, Q\ , 1`@AdAP(0#40!Q0!0000 00C0(  $00C$0, 0 (0```, 00 P,0P0S ,0 4 0 < R@0RD 0S<0a4 0Tcdcc -LL@T> aqPQ0000 0!!( 0(( !! , !(0 8(0!!00000@0$ 0R@0$0 4 @T mcTcG7 -@0LM@T 0( T  @ H75 p-LB MLP@  , `  0`\TP`PXL `0`0<La`Pa 0`xp\` 0`8$ a`($a! 1`<0!,148!t0dx |0htld0d|pTc55<5x5555X5555 5\5555(5P555c5 0- LM0PS0P 0PdP0AP!\0PPPx@Tp 0@ \ P|P L0 Pt0hN0Lb cPaTcn_5 5Pa0d(505d85 -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @P@dDFA 02 ST1b1 R000 \;PaTcPbTbDb@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0PaTc -X0LM\  0R \ @ TT000@Pa p-d0ML` @P0 K@ @P0,d(4pPa\5-X0^ P ($\,40\DP ^Pa -EMLPM0,0 |$ p0S S ?P@,P `V FK@0D @P4 L$ p t H ;P@dd00C@S񟗕z, |,|,|,\|,|,tz,80S|0# @A3 ,0S ,孾p,PP@ @ \D归 P\㸒 #00@d80S|00 0080S+  x\ 垒BK@$@0PP@ 80S \\ڜ@0 PP@ 0 K@\ paPP@  RTy @uB~KpGpGG>K0C+DP@E iT1` }@P@`0SHBKAG>KA0C+P< 1` Y( PU! WpG 4 O#J6; 0P@An3$P`@+DTU WpG Y|@<0@d |4 꼯bH7_l5x5ܯb455PaTc -L|Mܒ@0XpP 0 0g^P@80S S @0X 00 e^%$ H2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !0P C@\0PP@D 0R20X @ !0H!000dh00h0$!T0,0 $4>0CFT0 0P`d0 P 0K0 ^P@rp KT$;, PP@dT0 4P$LxܯbQ_H75Tc c5555@5 p-LM0@( +($00`P P000p(0; (yP $$4RPU@80S# ?0@ P 00 ]t$h00bh0@CP iL0(,$00\kp(@ JܯbTcPaT5 -L M @ 6@O"d, -L M@ 0@?"d, -LMXp$K4#&:@]P`! ($@Đ@b0O&#J86$;\ @ \@PE0Oi_0 0+400 P0i t5 -L,M< @@ `dD |@D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 4K 8K,0Kc^P40s Z<Ld  ?]80P@f"pd?`T_P7@ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x$ 0^P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8  e$0 0e#&B<5p@-$0Q:0.a6?!1c"QPo*0 800 !F &V:Up -L< (0 0!!( 0 ( !!ᓎ.Pޭ0tpS@\ ,0St    0pS{ Xw0Kt1 q `X ,0 St  Qʪ0@SPKt7(0(0 K@:U0Sʌ@TP t0S @t 0000$tP0St`0 tp=0i0pKK頀KtP6 0|S):R% 0S!*0  !!( 0 (  !! K @K @0S!`pKtP 0!!( 0 ( !! K@:0S@TP`U p-LM P 0R 0Rp@8 @0`<P` P0Sp5 -LM -LM@H 000 0p`P W 4 1 s @:Pp` W400\ 0#P, 0W 0  040 (0!0  !!( 0 (  !!0,00 1 0p`P P 1S @:Pp` W W 0 @  \0  , ( (0!0!!( 0 ( !!, !\ 00!!( 0 ( !!,!0㳪D\, 7 \ ,K 02P@,0 !( 0@ (   !,,01 ,(00  !!( 0 (  !!,} ,55 -L4M@00# T p` Ẁ"0 T0 0S 0S RT 9P00SX 0X 0R0v T 0 SX0pP0 0 0S*pe0崡@@0K`P KH  4 Lp D 0 8p , `PK 0S?0HK  0S0P@/ U8 W00W00SbP R00Q0#02SXTC0 0C0 S U^X0 a T0HK  0S <QPP TX 6#d -0 `VL@0 P UDp075000 T  P #d -L M0 p` 0S 0S0000Pt p-L MPV1a@0TH U( T0S% (@T@T 01 PQ0S 0@TphV0  (Q,0,0, 0<00 R   0000S0@4 ddd0S@-+@,  0 000@6HH7DH7 RQ-L 0P0000 P 00S000s(6 RQ-L P P 00S00000STP6 -L@M\TK K < 4 <#:0K [0*":("0004x6 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000 6 -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0DP\ 0R,0  0S0sJ 0SI R 0S0S0S EP5 02,\ ,48 <#R: TP, 00IP @0  0,\,, P , #010く/!d#dd -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#h\ ,,00@P c)1E`PX UPE000P:Pp 48<#h\ d,,00@PDꡎP p <7<7<7<7d -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K Pk H0, ,pLK*P L0S10L0 (0 S h(H0S<0H0 H,0sS$[ 00S40S80S0 0@@%P0,0S 00S 40S80SQ  l0` x0cl RV,<4< 4l :0 l 31꼯b6K_ -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,p R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  P@0S X 3S@0S<0S80S40S ,@K PZ 3 SP0\ 0RP0 L,@K PT P(HKs꼯b64(xL_4 p-LM`P@ Pb00P3,@0 p p-LM`P@ PH00P3@0 p -LPM✡0``PKpDKA(0 d` )& K`P P >4K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P [P 0S \00\0u]eK K[PpQ|L5T <5T5` (K``\ P K0[ pS (K@K K 1 0 1\Ky[Pp 0P WY [\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#0003T 3TU @1.bmUy @1 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S 1 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0fn 1T3e HaWu 0Q0 T 0Q0Q*00Q 0꼯bliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i D6P6Ri Ii Qi Si Ti tbi Gi Mi >i|6Ni0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 & 5 -0S S/cH0SVG Q@ HP`PP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q8(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,ҪpP0005S Y eP d0 SKd5$#Ġ0Č$7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dK=\K0HKd0KcK3|Ɵ@K.44HKHK GK3K0P P@  +P 80S0C80ž@T 80S0C80ŝ .KaPL 00S 00$105 H0Kd Ph |şP.DD0HK CKH0KGK0P ؙP@7  P 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cx4 R*) i(0  hGOK@HK dK  ,ğ(P0Q Q ֛P   .KP 00S 00$3 R /  (0xٙ^@K@eXß HK( dK0 圛P  I =2 R (0 Y hK uP 000 ` yP0 82 R 0L \Pa 1 R0 1 0 I BCVD  o}P`7q 00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`C U 0 R 0 R 0[S0[0S[Q5#$0$)K%"48<#Q !PS꼯bM_tb6p4@4bb0466L66!d66 p-LM@ PQ0 `0S R Q0000S ph 㯜P0`00 0(0 `d6 p-LM@P R0000 0P @`U00 0S S @0S SS00a0S0@ R \00C\0 0@ 0 Y 0S0C 0 ph魷᳘ D!d66 0- LQP 0 @R T0h( c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx   K U00  3  R0TK\0KhP 0@ X8 !xK U0h0  d  P` 0@QP@0pS0S 12XKOK[0)v2Xq  SK 0T1 `V OK0 S `VT\ T< PU p ` 0S0C 0 00 R 0PV PpPǖ0ST PU p ` 0S0C 0 00 0@0S00PVPpP饖,RaD6@-|0\ 0S \ Q @ 0 0R 0 0^@0 0,Ra p-LMp`@PT 0S @T 65z@0 0P0 S00@@ p,Ra -p0LM@T 0S @T P P R0600 hz,Ra -LIMp`0,0 &00 P 0SvP,6 yP`g 0 0 PU 0SPU6nz 100,0 S ,姥0SU P 0 0 0R 0OK`0`0=MK@0K<0A1T (K 000S: ȴ R0600 +z 0S0C 0 ᶴẕS/K ᨴ700SP` V 1P 00 0 `꼯bh61i -LJMp0P 0 兴 0`0CS 0 { 0S (: R000  R 0CS  NKJK00<0 K 0-K 6yR꼯bx62i -pL@P 6 y`V70 0 @T6@ y -LM@P6y P RP0S0S 00S0 0- @LTP 0S@T00S P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\\H_PaHH_ -LM0@S S  *PP P 0P P P0P P 4 -LM@PPP  0-P0L@T P0 P0@T00!d-P* 003P: 00 ? >-RALQBp`L PUe 0 S\D@ @\P0 S 꼯b466 -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ0,cddK_6 -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0K_ -LM@ @0T0  0 R @T0K J%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* P,c`H_ 0- LP  1v @ *v #v90 -LM@9 v v hv -LpMpxPK0@X 0 9x0 p`K9: 0 00   00#0 Q  忡鼯bbb86 p-LM P\ 0S \pQ  R X00G\`@M \K GP @P ;PTT nP  hP T# T 00#0  p  TP00 0  00  0 00   o%PP ʐPPT@#hH_pH_ -LM@pPPT T ~PD P1@T T sP, @T:Pa0S( 0S 0 @ `( PpP@ P`p(0 h`0S h(0( ݽ@`0S(0( < `0S(   ,cM_H6666606 -LMtP0夀K@(x,0 v  5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  GPI@8P 5X0S0 000AK`3Q @K@KKKK 1 !0 1\ڸ0[00K [ K  LOP ,0 S ,[ ZOP/P t0 R0 T0 KP ,0 R !꼯b4\6M_t66 -L|MPK0`x@(p$0  dLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$80 0\0ּ꼯b4 46M_6 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [  [000[S  A0BS 000S |@KXK7K 7 [PK77:00l0 0 %"4 4  0 $0 S $vl꼯bL6 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S Mp5X0S 58J0 R (  x0 R gPSH,KrPP꼯bM_X666dH_ 4 -L0MԢ0p(0 8 PU 0` RP U PU `0S6 VPDPKXB8r0S( *kP'WZ'08 HQ 1 0@80zHP10  0wt 9P E,0K8 AP<080  , 0R0% ~*0޳4Ra0Ra4dPRaK_0ddK_,dd<dl5 -PLUp `2X !@@6( 20 kZ P$4D 00b0k 00C0(0d,d0 0   00 80<808 8<<80808 < -LM&"0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S00 o 0@<bPRadDd,dK_Ld -造Lӥ0S Υ`P00ɥ80S Hp`80@@80S㹥00m鴥PRad<d -Lw+(02 0 ,04K_DK_hK_tK_Q0-4 $Q Q(0 `0P@ 0R----- 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  jP @0 S00 0唲dK_h6 -4L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) FP,0:S @0 40 P0MS1~  H0S 400cn 0 XX 10000 00SZ:XN p4   R= R1  R) R < 4( <"4)<(#,(` ## 0P `@0P`(`q 00S S00000S 00S S0 0 0 00S1 Rtt!$0w0S: 00 B00 0  0h0h40C0CMcq1P@ C 0R0% :P 0 SR0M0P@ 00K P 0 0R0% * V UV ('P偱4dM_6yDd<dT dl5 -L$M8 4 8 p0Qg ! 0@40X@0  0 S@@%` :V :4 0XPP04,!!-0@0S ʀS S cS( ; R4 0P804K @@ @40 0lS0X4P 1  0@Y $-H$-$-$-$-4:P@ 40S 1 0@4 444 S S4P 1 ( 0@Y YY4P 1 0@Y Y4x4u40S 1 0 0@4eS>ʂS400S 1 @0@YX X(S 40S 1 x 0@4(0/P<  P);4L)<4 840S1 p p8^400S 1 0@X400S 1 8 0@Y> 0'4P4< 4 < P 0W < 1 0 SP*<0 P< C 1<:)01<@<14@01\@@( w s<0 0 0g(00 H<(P<0~ S00  ƟA.L` BP`0@<`G4Pu^4@4 <@ 0<  S :00K< P<  0 0R0% *wS ʇSi FS" Sv400S 1 h 0@Y'XF%4 0\P<  1 h4- +400S 1 ` 0@YX%%4 0;P<   7F4 7400S 1 P 0@YeX|$4 0P<   =$4 =400S 1 X 0@YCX#4 0P<   44 4S 0CS30S X Xt#40P< < <Q Dß `LP`0@<(`h Y40P< 1<< p0g̠  H0S2 <03p2( @ Z I E04X >4 <1@:)014PP<4<4 400s0 (0P40@ p00g4CYX[400S 1 H 0@YX:X!4 0PP<   <[4 <1 R!4`P0@0S 1  0@4@) 0妮0P@ /,0K P`4  , 0R0%` *H `P8=4dM_6L dʚ;d dl dTK_bb\ d6T dl5 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,I 0K9Pp  0R0% * 0 S0% :X dK0\ d0Kc K\@Kl  dK0L -PS@@KHK0 H0KGK$ HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rf堭\@K   0K0 Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0K{Pp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KGPp  0R0% *+ 0K5Pp@  0R0%@ *<V0K0 $Pp  00R0% *$0P@ \ 幬뼯bT d6dxH_M_ 6l5 -L M@0(  $( ,<4<,4"|P@2U110SPHDPK0 C0KD K<`K0SG  P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(囏\0W00S0%" K꼯bhK_lK_pK_ddK_< 6 -%LDM0PTP ,0 0 S80\0 `P dP @p` [:X HK@h@ 0@K hG0KHKuHKhP@0[S U~45 ,0S $,I?0[0S 0D0fCT#8-8-(=-(=-0SY 0S ST Y @0KR@ [R R h@K H0KPd0 T T T񟗊P9-H9-;-;-<0\0 PP5 1:)0100\ 40R0 R1 \00 0( 0(` T(:-P:-|:-:-0000s00x00004XK X0 00 00880"000` PU 0S0 00 M00!800 000c0  H0S 0T 8 40@ 08 0b`0< 0@\ `0 s< \ pT Kd08 P\ e;b1 V1 ?0[0S S?1< 0S5#$0$#K4?0[0S.Y ` 3  1  HPP 0S 0S 0 0R0%0 0":d0 d R  0 dP SP  P0K Ppd  P 0R0%0 *0L0K Pp L 0R0% *壪뼯bT 6bbTK_l5 -RL MP`[@YPUX 0T01 @P,  H0S4 @0 ,P V Y pz*0.Sp Q:W 0 p,0 UP* YN* Qp *0S .S  Yp*0S .S0, 0SN*0G>SKpA @a0@RSD0SA La0LRS00L S:W@A @a0@RS `A@0@ \-P+^pG`ĔĄPPW Y *0.S,0U* Q:0 0, S*00S0C00  00 S000C00 00c 0X000 , v0 P`  \o 1S -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S P0pi0\0jS\ 0jSg P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P >P P  0   P  000P ]P040 ,c -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K#  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 ,ctb -#L4M0P,0 0pT0 Pp 0R0% :Z. HKo0H0KT0 0G Kc HKX0 )@T9 h0 @@TW1 h 20S'@HKLP0 PPP x2 ,0S p,友@L@0S  P KI 2P@ r0:S,0S00S40S80S T , AP0S 0S$0S(0S X /PQ 0"0 # W $!0P h 00S! #@P0LHK -P  OPP0P0 piG@L-@0S   P K L0K PP7 L 0R0% 0*噧뼯b\"d` 6ldʚ;l5 -((LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  KnP` K`KPK K( 0K@KYK`KPK   0 6@T 0  |P0 @T0[Sq RF  ` 0: 0000@S1`6   0:( @@ 401K<1 0@yP Q 1 0@Q 1 0C0@\ 񟗗N-0O-HO-`O-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-N-xO-O-O-O-O-O-P- P-8P-PP-0S 1 0@\ 3 ,0S ,堉0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K KK0 e tP 80S0C80 R01 RR|K0 6y0[0S1@  TȠ |0LP*^TPK(@L0( 0 00@S*9PL ( @0 R 4@40(0@ͥ꼯b!dJ_t 6M_ 6 6 6Y -LM@P7`4p1 @0 TRa 6 -&LAM0p,0 `@0PK Z - L6 R @6 R 0R0%P s:Ui  KK 0[SU 0[SI 0[S 5 Rş@0 5 ,0S ,rK| U0[0S0S @5 R K0 0BH@K0@K KG0KHKb wP` 0P 0S 4 R80S0C80űMxK KKU @K P80S0C80ž0[`S 0[@S KK P00  3 R K KK)NK(H( 1 Pz!R0 ! 僑Q Y0 00 S T3 R` KHK@ KKY0PI 0P徤O !@! 0K@j& !R3삟! }20SPAdPK@Kb`K^[0KxK c0KdK0K0KKK\KK KK FK !0@wP@K9KK0 0KK& |w1 R K KK Y0[0S@@RT1 R K KKdvw= 1 R K@ KKw 0 50 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K P p P  0R0%P {*L嵣뼯bJ_@K_M_d, 6D 6 6 6 6\ 6tK_xK_b- 6 6 6h 6T dl5 -P&L0R@!0 0P0` c 000 PUO0Sn 0Sd 0SZ 0SP !@( B("("48

 @ 0T  # 0@05S1#=#=`Zdddd!d!d!d!d!dJ_ldK_xH_dd$d\dM_( 6!dd,d<cl5 -LM p04`(0@S1!(P3T /+T T `V 0S,0K 3T+0[+0[11,@[PZ0S (0K &0[S'0[(@[1P <T -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *奛$dl5 -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K 00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K"[P"48<4 #8V0Pˆʎ,dd -0L0@Sp S S S 0@ 0S 1  q0 L @0`P``0d -L$Mh0L ,0 @ /  DK)0D L PhhL  0Q^ 7 0(@3T TT +T-  PPA p3T0000aa 0V43T !T +Th0 3  )0L PL @(2 ,0S ,}<Th0 2  )0L0P1P@ <T (eP@  00Qh0 1  )00LS0L  L h 048<,Ơ0ŒHK)0= H L0PhhL b@PK @ [R! R Z 0Sh0.  )00 _L0PhhL .?0[0S S #K?0[0S꼯bX 6$d -LM$0K@ pf3T#0[#0[00QQPU@#T !0 00l<  H0S 40@ 00lU* 0 9 P1`@(Q( R0,S  3S00! 00!R0 -L8MqP@ `PY 1 \ 3RC @,R/ )R R 0 S  |0\:L0K VL0[0K0[ 0QR+R(@\:H0K( VB0[ 0@\:T0K %[h00SV T0[<R0\:L0K VL0[0K0[ 0Q 뼯bh 6t 6 p-SLPMPK0`@0%0PP@ ppp p-L MQPP0S S ,S 0PP[lp-p4 0 ph4l 0 ph mpL_4 6 -LM1p 0S 0 S- 0 S*0 S'0 S$X8儨h@0  Po/00e@b0( ܘ0S 0o0C0 MRM.0E'Z`, 0S 40 G0S 7P 80S0C80Śdǟ00PP ch00<'\0@0 V  0P6000 {0@<vTT h  0 @0 <0S 1 8  0 @D&DƟD0 0SV 0 6 R 6P 40 80S0C80ş00xk00@ (  0 <0( 200<!0 R \0R:1  R \0R*P&\ 1 0@V 0<!0 R \0R:1  R \0R*0 \00 400,0 0\Z \4 R 0@55 R R  R R 0 0<,0 Pi 0 <0S 1 X0@x3P@ VV A\ Id----------------------------------------l---------------l-----------Y  0}   040 0@<0S 1 H 0@Y  0@V00S Sh000d00S^ 00S ST0 0 0P 00SJ (P0<; 0 \0PEjb@W,00S00 , ,@ P, m P 80S0C80ڌ00x, 00,0   lP Df8 \N=j@\d K_0K_tb 6!d!d!ddJ_ 6J_Td!d -LMpϟ, 唐 P0 0  xK 0 Kv X pȐ P , Q0Q4QXQ0@S @0S 0@0S 0@|0(S 0@0eT0S0P0(@CT00:Y KP` pp0KPP`| R Y 00|  |0 <000S Y 0 0   000S Y 0< 0   00P$ Y 0+ 0 0  P `0S`@ R " BHxK B@D 0S 0S0S0S& 0S# T @00 S X  40S8 X  \\0 $(;0S00 0S 0 :#,8#$ " "4"0 X 0s0 0h@K0  `Kg0KhKKK 0P` R X00X00 0S 1 P0@ R \ X 0S 400  \1<1   QKx0K@K@P`E \ X `0S \ 5@  R R R R  R R R R Rm0X0 g d0d Q !0 RK \0RH*\"(`jLKP L0KR ȟ,0 S ,-xLP 80S0C80=hLP0SQ 0 S   0` \: 04 i<4<("4 \  0`0C0 S0 ڀ0S  00 0S   0S,0 0  ,00  Q/0S 1 `0@p00 W V0 W`pZVk6P@ c+Pp 1 :)0 10(@H6   @  0KjP` k 0`8#8#00!$ S n0ѵ ѵ 4<#$ 0@ 0D8#8#$(,""(  0P4 0 S  0S000 0" ##<0 p 0@R 1 p 0@KP zIt@07` LP4P@ D0(`S 1h 0@1  R \0R*^\0 R1@0100 K! 0KP`1 @01 y00S Sp000l00Sf 00S S\0 0 0X 00SR00S SG0"4Y@>00S8 00S S. 0 00S%X `0S ̠ 1<<1P 1 0@5S!`P0@P 1 X 0@3`" P 0SP0S 50S00S 0SP@ T  #P@P 0S  j  Rhj1P AP 0S1X0P@ 0S5 RT0  / 0,LKLK  寿꼯btd 6dcd|d97dJ_d6@0-` |8#8#$(,""( R KV P`pp+ |K ! P`  K !P`  K !P`  K ! P` 4J  R-LPp`P@ U V P  @W1t7 -LMpWZ 1P  H0S> @ Z4PP. 21`+ U'   u0@P0 0 000<4(<"4!< (K= 0 X 0007cP40@ @0 0bS0 0@ʴ @00c<P @0 0p p-(RLMP`'0@S @0S10  0b<S 0 0 0 pZP  0 0 7p( B(0HP -LMP@Pp ,  ` P 40V80S0C80O00Ph0 0 EdP& U0@15SQ CSd0PUho@0  00 ?0#3 00-"d7,cM_Mb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0※ 0 @@|pY <5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@00@!@10 r!01 !1 0 g! P@ H0pkPApPp\0S @40bO@0 >O\@PZ 6O P@` 80< 0CR80E67MbhM_xM_X0GS S S5SS ʇSS S p-LM@!`\ XP P ᄬp3000  00  00pQ 0 0S X'}kpPU➺( (} Dp 6H6 -SLMpP@` R00Q00S3R`U-  ,3P$ W W *`X 3 c0X0P00S` U Ǡ`   -L Mp, #n0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4m0W0 0D D 001100 %!!d -LM, 4 0 m, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <m8< @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  u08#Xd zM_x6 -LM\0@,0 `p XK hK 0R60帐 0 弐 Đ 0% P@ i:T_ `xK 0S@ u0S.0Sş@0 ,0 S |,]XKh z0S hK H z(50S xK$ zP @(0uzX0ST0SP0SL0S&[4R t0S ]zd0S`0S\0[Sx0[S S pG@K ZP R010 0S  0S 0S 0Y0R00Sh0[ xKSppP`z K0P@BY Y0 00 S 8s0S[ xK⇸ Y0@4zPXK PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXK) yH@KexK@K0 H0KGKSLP@ 40  00 R TLVe зP` 0  p0S 0 R myw0[0S5#$0$'Kp0S0P@ 0K \PĀ@  0R0%@ *Hx뼯bJ_M_d66666,6\6@4666,6T dl5 -LMPK 0 , 0S Y0 00@@⼨P d00S#X U 0S @00 0 pp    0@00 :0` d`K0HK@宥㫥 0U H0Kc KG Kd0K\PK  0S^ R 0(S@@K  0KKP @@K (` x0(0     0 ۩ Ru Ri  RI 0@#$(,""( :( @@R $ 0^0K K@@Z 1`P 0@ 0@@@0 \ 80S0C801 ,0S ,r[ K P Y@ 0 @@ 0P 01 0 Y @ @ i 00S S0 0 0 00S,1 R P 80S0C80`LKᕶ0 xTD  qPM=@@@KŤG5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 ʧ1@꼯bcdX6M_h6 -LplM0@,0 `P<K 0S㈠ # X6 RLƟ@0  6 ,0S ,Z+@( P(0 w 0R0%@ Z:TP LPK Ǩ 048L[<# #3 0P| 0  2 P$ \ Q <0[S  `Ft@K Pl  R010 ȵP 0ڵ ZwZ Y0  00S t4 R ĵ Y0@`@w{ P` HPU 0@T 1S?Y Z00RX Y LQ$ 0 S!|P40@040 @R 0 ` @ <0T# 0 01(#(30Z  0SgQJZ\T\00Z00S?Z |!0 R00S| @-i@<P  "iX2 R<K 0S 0 S  1" 0 _Z\ 1!0Z Y00Y  弧1S/ !x1p!0 ;%Y  tP1 R $ov0 R gv0 R ܴ \vK0[0S S5#$0$$KK0[0S0P@ x0K IP p @ x 0R0%@ *8u뼯bM_d66667xM_J_X666T dl5 -LM  PK ,  ҢY0 00@@⮥0P0 d00SX 0S  @00 0d@Kpp0\`K00 :0` 0 HK㠢㝢HKdKP cKGKQRS 5,#04%KKT P0 X @ PK K 0K P @K  Ԧ(`w0(0P 0̦ R R  R 0Sx 0Sl  ^R N0@#$(,"̠*"(** :( @@/ 40K K0@@Y 1`P 0@ 0@@0 \ 80S0C80ڜ1 ,0S ,QX hHY@ 0 @@ 0P 01 0 Y @@ MY0 R0000  @ 00S Sv0 0 0r 00Sl0 R P 80S0C808$Hm0 `t1 <1 K吐 K1ޤ렀꼯bcd6M_6X0GS S Ss5SS ʇSS,0 P 0SPVa 0- @ PLCT0hDT. qT -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| +P`H 84 1hl1 p ` `R0 0U0 0 p @ppp 0S 1أi0ͣ03 0 0 0Ba0⯲ 0( x-t0⦲ `P\0(0i!t0⛲ <P00(0(sM_VaK_M_7Mb06L6666 0-|0L PR0@P@ X R 0<00  0| + 0 CS 0hQGM_Va p-LMPAfU`r P@k bU !0SF 0R20 S0 S R&0`!00S R0 <10  0| z+ 0S0C 0 phf G0 0( s; 0 0 0Ba|0 R ( tzs0 \PX0(0os0 84es6M_M_Va67Mb@6h6666 p-L MP0`@T6 Ʊ 0( >s0000Ჱ 0( |0s ( l+s R 0T00  0| * 0S C pphFphs646|66Va -LM00 0 0 @0@ @@ -PLM@ -|0 0R h0 R] 0P (0hrQ 0Shy000 rM_M_6 6 -PLM@ R000h_mr,6 -LpLM0P,0 `@ <KգT2 l Rl@2 Rh 0S# (2 RŸ@0 ̢1 ,0S ,UP @(0tr<0S80S40S00S5 0R0% A:P7 d@KH kP%` R 0 l 僡 Y0 00 S 0 R <K⾰Y0 J;r@ <Kl  0@0 R (r0P@ h0K &Pp h 0R0% *(q뼯bK_J_M_dL6\666T dl5 -LpM0@,0 `1PK !6 R 0 0S# 6 RƟ@0 dƟ,0 S `,T JPG @(0,q0[S 6 R K5 q0[0S 0R0%` Y:VO @KPE P= 0 4 TPK8( LTKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E%0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF K⣯Y0 D q<0K@ @90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 2 R j 0Pp2 R ] 0p R 0S p R0S\ 0SX SR 0 SB K`{0 K0KK0h [0  /h K0h [2 00h0K1\K 0$(,<4 p-L`Pp P 0 RL tȓ T0@0000C0T L 㲓N_Hb!6x"d -\0L0TS $0S p00R0S P#d%d -LpP`P@U U UPEP PE0R0@h%cpp00"6 -LMp8 Q@ 4 < ; P,, K00K!P4 , X3 X-4%j6+Fcj 8ؠT@!08 T d8  0@T0X00< X,008 R4@8@b0 :#:RJc0n<0 0`0%d"d0"6 -0LMPp`:0P:X@PH BP PE 0R08@8ibiw 6"d"6 -SLM@2~s H00H0( (0 -L0 h鰼Wab.O_ -LP/c.c.c.c.c.c.c.c.c.c.c.c.c.c.d.d.  $(,04@DH`\"6 0- <LM00CP@ SNd.e.e.e.e.e.d.d.d.|d.|d.1? ?0 0 01 K"0 0 ,1  ,x; ,$0 Sde.Te.pe.|e.0 L  K20C0 10 `UU33p"6 -LM\@  t\ u\\Q10` R``>J@`z, 0 V. @ 5  )l \,0q6S @ Q q0` QJz QsY QPF @04  @TZ00e/C1"/ 0b\ ShP <1L,`8x"d\5"65"6`:6"6"6"6>6"6#6#6 -QLM@|xh"a!aha`aPa$@aH4, aD ha#64#6X#6d#6#6#6#6$6 p-LM0~n0`pfVPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 G7%d -L^$6 -L^4$600-@P 6 0 -0L\Pn -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS Dp.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.o.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.|r.Tp.|r.lp.|r.p.|r.|r.|r.|r.|r.p.|r.|r.|r.p.o.q.q.|r.|r.|r. q.0q.Dq.|r.|r.|r.|r.|r.|r.|r.Xq.lq.q.q.q.q.q.q.|r.|r.q.r.r. r.(r.4r.|r.|r.Dr.Pr.|r.hr.|r.r.r.r. 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P45&6&6&6T546`:6&65P6&66t66 66,5\6$5 655"6'6&645'6̽6'6!6 '6'6$'6,'6<'6D'6 0-@PL> `Sl h0 $$ à 0 < 0 $00'6X'65`'6l'6 -pL`@Pu$ T 4 Z DU pP@TXD4(4Px'6|'6'6'6'646 -L0 Z\@`%Z' !00St 0t  rW\PD  e/'646'6T$6\$66 -O8@LMpOSP!b$ $00S 0 hdX@@  f'6@46'6T$6'6'66 -@$40$&S !PL$pdxl dVH'6'6'6'646T$66\$6 6"]"6 )t5 -LMp<`@PL E8P$1( <0D $00H P dK}P8\00S 0@00LMn<`p4 KP@B 40 R08 &8 P00U* Vؠ 0. J   0Z UJjF:804 0S80 d~@X00K@, KP00L00  SG7"d%d*6>0 >0 fJG7M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p$0 0 0c@0 < 唒W`D h 0x"Y, K00K 6, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K/y%d  0-LMP 0 .@K PP@ PsP*80 0\ @8:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH"dd#d -LM`0VPp R a :VP@bT@!W W `d L 0D@WH"dd#d 0-h@Ld0LP 0T0P XT ,0R 0X0S0hfR#d"dD*6 -LMP`PV r @0S  2S @2S2S lphARd>R0JS L.L.L.L..`....\0  ,R\0'R\0@"R\0 PR1`VAA0S 1 R$ 1 ?#+0AB%@Q Z 11@T !mQtQ hQ81\ ?# $1H1@Q1@!+B%0@ PQQ\0Q\0 0X Qu" 0|  QcmQ58$d 6h/6l/6|/6/6/6/6/6`:6`#dX#dH#dP#dh#d 5t#d/6p 5/60r5 06@06p#dT#dt06060606060616 16016 -L$MCp< #@ 000 0, !@ x3t#Pl3UPQ\PH  Z)zZ ZX H0H0H  D0P@< 0qH  R 0 H80 \0040 < @00 ,0 08, 400.08S  0S00,P 0X 00 H P@< 0;0 080  <0@4 00 , H 0R6BS`$dZ080  P@< 0@80K0@< 0 P "dTc#d 5$b"dG7ob2636H36x36 p-LM( \@SP`8 0 jP fP (aP^PZPUP$PP4MP00S8@< D CPHx@PhNd9PH T4P L0P3636 5363646X#646,46T46|4646464646464656 -LM \@P`p  0 P`0<1 0-LM0S@ Xǟ#&R:0R*0a00  01c@W2 0D0 HQ`  D0 `6W  T  8 5S55SSH0 SL0L0S S L6!XD0`0ó D0` &U  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`}TU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 5S55SSH0 SL0L0S S 4!ATD0`0ó D0` U  D0`00D0  300S p3 0 P3@q 0Sn ,3Ph ?@P8 ]  "U 48  F0 `!D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 5S55SSH0 SL0L0S S 1!aVD0`0ó D0` x!U:  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8kA 0@ 0S 0P O0 |eg)*(":1"(Q 001 0Rt%dd%d%d 5"d"d%dda@56\56 -L0@ >#& R7:0R4*0l$0  01c!R <\ 0P \0T\ 0 D00D0   $0 2R @ ` #& R :0R*0l(0  01c!R <\ 0P \0T\ D00D0  d"d -,0L ^  08#d"d -!*(L":M1Q"( 001 0R  0d* " !Q:0Q*0b !b0 P 0d -LM$0"*01\06S0:0@<,3`%dga%d"d 0-0 L"*("1"(P  \@! 0 SP!0!;   @00"d%d"d@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000"d@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pCP ` `000@0  0@0$0)$ q?t%d%dgaga56 -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S 0" "0 "0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,P70 "R@O=ŸP 0$T D@7 0@70!@5=0 @70!@'=< hPJT:k@o`P@) E1? P 0 01  @`P 1 000R ;P= ?9W 0pĀ >>(Wa%d"dL%dtgaX%d|gaxgaga%d#d`%dlgadfagagaga56'7ca(XdaD.daHQ_56da56`ea(fa .56hfa0gaT.5666PWaT6666 -!: P0@S`LPp P@: #Ŵp0L L \  P0p@:8 0 0 U0A> x%d"dh%d66 p-LMS@P` ,:8l#* #800R 0 SP*  ^0"5060p >%d66 -80L0 00 Ơ 90 p_%d%ddat%d -d0L \R00#P00*0 $P40h=t%dpQ_G7lQ_00 R 0  \05055=t%dlQ_pQ_ -L$M]9(Z91"0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEPdU#&R!:0R*0a !bA 0 T L8%5HL;<@T V 0 *$;@T@gad8696 -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P lgapgax%ddfa%d -0LM@0pPP% KOPU$: 8 #! R#8 001 R00*"5*6f `  0@PP8 c%d p-0LMp4 40 1c!P+ Q)ڬ0 \0јP00l1  R0C0p`1AC\0^*PP06 @^:p_Q_Q_p_Q_.d,+d -`3LM T, LcLL3< r 8C0S ,CP "88 #$0:3 0pǏ42 JP0  0S",0S ,P@h:t oK'f|2~Ϡx KP@,2 ( j< p000PPC$0P=*!a06V,*46!SAW  4 *1 0 42P44|!Uj1 !@0p&V:@U00 Z0#02S0ESp/x/T/////////////////99 2o99` "88 #$x9W0SS 7꼯b)d_"dQ_Q_896%d\96d96*d.d$5%dl96x96@B|96969696969696 0-LMPK ]P@ 008@"d -LM0@X"d -0LS S  -<@L<`P. pi0L ^| P 0U@`H@ $@K,0$ z$ 00uZUzj7(Q_%d:6 p-LM`00l H0N@0d0>0^P w0,0 .L 0L0H p7%d(Q_:640 ( 40(S"4Sn_40 ( 40(S"4Sn_ 0n_ - 1LM @R)% *B? S Z0  "!   88먦80Jm88|0*mmL7\00 S 4808늦(8$0,m84Q_&7:6@:6d:6[t:6:6@ -pLM0`S" @0  2 Bla80PU *   00VU:`2 0Sp_:6 -LM`T^@PƄ ?p 0p 0,`e0@@q_"d-??!0S0q1!1 R  P 000$0$ P 000d@d -LMP< 8 ' ?x$ , 9ɟ 9+9 R)9* +8( f Kh800 0 7X7I)à@ȟ刨ȟ bx@ 3`h`7`7@P a,Ơ 0 @PU @Z0 _X3 @0@"0>0>0 3 at2"& Ÿ P 0#60 6% !01 $|2x"<p6`6_!_1_ 5"2 2"2 55pI4! 0 @J51,5#1h  00Av0@0  pJ0C ^:00C0`0 0b10 @,:6@"dL#dbAi` +dtbp@0r_ /s_:6.d:6+d.d+d p_+d ;6L;6+dd;6,d;6+d+d+d.d#d+d;6;6<6(<6+dH<6x.d`%dl<67?*d |<6"dd_UUUU<6<6 $b#d<6 =6(=6.t_L.p_4_4=6@=6H=6%dP=6 P-LP t2R l2 `B00Pb 0`@"P@0 SS  QQQ00 Qx AP/5,50-S SPX 0-S0SQ q00C@CSW/// / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / // /// / / / / / / / / / / / / / //@0000Sl00d0`0K@@H4@0 S DSBOb+dp_p_p=6=6q_=6=6=6=6 p- LM0@S p00`PP@` 8xu0Sph`PHP`D `P4P `qq_q_=6@=6p_p_s_ @=6p@0Q 0    -0L 0+R 0  hCt0`0Sdd  0\SO] RHHD0 >4<4 00L#dAih=6bq_=6 q_\/64tb -L@ M@\ (0 @+q_.d,?6 00C0q_ -@L`o%0pS0P0U &4 P0S U{,PP _0`0C0K%@3101?%;%P4?6.dS  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@P\0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p\``$U-Kz4K 0 3KP `p,@K -L M0pK@` \\$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S hv Pu,0P# P 0`V U004P< (0;4P00@ @0$0 0SV h~P 0,0h -0$ `L@(X `, ,0P+|+/+/,/,/,/PU !0p !U 00SXp 08 0 0,0P#.d?6l?6 -Lp` PP Y@  X`` 0$0  00 @0 000P 0ҕ20•U@ pP p!#U`3f!  -LM,0@S$p-/-/x-/x-/-/-/-/-/-/00Cs0 0 00, 0S P9p  ,/0S ?6 -LM0@0S S T@D 0\\ P0@DSSa`' b?6 - `L$0p04@S0P0p0CS0ԕ PKH//H////0/h0/0/0/0/\//@0/@0/1/\//1/$0( R0(0P 0  0@0PS 0 x$R l1Rd1Rh:68>65L>6P>6x>6>6>6>6>6`:6>6?6?6 -8qLM@PZ 0Uă`9 U 0 _U <0?R0S0AS5/4/5/5/4/ 0@0p| V.P0c0T  L.0D 08    0haq_,606<6T6`6x6 -@LMMT`pP1 )@T 0 S 1S 0S0t P.0S hk_< 0 h.pT 0 566Љ66 -LM @iY  0S@0 @/d -LM@ R000 hY 0-LP,0@T 0U @T0/d p-LM0`@V@ P7 P0 [0X Z ,0S7/7/8/8/08/88/@8/$0  B0[0$ ph; 0Y0X 4(v]0[0Ml?-0H,X9-00 0X 4(Y0_] 7ph(- 2 86\666 0-LM@PM < 0 Q^A0S<  R30ˠʌ ʌ00ɌH0 @PY00P  0hQ0| 00  004;00CPɂ8,,,̊6Ԋ66u5 -L"M\P@`p l2\ ,@0S p  02\U 2\ @}̠ 0@ @O1\묠 ` \ Q 0S(   0000 0  0p0#00, 00 6)@ ` \L@D04p80P0(<@1011011 011@01101`0\ X0\x0P Q1 <0000  0 0 Q@Q QQ`8/5 Q- L ,6 -0 PP0L000 1S010 130S00+3q P4| 00#`Vq 4@40!`R W3VhT*4Q_q_ 66H6W p-LM`/P##PP441S 0@0T1!@R0Tr#4PU jpf40 p-LM P@| 0`\ p| 0`\0` p-LM0P@1`Tp1@T -LM `0PdP 40!pWW 1 L60P!0Q0@T JP@ 0T jP 00 7P$08 <40!\@ P^ @TP  0 S 40 40!p 5q_'0@-Q0P 1OQ1Q00S0R00@ -0`@1LTpP 1@T -LMQP`0p%1Q"1Q 4 1S @X1 \@ 0T4 X P -LMQ@P`0'1T$!?T0S0V40P X 1 (Pp :4 1q-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LMDŸ Q, @4) / 0@\0 | w\3 \p 聟X- P`K PK@K ~  zP@0!0 1R 0t )<1 ,0S D, Z 7F/F/F/F/F/F/F/F/F/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/ G/ꨀ꤀ꠀ꜀ꘀꔀꐀꌀꈀꄀꀀ|x5(t`\hd꼯b\646656̎6Ԏ6666(606<6D6L6T6\6d6t66-66ď6Џ66 -LM40p1` SP p ~P@ 0p tYl2 dd2  $0pPZP0 @Rp Rz Rk U 40!Q 1 f # 0,Ky0!0Q  202202 202,04S!20\: 2+Y04KS1ԱL0 1ı0 4@ w P( U$1 ! 41 R0S1A0 - 0S0 0 04P4 x( 4@: ZP0S`RUq_iaTq_55>/D/5 -L MP PE㢟 , u`p@ 0PES u@,0YIX000 qTP >X0 0 eTP2X  \T0 P 0 0R ,@ -LMK 0P!5 -P`P0 S00Ł0@p$ (00L@p1t  0d 0Q000#(  @80S(X1 h(q_q_`:65PU/}/T6 -؀Ld 0 PUb p@0SP 0@ 0UP0U hpp@0SP 00@ 0UXP0n_M/Q_n_(\_ - 8L8#Č M R00,p \, nP@{ 00 ḀP`oPU< 1*Z`  Y  Y 0  101PU 0d- 1 010, 100, 10, R ,8Q2 RP`1Z0-.1lP` V Z`-P`101jP1`0 0.` q_ - 0!4LM#`pP@7 0PP- V0 70  V0 700(PUP w- 1 011    1<1q_ -D@!88#L!PP<`08 0!<`02 p<`(VUP*V D00S 0   MP !`h<`@``| U hu04000;00q_ -L4M@ 帐0Sg 1@  D $X^ $0$0御~ @0@X0(P$0[RD0p`0<B0@@U P2 46SK 4`K %R00$((*$<$%4K20K1 K0K/@K-K,PK `@ 0PW<H0H  0 40!   P@ #P  D@0 +&0SD $ 5@0 @0 0S<`KQ00 $8$$`<K;0K: K9@K8PK00<; 4 00@{01 0u6 0-LPQ@M0hJ0 0Q(0 <0 A0& 0-DP!88#L\! @T 00, 0h 0<( 4bQ<00q_ -L M @ 6@yU/lQ/ -L M@ 0@iU/lQ/H0@-8%V l l @PA ll@0R鵁N` aA -L ȠLM` Ƞ ,Ĉ@,d0 0 P,@ h0 @  Pp 1!:U :U :U :cQ   )?P 0!16U<6U"*6U 6UP6U Q QY00 "  d 0@P0 00 000s6U 5U 5U㲀`U@ R0`0 UO0HS"5%@PJ@dDFA 02 Sh1b1 R0``00`2 0P0S1 0" 0#$0$   BR !G4$@P@dDFA 02 S`1b1 R0``00`IZ0 0bJ10000 2 0,$,!$#, \@Z`s0StCP R0`04 O  0@@@P02 <4(<"4!<002 0#$0$ 0 S0S0002@2@dPY`|2U t2U 6 <@0D,S? 0\PKP@PZ0[Y [$ R !FZP@ 0P@;`@K P 0 P0"  6[#$0$&K R0U 0,10S}U~{0Ux 1Ut 00U0m0Uj 00Ue 0꼯bq_ Q@c Q 6c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cctbPbTbDbddQQ` -LMpe,0 P2N؁@Q0`0h "N d0( 008,!2040 1 K ` M 00P M@ 07K? 40<47OT  $P%0 0bP 0 PY *(0 ("4400$ 0 ,0\ oe@ ]M .`tbQ65WEVlQ/6 -L,M` 0 开"4pKP@ .M%4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ pPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @[@<0 , N -LMP`p $P P@ $0K   pPPPPqP $\00S 00  00   -L$M@`p 0@ WPPb 0KN 0@@@@ p?P@0\@@T  0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @ 0  N -L$M,`KP @pnLY0,K0 (K$pKP @@a@  -L$MP $ 1`L  Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 I@* 0   N -L M0pK@` L$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SLM@Pj Qf뜁pQ0`0V tK  Pp0 0@T@b@bPU?J! @0L\, 0 @=p0 @PI@dDFA 02 Sʬ1b1 R0``00`10N^J0D@T;p `tbPbTbDb -L M0`KP pdKG0KP*K @(K8)K0 -K,pK+K@ @@N N -L M(`KPp AK@K}(K0 pKP @@4 -LM@}̠ 0@ @! -L M0@KP `pKBU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L Mp0@KP` JJCV0K/['Ġ/K)K8'KP 0 *Kp (pK - ML`0 PpPP@0nT `:PP` -LP -L .IP@/  9T T 3 0PT  o&$ pI@` 0F @0 Ppx` P0  V@0P .q_q_5`:6/q_5&7̔/ 6<6L6 -܀L0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UTQ0(Rān_`/Q_n_(\_&7 - 8L8#Č M R00 `,Y, PP@| 0 0 ḠPppPU7 1'Xp ,0 S0 90  S0 90 0P0U0!1 010: -Y 8Y 2 RPp0! X-. 1X0-.1 IPp XpP101"~P1p01 0 -1q_ - 0!4LM#$`pP@A 0kPP7 V0 70  V0 700(PUP0 11 011 VH y 1<1-OBq_ -D@!88#L!lP``00l0 $@Th@ $0l$0徑' `hPX0(p$0(Ep Kh0D < RP0 @@P`p@K  0@ G x d`2 pK?0S@ pK?0S@ pK?0S@ <KDht 00`uyKwpyK"<"1vT!0xp@ py[$L@ "Ġ.<K[  ,2U" 2U T 0,0  0,  e@ 0e/G/1<1 2U 2U 0 e/xG 0wP,  o1UC 1U 1U0 0 "   QD10S 0 0@{P, 000 , P, 0U 000im&4400 0 4Z, 0S0q U 0S00000N@0UO 0D0Aq_Qpd Q@mdtd@Asd edArdAmqdhdk~gd/Q` p-L,M`@0P0 ~B< V@D QT L@KP$ 0PLP<K  0S p5꼯b6 -L P01 0! 0S 0 0@K Z X0 K * 0fP 0 0@K 9(P@@T0` 50K01#5#(0  * 0P q_ -LM,pP80 ,88 #$"P00`r0P< m <  @( CPPf  C4@ ?A„p0@@ 0 @ P`X@/RQ@pP34`K @@0'2K@#Ġ *0'H'T40K-K,K1@K0PK/pK@0@:00<0 0 |  0 `008 $( ,<0 ,0P00iaq_Tia'R \ 0L_S BR\00 -L\MPp, K0D ! H L M 0SF 0  ,0S40S< 0 0 S . S ) S 0S0#P3 0 X0K@LKS0R? Q@0  S S  S S S0S P@ 400S3 Sj `8` 1" R 4K@80K@  @```Y8\ 0?0S8 @4K P<0K@  P@@@C<^ 0?0S @@Tq m  L  40H S0 D0 0 440  0 D H0@ 048D  04L0  0?H @ 4K P00K@  P@@@0^ 0?0S0P (` K0@P`P Kh  #DP T@%h0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6 / ///\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  X6 p-T0LMP`00@8 ,T00 8\p/d p-0LM@ P0`<0 \00< ,T0000 0<< \pho/d - 0L 0<,/d - 0L 0<,/d -(0L 00< \/dPb -X0LM@ 00<,0 0S(000 @/dPbx6 -LMQ@0>0~n0`pf2PP 0f0V@0*` vVT( K,0K JTZ:02R P, 0L00 G7%dQ0+G70 -L+븓6 -L%6 0Q 0Ria@ -0L@Mt@Tl0d@ \@ A!0\@0 0  "!ia680dkaja080d -1LM ?ops)J`0Y10  "!QU PP  0@PU 00#!?o0cSp 008 401o80d40dkaja/d<0d -LM@X0DS 00#!40 0$ !!(680dG-0M  "!āġđ!R  80 QPR Q R  101 R R1<1 R\ p0x 0P `0P @4`$0 0  @(09)0 40 ( pP` @$!R 80 QR \@0@ 0 0!!Ѝjaka/d40d80d -@@LM8 s:( 8 0 /d -LM0,"0S{ 0`  "!r@P0   080 Rn0  "!`00#! 0    090 RR0  "!`00#! 0   000 R60  "!`00#! 0   000 R0  "!`00#!  1 L0 0!!Ls_40d<0d/d -`@LMP8  0 0#!, pP0@S0<0! 0TQ4 0!  84`\@@,0 0!!40 R @  bjaTb4Q_<6`6 -LM`4 0!!0Q!0000 0 @P@dDFA 02b Spd0 S0``00`vJ 0!!jaPbTbDbM  0Ѝc0 0/d80d40d -LM0@  "!@0!!$ $0 1h40d<0d/d 0-L0LP 0P0@  "!@0  "!40d 0-< L0P@!!@0  "!040dH- P00 01 0 00!`<0d40d/d0 S- L( ( 40   ꌔ6ia600  -LM0@S000 S  P- L 004,0P  ka6 P-0L  04\00S  ka6,0Q0 Rp0 0ka@ p-LM0l00P` \!0@0T!;Sy0 U0 @2@2D"4 0@TT0y/ ph .80 4 8  < @ D O H L P R }$08@8BX0pPpTX0 p |4! 0P\ P0TX XP0) P` \LP0TX XPTPY04 0004 d80*0x0 0PbUP#U@U0 PT0,PE\U@U5SP0T,,P0T0,\PT0,TPU0x0h} -0L`P0 0  ^Of Pq0T @,000SNP0T,,@C 0`S0 P 0T,\0@00P:P  2P 1 P0LT ,P0T0 \P0,TT0 P: PT \ 1Pp0S00m1 P1LT ,@ P0T ,P0T0 \p0Ė6 -LM@0S 5 -P0PLT ,P0@T ,P0`T ,00pPT0 \P@T0 \PT0 \|0 0 |0  -`D0@0V|pLPD0@@|@ @0 T736"  @TD00CD02 Tx@P0T ,P0T0 \P T,0   P0T,"5 0 0 0-0LS@P P10S c00h0h0h610S0S 0-P0T@,L,Ps0S  x0S  R Q 0hI0S00#0Q00S 0h -P0L0@`V%pP / // /x0V00 ?s 0 1 Pm/@ 0`t_6t_0 -LMh@Te Th $0Sh0TT-@h0$ $0Sh0 h -LM@?P 0h -0P ,@L0`@$@T@p@| 0-L@ 00P8rP80h -LM@P 0h -LM0P 0`f@LOTp00 PL#dAi -LMPh0d8p2/ p P` \h@h•p0p2@ l@  h•l 1\ @0@P h2lp"pb 2FPFPp dhPPH < 0> 6!H6-6$6/1@6 0-LPDP@H8S8S p2 S0h2lpB|HHH p-LMP@| 0U0`0  UD 00C0phH PNH= -LMh2@ld ,P1h” 0l0d \,h2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 th2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \D8h2ld ,h”$0 0ld \' -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \J)K&L#M 0@ P P@@@Dt :@Dt hu@0 \ ,0; \8 , x0 -LAMPD@Xp00`".(1 ) ( 0`0@48@0PIK L0 X 0 0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X v4Q_H0dhs56 -`,0L(0(@dϠ>1 0(P\ p 0S [o@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0C0r_H0dr_D0, S0D0D D @00H @0X0d 0-PH0LS@ S 04G04 HP0 -LMp\ PU  ( i@T4`  P$0< 0:000 `@0@4Q_ 0-@P LR000 @ H0 BT@  $Q  R8000hQ80 8004H00QH % 0Q 0Q0 Q 0000Q t0QD00\0QT0Q#!H0<0 <0 0 AW@\W@@W@DW@FW@_W@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40jh -LMH 00R@4< 07H 04h/P0 S 0- LRP@ @0S #S0S S S lh0h`XS SD@<S4ȗ66666 66`:6@6,6-646@6L6 -0L00t0 S -LM@sH0 R x04She4Q_ -LM@V~dh @0\ -p0LS0 -L M@P` Q @0D00D0D0L0d0D00D00` 000d 5\dP 5\d h5\dPC/P5\dh 85\ d 0h\ 41dH 0\dPL 0\dP 0\dP0 \d0 \dP0 \d00 \dP04 \d08 \dP0< \d0@ \dP0D \d0T \dP0\ \d|0d \dPt0X \dp0` \dPl0h \d d00 \dP `00 \d \00 \dPd 00$ \d` 00( \dP\ 00, \d0C/\dP0.\d0O/\dPx0l \dh0p \ dPX00F/\X d`00I/\dH0 \d@D0( \d@0, \d@<00 \d804 \d@408 \d00< \d@ ,0 \P0 T00@ L00P00 0@L#dAi1d1d 80d@!D! 40&71d0u_ 6d0 \d@0 \d0 \d@0 \d0 \d@0 \d0 \d@0 \d0 \d@0@ \d0 \h dPX!dp1 !|0S P d 0h\0 0 !qQd0$ dh 0\ud0H" ,\2P~  l"zpwx 0- @LP,0@0 \ ,0; \ ,0h 0-.@LP9\0.\  ,0= \0hq -LP`ႀ p.9\.0\Z.`0\0b/\.,00.\.,00.\.,00.\Bf/,0@@D t f/@0\WpG.9\.0\.`0\@0f/\.,00.\.,00.\.,00.\@f/,0@Dt f/00f/\b/,.,00.\' -LP`₀ p.9\.0\.`0\0b/\.,00.\.,00.\.,00.\DBf/,0@@D&t Pf/@0\f/@0\WpG.9\.0\.`0\f/,@0f/\.,00.\.,00.\ 0b/\.,00.\@f/,0@@Dt f/,@@0f/\.,00.\' p-LM@P`0 K@!p p-LM@P`0 @pA-`@0 S pP  0R 18S8Pp  0T0 T  R1 0 TRXu_v_ -42LM @`PP~ 0  "![Uh UQ U: U" 'U 0!!q0S'S  !PAh d 0Pq0SڂSL8Ah dn( 0p0SS@h dY 0p0S S @ hd =0P@0[SڈLhd .P,0 $zu_1d0u_ v_<6 0 1d R[040R0(0R>ӂ?00 L0&7v_ -LM,@0D 0  $ -LM?@00,D 0 T -0LP 0-DL@P_0000 4 0h1 0`1l!0h$`:6'0 0-XAPPPTL 0S@T0$0S U(? -L MP00 4X1,q0040 U? VR (1 RBXaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` D$@PpTWd !P@ d0  `0```0 @Xa fv_R+0*06 p-LMXA`TP 0S@Tp$0S 00S $0 $006 -LMXAT 0S@T$0S 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  xaT0!l@dg!T01STJF04aS ,0S T<QQ 0S GQCAT%<08W 1@S  0!p0T@`&1T 01ST (PDl546&6646l66\5h666>6X!R0S`0(0S0S -`0L(6 -LM(0@S d10Sd1 `0_Y `Xp\ `0 D 0`R:@P0Qw\,P400 P] 0D40H0 P0P `H(0X P?@ 0S 0 T0S (0     0X1S 0S`00`0L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H} 040 ,\6 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0P6 p-L M @0@P4@P p 0X1S3 0S0 0 -  0PP0C P0L L QL5 1SP0  5M  1N -O )P0  C# p -L M `XPQpK 0SH  T0S Q\ \0^࠱ RQ3 V+ `400$ @TXp\`400  ` 0`AT   TXp\`40 0 @50 -L M pX!RD 0SA `@V T0S T\ \0X@`VT \0S P`400$ @040 P `X`T`iji`400$b m 0T@X@`A400$50 - 0L40 ( 0-XAPTL T0S 0@T05 XTU00P00 SP$ / -LpM`K@p p08GF/V_ 8 PX( $ p$ 000D0 -LM 4`0p " @ KP @KL K~?K";P< @0D "H0 0 P0 P " L0P R0X0 TH0D$PL0X L PE PK "D$X0NT S񟗶<90:0:0:0:0:0:0:0:0:0T;0\80\80:0<0T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT T\&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@Dd2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@ߚPT@ ٚT0X140 0, 00 R( d .P d @#00@\ PP \  X 0X P0 04 0 40  0 \ PP \ 0X00X P ,P@@Q UPU@t@P1sw@Pt PpDPm Pix{_Rv_ԝ646\6`:6 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`SV$p$@P0 P0 RT  0 R 0R"5 -LM `D#0PU 0S; S XPU50@30 0 S04 40@40PU (Ö,X†\Æ ?00 P#P ? ͆40 40Pφ 40P@0 PSU&11@F? R 0R Q pW P 1SpW Q0 K:P TU Y 0R P 0R 0R 0 P@2"32#"22""30 # 3X–\ 0TX2\ $PP> 30CS D2D"3#<2<"2"424"3 #0D "HD0S P0 D3< 400D3@ 400"D#4 040 IX2\ $pPT1T!3#L1L!2#@4PSU$$@Mn0KiPZ0 PT0 RpNN0 R= 0R: 4 4 0| S @6\6"5\ x L  < !l6H!`!(!l!t666С66 6 0-@3Ls@  g PP 0D#< 040 D3@ 400D# 00 4 p-LMP@T`8  T@  p5@E H3SDiDYHCQDD 0HHQ꠵! -QL,M@P`p?D38K 400 P0D3 <0K40@ K0  0P@80<  4$@TD3@ p400 D# 040 A=46X6 -@LPp`3 $@T`V@3 $@T3 $PP00 3 -L0MD34pK P00 4\ 0`2D8K 40@h5 4005PpCh@`=X:S~p   40@P?L6h6 `:6x6666أ6С6 0-@\5Lst ) ( PP%5S#h%\ 040 h5S 400`%r h5 400h% 400 0 -LMP@KTp` T Bdhh`ht\@hh 0 `h@0S8d5h`6 6 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0Q P0 P 0S PX25-5 -LP -L Mp,0 p`gpP| 0M@ @40@0PmP͆ ,@0QP^1 5*Q1,* @0Rʆ ʆ:2 d 0X JR4 h (1X!@0@lP P( 0\ P  0400U 400Uo`XPHp!`!d!h6H\!< $4646L67l!T6x66С6 p-LM:t`@0Pp0: L0 400  040 ὢp!l! -LM@PU`p0  U 5@ :0Q:l0F\05< 0$00 p!$< T! 0-P@L 0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 06 -0L* -LM@P`p ?0 ` p 0 @ @0 -0L MЍ+y p-LMP $0$00. $0$0  $0  $0|x`@$ @0S}Tp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  Hd00 0P@ U0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 z8  X0 gL0H08ƐpW`F(PEZ46t6666${0}_,{0|0}0 -LM$0@  -LM$0P@Plpl`@ \0 DG0S0  R  hOX5x16}06 0-PL0S!@  00 !?C1 $00 0R0#S 0S @ @f97D6P6 -LM$0@P 0h#0h 0-0L P@0,00 \0h6%\6 -LM0 @Q@ 0( Q0 ,00 \00v00 PL#dAi -LMP@ @0<0P 0P`p@ 1  ZPHb Dp!0pqPLR <( 0@\aX p\m}nzow(@KF  0( $ P %PD H LPHP@Q v

0( @\400 D0H P  0SP 0P0@<@0 \d<0@( ,<0@?( `\@Xp0x  㛲X0 S@DRX0S0X0< <0 < 0H0D0P~_#d4666676 0-<0@LP , 0<0@( ,<@0@0( \<@ 0\<0@ ,   0 NP6 0-<0@( ,U< 㷿0 04p\0@4 0\50.9040 \004 , L004 , 004 ,@ }_6 -h1LM \1+R pW`Vp`@P`, `]0 Z4 W08 yvs p5 @   @TPZ5 O0L4I 8F,oL#dAi 0-LM@s4e1Z. 0s0 Z0 p0t 0 Px0| P !.0S j:H0H H D0008Ԭ60ܬ60p00X000b#0D&0b -L -L -sL)PB -2aLMqP@4`KT01@RT4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01_ 0-0L 0S 0 S 0SQ0@A0@ c cx PD00l/"b0_Q0 0`_Q -LM@vZh -LM0@S eRRyP0 00S 00 Rڰ0: -LMP ߽ZT0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`崀0V o鲽VP0Ӹ09P000W0X0AeP 0S W rLm*0V QW 0000BaಪQJUPpW@:p@@p崀\55:7gfff p-LM@PG0`S 0S 00:PpN00 -@Lp+`P@&PUPV0P0  0-@PLPz000!0h< -Lpau0`@S@pP`PP0S d@ VJT_@DU0Sd T` -H0LM @[0P hNu_ - LM0S0 @T0Y\hdd0l,@ 8 #8~4P6 dl\u_@B 0-LMP @0彩;61 ,@0@0 P h0 2K$ 0JX0P0d55`:6_k1 0-LM@PP0U幘0StL0  mH\0\  @H 0P0T 0  L060 -LM@0⏩L0S0P0鞘0L0 -0LMS@  S00P0sH 0h&%HH0P0P>0 -L@Pp`VP RPTU=@ p-LM`\PY6P 2P@0dS:ph0dS: p-LM`ɿ6@ TPPU $   00 00 @ Td 0 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00_1dkaVUUU 0-LPѺ@0hʺ -LMPPP p 5P@@TV,K T`@ r᭺V!P10SV ``VT0\ `S, ( X, (0@@]), (0T``0\ d0Sh,0| l0llp(0 t0l@l,@ ( HA`00X0aBaࡧ<0@H. 00 0a1d7Mb_Qp1@-QF X1Q00 <1Q R 0SQ @T`VpWPRS Q TVW0SS0SSh 0l0 p 0t0 x 0|0 0d0h00l  p00t x00|  00d  %W A W@$W R R | 0\q 0 Q  -LdM43l0 | h5| ,  h0W^40h%0 02  PZ.XK  @0S S P@0'\00x7hhA`2`0S0414!|)D2  p70p702  p7@0p7p7[@D 2"@w>H_00%0Px@K !h 0/x0Kl KP |100|0@0孵0t81p! 0`P  L 1 ,0S 4,|$!0`!wΊ_0@@%0P0`@#Hh P 8`p@w>0P|0%|l꼯b 7666860_&700d6 6rv|p6><:86ȭ6 -@L޸`$P P00$ ;004P$ [$P؀˸0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0#(ДB.@.n_0Q_n_(\_&7 -LMD@!88#,!ծPp ӳ >(<!pǗP` @0  R1V0)0.000@.000000.0 00<0X1H `u\!khPP P <80  mUq67 -LCM⠁ X1deIK$ @0 `1PS 00000d000 ;004 0 <0 A&03 l50l5E $0S $+> @7SY?0Q  h <hPD@0 |@7S07 \X0  ᅤ<00 ,p(p$p꼯b666467`:6@66P6 p-LMdU@*0 `&0ѳph -L M @ 6@{~"h0 -L M@ 0@k~"h0 -!LP!$CP@B 0pP`)0S* p7` Q 8Q2 R  Z0 10  Z0 10 00˳1`ij*p70W.p7 0_ - 0!4LM#PP@ 0pᘳP` U0 80  U0 800 Q ᅳ_ -LMe 40 47 v|`6p6WEV -p@LP`$(h(0"4 40\0$L0@ D0 h 0S000h0 - HH$tL M' `0 D@ PP, pǐ0{ 2Vu 22V* 1V h 0, >,, ez@ ,0e/+{|1V 0e/ ~H1V6 :<10S  0pᣲP, p70p7 , @P, h% 0S0000V p70p7勲0  $44000 |U, 00 "   0,0 0S00p7_mdedAsd rdAhdk~gdh0 - 88@L#D M$`圫P, " , 0*0  0 ,00ŽI(`唠PPd@ pFQX,*0% ,含uPP@PP@ _ -LxCEMpC\, 01 p 8 8<#D0$40LPP h%` 0 S4 4(@P$8 0 ZY4! 081 ` 0@W V X,0 S L,s4A< 0@@0 \41b 0 h5 8^WaO~N0p'S000000@000408( S0!hX0`U\PG P@ `1S000000 0 S 00Rp R0Hp0奐  0 p0W 0  0 0;  Ȁ_7 -LM@p0  0p00$ (0  -PLM 0 0 P<W P-L`@ 0PU R@B $ph02T@D(7 p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp(7 -LM2"0!Q2@< 0 -LM2@p( R U)1<`V W 2s 20 2ih2 02p  lPp`i,p 妳606\66 -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hD尴P0U2pPj奴\2d|16Դ66 q-LP@p QR1< RL p R l0U Ru2602Rݥp`V) l02 1<   1<  ht1< Q    0 2ꩥ -p0LS Q R h0 $  Q 1<0 S 00  p0 Sl  -qLMP` Qq<@T hp0T 0 0 00/<0`T 0`0 0RMp0SF8 0p P00R00S` 6Qp 00h 0-4PL0@S\00P002d -dLM \L@0KK <P <P  1d2d2d 0-d0L \0R@P 00$\ 800S04 2d2d2d0 _2d0  _2d1 -H0LMQ <\ 0 40@2d Q-0L  pS0  A b00\p40 -LM0@ 00 R 0tS0S00鹑 0-00L 0@S0 4k PR0t0R0000h\00喑 0-LM@P$KT 0 P  0@SQP 0@SP  0 0@S  0>0 XW 0Ra R R P-L P ?#?00cS"1"1"1"1hP Q hQ h P-L@`P? T7 T# $q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0 02O 0(㈋"P00R00S0P 0200 RpP0 b_(61d -LM0Pp 0崁p@`@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP 0 od (0 p 00 0o_ -\1LM p0 04`@0puP Y0K  00p 0 @\8#xW P1: p0A!0@p A! p0!!  p0!!_ -LMp @ 0p 00 0 -LMA0p 00 00p 1S0a0c8#0p 1S0a0c8#8P * p101 p0!!p0 p0 @p0"Rh(e00 p0!! p0!_ -LMp @ 0 p p 00 0p 00 0 -h1LM p0 !4  币40X#8#8B0CZ80 >1 p04`0p0@Px 00KPȠ% 00 [ 0 P 0 S0(p"0, @Y@D0P8# 0 0 (40" X8 Z0 0 0_1d -h0h LQ@u X kan_L1(\_7ȵ6е6 p-LM0@SP`E0S1 U)  lP`\P l0 QPU \0`  p0,!phxl0\0PXU\P  U\ 0, P`00 00儇7Mb -XPLU @ ?#<0 p` @cT0p  sD@0S 0 S04mq00=m}6 p-LM\0PS`px@V0@@T tp0x@ 0-\ @RLP0Stp00 0SX0S7  - (L(" P`&0AT" P0S `0SXpW4P#`P`Xp*@ _0X0 -T0LM (("!X@ T  00X_ -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0  _@-$ @.MЍ@_ 0-LMP@@ 0@0CS00Z -LM\. 0\ 02pXP 41` Q 80P d0\ \0\XP 41 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p  ] YP` ] c l fH2^4gP`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! ~afP`,0      00 000tpA@< S l0 K  $@ P`l@10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @T_W@D_ W WW W-00 Ƞ Ƞ,1X0S_D0P  0(1S \0SP_ -40LM@ T0 \ 0ka p-LM|0@SPQ \`V0U\0P\P \`pU 0 (٥pp\`Vp 6$6PP 0P 0!R `0SX0S  _ -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G00kakax_kaka -@0L R 000 0S 0S 0kakaka -4L,\ \ kaka 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[0080 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀唁  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3鄄_|_ 4S @08#<@8oS: S>; S P 0 R0,Rp95 -LM@Q `d1|d1d1d1d1<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S 4 @6 p-LM0`PP@ S7XP W0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ H 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S$ h660Q 0`c Q- LQĶ6 0-0@l0P0 p00 LPU  0S30h0간_Զ66`:6Q p-LM`0PSKX@T 0S1P!00 S P0 pl0`0CS0000 R00_0S0S|| 02c1"yPJL04 oh00zn_\s1(\_766 -L$M ,0 0 0, 40 0(0 @0#4 p0#0# 080 XZ 8@ |0t@0|08 @0,008  D 00008  H 04x00P@  0R"<0 ` 0S P?#<0<0cS 00L k;LU` ` P㌀T 0,S P?#<0< 0cS 00,00P;U`, `PD0S 00S P?#<0< 0cSt 000004;U`0 `PHPf 04 S P?#<0<0cSX 004  ;U`40 `P0t@ 4 P?#<0< 0cS> q@ 0000)L :U`P ` 4L80 P?#<0<0cS @0: UP\xPN0S0S 04 ong00 yPE0S P?#<0<0cS 00  :H U`HP ` 0Sy P?#<0< 0cS 00  :D0U`DP `0c0SD P?#<0< 0cS 00  :U`P `@/|0S P?#<0<0cS 00|  L g:L@ U` P `| - (L(" P` 0AT P0S XpW4PU`+P`Xp\鈄_ -\0LM (("QX@ T 0pl X0;鈄_ -0! LXl p -p0LM Ƞ Ƞ,A0S 0X00#0 0CS0x ꈄ_@-$ @.MЍ@ꈄ_ 0-LMP@@ 0@0CS00x -LMPI(1Q: 1Q?1Q< 1Q0 0Q 0pl00pXP 41` Q 80P 0Q p0QXP 41 PXQ 00S00 |f}fvt~f-00 Ƞ Ƞ,1X0Sꈄ_X R> -LMp @l0X@PP 0P 0!R `0SX0S "ꈄ_ -LMp0PP쀟0AT P@ 0 Aᔀ `OSP@ V !=0 S0SV @ S__s5646 ( (-"L@pPP@0 T0 `04@S X`V0p 0 -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00_ -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S_@-$ @.MЍ@_ -L M`0V,0 :3V3V x3V Ll3V@ ;`3V% X0S\0S p@ppTP ,000 0 d@PPTU 2V 0x0 X@T 41` Q 80P x2VX@T 00S00,2Vf 2V0S SoSoo1V 1Vp@pT ^ 00  00d@TX@T. -P 0 P?#<00cS`  7UPP0S 0S04 7d00^vp@pT 00 R d@Ty 0RZX@Tn 41 P#QaWbW`Wvt}f|fW~fcW-00 Ƞ Ƞ,1X0S_ -LM@P `0SX0S T0 S `0Sh& p-LM`P |kQP@|0 p04 p`e0 00`x 0pȝ5Ȅ_ -PLM`@@ pPdP`0ph0p R0pd@\Q 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ \0 S\0 S -p@QpPpp TL\` 000Sd@TV \P ` P0-L@ 0SH00 -L@M0 4,8 mQ`( G QMQLQCQ _AQN -@Q (0S (u 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3 0/S51|111111111111111111111111111111111111111Щ1Щ1Щ1Щ1Щ1Щ1Щ1Щ10@TPp @TTK 0X@K@IPsT0X @p004 8PJ?66i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U'LP000 ㍻ ^0 /R 19R00C P^L0 0 C^L00C 6AQ$1111111111111111111!R,00 ,R ,0,00,0 p-LM,@AP0CQK41\1d1d1d1l11T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T11T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T11T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMp0PS@ !0@Tp0t R`@ 0!0@Tt x RD`@ 0!0@Tx ph:5;5 -|0LS@` QP!0PU|0PPPp01| 0 !0P U"<5<5 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C ꀅ_@7 66666$6(6,6064686<6D6L6T6\6 _d6l6t6x6|6666kap_53 -LM@PTp`\ 0 S  0z P(0  0FP 00  P@ <č Kj  0R P ꌹ66 -L M` P@, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  @$ D1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 Pld̻` Z<2<"082 4"002 ,"0$2 "0Q0 0(02 0 1 00A S-1x1x1x1l1x1x1x1x1x1x111;(  0t!0p1 0h1h!0d1( 0<(0,Q~(0,<(0G~e \0  c 8@PU  \0$!0" a<0 05  a8@PU (0 0(0W ED$A@5<a븺111111X1t1<11111h11Թ6 0-L@0PS  0Rc0Q 000 0T R@-@0P 10RS<8 00@5 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  `F0v@P -L(@pP`0S P$` W(00(0(00(0G-@MT> T2 ,P E-./0p1` U0ޕ0ޅ  eS22 R0ޕ0ޅ b BS22 R0ޕ0ޅ b BS22T T 1\hЍ 4 8 <\h0 48<\h0=5-! !^p@-C7@<00RP`h@$ 0<$ XL1H!!0"PEu R ^@@@ @@@@@ S ^@PEup(0  \B1 P0"A-(0@ @0 $00bT0C$ X>" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  {@P@ p  00@p00p騅_ -LMX@$p@% bT0 apGL Bw &R$  EpG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@Tp@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000p贖__UUUU33330__ -LM@v 0 ST0 S Dt@00 0 000 0,0 0S016@1$11,101@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 laka -LHM`\@p oT X !4.0 X@$P嬐 W& 0P 8PEpbu ( 0PE#200u0   @ \0 AD! 1000C0PE00u0 PEu00@lalaka -LhM`\@p oeT X $!4.0 X@$P嬐W W- 0P 8PEpbu ( 0PE#200u0   0#2000 @ h0 AD! ! 1000C0PE40u0 PEu000 @lalaka -L∡M`\@p oT X D!4.0 X@$P嬐 W4 0P 8PEpbu ( 0PE#200u0   0#2000   @ t0 AD! ! ! 1000C0PE80u0 PEu0000 @lalakaA-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000|괆_0__p@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0pph0h  @D1t 0p 00#0q0@D0#0t괆_0__G-0M, 0P@,P00X0PPP` U$p@,!0pG0 wP( 0b@U0S T eR0 APd 1Z * 0! j\8%1^<,pG0w0Ѝ%0Z:$P 00Q( 0e 0 0 0A22V$00S,P`00`  `VpG! a `Bw  02 0,Z0 @ V0S 0 S fR0 J\Vڬ3 00003 !@@D\ V0S Q fR0\@D(\% U0 S0 S eR0 0 @CTŸ 1Q !2 0 c\ 1^<  pGw] "0A\<X"0  000, 0pG!0 w> 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S30___0 0 S$0 S000S 001111E-M pTJ<h@J+X< ,$P ` @h0 P- 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEu@-A;A'<00<  |hx0h@  0011 @01 (01 0 RlaXla -L<M@\`Pp mj1 WT0X(# U$% 08 P@Pcp!!( P0@#1<0 p 01<0  0 \ 0<L00C0@p (P0@00 p\laXlala -LXM@\`Pp m 1 WgT0X(# U$+ 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 d 0<L00C0@p ,0@000 p\laXlala -LlM@\`Pp m41 W T0X(# U$1 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 d 0<L 00C0@p (0@p0 000\laXlala0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 0h1111G-M(T) <h@pX)'< ,$P ` @h0 P@ / 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@`lala -L`MP\p@` md(1 XT0X'#@v$, 0P8 N`c~& (p @`0N0x0~  01x0  0 0  p 0L 00C0N80~   0N~lala`la|la -L⌡M`\p@P mT1 XZT0X'#@u$5 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~lala`la|la -L⸡M`\p@P m1 XT0X'#@u$> 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~lala`la|la(0$8 Q!0  Q:@50@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP r80`@T  @Tphrla -L4M, <q7P4 ,4< b,@$0 0⣡ , 0 404@[7P8 u ,  ެ,  0@ T,0D $0L0 L,0,$0, L0 (P 8 T@ H X@ L0pWLX0H ##,*,T  80@ 0<0 P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804P487474 4z78 0-L@ rP%@qTP 0h(0-LQ@0 0R, 0 S la_la,0 P 0SPla -Lp `Pq0@T U 0$ R @T qV 0 RX 0( RW 垬P qla -LM` q $ (0Pqr@ R0P0u ~q0 00 0X0`01 Piqfqq@ R 00M [q< &$ (  W.W$ W$!W80B@@Fq R 08  809q088 0@68 @W W  W  W W W  W|  WWl Wd W<55P q\b_labb꼯b 66Ŀ6F2п6 6(6D6 K2`666 -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  T1i P 0  0 00  `PP   i  i     d 0SS00D h4 h0 66646X6|6 -00QLX0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S u P 0S0  0S   -LBM p0004p`XP@0 Xf 0@0X0 @T@0s 3@R{ CKA A Bf0 ,1R6 #P111s- Q 0L`1S,0 0 Y$0 (P @ > F>d00] ,K0{E| W1<0 S0SS!0@S4010Tn2603dSE5_`:6,F5C1 F5E5 -QLM@CϠ m? R  0S T @ hz Q0- L@P Q 0|1Sm?@F p-LM1 S@P\`|P50p4F`_ 0 603d -0 RL`p@ @*PX@ P 0p000 @WP:!ÏE? R 1S 1S 1S m$>FOK>\ >m>>FO=> >00Bao27Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PP @T*0P\?@T:@T*0\%@T:L0W 1S c LK?q@lPTP LK0|  @TZPQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a堎 00@W0@m004\U^00lala6 0-LM00P@K4U O4 0000O 00Cla 0 03d -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P40Uφ0 P<6T6h6666 0- LP@0PP 0 P 0S 000CSPPP 00 -LMP`@ w]000 4 080P@XY\` 0X0 Y 0\0 ` 0S4Pp X0S0S S0 X0Y R 00CS񟗧{2{2{2{2{2$x20 Y0X0S S0BSt{2|{2{2tx2{2#0"]T 0S0@T<0S| =Qy X Rs R00c 4D0 iP i4<@0 _PX0SG 00p@Pp @TZX 0S- 4S* 0S% Sp2Y T00BS y2y2y2y2z2D\0 i9  \P \1>P X S4>H0 P P= i\>0S4P 0 S00S=  X0S 0@Th 00S> 00S<  io\PL c @ > < : 8S*0Y0 00S PS 00666-6668_5 6,6X6p6,_56666666 -pL`@P@P(PU@ZM0@0CS0MAT P0W1 !0 s |BpA@ -QL1  Q S 0S B -L`p@PPPU@Z@P`@PPU@Z@`p -LM0@S  1S01 1SP P1 010C1P1 VZ6 -LM`pP @ 0TP@@ Ƞ,Ƞ Z0000 R P@@y= -LM@PP`  h0!T` 0D0040 R PࠁࠓN=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qr_  ˊ 0P00p000 0 0PPEDd 0 P@00 0S Ax_= p-L M0PS@- 0BS갃2,2Ԅ242242H2x22T 0R0P RA R*R# T00CS000@  0PPpph90\# (Z X 0 ?T T 0Q0ph >D 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48錨27 p-AMLAO0P `0 P 0 C400\\  P202p Php'2(6 -LM@? R#? R 5+Q P 5;5Q 0S110C1<P5 ;%5 ? -? LRP0p!5@@ A]o @Tڴ5 H d 7P9 7P3 H M F K2S 5%N@05% +%A. X.T0m.P myA(P @627\6 p-LM@? =l]PP? 3lTPP? τ%ld @oPP ̠ ` Pp 4Op  꼤22x666 0-? LR!^? ( R $@T L0@TWK0 0-@L!NPvK000,  0 -P?pLP@`w@1TZ1TD*1T4 1T ` @%# = S =@S @ 8C8`2%2  f 2 [ @ o5050 R0m 04P`5@`0El0T `0TT0P\բڠD0T!.0`2i 1i i i 5i i 6i( p-L Mt0@0t0P`N]@O0 K` 1SI@p86 -LM@h -00%P-@%LU  %-PSP:P!`PpPP`PpP P ? jr}bdr}bP vP02x Nr NP `P02b xqN\ dkNP JPRM ,\NG VN6606P6p662/02m -LM@20CS2h 0-LM\P @0?00K:PEDLKK CʠKC6PKK@K0KKP0 -LM?`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0pxM 6 -LMϠ P`UCĠp@ K 0Kuh 0P K L0~ @40PweT xM! 6 -LM@2/ 6S00@ RA?< R 0, O0ShM6 0- 03!^(0LS $@T J0@T!I0 0-@L!NP@I000,  0 -LM?D 0Rp( 00 ,0  (0S (`/ 04K4 [30[ d1R`hU&h@ P0K< 50 0 ~0S\0KΠ =0!U @P`꼯b6 0/QE 0-@MLP 0@Kl 0X 0@0@ @P(1[#4S4  <0@Ps 0@PKj <0@@P` 0@xPW H0@oPN 0@f0 04@_P>  0   0-LMP@ 0PHP('Ϡ  ^0  0P7P  H0P.P 0 %0P"P  0PP< H0PP 0P (0" -LM 0S0 0P 00f5 -LM`PpL0x2 P@0 |#/>◯@"\RZT3@/2SP@ x$KfPb3!T p/p  `KU0< P" 0S;9$30@TTP 0 S00Sd" 0@T= υ08q?0j  K/0@  0`K0`K0`X υ0Q!?@@PK {  X0P}10p|!5x1 t!0p1!n h!40d18  <0 L!L1p 0F$ R "0"#[* )0  T? PP wx @Hi9?T'> PP fx Ol$  PEr% ]@ %5;590' &0i&/0` @D `0 @ , 0E@x,;H6662276 -X2LMQP@`pr42Q\*,2QH $2Q p%9 = S# =@S @ 8C8|23%|2  0 K [ 0[40 |2 X 0 K [ 0[40 p@ l505%@ 0 R0+f 0u 4Pp5@pX0 x0Q l0Q-Pڜ0P\0S\<0Q!. 0p{2i 1i i i  5i i 6i( p-L Mt0@0t0xP`G8 M0 K` 1S8pk86 -@Lb00%P- %U/&lPRpP9tP `PpPP`PpPP03rvbryvbsP tP0t2x "G x G]P pP0p2x x Gx dGGP lPlRx ,Fx FT6x66666 0-LM?@0TA KPK0K 0?0(0K00K0K0K@K@KK@KPPP[ -L M?@TA K0K ?0(0K00K00KK@K@KK@KwP0 [0[4 p-L M?@\AdBT0 K  p@0( 0K00KPK`KK@KKKTP00 0-LMQP@ ?0@00K(AĠ0EKK@KPK0KKK0K7P0 0-LM?0@P (K0K 00KK@K@K@K@K@K0PS0KF006 -LM0p5`,? <5 ??\ !?@?\ RU@ P5<5% ?@E ;;1L"  w0S 2 ;;!L0U@P597 -L M?@ \K @0(0K 00KKKKKKKP(yE6 -LM 0S4 0 0iP 00_ -L MP`p@ E! uP(R!1 p1#.p2/1,2bb, K&P E,@,0PT,PL 0 S@00S8" 40@T(@K6P&  WE u0 0@5 0 0 X 0`vR!  !#0  6( 00S<"00S4"  4"E662(2x2 6`6222P6 -@L!#`((/0S0Pf65p@  F00X6( \Q Q? p-LM@R40+P`  0 u @pusP@ s1+(  Dt7pD6 ?0-LP $@7P  0S 0(TP7  P]7 -LMO0 S   (6P7  P?7 -LM@0p(0 0`S0P 5@ R, R00RPPU 202PV @̠p00p0 s 1S i 6P? R( 0-? LRi@0P 0x0 0kx0x0m0x0x0 0x0oPl00l0 p-AMLAO0P `0s P  0 C40 D\\  MzP202pT cC(/4p'(2h6 -LM@? R5+Q P 5;5Q 0S110C1<P5 ;%5 -LM? PR0p5@@ 4*" oo gd@iTڴ5`   `r7P5 H7P/ $ P# L" H D@2S 5!N@05%+%E4! Dx!@0ix! P i34B@627\6 p-LM@? =,PP? ,oPP ̠@ L P~p Bp @266 -P?LP@p`k31T\1TF*1T6 1T ` 3%% = S =@S @ 8C8`2/%2  `j `2 `] @ [5050 R0` 04P`5@`0A40T(0P\դڢ2i 1i i i i  -LMP0/@|To t00t0Ac30 K p 1SP36 -00%P-@%LU` 2! @PPDP7HP`PpPP`PpPPrpb{rpbP HP0H2 A AP DwP0D2y xAs dAP @aP@Rd ,sA^ mA6606P6p66 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(Mp8KSP@~,0[+ [4S!A<K@ KwP` !0A<  A0 Ġ(̌"Č!̌  P`T0 Ġ(̌L"ČD#̌L8#D !L 0 @P`6@<P Ġ4(̌<"Č!4L.< ̌DL8#D 0%L @qP` < aOq L @< ( 66666,6T6 -LM05P <5Ϡ000  m/B0T00p` @  ?0488W p" ?rP `P pT@5O<5 P 8  #8 5+ -LM @P/P 0@ h6 -LM 0S4! 0 0P 00Lg5 -LMpBP KP  ? `/0@VM02S 42S 0P!?f  PPP 51O@`P $? o1!0@5 1!0 X 0pWq0  1 P 0 S00S4" 0`V00S8"00S0"  4?|6 6H66+6`62<22P6 -LMp`P@ d? 30Shr\\ ἀϠP开0\@  i.i@?662ܯb &7 -@L0P2`Shpf0P0S 5@ @q0000P2Q Q? p-LM@R40+P`  0 @pmP@ m1+(  >/n7p>6 ?0-LP $@7P  0S 0P7  MP7  -LMO0 S  T eP7  1P7  -LM@0p(0 0`S0P 5@ R, R00RPPU 202/PV <̠DA   @P}<Y"0g>R(0K ( R n 0 4(0 bo(0 Sl00l0h00h0( P / 07Pl00l0 <P  / |26 -P?`LVp0@ /5X;e5 XXmu/t00t0 L>X @mp00p0 @m 1S > 6 p-AMLAO0P `0+n P  0/"-C4? 0@ @\X  P202p =Ypl26 -LM@? R5+Q P 5;5Q 0S110C1<P5 ;%5 P -L M0p5P@` .@υ 0@ / 005  00 @ 7Pp v7P <2S %@ %5;5i. P  A=@6\6 p-LM@#> ?PP = oPP ̠< L P$p =p |266 -P?LP@p`jb.1T[1TE*1T5 1T ` Q.%$ = S =@S @ 8C8`H2N%H2  ?  bH2 ?  @ [505.0 R0[ 0`4P`5@`040T(0P\եڣ2i 1i i i i  -LMP0/@|To t00t0x<-0 K p @1S-6 -0 5P=5U@<LPP@P7DPt`PpPlP``PpPXPXr|k`blrvktbpP DP0D2 <   R5+Q P 5;5Q 0S110C1<P5 ;%5 - !LM'NPp `0Jj?  P  L||  0S2020K# p j'3 -0 5P=5U@DLPPLP7Pd`PpP\P|`PpPtPutrh|bo\rhdbP 偿P02 9} 9P LkP0L2m x|9g dv9P DUPDRX ,g9R a968606P6p66 -P%>`LP@pD* 1T51T&*0T 0T p * @ p>@ X50530 R0W04Pp0240T(0P\2i 1i i i i -%> Rt00t086 -LM0`5P@ M*2s 2SC 7P< 7P@4 =<? 1Pp 8i**?<? Pp O0D  p冿峾%@ %5;58p8?"΅P? P7Pp u \666 3@63`6 p-LM@R40+P`  0 {i @pgP@ Eg1+(  X8g7pR86 0-0_@ LX07P  0S 0P 7  P7  0-O0 SL$ , P 0ҾP 7  P7  -LM@0(0 %0pSP0`+5@( R1 RR# 2S$ U 2`02 S02T700DD@A   @嵾DA 7"(0K ? (00C(0 ( R g(0 Sl00l0h00h0( ` ) (7Pl00l0 <P ( \6 36 -LM@%>PU`0p (5V;U5 VV t00t0^ m7V (LӾ(K 0偾 P(0St0p000t0p01S ( f ` 6Q Q%> -RLM R0K R 圾 OAq- $0A0 0!q "<_ -LM 0S4 0 0P 00\h5 -LMP`cp@ 86m P@#?@"R@2/@3S0 KvP@000400 x4 ?080@0<0 `Tk80se <0sb @0s_ (,`K 0P@Jn6  f tP$ 64`0@  ,Tph,'Q Q -LM┡2 S`( tp5 U  <5   (0S (y0K _)[ 0)KHRU@ P5<5  0 f0S c?0 00U@P5 꼯bd6 p-LM2`SP4"8 "4D0 mP&4<H0 fPOD0|  `Ѻ20CS2p ,3` pp"366 p-LM@R40+P`  0 d @pjbP@ b1+(  3b7p36 *>0-LP $@7P  0S 00IP(7  PR7  -LM*N0 S   0*P(7  P37  -LM@2S"2S 5+Q P 5;5Q 0S110C1<P5 ;%5 p-!L!M*^0@ `0pc @;\< l1L0 H   2022@0CS2T20 2p 820ȴ 꼿 #^` 5X0p fa ! 1PZd Y0XP0P! $P 0 S00S$" 0@T00S("00S "  0/66 6H6`8343X93;3rP6 -@L `p`00PS 5@ 00  ̳ rQ Q0q p-LM@R40+P`  0 @p]P@ ^1+(  -/q^7p'/6 ?0-LP $@7P  0S 0õP7  P̵7 -LMO0 S  8 奵P7  qP宵7 -LMP0p(0 0`S0@ 5@ R- R00R@@T t20t2mPV ˠA,0  @卵庴,ᖼt"0.tB(0K ( ^h00h0( @  ;7Pl00l0 <P  Aq136 -0`LPpU0@ 5X;U5 XXmt00t0C PR.X 0幵p00p0 ] 1S 2q 6 p-AMLAOP `0w^ P 0XX  +Ph20h2p .?p<336 -LM@0 R5+Q P 5;5Q 0S110C1<P5 ;%5 q p-0LM @R0P5@ p5`7Pl 7P ,2S %@ %5;5ph P -q@6\6 -LM@"> ?PP#> 3pPP? '΄$ @p/oPP ˠ, ` PQ~] 4l-V R 7313x666 p-0LM@PQ00 5@ R R00R``V p2020SU,ph飴"t"0 0-bq6 -0`@LQPp+0T 0T p y505-h0T  R\  @ p@ "qi i i 0-P@P0L HR 0t00t0, 1S 0hq6 -0 5P=5U@,LPP0P74PX`PpPPPD`PpP<Pt j S%H0S D0SP5P@@05%+%\ p#l0$y)@$  /\6.V37@6 p-LMBPT pLD <` 00@  n!T phi!.'Q Q -LM2`Sp`t5 X  <5  o$  HRU@ P  Z0S-L P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 P&4<H0 PO̠D0x  `儯屮20CS2phꈶ ((`ꁶ ptO366 p-LM@R40+P`  0 Y @pWP@ TW1+(  g(W7pa(6 *>0-LP $@7P  0S 00P7  ɮP7 -LM*N0 S   0߮P7  P7 -LM@2S"2S 5+Q P 5;5Q 0S110C1<P5 ;%5 p-!!LM*^@ `0'X @@;T<d+ H  @嫮202խ2@0CS2T20 2p馵 4'0↩ zpS<@tN36 -PLbpVt@ 5X;e5 XXmt00t0v t'X 2H0220CS2@p00p0 V 1S K 6 -LMP`2S@tp RA R00RppW h0l0h0P(T ̠AD0  @2 02@20CS22D02啮20CS2 h 0'hp00K 6 00 CW00S,KA :W+0[l00l0h00h000 0C00 0 0pY `7Pl00l0 <P T E tO36 -`L2PS@pj21TM1T9*1T) 1T p !5 - R @R @ pY Q @ g5050 RtD t<4Pp5@ ?tl0T `0TT0P\կڭD0T/0cp2i 1i i i 5i i 6i( p-L Mt0@0t0P`L&*N0 K`d 1Sp6t -5@=P5LUPDP9HP `PpPP`PpPP02ЬrJUbʬrDUb>P HܫP0H0޳ p%س \%(P DƫPDPɳ $%ó %06P6p66 0-L2_S2(0S0ht!$@T "0@T0 0-0L"RPO 5@00"000!000,  0P2S0g -PLM@* 2tpS&_P`" N!"R O \X0i,0 00 0S "1S DV372/02| -LM@20CS2h p-PLM@`P Q pV pU UPpU] U 0ll "%P`P`0U  XU Q_0UP6h5B7F p-PLM@P` 2SQ pUUphU] U 0h h$`P`0U   U Q_0UPh56B7F -LM 0S4' 0 0_P 00i5 -LM`p vPP@  $( K,PP  $(1!`!1 ἀ|1|!峀x1pPp!p1PP礫0`U@(堫P> 0 S200S=+ $0@T 00P P P 0  l0 㤨00S|0 00Sh0   P"$66 6p!t!z!x!P!((((\6@686!v3!!p6 -LŸ2 RP0p  0  0SXb0SW:(# M@IJ.!@00CS0 0S A ` 00C! 0Pa0 S AP?AP#xAP d1 X 獩P00ꎱ #ᇱ #תX uP00v #o ~#꿪P ]P00^ hm#X Tg#9$i(!!P6!((!!!p!p6606P666 -0LmMSp  !`B!@%=?ZDP U@@T,0 -@ WS eNN0    P00, H#0#"h6j5((6|(!'m36 -LM?pH0 \`,0 H \(A0S Q00C!00 S1 @=]0P p0pᴠᶐ,0@000N0@ }@  8p @凩 BD0P@@;oFP!((t(x(!Dl3' -LMy= 2Rp` h2R \2R ]PD2D"p 0 00@0/N2@ BŸ   @9-0 0@? SO y= R 1R" ʈ1R 1R Tx1 @l1 p p 0 00 01R 01R0ASd3d3d3d3d3d3d3d3d3d3d3d3d3d3d3 0P 0S0S? 2K"K,pKsD0 ,pK2K"KkP! l(p(!Dl3'*D* (!( -L@M`83? Q@ y=\ 3Q d 3QA  ] C0?pP% W@-00 00 RhqM2  mŸ 0` pz 5h2P@ @    BQ%-$! 0 ""K0 2K"K )= R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "K\!P0p2`TKPK& MV?G K5KlQ]PpPW 0"K0C "K Sh3h3h3g3h3h3h3g3g3g3h30,`K2KT0000000S:L0,`K@KBKP! !'Dl3p(6(* (! -t0tPL @`T0 0 q @ 40P 0(00C ` 0@ P!((( p-QLMd@ P L0L 0 S `P`p0` \P!((( p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S Ppp40P$0PP!((((( p-LM 0@0 0`cPx Pl0PY0ڈ1!51 0|!|1 0 ( pKP1!1H1)1<K 嚠0!#Rr0` VF 8! kHP@i IH1[ @0 0p0V 4 8<#8:#:0 0^J |;`S80 @ 51S 5   , 0 K0$A ;8 1 , ( @ U@ 7 X X07S@ @S@ @! f  g@ VP Q@1PPXS%X   C  X 8&PP JB\ʔn4 0`0000!\:  0F@0\p '.40PE X \:Ÿ  P*X WP@:0/. 0b < ::02n` 8\: 41  i'8 0PPOE   PڜP@ :0/. 0b:8,0 S 0,/ @@ T7KKl  .4 0 Tǚl0$ .4 00 S @' cTdT  "bPTX7l0T'!NlU0.NH qD 0 A~@pm !0@T`0p wP S 1  <0 PU> < 0 PEPT8P<1)-4AH L:  @jH 嗖P  Q 5QN n   =5;5%@ % 7 S  h O \^I H@Vj5"VS6 6 6l3D,6P6p66 0-@P [5L=05U   t P:S :S0h?] ZX ZٖZD01 0-.@0LPNW0CQ  T 00HSAQ B00HS00h7 -LMPB? (K$K(KP@L0p 'Kn#K @&@K%@K"pK!@K屖 ɕ",3 p-RLP΁M.|`|0 pht0 T0t@D0 @@ <ʅ@J$ 0ph4" 6  7 0-LM0 @00P<@0zTT@T@ p0L00kD0000D0>P h_0 40P40h Jl5d6x6`:66а306 p-LM00@@P0`SD00D0 0@@0ph 0-00@L@P0S R000H0 0  0hv -@ML40@ @,@g0S hhf\603P6 -`LYL0PS"DpD@ 0T  R0000 0  @ <PL0S  D@T/]\6 -LM@0<@0D0 -0P0CLpS?p333T3T3\33 0 S00 0` S0C40pP`  0$0R  0 4P  0 S00 0G@` ,: 00 0 0  00  00  @ 0 S00 0 S0C4 P` 0 @ $k>0@0ma maD p-LMH@PT0`Q4& U 000SHPp@T 0 R @Tp000SH@ pPp p-LM0PR `@$0 $R Z RR 9R3 4P 00 K`V 8O@8Ÿ<8N0 @@<(p0$  ^``00 @8Č0`` `@u1R 1RH 0\$  G 04 < Z(1R0  R 1R KL   R # 00S0##400R R   R  00S0C4H\0`H 0\$q  j,3 p6 ___ P-0L 0 m t6 mbl5 -PUp`L e SP@ U 1R@P<=0SPP p-LMPK`@8 0` >P4p 0-@4PPL 80S0e00hBR -LM@e pP`A 8<08SP 00@Ps s0l0ML@P \00l m0n@o@P80X q@r@pPP@'X0<0T0<@0P S`8eY 8N0@@<P@ <J@H8eA -8` aP@m,3 -L MP `0 Ƞ(,@0 , !@P`p0Z ,)( < 0R)< 0 Q0  "< 00S RP K R D -LhMؠ0@(0 PPK` (0xK(0 ;@;@ @e 3Pp0T  @@+  (0 S (鼯b66Pe -QLM@p* 0S' 0S$ ;`P~U~P#0 P 0f0  0 SR*000 0SR: 00 Q 0S3 : AQ0A Q0A <0<  $0 0  nbmb 0-LP@T 0P 0T0C?0D RR1*00 RR1:000 - L`ePU e 0* xp@T e$ 60`0p6 00 ?0 0ppppP0Z00P00 -Lp` PU030#\Z0 @pT0 #;%4X0P 0p -LM `Vpe @ 1PU @e ) @Te% 6 0@ p`0 `6 0 0 0 0``P@000 Px@ -L M p0 0W`e , 00 (.PUe & @Te" @6`@;6 00,0(000  0pP000 P. -LM 0`Sp(PU! $K 6P`e @$0T0  'P`e$00@TPU0 0sP 0AQP0000 p-L M`@P{P 0 KP  0R 0  0$0  $00 p -LM0`P4 ep P@0 0P 0,p` ( 0  0 00PU0e@0 0-@LP0 P(0  00P000h -LM@00  0e0C 0hX P 0 RP\ P 0 RP\ -LM("HP0 T 00 -LM("HP0 T 00 0-P0L00@T80  (P00 -LM,0@0(00 001 0-L'M@PL@ K @ ~0 PS 0鼯b6ʖ 0-(0@00P L00P,00 0,0 00 -,0 0(,00 L000 -00, 0 0 0 0  , 0-00 00, 0 0  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,0 0-@PL0$00$ @  @R00@0 -LM0@S 00P *a0006 p-LMP@(`V $0S00S 0R*1 00 0S00 V 0S 0Sph`pp  -LM00@ 2P00H p-LMH@ Pu0`S phm000 0@@0f -L$Mx`̠pdß `0 @, 3\00 u4PP 408 PP 8<@ @0P PU(@Kr308$ (0K0' K&0K0 4$0KPP44?PPSLPL0PP0TT0XS P@h8H iPH PUHPX0͠ P PPPLO<1`*K 2K7 }7? 1 P A0 x@5 0 0  xp8@0`2<8D P 8@ @0vPa _666 64_3 6(6H6h666636*XbI`6,343x3 - L 6 -LM5@+-Q* d2S 0 S 0S1! 10C1h 6`P 5;5Q 0S110C1<P5 ;%5 ㅹ -LMx@P`5p;5utPVt0p000t0p01\Si>5tp 0-Lx@P0h -0LMR@P(0 x`, RRX2S S0X2͠\AHX0  @P@^ Z SX2d2X"S0d2(0K@(0S Sl00l05@ Pl0p0l0 (00 0X( Z6`h0<0Ph0  3666 0-L4P@0 41P+  700A50 -PL@pW1T`50T&*0T 0T ` E @ `G@ 505<0 Rx&$xs4P`x,0T 0P\2i 1i i i i  p-LMt0`0@t045 ;%5PDph6 - LMx@5@ 5@05%+%h 0-LM@ T0P5 T0LDHH  L0S(tP0V0' 36 0-x0%P-%Ut @RL04tP -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 9P $000S$ 0040$0$40D`(00(0 <33$6 sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WP d `L6x66 p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@16 -QLM@8 0C?. B"0c `66 - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  hu(m56 0-T L0P@K \  0 @0  P=$8P 8$8P <8T @ $8P@40 }T00T0 00h@T0 00 T00T0 )X <#3  \0 + ;8#(0$8P 8T0@ \0  ,  R,,$8P0 ,3786 0-P(0L0T0@08T0$P0 4PL0 0h p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@0ppp p-LMT0@![Y$80 P8}`$8P0 4P ` cVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00@3h, \00Q0S p-LMP`,0@0P 0P 0PPP[0Ud0`[PP`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00T 0@ T d00<0H0 0\0HT  0d0T 0+ \0T H 0d0T 0+ \0H( 0H0& X0H0& X0H0# xX0~H0# oX0sH0"giHPCQ- -LMT0@h|0S 0 ?C5A0P 0S0Q  0-T0@ L08P0 $4P0P8$ 4T0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000- 000008P0 $4P0@8$ 4T0@@ \0 3P   006    0060000 0S  < 0060 006 0060@006 000 00608P0$ 48PP0$ 4 -LP m5 p-LM@P`  |(0tH0 L8 P`0 T0d  $8P4 00 X0pphm5\6m5 0-(0PL@ F 0ES 3333 H0"S 00 H0"S1p H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 8)l0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4% 8P0 $4P0@8$ 4@ 000 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP m5 p-LM@P`  tu(0lH0 L8 P`0T0 $8P4 00 X0pphm5\6m5 0-(0PL@ 7 0ES 03P333 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% `0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 0 0000000000000000066 -LP  n5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph7 n5\6n5 0-(0PL@ 7 0ES H3h333 H0"S 00 H0"SPp H0"S 8P0 $408$;P 80% W0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DTT3333d33333333t33333333300600060000006006 -LM@8$P 08 -L"P 0n5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph>0n5\6$n5 0-(0PL@ 7 0ES ,3L333 H0"S 00 H0"SWp H0"S 8P0 $408$;P 80% ^0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008$P0 4  00000000000000066 -LXP ln5 p-LM@P`I  t(0lH0 L8 P`0T0 $8P4 00 X0pphtln5\6`n5 0-(0PL@ 7 0ES T3t3 33 H0"S 0 0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4000  00000000000066 -LP n5 p-LMPL`@  0#(0H0 28L0 0P@?>C2<0 S T Q P0$8 40 X>8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\   $4P@8$0 88P0 $4 -0$8 P8$08P 8L0n5\6n5 0-@L8P0 $408$9P 8P$8P0 4 P }U0 p-LM(0@`PH 0BS 3334 H0"S pp H0"S3p H0"S 8P0 $408$;P 80% :0 8P0$ 408$9P 8lp p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<00<0006 -LM 0T@!'P  @%#,00R0S ? 6Z p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0pph!6ho5,6 0-(0L@P0  H0"S0ES4|4440%0^:p00X6 -LM@a8$P 1<8 0- 0@ L|PP  0?.C5BBT@ 0&0S$ &Po5J66 p-LM@P`b0S  ( |H 0LP`8000T0 $8P4 00 X0ppho5\6to56 -(0L@pPA H0 S?0BS44H440% ` V j80P$ 8 0$8P 88$P0 4  5J6 -$0Pp @0 `0 ,@L8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  0060 006 0060@006  0060 %P x %P8$P0X 4000000060008$P0 4 6J6 -LYP o5 p-LM PL5 3S@`* L5 3S? =  (0H0 P`8 0L T0 $8P4 00 X0pphi\,0L0? 0L0 o5\6o5o5 0-(0PL@ 7 0ES 4 4 48 4 H0"S 00 H0"Sup H0"S 8P0 $408$;P 80% |0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 000 00000000 000066 -LM@=8P0$ 408$0P 8 -LeP o5 p-LM@P`V  t(0lH0 L8 P`0T0 $8P4 00 X0ppho5\6o5 0-(0PL@ 7 0ES 4@4 44 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LP p5 p-LM@P`  t}(0lH0 L8 P`0T0 $8P4 00 X0pphp5\6p5 0-(0PL@ 7 0ES 40444 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% %h0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@$8P 088$P 1<8 -LP Lp5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph4Lp5\6@p5 0-(0PL@ 7 0ES T4t4 44 H0"S 00 H0"SMp H0"S 8P0 $408$;P 80% T0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000@000066 -LTP p5 p-LM@P`E  x(0pH0 L8 P`00T0 $8P4 00 X0pphop5\6|p5 0-(0PL@ 7 0ES h44444 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4 00000000 000066 p-LM 0`0@P/ 0?.AB"'(0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph$8P04\6$6p5@6 0-(0PL@ 7 0ES 44|444 H0"S 0/30 H0"Sp H0"S 8P0 $408$;P 80% 0 -LP p5 p-LM@P`   0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pphp5\6p5 0-(0PL@ 7 0ES 444<4 H0"S 00 H0"S4p H0"S 8P0 $408$;P 80% ;~0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP 0q5 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph0q5\6$q5 0-0BPL@ S 444` 4 H0"S 0 H0"S+p H0"S 8P0 $408$;P 80% 2u -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000C 00000$8P0 4' 8P0 $4P0@8$ 4@ 0060  @006  006000600068$P0 4     -LP q5 p-LMP@`  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH'H' 0q5\6xq5 0-0BPL@ S #4$4#4h$4 H0"S 0 H0"S)p H0"S 8P0 $408$;P 80% 0s -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 0 00000 00000000 000066 -L0P q5 p-LMP`@!  (0H0 L8 P@0 T0d P0 $840  XP0 8$4 0X ; X @0X : X X0 \0  ph2p$8P04\q5\6q5 0-(0PL@ 7 0ES |'4'4H'4(4 H0"S 00 H0"SCp H0"S 8P0 $408$;P 80% J0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0@0,0$8P0 4  00300 0 000000S S000 00 0, 00000066S00 000P08$4 00<000 - LN5 Ó0 ?0 0 2P 006 p-LM`@P0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0pph7 6 _46q5q5,6 -1`LQPp@V(0Q 0GS p+4,,4<+4X,4 H0"S H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@p H0"S0% 4v % _7r546 -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000000066  _7X6D6L6r546 -0LP p-LMP@0H00`0X4`H0\\X00`xd@h0l0|@00@ yph6`:6\14\O4X/4 0-T0 SL@P XP:0  T0S0`6 -@MLT ,0@(@ţ0ShZ\6/4P6 -L`_P0PSXpX@T 9X@PT0 H pP0S 80@T@ᾣh6 p-LMP@00`X  0@0 P0php 0-@ PLU h 0R0 0000\0 0 0hY0h0S` -LM@004 P 80 8 h80 8 h> p-LMP@ ϣ80 080TP PP`x80  0 80ph魣X80 80 p66y5 0-80L P  080VHP @T H00H D < 0 8080 0-@L004004PP(400PPPP80 U 0400<PP8006a6 -LM@004400 -L 00 RQ400P -Lpa``P0 S@00 T0p0011@P<80080p400 40 ` PP @&p Pp 46`6 -L@0P0P 000DPHp 0 P aP<0`V0 00`00  <0`V x66 0-@0PSL  0u0S< 0000L0 R 6`_ -LM0 S@0D0P0 -P@PLDp`@ 㖟0 !  ㇟\0(,, V`FڪV< b̚5 p-LM0 `S@DPpbM 0 !T phR -LxMxpH@0T` 0  PK0StD D0$@  @T 0S  @鼯bD4D46 p-LM0`@@ PxP0 p006 -ppQ0LD0P< P? 1@S  `aT0!T@L!T01STD0 aS 0S T Q 0 S Q0T X 1@S  0!X0T|@H1T 01ST l546&646>6(6l66\5,666 0-H@LT PP @T0P -LTM␠p@ Pw `DV Hx` W0tK0^0LTP;tK80 405KXP 7T0[`0x  R -LLM␐`@ pPAX0D0^H++LtKTP;40 80 505KD XP @p W0U<0 80tK@080 @ 0040 -L M@0K @c @~[ -LM K [ 0K c m -L M0K Cc @[ -L M!K [0K!Cc @~ -L M0K C # @m -L M0K!C # @\ -@SL M`pP0@@ @HP@`F@P@V 0@; -@SL M`pP0@ A@'P@`F@P@V 0@ -LM"à -LLM␠`  UPtpKL 080 05KX` &@TPd T0V  ?cU<@0Y0T00ST0 0 -0' p-LM0@`DP 0 !  ph p-LM0@`DP  0 ! ph -LM0^`p + PP%  @T㴐@"  e  `"0@S 0  0PD400v p-LMP@00  Rp `R0000 0 R UphQ400Dr00 R0xSI p-LM` @PT   @PT400 ph p-LM80@080PKF QP 8 0S8  080pp004` PP$ /Pp -LLM`plKLt100 05K<P' P%80PH@T @08T#X @PLK#P3D0pSD@H0  cW@ H@T L 05K0,8P0 0 0S LK 000 @T0S  P 06 -80L0`~Pv@~ Pv@?>11LcQ aR#^T@ R \aP6 @?>11LcQ aR#^T@:#:P'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@00400@PDT 0Q 0 400'?>11LcQ aR#^T@ 0BSP rࠓ@U?>11LcQ aR#^T@0P06 @?>11LcQ aR#^T@:#:P'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@n66 -80L`Q Pp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@ p8@?>11LcQ aR#^@0P 00@?>11LcQ aR#^T@0p0 @?>11LcQ aR#^t@ Pp @?>11Lc QR#a^T:@#:04!RZ4Z4]4]4]4P`@?>11LcQ aR#^T@4P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@ p(@?>11LcQ aR#^@0P0 @?>11LcQ aR#^T@0P0@?>11LcQ aR#^T@40 P @?>11LcQ aR#^T@0Pp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@0P p0 @?>11L cQaR#T^@P?D6 -`p@PL  k0S ` CP -LLM␠P  `tpKL8 080 X  )05K@T` T0X  ?_cV<@0Y0T00ST0 0 —05K0' p-LLMdPK`@LjZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0    r5` `! R0-P@ 0bR03 B00_``0 B`3`1`1c11c!0"b2c3c0acP@__ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q v54v5Hv5hv5v5v5v5v5v5v5 w5 ,w5 Dw5 Dw5 Dw5Dw5Xw5Xw5Xw5hw5hw5hw5hw5w5w5w5w5w5w5w5w5Xw5Xw5 Xw5!w5"w5#w5$w5%w5&w5'w50w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-D p @D p @  88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx !p "x " "` "h " "t " ""|!L+$"Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2007 OpenBSD. All rights reserved. http://www.OpenBSD.org  $$\5hK6|5d5l5t5|5@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Uh&8t&@t&t&L+$4u&v&L+$@w&w&-&L+$w&d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ha*Ա*Xv*ܱ**x*Lz*{*(*d*ȁ*h* * :+Ա*XF+ܱ**G+J+ K+ N+N+7+ O+ *vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ].].#d$6 6h$6 6t$6 6x$65 55 |$65$6$6 $6$6$6$6$6$6$6$6$6$6p $6$6p 0$6$6p `$6$6p p$6$6P $6$6P $6$6P @$6$6P P$6$6 $6%6%6%6$6 %6%6 %6$60U6$60U6%60U6%60U6$%60U6,%60U6  F66F664%68%6@<%68%6D%6H%6 L%6P%6 L%6T%6/X%6$d6o\%6`%60/x$6$d6p d%6`5 @6l%6 t%6l%6 @x%6l%6 `|%6l%6 <5l%6 %6l%6 %6l%6 %6l%6 %6%6 0%6%6 @%6%6 `%6%6 %6l%6 %6%6 %6l%6 %6%6%6%6%6%6 %6%60%6%6@%6%6P%6%6`%6%6p%6%6%6%6%6%6%6%6%6%6%6%6%6%6%6%6&6%6 &6%60 &6%6@&6%6P5%6`&6%6p&6%6&6%6 &6%6$&6%6(&6%6,&6%60&6%64&6%6 <&6@&6 D&6@&6H&6L&6T&6X&6 `&6T'60d&6T'6@h&6T'6Pl&6T'6p&6t&6|&6t&6&6t&6&6t&6&6&6&6&6&6&6&6&6&6&6&6&6&6&6 &6&6&6&6 &6&6eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0tx.|x.#H*6P*6X*6`*6h*6p*6x*6*6*6*6*6*6*6*6*6*6H*6*6*6*6*6p*6x*6*6*6*6*6*6*6*6*6*6H*6*6*6`*6h*6p*6x*6*6*6+6+6*6*6*6*6+6P*6X*6`*6$+60+6<+6H+6T+6`+6*6*6*6*6*6*6l+6+6X*6+6+6+6+6+6*6*6*6*6*6*6*6*6+6+6$+6,6,6p*6x*6*6*6*6*6*6*6*6*6*6+6$+6X*6`*6h*6p*6x*6*6*6*6*6*6*6*6*6*6+6P*6X*6`*6h*6p*6x*6*6*6*6*6*6*6*6*6*6+6+6$+60+6<+6,6x*6*6*6*6*6*6*6*6*6*6H*6P*6X*6+6h*6$+6+6*6*6*6*6*6*6*6*6*6+6+6$+60+6,6 ,6 ,6(,6*6*6*6*6*6*6*6*64,6P*6X*6`*6h*6p*6x*6*6*6*6*6*6*6*6*6*6VA-65PVA-65VA-65VA<,65VAD,65 VAL,65pAT,65qA\,65qAd,65qAl,65qAt,65qA,65rA,65tA,65tA,65A,65A,65 A,65A,65`A ,65`A ,65`A ,65PT,65A -65 A -65D -65D $-65i ,-6@5 i 4-65 i <-65 $i D-650$i T-65 ,i D-650,i T-65 .i d-6@50.i t-6@5!i -65 !i -65)i -65 )i -65-i -65Ai -65 -i -65Ai -6@5Ai -6@5Ai -6@5-6-6-6-6-6-6-6.6.6.6 .6.6.6,.6(.64.6@.6H.6P.6\.6d.6p.6x.6.6.6.6.6.6.6.6.6.6.6/6/6(/68/6H/6X/6.T16.h16.|16.16.1616.1616.26826.L26p26.2626.2626@````` ```@6@6 A60A6DA6lA6A6A6A6A6B64B6D6XB6lB6B6B6B6B6 C6$C68C6XC6lC6C6C6C6D6TD6D6D6D6E6 @E6 pE6 E6 E6,F6dF6F6F6F6 G60G6TG6|G6G6 G6 G6 G6  H6 $H6 8H6 LH6 TH6 H6 H6 H6 H6 I6 ,I6 PI6 |I6 I6 I6 I6 I6 J6 8J6 dJ6 J6 J6 J6 K6 (K6 LK6lK6K6K6K6K6K6L6 L68L6hL6L6L6L6 L6 L6 L6 (M6 \M6xM6M6M6M6N6N6HN6lN6N6N6N6N6N6O6@O6lO6O6O6O6O6P68P6\P6P6P6P6P6(Q6TQ6Q6Q6Q6R6 DR6pR6R6R6S6S68S6`S6S6S6S6S6S6 T6@T6\T6T6|T6T6T6T6T6 U6 4U6 `U6 U6 U6 U6 U6 V6 DV6 hV6 V6 V6!V6!V6!W6"0W6$dW6$|W6$U6$U6$W6$W6$W6$W6%X6&X6&f6>Df6>\f6>tf6>f6?f6?f6?g6?$g6?@g6?\g6?xg6?g6?g6? g6? g6? h6? h6? 4h6?Lh6?lh6?h6?h6@h6Ah6Bi6Cj6D4i6ELi6Fhi6Gi6Gi6Gi6Gi6G j6G@j6G\j6Hj6Ij6Jj6Kj6Kj6K$k6K8k6KHk6KXk6Klk6Lk6Nk6Pk6Pk6Pl6Q$l6Q4l6Rhl6Sxl6Sl6Sl6Tl6Ul6Um6Um6U680~9o:k;lL|=>@ApD FPQSTXY] 35 ["$&'X4gklrdK2 55<@0h00   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt100t1D11111  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?Th1p1d22м666666 6,686@6H6X6d6p6x666666XBBp@m@m@m@m@ f(  pt""(4I@@@@1` #U4QFb '               >@0@@ Q@c@c@<dB2B2XJ2I2tS2TT2Y2PY2_2_2l`2T`2      r2s2l2q2dr2j2j2m2lm2abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` LF5R^H5 I5](J5J5II5I5JL5RL57PM5 I5 I5 I5 J5KO5P5@#P5P5P5P5 P5P5H@P5 NM5 _4O5P53A3H3@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- {3X|3(33-6P6T6X6\6м66666 6,6p6666!A  !@@@@L33`3H6333x666333Q`633362636333656@343CP86CPX6CPx6CP6CP6CP6CP 6CP 6CP!,6CP"H6CP d6CP6 6 6 6 6(4,34443 6Ð6< 4H 4p 4< 4,3p 46 6 4,33(6444}D6}X6}l64436664439684,33@4L4l4`6666!6(636626t4h 43n`46@`H6n`\6n` p66|#4p$43!666'4(4366*4,43urlphy_attachurlphy_serviceurlphy_statusOpenBSD4.2RAMDISK#97 @(#)OpenBSD 4.2 (RAMDISK) #97: Tue Aug 28 22:54:41 MDT 2007 OpenBSD 4.2 (RAMDISK) #97: Tue Aug 28 22:54:41 MDT 2007 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterdrive at %s channel %d drive %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) : where did the card go? ne2000_attach: setup failed ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comcomprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision ohci, legacy support%s: SMM does not respond, will reset %s: reset timeout %s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocregistersuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx \%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sAfter %d instructions (%d loads, %d stores), Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %dmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physiophysbuf%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-12.12s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-12s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplstunrsensor_task_unregister: unexpected state %dcoredump%s%s.core/var/crash/sigaplpauseissignal hashinit: bad cntsysctllksysctldlkkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunable to create system work queue threadwqdestroyunable to create "%s" workq thread boredsmashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s at rootconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure (default %s%s)can't figure root, hope your kernel is right setrootroot on %s%c swap on %s%d%c dump on %s%d%cinvalid geometryno disk labelunreasonable partition countdisk label corruptedinvalid label, d_secpercyl == 0invalid label, d_secsize == 0disk label I/O errordos partition I/O errorwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%llddisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 filesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %dcannot open disk, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryuse one of: exit %s[a-p]parsediskroot device (default %sswap deviceextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenablefindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpiperdpipelkpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplmbuf prepend length too bigm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectqueue %d > BQUEUES %dcan't return dirty qbremfree: lost tailbufplgetblkgetnewbufbiowaitbiodone alreadynchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rtinitrttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_cryptieee80211_aes_key_wrapieee80211_aes_key_unwrapieee80211_hmac_md5_vieee80211_hmac_sha1_vieee80211_prfPairwise key expansionPMK Nameieee80211_derive_pmkidGroup key expansionieee80211_eapol_key_micieee80211_eapol_key_check_micieee80211_eapol_key_encryptieee80211_eapol_key_decrypt%s: %sassociation failed (reason %d) for %s %s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) ieee80211_recv_4way_msg14-way%s: received msg %d/%d of the %s handshake from %s group key%s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! %s: no memory for TIM bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame invalid group cipher!802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) EAPOL-Key frame too large: %u%s: sending msg %d/%d of the %s handshake to %s %s: sending EAPOL-Key request to %s %s: station %s power save queue overflow of size %d drops %d .5 %d%sM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gfhturbo0x"NODS %s->%s(%s) type#%d%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s %s: bogus xmit rate %u setup APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdkdodzegf2fifrgrgthkhnhrhuiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreerevarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalSHA1TransformSHA1Finalmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corruptedext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapuvm_km_pgremove_intrsafe: no pagekm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs=%d PAGES : <%p,0x%llx> refs= PAGE %p: %b flags=%s, pg_flags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uMB) avail mem = %lu (%uMB) cpu_startup: no room for system tables; %d bytes requiredcpu_startup: system table size inconsistency_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumping to dev %u,%u offset %ld dumpsysdump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible vmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs scsi_sizescsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook %s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasd%s: WARNING: unable to establish shutdown hook drive offline%lldMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lld sec totalsdstartsd_ioctl_inquirySCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc_read_epN: ep %d, no xfer fifo full when trying to set short packet ep%d: fifo error endpoint %d already used by %c%s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info port 0x%lx/%lu: %scan't allocate memory for command queue ,0x%lx/%lu: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s %s: couldn't establish interrupt : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attached%s: cmd %u arg=%#x data=%#x dlen=%d flags=%#x proc="%s" %s: data not a multiple of %d bytes %s: first command mmcmdpxammc: can't map regs mmccd: MMC/SD/SDIO controller sdmmc%s: can't attach bus : can't establish MMC interrupt : can't establish card interrupt %s: driver lacks get_ocr() function %s: driver lacks set_power() function pxammc_bus_clock freq=%d actfreq=%d div=%d %s: unsupported bus frequency of %d KHz mmclk%s: card intr %s: intr %b DATADONEPRGDONEENDCMDRESSTOPCMDCLKISOFFRXFIFOTXFIFO DATERR RESERR SDIO%s: clock is now off %s: cmd %p resid %d READ_TIME_OUTTIMEOUT_RESPONSECRC_WRITE_ERRORCRC_READ_ERRORSPI_READ_ERROR_TOKENRES_CRC_ERRXMIT_FIFO_EMPTYRECV_FIFO_FULL CLK_EN FLASH_ERR SPI_WR_ERR DATA_TRAN_DONE PRG_DONEEND_CMD_RESRD_STALLEDSDIO_INTSDIO_SUSPEND_ACK%s: status %b lcdzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s Unable to establish %s powerhookwd0%s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statescoop_mmc_set_power: unsupported OCR (%#x) zssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwd0aboot device: lookup '%s' failed. boot device: %s raidwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOorasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtconfigusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %duhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored %s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev %s: %s, iclass %d/%d %s: no report descriptor %s: no memory %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umass %s: %s CBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk out %s: could not find data bulk in %s: no descriptor for bulk endpoint %d %s: interface alternate setting %d failed %s: no descriptor for interrupt endpoint %d extra ethernet descriptor %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: open interrupt pipe failed: %s %s: too many errors, disabling %s: usb error on rx: %s udav %s: %s, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not allocate protection frame %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control usbf%s: can't establish softintr %s: usbf_new_device failed, %s %s: can't create task thread set config activated %s %s, rev %d.%02d/%d.%02dusbf_devinfo_allocusbf_allocmemusbf_start_next: %s cdcefOpenBSD.orgCDC Ethernet Emulation%s: usbf_add_config failed %s: usbf_add_interface failed %s: usbf_add_endpoint failed %s: usbf_add_config_desc failed %s: usbf_end_config failed %s: usbf_alloc_buffer failed %s: usbf_open_pipe failed %s: usbf_transfer failed cdcef_do_request encap error mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s mmcdiemmctsk%s: can't enable card %s: no functions %s: can't supply bus power %s: can't supply clock %s: can't identify card %s: mem init failed %s: i/o init failed mmcdlySpectecSDIO WLAN CardSDW-820%s: bad CIS ptr %#x %s: CISTPL_VERS_1 too short %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CIS parse error at %d, tuple code %#x, length %d %s: CIS version %d.%d wireless network adapter%s(%sat %s%s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't read CIS sdmmc_io_attach%s: can't set mem RCA %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: unknown MMC version %d %s: can't attach scsibus %s: can't allocate ccbs getccbsdmmc_scsi_cmdSD/MMC Drive #%02d%s: out of ccbs  43dd'(p@@ @ @ 5s5s5s5$s55(s50s5|68s5Ds5Ls5Xs5`s5hs5ps5D6ts5s5s5s5s5s5s5  +-+'& !$%E " 0(O_7܀_Ȁ_7B70__7&7__7V7A5_<7Z7 D5_<7b7 __<7 7!D5<_<7 7!E5T_7J7/8F5_7J7/_5_<7 7!xf5_<7 7!$g5_<7 7!8g5_<7 7!g5_<7 7!4h5(_<7 7!Hh5<_<7 7!|h5\_<7 7!h5p_<7 7!i57<7 7!l5_<7 7!__<7F70 _ _<7f70<_P_771d_x_771__771__771__771__771,_@_771T_h_771|__771__771__771__771_0_771D_X_771l__771__771__771__771_$_7718_L_<7^7:s5s5s5`6$x1'&0A!l   h L @v57(̿((((>7\)|)D(@) )X)>7,@)v))t)dg)H)xr))>7)|)))>7(|)))T(l(>7d)|))))>7)d)|)))>7n(|)))m(hv(w(>7)|))) )45<7>7H)' dX>7>7>7>7>7}E#(D<8Q @X,?7?7?7?7<7<7<7<7?7\?7?7`?7d?7h?7l?7p?7t?7|?7x?7?7?7?7?7(@AAA==(A* dd%(i @@@@@@@@@A7@7cc`A7\A7@7@7A7A7A7A7$A7A7A74444D*A* *.*@*Z*-7|X%-7h*.78*0.7*\.7d*.7д*.7*.7* /7*8/7*d/7*/7t*/7|*/7*07V%@07l*p07*07*07*17h*417*`17*17*17x*17W%27*<27؏*h27$*27<*27d*37h*27*-7X*37|*D37*p37 *37W%|clB7-7&.7<*.7*.7* /7*8/7*d/7*@07l*27*<27؏*h27$*27<*27*-7X*xcC7-7T&.7*.7*.7* /7*8/7*d/7\*@07l*27*<27@*h27$*27<*27*-7X*37W%c$D7 ... ...$*p*$**$*0*HF7F7PG7-7|X%-7+.78Q+0.7hQ+\.7Q+.7д*.70R+.7R+ /7pT+8/7t.+d/7h1+/7t*/7|*/7(X%@07Dm+p07PY+07Z+07[+17e+417h+`17i+17+17j+17W%27<+<27m+h27$*27<*27+37h*27*-7X*37|*D374k+37W%(c(E7-7&.7<*.70R+.7R+ /7pT+8/7*d/7*@07Dm+27<+<27m+h27$*27<*27*-7X*,cPF7-7T&.7*.70R+.7R+ /7pT+8/7*d/7\*@07Dm+27<+<27 n+h27$*27<*27*-7X*37W%$cF7+++@+L+h+@+P++l+ \XG7G7H75t,L,\,,,,ȣ,T,@,(WEVrdroot2.5M@WEV  08`F<  F;`/mnt#$0 F`@@<@T 08`F<  F;`[~ [~F`@@<@TU F` bFT66mA FFN FN hlAF#F#F$aAF8.FFbgC6>@FxoF8)FN px0 sgFxF@eF@ecF@Fث Fث ivoFlF8.F00 e#F8M1FhS98F00  YrqFh:FT FT 96j, wXl" UAYvtj1Se[׉) 8egp+RȖ{&OTSF!)S,g<k{72FȌ\zk]|ga$ 1?S@PF0ys$zr4)%[xD^0h/h3%5xvsi  V)wN'9*Q 2B33"`. >#nPE0ڜ`{QHZ3EJuxH|v>n%fu "_I{6:C+3 {' H ^Wh ϐ`X;BAslf+BSipG(4㋥~yOkZsAnڹMaAdP>-]5.ۻ^}Sxئfl)1&M[MB%\)>U=X1a܍fޝڦbHo5A^V:nwZH#q>Zwy#eCaxկ< u  ... . ..ztsscale7 export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . ..@ bin dev etc mntAmnt25Bsbin5Ƣ tmp usrCvarinstbin.profilec install.mdupgrade install  install.sub ARCH=zaurus md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } ELFa(t4=4 (??@BBbb<$$===444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00pt 0S SX 00-SL@  @1S@DQ@Dt @Dt0 -LM$@0S0S -< L04S0 00 h-<= 0S00 -LM`pQ 0S5/ѝp@PPPQ P Q088 8$Q  : p-PLM@@P` ph 0-@L PP \6kzE 0OSP8  (00SP!k:%` -䢟䒟<LMP000ȂS09 vpP=v @T` 8K0  \ Xn TŸ8 Y3 R<Ÿ8 0a 08 Z0000S0A  10S000 B j 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU O00SRU!O0p1, @0S 0S  0<$, @0S 0Sp O0=h=$=r,= $=̎=ЍDt_ -LZ 000=h= -LO0= -LG P00= -L<0< -0L000,=0=00= -0L00,=h=0h= -Lp0= -Lh0P= -L;O 0-LMK Pjp@81 0T  R@ 0b0CS$ \\\\\\\\,\8\\\\\\\\\D0D0E0J0AS00 0xS S *S 0S "z, 0 $N0 N0$=l  p-LM KPY qr1 T PY 0b0CS5ꤌ$$$$$$$$$Ԍ$$$$$$$$$`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "0 0 (mN0 hNp$=l  0-x0LP h0   aAq 0A0q08@0P 0R0 : 0=0=h=0 R0 0=h= - L -Nl - L $Nl - L Nl - L Nl -LMd0\0T*P00s D@00Cs0 00Cs0cw0X=< -8rLP,20  4P ,10S0q QP1000 A0! 14P0 1!30P00 tgSLQPa` \10S 0@{=P4 $A0P 0m=P 0f=P>S0  Rp: P 0 0; S0`@%,"PS@0h0Q XZMPhx0=@<(h=T,=l\=l|= 0-LM@KsVP tR0: S\4 KPC/P0000 0BpqZ0S0000lm @ 0-L1 R 1 0Su*Q  1Q   AA P 0!0  tR l?0 0A820 0 0 0  P0    00 00000 0000 @0  W00 \D L000 %R0 0 00(00==,=0=lh== -0LM 0RE0RQ0R_ x00 l@ R R*T bQ A00,00S h=Ѝ̎,=h= -`1LMP``p@Q jhP@  . z0S@ Q0/T0V000 0T0 0 0 0S00f 0pd  tLP@0 fR `!* 00 0Rb?0 00h=l=(= -pLuM0d yK,0 =w 1b1 P a!  B=9! = 1 . !P@0  r/ p`%Pno JP PoOK 0!dPP`A @ R  x1 RtVOKd0`!MA @  R ,1,R@Kd0!:w?KA~@v?K!00/C#b10 & 0 !됀K p`0d wKP뉁Z@ @v?K 400 ,0SD,-.A?9=$<MbP -LM@N|@ -LG/ -0L0(P0 `@%,"0@p7q / 30p`0-  P 0 pWp@0P`p 0S0C0XJT00  Z <H  P00=P=<,=l -L Mȡ00 `@%,"0?pbq`C 2[ 8c8d0 K00 , ,PQ4 `0pSI 0SF 围PQ4"`0 K03K,` ,p  @0 pR' 0S$ f0`PP  lCP@0 pR<0 0S@0p R 0Sh=ml -MLM2 P` p( 堤 h"up?@Y 4PD(((((((((((((((((((((((((((((((((((((((((((((((0ppppI.KL1 BH BbT(JK L@1($Rp *0 PbUa=B^KPEPE@徕P 4 04 04 I>K0C 0CD $ 0t , NP0-S  TI0HI <O0$,OH97  -L0B $4: -LM`PP( @(K,pK 0  (0@S9JO -L M0@p00 0Si PP 0S nSZ =P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0x00 ,K+, ?R0S@p @f0"Sl 0#IY000 LPH00D 0oSP  I \t| -霣圃LxMP@`p#+tpA P0@$S30```````````````````````$<`DP`X`````h`p2`2`p22y2 R2l2|"0QAPc<2 R 82 RpKAP`,r 0Sp j/P g `P? pKPyPX0: S SK QPB1 R 0 5 DP) `j_0SV pW P@M=Wp@Tj_ W p0 R  6Vҳ   D bb勓P!PM`Lby<HaaaaaaH7 l@d -LMp K@@T` P P@ Tj_ 00T 0-x0L0PS0@Q  P 0S(0 R00 R0H= P-L` 0SGnS 0@ ,XP@7l0PP@p` ,FPp@0oS` PM=H -蠟L0S 0 R0 R ? X @ Pp`0DS 0 PUjOvP D0\j/T0 :jojPaHa p-L M `K P@0s  ёpϑp= -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 墑2  B 0R00 0`p @T T|8 i84 Tv Ttq8 ^8Te Tcf80c8,4  0m Q ZP@E "0 Z/  pVl1 R/ @pTg' Z`PT0  P@0  P3To/  `P@0 x P@X80 7 7 4 { 5Y@Aaaԓ -0LMPpP`)0 R @;$0 ;; 0 @ڐ0 R W@ $0@Tj_\Ɛ K$K<@@@;$00 aaa$4LT -1L4M`, P!10 00 @,0P 1P啐TBp< AH0`JZ/ 0@K 0:@`T9 T7 h7 U7T) T' ]7Z7T T R7O7 0@K,0<T00 SZj ;70 57 07 0P@0  0PKY@ax -`L@+PP pJ0S p.KPpĐl -LM`@P0pQ: IP@ 0S T 0 $$郌: -0L : -aL M, Z 0P@Pf  0PP\%1R 004 d 000\%X1R5 @$ 80`O͉<@d@d_0d ,!W!@40hc ,0C0$@ @$@,0QTZ 7,Z 7D (0d 8%P<(@dl (!@ed ,0C0 \%0R=TT 8 -HL M, 0 [P:P #1RL0S @D@030(6Pp g@5B`@5v#,Pc P 00 0b0  0 0$ dD0QZ Ti7,Z e7D ]S < -AMLX6 M L6L@P p`84 , 0&xops ?0@8SzHH@HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLHHTH`HHHHHHHHHH 5` YP_p0S JP44 R 8$ 9P41Ppl4 < @bTQ {T }YY ,+P`) P zPP 0SuP*0 P9P<40<4 ZP<$0R0X0S NP TTPP B.K B B8劐P@ 4Pᰋp0S %IBK@@;P XP@0D_P@Tj_0T@2 R 808P0"8$ c 84P084 1 RcBKHHP] {P5 P0 , 0  P 2P`| 04D000$ 04~ 04T 0 00T*P` Bw*P` P P P H*P`|B p|H984aDbhad7LPXH dl|Էd -PLMP P` @ pK7 80S@@ 00S002  0-P@ 0LSP  0S0S0 l -LM Mß'}KpG` pG , P@!Pq #T@U Zp`P 0S 2PP @KA <0A؉ 3) 0QqA9  岌9@X [^/2-22 ,0S ,ܭ囌9@T^p@R P. 22KAA ㄌP9#42 R uOKKP-P K Z\!aMK@D0 @D!i@F0Sx 0S0S 6 H@11uKJP-]KZ P[K  P@S0 RuIKA 0P?`:0StPP@' 0)GT&G9 Loa$%a,8DT|dԷ -L4M䗟য়T `D0, ׋ 0DSpH  TW' R  0|St7pW h @TP 0S T ,7p DW 7' 0ᣋ0VSPBO0fVpW& 6 P 6Qp& x6Wtd}  pP6PW@h&r @ (6pW D& g  5pW&\  p5W%Q0S   R 5pW0%A0S$ $  R T5pWL|0x%10S( (  R 5pW <0<%!0S, , R 4pW0%0S0 0 R 4pW0$0S4 4 R T4pWL|0$0S8 8 R 4pW <0L$0S #pWH0 $ՊL ъP ͊T Ɋ3WĊ ,0S ,0SG pL3W@#@=\@P% pW )PTKPKp6p2PTxWB@w10D#DP咊8PT0BOSl Ml RJp^ p2pWŸd0"Pv0St t 2R $2pW0"ex0 1pW"Zx0 1pWX"Ox0 1pW0"Dx0w pl1lW"TnpdPBOl0 $1pW!&l0 0pW!l0N p0W!x?PC0BOS 0< p0WtnS 0@ ,_P@.l0PP@p` ,MPp@0oS` WDah -PLM`p 0SP.r3@o3@@\.PP 0 p.D4 -LM@p`PC Tp KވP  0S -SH0=1@ !@!P 0@0@ < -L M$$@$$$ $0@㾩@h: p-LM@PPP'NPP PpPxP` `PLP @ 0Xpp$}Xp8$ p-GML`1 M Xa T!P0@4 8!ip ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 刉P# $04 04 =K 0C~BPPx Pl ׄ'0$L=-P@ 4KC97 X<8H -L0. l: -LM`PP( @(K,pK 0  (0@St-C -L M0@p00 0Si ‡PP 0S nSZ =P0`0@Q eP QLQJ  0V0P 1 0* Y0  0000V 0`0A00 ,K, ?R0S@p @/0"Sl 0<Y000 LPH00D 0oSP < \t| -L -ML M .0~`P,0 -gp B0@3Slx\0\x (D`dd = <>L9P 4P<*P  ,< = =XLP d x=,L61P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`FDP@ $`hAY0S 4: S < )VMKHHș@ ( G0Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l&; X00R00S7 P 0@ P 10135:3P y, X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A*, Д0AP,  ,6X@JP ,dV000TU 3 5#:,P( ,0+V00X@6h1h ? +6``U 0#5 %* % U UU 4S X0 4  \ P  @+ؔ  YRJ^   +$X T \% P ؔ PY0 <U U%1 ATE Uc cc+Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx9 <%!q0`J  0 !5 SP L S3 p0# U Ugg Ug gg *+X 0H,଄  <Ja +` 0%P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 T4R 00UV `P4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,9Tbstbtb  bC$b(b,<,bbP0bX4b8b\Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5& !0S66TQ$0 N0o00  e T *ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$+]$ 0+> 40Q<V>d8U U Uʠ 56 V:%V#=QU8'L40S@.cc(T5l (P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 PBNK@D@D*5j P p$ e ?Pa4: S ܤEnK`F `F @P0   %06`\d4S: 8j\d4S0} T([44 嬄 D D ~gF -LM@(K.P`5  'Ppp0W0* R00S 0rS`Fv (P@ P@Z`F (00T P P (0vj?(0 ;(0 T05| -PL`p@yPDP @T:T @2 5 -LPgM/, `勂PBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  U500Y00S ,0S 0S 0S $0S5MK  SpI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,נ0 {$, u (l oX uP@ <4909<edA$ADPPhx -LMpbQ5Q/YQ& R,Q0S hP4 0EC`8|@|PP:h8<Q@3L0D-<*4'A $,4 Q-0L $ Q*  q4<P -LM`@p{ $K4OP{0S0S 0 S4$0 UR#U` p-LM`PU@ T<PP UTUpTl- 0\ \8 0000ӑS^ 0 ^08 Br0 BS 0r0 -ALM3 05 008 0+ 0& 0! 0t 0d 0T 0D  04 0$ 0 0 0 0 0 0 0 0 0 0 0t0l :(HXl|4Ldx7 -LM00`Kq@ 00 pxPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K )P@ 40 R0 0(@M MP0 0( dP 0LM< 0pPP (0 P-L 22Tp 0-LMt@ 0Pdr}Q {@z 80he}0(0 `} 0S -LM0:(0 \P0( 0S(0 0 (K  )}PP) 0S& =HP`u 00,pK 0cSb iSI lS> oS& A0S 0S 0S(0SBP0AS, [0 0S0 ,P,00 0oS"P ,0(0P,0 0 0 P,00 0iSP0 T,0$0XP,00 00.(0px -LM `P0p-S000P(K 0(P P@  0S 0 Q (rL{mLv p0 D0h0S $ "-,0 0$  -LM@D00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@y0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@ny0 0 -LM0@S  hM 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+${ -L)yh{( -LM K00"P6t - LP6nt  - LP6ot  -A0 LR`P pPJ RDA R pP3 RA R psP R@ R pfP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p dl -LMx \, P`p 0LSE$,0 zx@nxT 1  zW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,*K1vK/v-vK*va0S @K00!d 0Sqi S  SetplhrI dJ Hx<x0 x$ 9 <H Xh4 8DdP, <LdXt``xhtFpx 0-0P@0LS 0@0I00lbpb 0-|PL0@S d0d8x0"0 0HS@-x4*x$&x0000lbpbl% -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 db d -LTM\ X3XSp`| , xp p <R|0Vu |0@0"0T #|mXpa@ P<p0| `Kx| Pxt K2PJ4K|x )P}W ,<<|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,岘x P+x xS7Pl2WPP|0 |(1  0P =@tt0l0  P|0|0%G.t  w~pA|@Px :p7 P?2H},977t@ht@ Jgt <$,DlP -0L :` -qLpM@P`!WpF@9 -PRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx`1`00 00Q @` 0T Q" T 1@KP0: S 0`S  0`SqT 8  (1xb,tb|bb7Ĵ ib0 l -NMLMDD0S( `Ppu $2$" 2Q0UOINK@D@DP4: SB 6P0S 1 R kwP1P v(0 S l(\r0SKAAnP0%4R%4R E0 R P@ B^KPEPE0 @ PINK2@D2`1@D2:r?00 vINK@D@D5PX0 R~4: Szur00b9|boP tbbl4<Ltxb -0L 0㨖:| -鐥LMP`0 4 t%AVp ?0@8S񟗅PPPPPPHPPPPPPPPPPPlPPPPPPPPPPPPPPPPPPPPPPPP@PHPX`0SX$00, 0S (4 | 0S u 0S#00k #000#0S ] 3000 #C05P 0 R J 0040 s\#X#A mL#0S 8 ,#0S0Pa0Ua 2 R 2 0 R! @ЂŸQ 0@;Pp ]0"0CSLU BP  U 5P 00j U *P@ 1\  `P 40`V0ES @MPP PkP  8/ 0 R, K P+0Q0ESU 7 @e/Z6 P h P00SZ 0 RUUPr/H`dt`l\ĉ7ph:ȉlH lmdh p-LM@P`j0Se/ 0U $000 0 phoEp ~)| -7LS 0707Pp `0 t @@tA0pW 00PZ -$3L MPU0 ` CCCCC200Xp 2 R \2 0@@  0S (0s& 0S! dBdsXpD00CS0X0ӤX0r PpP $B00CS00Ӥ0b PpyUYUmp0SE 1 R20S 0 S,   , K PJ  Q( K@@"X P 0 D0P 02.+_+ 00TK 0PKs  Po0S o0S *WT`0 Rt  P`h D WEVl:p 0:tĉmdh   fd gd  -LM@o00CS% & & & & & & & & & & & &% && & & &&0hB$ s H p l  p-L M 0@.QP,# P*p@ 0@@da 2 0R @ ^ 0S  R@X0V@   PR@p(BpPjbU L : -d2LM Ro L2p R 0S 0S <s2 RL  0Qq * P1 -"1\R) QB!Q0yM,@0W0 1R PUh>B0S8SP g<-B"0S8S /;0@@`\P$`0`r0 R0 R P  P xP  Pl$-dy PXlĉlplWEV     `dȉrdA edA sd 0  -LM( R,@:( 0e/eT *0 SR:*'D  -L M0Ss0S 0% O R|3|!x w( h s, \ o0 P k4 D g8 8 cG<PP@ 0 Y4S "Rr4S  Jr4S4SP0ST0S{ @\0 S@ oXں Xp 0@@0   Xp  \A oxa  0, 0 @@0P`0,  `0 @@0P`0,  ` 0S S! 1,  x 0S S 0 S1 0 38,  0P 00C   0,   ~ pu tpl \pc0  0 lp x                 $ , 4 @ L X d  -LM0 pWPd^(`pVP@R0 6B0JP@SA//000T0000l00x00000000V0 +8@pT`P0  `P   | H P@ `P?@0 A>P?>p= -LT0K <J<!(00  0?0 X0 00CS00  ä0> @: 00 X08p    (<Ph`!,<Pp -LjML0pD(0 GpP ,P@ 0`P` 0!0|pD 娺P@\ o_Ke/ 'P P`D e/\ PP3 DA@mX`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUn(0 S (|Tnpjt4nT Qn(<Kn9VH l:0:l -LM@0PKaP  0SpY R 0ST!T4K0 p / 40(0 `p>p@ P8PK1  Ampi0S i0@4i @480#4  i0 0lxd^ -LM@~j0S@  -LM@@i000S 00gj0S  M-L M0hp`P@ \ |0 0  RP 00 0 Y@@< -CML 8 MD$ BKL, :L < 8 \ 0'0\8$cP1 \P00\P` :Pp` 00LpP5W4w ,&(7Pp G<`T *0S P0hC1 @T:BKH@7H (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x    (  ~044 PSB>K0C 0C0<0  J<tP#W4 ` 0S44<X0D0pnP44 0 44 `W 0SD40D4 !<XP0W`u 0Sr BKHH0 -04P@St  4D <44 !\0P`T Z00R00SJ;BKJ J P 4WpP<$ 5=1 P<4PBKH0H 044 S;;S<$(  00 ;DD PBKH0H 044 S<,  0 ;D40D4 PBKH 0H044 S<$8  08 m;DD (PBKH0H }044 S<0PBKH 0Hg044 S<$4uPO0BKH0H  Q04S<0O7< \PBKH 2H8044 S㰠<$EPBKH1H !044 S㰠<cp.PBKH d1H 044 S㰠<$kPBKH1H 044 S㰠<5P;BKH 0H044 S<$P>L,p0X`x  0<<P9 (DP> a0BS50S2<$8a AR:R<`0A8̑"<W @$  sB>K0CH4 H@O0`L0p H z04S@$0O0W WLO0`H 0p c04S@$00W@4 p1 ?A`XPTp *0S ӳP0h@C1 0 @T:q10  00S044 04S44S ( :044 0@$ 0@4 @TM TZW> `H p@0E.KXXG W2 `H0 p@0X44 ` j @@jA@W  H <3@$`L 9D$ D$ h 9#W `H p0E.KPX W H0 @0P44 x` 80  R0 4((00 08/8x )8,8S$8K 84  4 D88t84  4 1`8 4T 84 844HXl,d   -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 ( A 0S 94 -d1L(M\@@K @ Dq04Q@K`@@ 0[< 0VC 0Q2 0LH 0G2 0B0. = j f bc ^ Z5 0p$B 0`XX Lj9@ :`h lD<82P *0P ": -ML M l NK ) e/@9 , ; Q ) ) )  P  P  P NK)@KA>K0CA 9 INK@ @DI NK@lNK@ P`\(K0NKHS㴠04@@ $ ?d(K0S (K G.K B0P@@`p p4T p 徐\4+S:\4 X4(@KS:X4 0 S(PKd}KNKAe/뎮KhkJ`; X c P+xP000CS00  ä0+0(Kq0 P@ P 0@pS񟗐VaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaYaaaaYaaaaaaaaYaaaaaaaaaaLZaaaaaaaaZD[[[\a\Yaaaa]]a]4^__aP`a`_aaU _OKe/NKAe/N.K  BP8NK @ hFfe/? c0p8 PP 0SPXKL@ 5p 8cP@ $8 0 de   =fǟ7 R@@R@eOKe/NKAe/ \  F  CNK0)@ NK@e/P P  UP  +e/OKe/NKAe/NK@NK@e/PxOKe/sNKAe/nNK@ OKe/cNKAe/^ Q    NK0)@ NK@e/P )Re/AOKe/;NKAe/6NK@ OKe/,NKAe/'NK0(@BOKe/NKAe/ 9S    NK0)@ _NK@e/oP IT]e/  X    NK@  J7 \4\&UYNK00A )04 RU X NK)9@3 R> C#PP  R0000ӑ yS0 R000ӑnSU Pd#00ӑyP ,0 S D,ޅN.K4  BP@ 4NKAe/ NKAe/PaNK@aU \)P@ NK A 0B`"e TTaPP0S NK@e/P Y POKNKe/A7 NKe/@2 e/. NK@ \ P1 R P NK@ )9N.K0  B&P  4M0NKAe/:Ke/ NKAe/ NK@3 ,5D9r(:R0:A` rdAdhV<i:tx;,?Pdll 4Hl -MLMV@$  R, 8 <  SO a`LV00Ld V \p XwH,0 S @,لL84 0S 9@@ &8$LD8T08¡8T00000@4BNK @D @D8 PDT LDpD0PP0DT0 @K@0L^P`FK0`  08LP@DE>K  D$ 8 (0HD S DH0 8d4 d$H"8@RH  `T P@@0 PSd$"hh p0S hD0 S0S` 00 0S+KT0RD$ 08L@$0PvDT0@@ m 8@P@ L|abXD00\8L P D$0@04<8L$dP3 R DD 0S- Dd@0@@0` PU``D0@@0 p  P`0pS :0S:@8 }P 88LeP DT@0008LPL8zP Dd@000dh.8@@0`0 @PU`DPf`H0S'`D@000h 8L4  0@ LD00T00S)@TLD  IP 8aBL 0S i0p@P`p`LQp hLTUp0BKa(`KH\0 (KH . 0<k9:iiDlx R-0LP3 `aF r\*(\` m齼 R 0@@   0 SS S S0d0T!\  mV(<<P0, 0 m[:|@T -SL4M< @ D  P<0a EH H@T8@K<0H@(T,` (f R0@@  <HL PL 0 SS, [R R 2[D@@08` P``H<L X0HD <LpL " Y<DLv`0pP`p` @m L '0SL ^2[S[8 @4@p`` PL 0Op0@<H L PL9|2 R 0SS 0@@0p < P`0pS :0S:D< P <|<HL PL 8K<HL 1PL 8@K 0SH<L PLS Sm ,0[ SSi 8@D@`p 0 S:0S*D (0 000  00L 冻D L0 0D@0>D 0@@0` D0PU``1\ <( DDP0 0(-:ii   -SL Mp, 0 *\| a\wJ,@(Z` o<, Q9@@ \ ZT , tR 4 0( @0 P` \. 0S*Ÿ(8@ P!0S4 0S S 0Ƞ, P`   0,8@@00@ , P0WPPPP P Q, 1o ,P(,(Z Z" ,@ 2R R 9 8##Xp00@0` 000@ 蠐唐嘐圐,0(Z 88P0( D:iiP4  -L,M4 *K0 P8 [3H Z@@KN4P0KD 8Ÿ P0@@0 ` p @@KP0K  U)dB0S%< W@0V<@0R@ Q00YXY0X0 @KDZH0ZV4 @@K`pP`8 0@ @0  0@  VUV0U07ZY(0 0pS $ 0`0S@ "TSp@0K` 0 @0S48u@ K 0S0ii -RL4M0, 0 > a\8J,(Y` o鞹,  0<0 0. @P   .(00  00P 0t0^K4d7< @P@d `0`@bS>4@D( bP$ 0060@D0N O )<E~K@4 kS gS4$(:P @DmS4(4( Q0a#5P4  4t8pPt h1(K R-K,X(K0?S X0 ` BR X0  äX0X , -LBMMB>K0C0C8 , <$ 4 2@ (K0S<@T8 2H$ (K HQD )@$D4@0P@ @0 `0@` pPDD  0@TS2(K DQ1(KHD T@U,0 S ,|<$r! 4 n 0n0C B#B""a`aD$  ZPxx!xZt4 0P4X D4P<Q @$B~K$!pG pGXPB Z(0K GP# 0( K(0K QQa B DRR4"ࠀ98$@`@0 84P``@48<$BL00CS0X0  äX0 ",9!!`!":H" -LsM e/0  K,0 6|8|xh;Z!p0l!8PP  XңPpX/W-40$Z, 0pZX 7 W@0pXW00CS00  ä0 +1@p PPz  @P@+`A Q ġ,@ P00ԡP@$'$70`*pw 7 wxl`,pС0@&P00ԡP@60` pw |6|k wxK`0pС8@P&P00ԡP@860`pw 5G wx*`8pС4@%P00ԡP@50`pw t5t# wx 4p748 @<@R00@VU`PA``ԡP@0$4 pp w 0<Ƞ, 0 @X  WT,8 @ P ȠP`,8@ R9Q78,8@ P.0S+ȡ,8@ Q P:0S*,(00  Q00 R0x00@ȡ@0 ` Q PU``X0S0S8!07<>d>? -L`pPAT 1SPUA@@P  l r p-LM`P@PQ@TpP Q gP pQ -LIM MJ~KpGpGP @ , 81JnKS`F1A@TP,0 S ,Eu 㙝P0rSJ /hVP@ PrU B>K0C0C4 000 !P=@0@@ < 加PP 4S JnKⴀ`F10 "\a0@|$叮Tʄ1SBKAA  0庼9t@ V|@ -2$ML, p0@@0 P`` 0@@0 \0, p`P( u 0S0S `9 0S0S t0OP0v <0Dv4 0@i@:i\A2 -L M0U@pY  55 u  % 5P00xйT$4@  $Pp 4Q 0SDP Ppd P(D0: S  S  S0 0Ep{ 00 R000Sg RꀶDDLD?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qK0S0||D K1Ps1 @u  00 ~J!0!@f  00 oJ0!@g0*J0d!@T P!P00p 0Q  J0!u@0 0T PJ0 _@0P 0<0  H04LH8x|hKDH@TP@dm @pKKKKKLL0L -LMc0Ss0S 3 R S0S3 Rt3 R hCP[KP,K M0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP;@2`DBH史P(@ 0S 0+0 !a}000+pP !1aA0 @@AP| @ 0X$1 Kv@e0A PR0: SN8 @TI08D4L -\0L RL H0 @R0,0, 0>0>8MDMP 0-QLP) 0S-XXXX0  kP@ڸ0 T ;;S0@0T@|0 tS>0H\ 0T w>00  fkP@0 0@84Px<MM -b0LP@@xr PP PX"000SQ(\Uڅ;;SNU8U0011 U00R@@T U 1 Q P=YH!0|!>l1 h=\=,DH0S @H0S G@ <000P@84TO -L M䁟P@P!0S$$$UT<0000U$ha 0 RQ R 0QF!< 1 R F T:P0U$`0 `[0 njlȠ( `0P@( Kd$@ PF$0H o<<T@8O4O<OPPm0PTP -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 YPAb0 0OPV?KK(@D@D?+iP`G?+iP;@@ H4P+X@ P000 P ,0 S ,j6F0 ;;*F ;$F Fp  F` F ?+hP}@94mPPTPPPQ0Q -LMdNK@D0 @Dp (0 Pw P  0 y,NPi,K-F,9,K'@,@ sP, KgA0h 7+P9T +PԬtL U -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,e0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 002,P\0` X@0 W-P+P9(UXUtL`U -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S "e鰬9pY -%ML,M%K0(J⒍K JE(H,0 (H %b}K(pG P`$pG; S/R P58,0 S 4,d KH%0R/S /00H5 0H5` %,K( B:KBPb:KP fL%$(K0: S 4 o*PsPQ.P|4 R %,PsP00'P@40S(40S- :KL5*KP/QH xKLP 5*KP:KH5P@0S 30S #a=(K0Q|3|#׸4*P#P* $P$C0S3 R *KPP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V D*A u%K(JPJuP@ "   {R?0P! 5t,11 0Qڍ0S0  (Ka=  ,-0QBa=l (KX00SX0X ?0l 49Ĭ UUUUH|tL UV -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4_4P 1@ X40$P$ 0S U0 R @4P r @0| ,0K8P P/0ST 000 08P(VPVtVVVL -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ \h @VW 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0W3 83`h  -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T mP T $`P  00T 0$`00  XPl0(&PC3dAd@d@000XRPldh  -LpPP 0S ,0SP!&0aV 0S ʟP0S$0 0@0S# V ➟P00 0$ 0 T %P(@`PP0i000p=` -LpPP 0S ,0SP %0aV 0S nP0S$0 0@0S# V BBP00 0$ 0  %P(@``P*P0000td -LM@(+aMP@ 0S t[ -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 夞@0 0 0S Z09\t[ [ 0A0- SPL@ 0]0S8  R0S+ 0+[[ -a- `L0Q!0p@[ P20P d 0p QL e+4 $\+ PP [[\0 KS- L0P 0@\ -PL@LPgb=0  G|1  @d1  9Lq0 241  +1$  $1*  00   0A0a-  mam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞Tttta=0A 0bPP2 HD 0 P,2 0 P 2  x*$0 S $yY1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0Z Pv A90H\qp\\ (,$\\0 mS- LG0P 0\0 mS- L80P 0\0 yԬ -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 P V $04 4`!f0 s L1^  l P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#RԬ (,H8$0 |0  Ԭ -H$L|M0 ,0 X P $00CS 4   4圐K R 0  1 P3=6K 0) P7#00CShphha=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,W2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0  (sq0b= 0P@60 0N PL [b=0P@06\  0> P 90Ԭq] ,]\](,$h]]qQ-H0 4S Q 0 S  q -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y (,$08H P& -%L0M0 (0 H .P4H@ AR4  0AS#$$$HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 y&S(0 S (yU0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#90]]] (,$^D^ -0` LK$KP P0`P| P/d 0QpL0L {P0, {% p(,h^ 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0/\ 00h7%40 |000 0 جx 8|^(, p-LKtM @`KP]P   \L0  Fp$pF/0 00$^^- 0P ) -LpM`@K&PP X0PpWH0P 0R ,0 ^$Pꌬ^ -LtMpPK@P1 R* 0R5 0: S, |3PAP . 0Q` P X 0x @$X.0L {$XP 0R @$ꌬp$_D_X_ -MLP4M H4p , t * $00C S*---------3P3 RIKII 4S+P) s.#0@P \ `3 RT3T P00#$3 ,0S ,R3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L垖P P0SBB0S1 R  ;IKAAP!0S$\1  #-4t!#11  BnKP`F`FU!B4: S>p@ Pp- 0h#00 ,  %x '#B X 9hЬp(,|__جx8l__0_` p-LtM`KPuP 0@T0: S 1Ppa-L 0#pPVpQ- p錬D`X` -LtM0@/SP @//㤕`@pKT/ `40S0S ĵx0\0S0S! Fx ج -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HEP,00 ", 0"x`` -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HtP,00 T", 0M"x`` -LM@l0Sl`0P y,0S u,04 ,"$0 RZPd`t -LM@ 0Sl`0ڔP L,0S H,04 !$0 R-Pd`t -LM@0Sl`0屔P #,0S ,04 !$0 RPd`t -LM!@P, 0h!` -*0LM"*@y?P+ 0h!` -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c+ 0 X!pW;P  0p\!x/06Q`|+ 0 a a0a@a p-RLM`0 Pp@0T<  BPW+ 0ph !P+ ata 0-0@SLP 4 0R0a 0h2ꄬ8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  MP p R0 RPa- 0S0S 0  0 ,0S ,OK(A4A P a=(K0Q p0| 0QX0P*4 0@  * 0$ 9`aaaaK -0 0R00000L R0000 R0@00x0 RlDh0P PP0 R P$ Ьܬ̬ a p-PLM@` 0S pPP @P0/S00H 0 S8 @`0 0 PPPPp b8bd0 R00T0T QH0  \80 R,0 P0" 0-0P LRl0@T 0S @T00SU0 ((8Pꄬ`b: -QLP=aq R1 0S  0S0! @0S00 0 P 0P 0P) 0` )P |PC00  bT -L#L M0PS44spP 30C S8>`>>x>>>>>>>>>>2 R 0, K@00KtP0,0 0y0  0l"(0X"" 0@"bMb=0@`l `0 @p 1؁ * RY 7 R$00  +QP0 `ç 0!夑 P;0\1 x1%) 0\!  R8a- 00 R0 !0 R  R00 R0 00S  0a @0@00(0SPA(h 00P2bbbb  c8,c -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p T pPH vP  P@P0  P 霬0:8cXc -2LtMxŸ@0pŸT S, Pp$T ↆ0 CR 00Ҿ2 ,0S ,L0R Y X@K1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᒎ:TP 0 0:S l R1 0 LP0=?0C0 h 7:cd p-LM0@P/+|P00l0s0SP`ph8<h0Sph00phhld -LTMptp %  p 00@JS񟗈NOOOOOOOOOOOOOOOOONO$O0OOOOOOOOOOOOOOOOOOOPPPOOOOOON(P\PhPOtPOOPOPPOPPPOQQQQQQRORp(4qDTR0S`0@0w,0S 3wCˍPv  4 up4Po\j43d Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|P1@ 0S `Pa0CS"@QQQQ`QQQQQQQQQQQQ1` 0S{1P1P1P1P1 87t1p1{1lPzqT1z-L1y*D1y'xP0a,AH0pK @p b<1P@x   0sP@ P❂UH@ 0d5 0'DdTtddEdܬЬ<̬|ddDجxdt@fe e:%DHn9:PX7Ĭ5%95@5P2d0h ,X0(d%000$T5045@%, 85R Q@b% % 5 00CSTY 0SYY[[YpP. Ym 80I`0< 80 VL PD;P< PpXP(L4 RYPW 3 , RC0S 0S P 0S\30 }QrP@ ÊP P 2 P 2Pp(嬊P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q rP1<xP0B LP dP}hP1 RY0  ]iqP@ NYDPP 1 K/PP 000B"P(P `P`P@  P*/P|$z `0S Ddeddeeeeee@ܬeЬ̬ܒHXxجtD7:00: ffH  fDfHfPLf: -LpM`@pK"@8! 00RPPCP0: SU/00 0D '!00SP  Lol -4L$LM4$䄟P4 $4p $p 60@DSpa8b8b8b8b8b8b8b8b8b8baaa8bac8bXbc8b8bb8b8bc8b8b8bL`8b8b8b8b8b8b4c8b8b8b8b8b8baL`@cHc8bTc8b8b\c8bL`dclc8btcc8bcL`ccc8b8b8bc3x3x#000d3+ X3kH3@c@pP@ P 3 R )  #b尒ŸH0pK  p L2P@l  2^` @ pp`~VH@ L2POH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QScc@d@dd R|PP R0S,1 $\P t0 R { R 0 PPg جxDp\fdH  f f@fff:%ЬܒH0:tD7X0:fĬ K00C0  0m -ML M\\1 `P$ ^KPE840,0S/0S0 S0 K0S( .S @ Wp ᬃ P;0W$0 S x$?d0 K@TTH~9lmmmm Tn$nDn pn|nn p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0Mn -LcMZK MpKK K(@DKK( @DN*K", 8KWLK KPH0`K: bK(J,J 02P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,>T *0S 0TP*0S0T0* K\ 0 1(K R K([x0(K RK*K:K(咂ZKX:KZK(8Bx0S  KP KZK(8TKQ :K(09 T\nn:no$o -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV c@\S R0P -LMp㦸1PU|PP 0S`QDP@ 0 S/R< ,4aP2 T,/00 1  zbPP 0S~~~~~|00 R0 h@T0 0S/S C@ ,0 @oHoȬHPo|ooX0X P -88L(0 Rg=too p-L,M(@K0P +P &P !Pt <A8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV PF P6 P& P0  40 P PpX!sp@0S P@0S P@0S P@0S P@P |P 0K   0K  w 0K  k 0K  _pPp -x0LM @R`0 R P0 RP PaP p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S PP P0! 0px  ` 0#S@ P,&P  />30pTp=tpX0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. &PP$ 0"C12d1@cP 0S P?P P0! 0px  ` 0#S@ P,寶P  />3pp=pX0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /PPp0 S 00C S0u 0SпP@j U 0SE00*q0S1W 0S !0 0P!10@ @@P000 RH 0 ӿ, } ̿x P 00000 0S MS CS000 0S 0S cS mS00dv,QW0p0@ .QT@}  (9 (q@qdqqqqq(r@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R H -LMP 0pS@ q 20  00S| 0SAT`q @P_0 1 !.B=R pGV0G SRꨌL  0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R Ep010!.CDR Pk?C@.PT @}< 0-LPL@DT  00S0 =  Lr -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00۽0hؽ0$qv -dpL0S ` AT@0`V01P@P幽᷽U p-LMP@T0 p0Sx`t 0 h0h ?X0PC000 d 04 GrȬr r -ML0M (R04 ,0  2 ,0S ,94! K!8 0AT ~KpGR0pG8 @TP@, Q0 0Q  CP XD! T14a=  8,1008 A>  0`PS 0S060S  aPT 4a=0 S0ń8  $ 9rG s$sDshss 0-LPL@DT  0+0S0 z s -8L@T`i !0pAT Y|PP! @T lP@ gP gP 0! 0A吼Ꮌh: T  /|P 值 ygP % ss t -@L0`SpP` M0AT |P @T {P:0G0 0-LPL@DT  0铲0S0  =3lt -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S pP 00 0 0   EB0, PhPP 0p p00  ` WPP 0X0@ 7P 00  tt 0-LPL@DT  0魱0S0  =u p-LML`0S P0AT  0V@TPOUp -LM䀟pPP, / 0"c12f1`cAT 0S @TԺP@ fP pP ,000! 0A(o0ST />38u 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00Ὼ0/>3 0-TPL@ T0 04 @00r0S00S0$lu -MLM,Q,0S, p`* 1 R 0/S BKAA<P % `Ѐ@0Q P@peBP 00(00 徠 000 ,0S `,6T |P 0 9u$uu -`L0S$ PPUJp0"S@0S ? 0RH Q B PUZ000x p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@1p x -P 0S\ \P00S0 BS,4Ġ00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR|00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  Y]0S @T0   00R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8   -3LCM |3 B, RħԪȪԪԪ83 R  3 ,0S ,3BP0SPdU <"Kz d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A 婲PdC000 (3>K 啲PVXCX_K#^?K@|A ϩPHx!1RS@$0uP0;CS040@4Q0S|  ` dlA  !r 10C1 =At0\ T0 02P@T00< KcK0 ! ݺ`VKe/K:1  < K eK R x0S: A U+ 0S +m5  1 刡 n 00Ì bK 0Pʱ+ 0<6 ~D$&'r464\&=K@ӱPpOd&Y?KP0C PűP Y?KP0C P己PwllF]?K 墱0(PK0@00  O? K ^ 300 0p1  000+]?K| W ]?Kr 7 ]?Kh ~P@ 00 姲OOK,n@@H 0-LGP:0^  x0\*m5P0\@ PL0@ DM@P@4ޡ? 0̮4@$ -LM@ @ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@d0P0?P P$JKx!(@D@D0h!`P%rk 0P ,0 Q  ,;* k`8#8P#$0$ @JK(@D @DK<:(<2: !<(K0<:(<2:(LL!<  0忱9$,@ Į||)|, -L4MD 0K`lD 0P@K0 Z L7  剱  ,D h0S '0S0 0R0; 6"  O R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $L0 0c@BHX@000CS00  ä0e S7 S@'PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0 p婰D 0T Phß00p@gU0#DHLᄰ$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:n0pW@ *0Sp a0W:\YP@K0/PKP@0/郚0 \G 8K848 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   pĮ},̮@Ȯ($}:8}@}L}`}d}l}|}}} $}}}}HP8@~MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004婙K(IITK(JJT$0 tzo * fa0# qo* ]a#0S`V* XЋVP@ʋX0 Ґ - P@ἋV0 8#0 ?o *+a *'aQ 2 R v  ,0 S ,M'2@2@P0 ЗŸp`0 ɗ6@PK0L X0/0ṗ)K@ B0/0/P@@婗0/P@@0/ᙗ0/P@ @K0LP@0/@列)K0 BP@0/@KP@P!<0 @n *` i W P@M  nf  n *`3K (JJ0 n *` 0RBK(II l*s`Y@A9:~̮0~ȮH~HP8@\~~~~~ -L0 K M00, 000K 0  p/? 0@ @ _` Q @0 RQ   -LM@zT (0PÞ0P%̮ -LM@Qs (08@`h0QX| h0S #!Q <hpxp凭`XPLHDh840#$(,"(hz0S S0Swusqo0("#~$Hh ,T|Ā(<Lhxā܁ 0Pt 0DXp p-L M0@0aeP0 !P)) 0  tVP`F `00CS00  0p ph(V`Fꔃ؃: -0L M0 K0 .P@ 廬0888 l(尬0 lĮ$l -LM@0 01R4 R(  0 $h,X -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @KT墸<ĮĄ "2S 0 1R0S 0S, -L0 㱓$: p-0LM 0PaQ*@PU: P@ x 0P 0 Q@ 0S @@Tp0S 0 @0  -LMСpPe 0Qi$0Sƚ LPo0@0  Po0 z5@"%$0& P9 MP P Ꮻ(` 9P0S0S} 0@ efXeP0 0QO$ 0M#Ȼr:ą -LMp 64 K, p" PP0S40UX0SP `4V ,"0 0S@P1 ,40X+0S*kP8 #! Pܨ`S/0 P\ P8 L; 4,  00X00,00 0S0S,0 2PP0S  4, 0t 00PPPPX,00@0& 0 0 0$0&0PO}t0Sqm - qPFL` o0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P RĻ  -MLMp0P@AnK 0 `FO`F 0 0U0 U00S0 U. 0S l g"@H0S D 08: S0  9Ļ T -L@!x1hFSP/ 0Q0 0 : SFH` d0S T(0S 10g1hhP  PP 0h<\T(@LTl -LMa0P, 0 (@ tt1L pKR `0 T! 00C SGh0X8X@XHXPX` A?K K0 0Q0 00nS 0 S !0nIK00 K pKA/00, W       9t p-LM(`P,@坪P ,IP p  L0S$ `0! 00C S<LtTt\tdtlt|0 0p0000000 -LCM MD$E~KpGpG 0,           `$ \$ ` 3* R@ R  ȣd$ 0SP' 0Sk3 3(K |3P\4 4 XT 9@T40 @TL T0@: S< ,(P,0 S , 2 2@PP 2 P2R( K"\$ XD @An04"T2 R0S <iBNK@D@DH P@1 qd4 S00C0 zy !1@01k 000l<y \10S @&<nx0)0S dP^ 0 qPV 0 UP@ x0SJ MGP @0S? <4I 0S t89T|<\`<  TD\pć -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3| -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,E.K B B0h$ !1`$ (@K  d 8 X \ @&?ၔ hBNK@D@D 0 P h F0D_0 p` "p9Ļԇ -LM r`p&娎 PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S7RP@N &,0SA&y00,0S0 00 ٦0 R !@@P0, P( ,P6  c Ɨ@0 S/0,0C0C;0 (0Rd@E: -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  ^0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QP|  -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,3 0@83P @" Q 7%0$ :  0ePPd 0hƑ(0CC1/|x0Pw00S  n Q<;P99Ԉ8 -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0  p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,\ 4 0 |00S00YX   D0TPDHHPH @7 Q L: 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:080|0c @P0088  <  +9d&Ԉ8  -0LM PU@p$`y` #T*U0 R  0喃" l`▂#0U<0 R 0p 0喃" 4,@\t -0P0 P00LMS0 P܀ R0 P.:p$60PP5`@2:(P`@,F0B$|P0 R0`@00.$F00$@0 pĻ -!LM0\00 \pG\(:`(P``Ӡ,F0Bའ$ˠ0 ƚ \ṠPt0t0l h d@d0 B0(0000LT\Ļ`@XDPH - 6 8`0(@ 0L 0SĠP`傠묀pplP3@00 00`PS P@0Ss0S͞P,D\TLXP`DH@ԉ -LM@P00H -LM@&B ? Pa(⚞PUp* 0А0 T00P00@ 000p@0 (($`"d0 dS D 0 Q00ǞP  -P0LM@֟<0 P 0S P  p-LM``0S TPT 01@CT*ge000p_0T*괴 0   -LM`P@aUpᰀ 0SP 0S 00C0$d 㞡\0 iD80  \0   >괻d^4  <T 0-(0@ LRP 0 ,p, 00 0-(0P@LT ,]P  T00T0S 0 T @0Ļ 0-LM@N0T0 T00S0 T0P=7@H0S|1t.p0 Rd T$0K0 P" 8 (HĻPX\hty -0LM@ 0h \ 00CS  00 00  댊  -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`P( 00@$K^N$ @0 0 /&`$ 000H0G  W00 R Ļ 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ]$0$  00C00<   -LM@P r0 `0"pM b0@SB@T\1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ OP J0 R T@DG  0;T@Dl6zX T0 R D,`7iid p-L@M P`K E0S 0S  j p -LM`t`ğ QS, @ DdI 0S 0Sm p P0S 3 ,0S ,s 0ṢģL0S/ P먓0S 0S0\CS 0S 70S 0S @C 1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0 R | P+ h1 !0/o (K0 o@0 ,?0S {0Su P 00S(< ㅝP0S X^ P D <I tt ,č4 ܍ ,HTlHЎ  -LM@P4Ppc`VWW1 0S>000 0. $0`F0V$0@X L0 S00*P (@ R00  0R 0S R0R0S P 0 R P` gX0 S00Dŏ<</(X H (  -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  t)  -LM`VPڴp崀S@PT 0S  0T @T R 0S `FVP 0  0P 00 X -ML M0,0   BR*.*...xt P d$ PTDT$E>K0C4  L44 $0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:_$3 ,0S <, 0S 0 S s S # P"   00C0 " P  000 00C0  TR0S-@<2V@[ P  +2(K_KK@$ (@0\4  X$ sM!Q& B0O0  0l{ 6`X!0SV Eo0 ᒅ5@"%$1 R0 P P. Pd P D0:90|f9 ȏ$9/ԏ܏T D L@ @`Hx -MLM$p\0,0 (`; R 0S  L0 S8(K 4  `0 A?(K  A?(K D KKgU0((K0Q 0@^^>KMK 2 P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dZ X (,0 S <,E00 00CS񟗳11`3`3 4 4$0S&&L0S6 `03  00C SKP2(3P303P383P3@3P3H3P3X3 0S 00C S'22323333333 300&c P%00C00000000      0S $\NK @D@D0, S^K PE0 0%z5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00r PS L0S|3(K4!  `0A?( K A?(K KK &T$\0 0 Q0hNK0ᴀ$00$03  0`0C0  @@Q @T; Q 0S+ 0 SP $00$0P "00C0"t>KMK ἗ PH"dD000.S "X ?8P00L Rm `0j 0Sg <\@P^>KMK @d$00$0@1  0`0C0 ᘘ崀=@t?PSP( j50.SR 00Ph L0S# `0 0S 0<0P$0  9L0 Ļ Xhp|̐ؐT܏H|( ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000긴 < 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.:,;;,;;; 0QP 0S P0  00 dHK HKtHK4 00  9,< lHT( -LM`VP$Pq 0S8 @T 0S @T0 \( 00C0`FVP 0  @00嶒T( -LuMĆ0,0 l p! g1PW1 1 1  6 \pP  (` ,6&CPq !,6"! 0&7& &  rK f?KP4 Z(1P*P0Q0 Q00S 0`F' 2 0P:6P P0ş 0P1!5% Q5@!0R# 0<0QK0S   1, 0S  0h` K_KH$1U,6 1R rK P0S#1}U& ɖPl0SV1#nU&ẖP<6 PA0S 0S ) `1B 0S DrK~ P ἑ ẑŸ,0 S ,j C1! 0 000S  ReKX P !&001&hP dHPBeK7 P & !00! &GPq '1z! ue,6KQ01,&K `,6xAQ000L0SD1 S@D0S!1 S* 0Q15021 5:0Q 0ׇ 0@0CSt>lC`C`C`ClC101 0`F4,6 0 ,6! yX@0 L;9(\@dȻlx @E -PULp`:4U@$Q@TPZ U:괓 0 <D0<0@ --L T! : p-PLM@P`l0l R ỒT D0 Rp80 㾼 0    Dy<ē --L  --L  -LM@E h$ --L   p-LtM/P>@TK % P0: S p0`rS $ 0-/L@PU+D0 00O/00(+E+E00 -LUMpPKP P@lK8 0S(0: S  SU zP U@P P@0 R000K@ P h1: SD Zc$^@Lo( P-L P d8 -QLM@ ޏP T S᭏H -L:P EX -kMLM7 6@, @6K0A䆟 A 6 P_ P6: S @PK 㢅&P0S| |6 Rq 0 S i\0Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S , L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5y@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@3PL x3PTChG T3P= ڄP03$- 6SR ,@!0@T00 "2 㸄B00㲄0"S P x2lPP\Hd,(PPO@'nT J/ Esy1  LPP>, s&R0S%"0!S$~ *pu!PLm~`C ,eXC ]뚙?A9ĴhH0<Ȼȴ$Ĕ DhĻ4(  Dh@EԖ<dlx  -L M, Zß ?y3弃 ;mP c+ #x3R,p / pW,P  0bW@Ṏ0EOa.6 0@Ɔ& 6F@V姎3 ( &$6堎r 0(& 0Dᦎ00 ᡎB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ B+㠑P 0 R,w6xP@kU*0 Q@tPU:aA ,0 鬻$ȻS̗ȴĴܗ<|@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%%  -PLM@ 00 R$hk鴻y -LMp@K`@vm Pa0@S p1P  0PUZ c qh10  00S 2WnC` `F R R010!,!lc.ㅐ 0P3 00C .  Kp_%[EUPv10GOa.U&`n  0 6 & `@0PV6@ p$)P<ؘL -0LM@H H}P0T A edA4H-L0(&S  d0 P0S\P P1 Pa S\Q 60Q -L: S  S  S H0 R4 S S  S S꠻ -1LM `ReJP@@ WT|1 RRp1 RNd0ST D1 R <0QXp(x00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT YT00yTP xu P00XGpu@4L(E괻H0:̙ -0 @LM̀@@0 ` @@``PUPTp p j@gP00TQ  p0WD0@@Whl 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0lh  p-l0LM@Ɠ0\S` @088 000 0 `Ppl p-LM0@S` PU 0 y0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T $ dpȻ 0-L0P LR @  (B$P 0 봻$H8 -LM8pP(2G 2 R b  ? @_uTo 1 RP a@T T rP叉ፉUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1o 1 !@PȊ0 @C@0P P  ?u@0@ 0P PPUgHk밻ȻĴ$Llhhȴ -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, ҍQd4 ,4 P[ 0@0K,0QM@4 8@ {H]4P8pT54 , R0,# @K@_@K0 ᝍ 0`Q 00Vs# %@!0P -88 x 4@0pW д8@ 0@80 0$Ԛܚ   -PLM, 00 ]@_l!@K0/a,@@K,< FQG 0 s0PP< ,@`K 05Q.0pZ o X@ 0R  @@K0 `@0PK_tp  ᤉ,\0 Z<,S00 ,K$(0 0p@-l@00CP XPX`  Q2 00CPp02 0  p4( -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH iGT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fz`` /00f V:TPU L0L X0 0 TP  U \KLo@ T -L { 0-LMMpPANK@D0@D` 0 J> m80 :z 0S 09\d -LMn0@+"zzc@ -LM0@S j\kTk\k00S lh0 R \P0008;Vl -L`P`똡嘁q@!pb@1 P4lXlXl@lXlXlXlXlXlXlXlXlPlXlXlXlXltl|lll@@1@@@0 #<A00+@0 0QQ0 R|0 R 0 R|0 RP0 R XqP LIH0M tЛ:؛x:7T| -0`P0@LpP -FPxP00U0`00p0S8-PP$ 0 @0:0H l| -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|3t"0`000R P, -0R(p0 CR 0@0R P0Rp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rͱp0 R T 0 R2 0T0Q0S* Dl :0@" eX`o@0:t<l|xT -0p`0P@LP DP@ 000T՚0S X{P@ d0 @0:0l| -LpM` 0Rp䠟%  p@ PP   PP p @T㞚Pl0l,d0 KPL, P 3婄P$:pTl|Է -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu0,0  `  L4H4 0`00  p0SV PEU@ CP PEU@ȃc0S CPPE@ $0S33 |3 00S UD30 0 O*Y U Z U < ,  CU "0p0t0 ڴCPPUU|CP\PUSPb0S CP 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q d㕓PE@< 000PEU@ 00S1Q& 00S   C0 uP 01S00S00S @ C|0 juPp@ ܽLAp|@PhxTvؽ 0-TPL0@S s<0ޘ > 0P@0000 p-1LM0`@PPǘ uP=UP  uP3PJp uPx0l tP`P0X500 DtP< 000p i zi i Խ~i $ -L,MD0P`K@p,0 ($ g _B tp 0S 0S 0S%@P yP<   tpJ<@TU  @00PEU00Sp<哂,0 S,D9i$ȧ p-L,M`0P@@K0 +$   B`0` ht0sHD  ,8 ㊮ 0S p9i$ ا -L8M0@(0 LKPp`$ ׆ AU0 @ PK>-P @Rp0h-S`@dAP8@ 9D0D tp0 (0S (90i$<L -PLp M`0  ,P`  ˆP 0 Sr200000S0p,Kt+P p〗,PU V" X 0 Sr4200000S qAP n %Ph0 r1000P^ 00S .B  AR #  7  tAR #  d(A $A 00S UP2  p,Z  'AP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPUx,I,VLW<<( 6\<dHXܽ:p -L0 ,@(0( $spɖ ܽzi  -4L ,@(0( sp ܽyi  p-L M$@K DQ喅8 rp$ $ḀP`  $0 0 ` rpㅖ 0$ PS 0@UU0  CR 0 R00 h= 0PU@H00CS00  ä0 ᯀpxi Ĩ:l -P0LMH@D0  \ (0$0  |ؽ -0L0  -0L0  -<0<L00, er0Shܽi  -80L4000 0Or0Shܽ i  -L, 0000 0ؽ -0LM0@S/ h00S00S P00  ⎃,0T, @00 0 0 0|ؽ -$$ 0L00  | -L(Mp0@PK` @ 0 j q0S r?3[x DT 0 T KqP@o 0S, }9ܽi i P` Qd0d0A00d0X` -L M Kp0,` *$P@\  0q0t0p00dS Xe*?0SHD p@h ?$ P0t@l0@Bl`X p-0LM0`0S ?P 3P!K(P@T 00S >P 0S 00S` @TV80#*p<d -PLM`@Kp| `$>1 @`*@0 DP 00 ,(0p0S3ܽi  -PLM`@Kp| `$x>1 @`)@0 DP 00 ,(0p0Sܽi  p-L,M`0@PK@$ 0 N F>0S  P0r00000Sp  ,K0>PX P{H0pp83 0S(Ap9< i$Pp p-L,M`0@PK@$ 0  >0S > P0r00000Sp  ,K=PX P6H0Ipp8 0S(p9<i$ -LM@0Pp`P  R0@r1000xSY@Qg W =PY r10000D0S  rt10000D0SX0UYDDeY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S A=P@00 `hV fB`x;<8 p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph8@T$@Tpx;<LT 0-L0MPQ! @0K  <Kׁ0@0  ; K@ P \@@0[X <0K<H0H <0K0$oP0` 0S 09ܽi Xh 0-L MP0Q 0 @!K  0Sp r Kp0@KL <@0@ np0, 0S 09ti -LM䁟0\pK@8 P`K$0 l@ h0tL0 H0 0L0 Q  P L0H K2lpK1p`K01@Tژ2 lp/0QtPP@1@SPTUpPl rp200000S 0:SP P8l PPU t$@T0, CR 0 R00٦p0K1S/U@ Tڴ1S0Sp\X1PT![ L0D hlP 1S  0 CR 0R00Ꜧl0I00CS00  ä0 \00S),0 S,9ܽi i8iiii:i|CBȬ<جܬ i   ->MLDM1圑0 ,   >KK(@DD@D d~` 9P kP` 0S;,8>{KL@K(pG $pG>[~~ z~ 8P 4p p9 kP@ <0S <0TPD( 0 0CS00ä0<0@T|PZP ,0S<,e9`i 4i|L`h:lt -x0L`! @ T @  0 CR 0R00ĥx0 83tSpRW` LDLUYTP@ZPMYp[$[ed0S B0S 0B 0 CR 0R00}505P &d 0 CR 0R00fx07< h 鈭:CBĭЭԭl 0-0L0MP0@@K( 0 } 8|0| jP0SX0 P0 H00<$ ň 0S(0x96i(< 0-t0tP0Lh@h  \0\00 00N8@08 jP$T0xܽ<D5i Į p-LM@`00X`PD 8t@P$NP^Ppx<Ԯ( -Lqd0d0`pTX0@#nPp@@Np0 H 0x<X -LM@KD004 (/ 00xį< -LM@-D004 ( 00x<D -L M0p$0  @pp`0h\$KP`@#$0@@S ܇x<Ht40S 0S0S-L0S 00  S\0S0д 0-@PL0 Np0 㙇00 0-@PL0 9p0 ㄇ0 -Lp"PP`@l2d0p0`@0 @e8jo@T( uw\   p-LM0@S`P 00  SxPp@0Sp -QLMPp W@cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H} H00p@0S% 4ip<D  %P\ -LBM MLCNK@DP0 @D/㋏KKoK,0 PPk{ c61 hPp2(K 0Sc 0( K @<PP@JuP,E6(0K 0(K 0QpRKH K <P@P2uPP,-6 0D ,0S4,G9Ki l|t -LM0@(0 4$4Q4QT00CS00  ä0 T 0S 0SS}Xp@K Ddz 50K( `0 6hP`0SP@KX( z 5 !hP0P厠uPp 3 ,p hPx㯋p @4 @0R0 0  CR 0R0060( CR 0R00' 40) CR 0R00`R00CS00  ä0 880< L:H20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^ 0\0CS00  ä0 8ȡp10S P00@T`10S V8`3 0  㓡00@T PU`uX0@T  @0S 0 0$0S^ (0S(9yԽ`$l:xi 6i(ԷȤФD~ L@Ķhܽ -LMX0Tr$0 0S00+S (宊$B$ 44PK ixw D4 DfP 1`  01S# |yA0 x! fP 01S Dgy\4 0\41x<? 14 8#"50! 40K@  DfP 01S :y| /4P x00CS00  ä0 d͠ $0ST$;9 ܽض%i h"i  #i ,:< -(0L00S 0 0S 00S "48<#80  -DLM08@,0 0S^0+S ܉`p㓏Kpp <rP,330: SOK.x 3O_K0d fP%01SD;@ x,3 (K @OOK <}rP,x3]SOK.tx l3OK0 eP01S hMKP:.Rx J3O_K0  ePp01S <1<1<1<1 <1Y 10SB .x4 30L meP01S) (&81S<1S $@8P PdP Pd j0 ,0S,9  H"i Th%i pIi ̷طQi  l ,H -LMPP1@q`P4K $ wV00V@/P 0 K0Ip@ 8PK 0z6P #.00`P|P@ 0 DvʅP  <Kk<004 㨂 $0S$u988<@P p-L MK,` 0 AP0S |V0000 P00P0S 00p0P@0P0P0 `20p8\ p-LMR@!X` 0S   TZ p@0< CR 0R00Ꝟ0S7 0CU3* V ,0 CR 0R00ꅞ` \0 CR 0 R \ 00o \0 S0 S0SD>0 CR 0R00pphRplt: Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00, ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0S:x; -LMMp0UK,0 d1`@ QAv0VP1 L /,1P MK!.1AP /100>0@` V?K]P e 0eX1 R  ]t0S 00S Q0S !"4 40X ,0S$,9H@| -LMK,p0 Q`N 0@S W0000T00TQP  u uT@D0T0T0 d20H\@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  4&I: -L(M@q0D@K$ ,a 0 cu$ [0 bp0S3 0S/ 4P% gP0   bpK0@`TUJ0PPE Vt` h@00U00SV  0S, <9i$% - @LM0 3锼h 0-Lyw@TlPll 0hΚ/ 00oZ404 Jb0S 0h0ܽi 0DD/D0D/0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p] P8 ,&00pP6 P@ &< 倪p< 10@GS񟗶`PX`x,4$P@@4@@4P$p4@$P@@@l4\4X4T4 H4H$P@<4$$440$0 s 4 #4@@#3@@330샟80 ;0e#00#3@t#P@@t#t3PT#@@3@#PP3|3x3t#PEl3(#00?$3#< s<82"P2@@@"0#s"000qS`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0S\2 R 80S0Y 0/;40$"0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   z11 S41 R!1 Rx!x!t! 0S SX!S0 R@!0 R0!0!,!4K< Qt< mqP n0H 0000 K_P"[R0 DL@8|H8p<`@txThXd\P7\(@l,0@,\4ht@ -1L1\0@p ᎪP`h ɬp1 R\0SᇫPPK 30CS\\l\\lD0.S# A0SW ᝬ@C0@T@S@@T  003S 0 R DxƗ"D0 SDT弗P0 g0S0t@H0dlLtl -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@KK00 #F0P @ qPql QR P   elP@ 0 0),0 0 0",0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V bl`V2 ,0S ,D@K"0 /qx !0t p /q! 0l / q1h R0d0  ` `!0/pd  000 +0-S lLq 0R@@@ p P [܁   ?0 R0 0p Q0 R Y!D `S\0 ]9PxA(0hT!0L@l -LP# \ \ P  \  Php P 3S40 RP \ 0@, 0-@LTP 0S@T0  , 0 0CS00ä0: -L MԢ ( 3S 2 R2 R 2@lpQ[ 0SU l2@` RL2 Ry<@K$ 00@(2 Rf  2 RY0: S SK 0SC (080c!01 R 1 R0(D1 R&1 R# : S : S h00CS00  ä0 pW (0S (( 680([ "88 #$Y T, xOX@ 0B ?W@0 h?u  X:l9Ph `<|X:̹Թܹ 0-0P R 0L0x0 R00d0 RX0 R H0 @Tkk00P|X4 -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4k8 4kP80080 3S 1 R1 R 01@k80 R< ;al` g0/STR `Q0.SK R pGQ< 09|@t 00 ( -L(Mlq0@PKda @ 0 凌H RPD3[1 ,,!0zP"P  0 S N 00 0 x 0x 3KpRP8T 0ꊷ8 09i Ⱥ<Xh|i  -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LSW^0S 0' ; ㆊ0P˙P 0x 00P 00鑵8H 0ꇵ$ 08 , -!LWM0,0  pJPUaKJ/ bd T 5PP=WoK0PS @W 0]KS  @P U00R00Ss0 ,0S , \\ K.0 a0 O \ iD0D <` 0$ 39Ji(<, -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ Kal`K@ ]0 0p ŘP ,0S X,= ]@៴0 9L, D -RML 7 M(% 4% @% , 7) ǟxx   , 0 8 < D  t' \p2 H0@/S(4@ x 0 (HT0Ɵ:;;@00S lVA0C2SE0<00S|090;0:0;0:080gş80:( 8 07lFKL L4EG.Kx t :  B0p l [P 0 _5 09P@ Wl0:;8ꌳ TNKA @ 偳0S 0 R 4%RQ #NKA %<4P|ß0 R 4 R Xh 0@0VwP00<0M,0, "NKA 23 R 4 R0 S  "NKA]/l2`P0S2 4 R.". i8P"?肟@;0 @y/ A ?T 2P00(H10 \vP >T vPp!NKA P L0 R 4 Rk (`rϲXDD a080 00V00NKA n1Pڠ0 R 4 R Pø;d0 0:;7B/0<0:;:?.A9,D`:(@'T'x@z7| (Ddy8 0LX\Tt|*`h'u4X|l<0Ll4z1 bZ Z0% 1PFKL@ L@@@@@@|aGK@Hx t : 0p l P 0 R11 P0Q1  tA^2̆<P 90 I,%R0 KL@ L@@@@@N>K@0C, @:0C D {PJ$0S p0 00 )\P"0  NNKH2@D@DP)`' 0T `\PP2)( 0`\Pxu vSp X 0S Q0S33 0 $.0% >5 ZP$  #0 5@T @@T d\T`$0 00000000@@[@Tt@0D @T4 @0ROK4 Iq DP` 4)* 0 '\pr FKNK@D0D% R44:0  4 $: 0 \PO0 8LuP00 0 s0% 0% 05S8%R 454 00) .00   ,0S  < 4 (%R <5P(%. 0s 400) /0   0Q4 Z|&0) %R P0Sh&\KPEt '@0@[P86'0@[P&@)$ 0 @[P6)% 0@{[PE(@C @ɳ  ó 50C5 | @ >qL L,(0@ Lx00MKBKK dhdKL@AI L@ A 0IH P L PUd@T]0SV(0 NP@0 5 @cP> H804 =KL0Cˠ 4 $5 4 HP5 D 4 "P L%$  R 0SLPڴ0   C0S Zݯ0S  @Pr8K@:0=KEK0CL0C 0 0Zp: Rh[f ̳; ɳ//n D0 S \N>K0Cɠ@ 0Ct* @Z 05 oPP ;@<\0+0@0 )<5. xZPh0s )|; jZP0s ); \ZP@P 0)3 LZP%bP$O.K B BmPHmPJK4%4 0 @% 0) 30  @0KP@ V @ThOnK`F`F 0P@5@ 0S>KPLTK,3L4]W@=PH) P04 X=@O>K0C)0C& D YP 'KNK@D E\-D)+ 0 YpDOKI) 0Yp$,.N>K0C 0C@ YkPT.00 1l$x>x 哯P  1 PPj1 hJK  0 V$ RK,%08g/PP0  P$ 000P X\ -LM8P |0 R 0 l00 <L \=J:P 00 @4 @ @ @ I K kY@@H<00    0  -3L$M R 0SS@@@@@@@@@pp3  -X\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p ԑ0P0?@ P`2 X0 0P 8 Ꮒ,徱@K⻑<@@<4 Ġ̌(<"4!Č ̌$ -ML,M"0"KiK0(J, KŸJ@(pK(I @I" RA * -딂0" 7 * #tr0p" - *0SP `Va (" * *Q 1 R ST  {K0\ ,0 S ,&=c/P@0 5|p`0 50 P@q40 X4 1K0L $1$ yK0pG@!0P P *,/P@(/0 24T C40 X5 0 t   *vY@|9T~0~~:t -LMf@0 @ 0 PRDNNO4OPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPOOOOOOOOP PPP0RQhNNNNN\ 0S < 0$  048<("#0S S在0S S 咨 048<("d`储SPLHy@<840,($ PPK⬥ .0cQP [ .0YQP Q. y. yA0dpC= 04SMPRR R(Rd0`2  _  R$ R <W 0PPK .0QP 0 DRWPPK .0 QP pU 1MK @D K@D @ @ 0Xt Ptpnlhd`\Xݧ ۧ 04SlRRRRRΧ0   Q1q9,8`Ht(<T܁~hx 4D~LT`lx -L@MP0q DH0`LR!R 0 帤8,#44$<@PČ! @P@KP^ .0\PP. | pQ .0OPPL.  ጤ 0S , {xx9$HP -D0 ML@( <@@1 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K P,00CS \\\\]]@@TT(00T (00 -LM@ KPP"<p` 0 pKO0s 0H HJ@0P* M$`밥LWԷ -T0LML @K0*0$M000 W<0s 鐥LW -LMH0HD@|@ 0@ :<Ph__d$W  -L[> -PLdMPtJ@p6Phw\@@T&PHFH <P,6,6, P<P<`Ɵ*N%%5@@@5 F?%@@ş5ş!p%P0K@@iqJ?@{Gz?~@%W Ad$W ^VJh|,? O _-+( O \ W-+X XTd ͠` \0N @ˢ2P@2p`] -0L |:@ -LM`0X"XB00P0H0PPE 0S00(2( rP0005b22 .0S D,B,@,>,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_\tx` TD  p-LM@HLP `p -LM=@T00.0L0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;}` -L0MԂԢ 0Pp(0 PTPK 2b40S @@PH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K` 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 EpP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*B040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0l| -pLM@ 00s)0@@-`@? 0"00\ 0S0S000\ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$| -x0LM@ 4 BN@Ap@0t hz 00Np| 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0(00S00B>0@-(0A> 0$Đ6I  -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4  0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc5=?0/9P6 0S000 p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0xCpqph(p -LM4Px 404@0  0000 0 00 0 0 00  0?\00 -LMX@ 0S 00 0N> @0S0 04h -LM@0 Cpq @ -LM̀p`(P@TC@!y4A>B.A 0 0$D4 dD P  40 40 4sto 0-tP@0L 4@ 4@S 40 04T=0@0h000 pD0 00000Sp00000S <p0 000 < -p000L00 0S0  Pt t%P@ qL0 0000 0S8 0(0$   <(0 $ 00 0  -L 00 0 p-LMP%(B$`$@000!B000pB -`Lp00S 0P@Bx 0 0S %A0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00 -鐠p0 刀0b? |`PUL@0S 2A0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U uA0 @0b?TU,0@ 00c0m^ -PL0`0pS @eA 0 R ]A 0 0CR00S 000$KA000 p-LM|` x0RR@6A`0`P0 0R00C0*A00`00S c0Sp 0-p@LPA`0P0 AD P:00@P*0P0 0-t@tP0LS 0S 0S0800 P0S00 - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00 00 0-L@dPpx8@H D0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&HD`XĬ|xX<ppp4  p8ܶ(X(D@H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S  9 -LM@`M7pH700T0$*ZW 0PU*  pP@E X  @00R00 0R R0@T: 0-QPL@ 7 P:00S0S P#0Q  0Q A0S0pS P0PS@0PSP p-L MP0$@KS` $0s 0s 0S 40 1000 ptd P-L 0h -"LM0`PG"0S V HB@,K0 Kp0@ PPP{00S@HSP2@0,0 ? P8  8K81X 0 81 11  'P, 0d8K80 X1@0SiP ,P (8K8p 9yPYP ,F `1Z0 00 0 0`F =0`,`0Pg@0SPPt0`0S zD!t0U `00S8K 8p Ũ'10pl4tdh|`Pd -LM@0K` P8Kp @PU0P P@0 PUk8@0P`` 0  ' 0  ) -LP`pWW\`V@ZP PT 00 | 0  0  0-LP@+P@ sP0h0 -LM@PtPm p-LM@P `P U P V P ph&p -40L0S  h^p0 -Lphj -LM@50 0R`0S! 00R0@S000Sp40PS UP@000S00 -L 0P -LM(@0$SP00x, -LM@]P -L MP@4 R `p 1 0pR 00R`P Xp PZ V'y4p6Z`@ x p00h !P  P d  @00P00@ -PLM`p% 0 S" B4@?4@@%PP` 0 Pp#@}%PPP/DL/ HLo -LM@ VP -LM0`SP #R %RU0US 0 S %R #R1 1P 3``0SPQp@' #R %RU0US 0 S %R #R`0 X0P   d |3@Q00 -LHMp0@ 0 P  03pq ``K@ 㓨@TPP@T 0 S  g9X - L0z3pq0  0  -LMdp'P@00CS00`Ӥ0` V e0H v R00  @p.C3P@`00 -LM@uPp% 0S" `V $3@!3@@PT 0`;.$b@5.]@H d -L,MH1@TMT0K bIT0pTD0DPpP 2 .T0WT0pW`D0-PUp 2@2@`x 0|-T0W0S 20P S200@TKL - -t -1LM0S0 4  1p W EP` |cP 0|S`2@2 =@Pp8@ 80S0%S 0sS 080 @d2p00@]2T:@-TY P)K GP )[40D@00PP0S tp0 -,1LMP, UBR`Pp; 2@ 20,@2`@Z0 %S0sSZ   , ,1P@00P1U:@-T o鯅t| -LtMK@զP@x0: S@@, p-LtMP0SK` 1@x `q᯦0S4`d00S0: S 1*@[ `T  :,p|4 -LtMK@EPH0K00S 0-d0L0ST00pP@u TU 0000| 0S00> -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ l| -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7  -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0 -LMp`pP@uV iE 0S<00S,00S 0 0S00C'I P000P -P0Q0L00 00 000 - L00 00C0 p-LMP`(!@0  000p P0-L@P@ 0Th*0he*00PP0PP -LM@0S00 p-DPLM@`T Pp@Tp 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@,|@ -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P b @0Q P 0Px00Sl00 @,@ @0PU`XW,x  ,|@ p-pLM`Pv ZP2p P P@0P`40`%@0P`p P P0`p -L0SH hp0 s 0 0  Bh -LMp`pP@u P |00Sh0 tW V P@(0 f K!8 -L M@Kq O p-LM`pP@ux<pP@uPph UT0 ph, p-LM`P@P  P pyjP@$00S/ ph8 -L M`P, , SP,0@cT A dxlP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@H8 -hL-` 0S 0 0S<0040   0+0 l -p嬀0L`'PPጠ '@T0 '0P0|<  cj+  be+P@`L0 0DS@0 80 40 00 ,0 00 0 xhlpt| -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 0+$1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(̡9hlx p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 lxh@P $0 000@P D<P`X$0 000 p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pph -@LM80 00 B0 @00`0hl -T0LM0@SJ@000S P @TZh -0LlP -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000|Hlh -0LM00@0T0p` Pcڴ10U 010`@%P`  TJ1U RZT010Pe0 DPPE0 0U00lxx|h -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c \lh P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0PR'0 @@0@0@0TP 0 PX 000P 0 yP  000\hpHl 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000lHh|P00S 00<0< 80Q0(000000t0 0 t p-pLM@0`t cPP:p@ p%#@0t T T000CUP800@P@0 V000p -@0LMTpP$P $@0ꌀ0P0PE P@ p U `ZP @0<0Pf/$(0PE0@W0000@-p@T* R  :P0b0D 6@0@@0@0 < @-P 0S 00Q  -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0  -L^ 0  -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   | -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp+P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 | -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S \GECU,  !h4`P !LPp% 0S" 0S@PP` #@#@@?P 0`,U0SP#+4  '4{Y L W40 , otxd 400S Aa0@S<0 -A @L2$0R20 -'PLM! $P .P ^P@0 00 WP|@000C 0`@`000T@P@ 0s0s(P -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3 -L M^@K |0^0s 0s\0000 H00 0400 S P P -LZP ,0, 0S @-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  0 P-L0 x huLo 0-PLM@Y P 0P[0=0C:SGlPhPdP`P\PXP@8Pv040K 0(10 e0ptx (lPPP0 PPP= -@LMTd ThL0 !@<840,h}$,,P -LMЁ0P@$0 * TTbA`6 00B S10 0C00B S0hQQ@`#0,SVVE1C B(1`$1 <qK 0S#T`VPK K-!@*!0@1` 0`V@K!0@! `PK!@!P0@`0P KHP  $0S4$9x|0 d<HlX -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e` -l0LM@QT T@ hN$0  h$0 R00L -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV\\\p$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[VX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4DDDD W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHh -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW|hUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS\\t0010$K0$0 U 0  0  <$PQ PP -LMA@0 w`t -LP0 0S00 -LP  0   0Ph -LM0K0 =x -0L0hh -`LPp@x`0PSE 0$S T; "P80 0C$S'"""""""""""""""""""""""""""""""""""""00@f 2E 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X` -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ Rx<<X\0S R 0 R000000ӑS$0S8A0@Sa @0R0-P00 p-LM@P` ᓒX0@0P SP000000STo0Sp -LMK -LMpo `j@g@@# 0P` -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ r0 Kn00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS '''''00CS '''((@T U7`KPP0DS h(p(x((({ 0@p|l p-LMD`DP0@S 00PCP0  Ppl 0-@ L08PS@00 0R+0@00hk -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 #0 P@0@@hp`0Z-00hH  ,0 S ,9p -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hwp`0Z-00hH  ,0 S ,ؒ9x p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Sp9gfff 0-LM@P0$@K 0 O 0S 09 0-L M@P0@K 0 }7 0S 09 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@] T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 hd` 0-L@Psj 0 0h p-LM`0PS@ t00SX 0@S  @00Sc?(0 0S0 >p`pT00C p p000C 000C?0010@-H 0\8001000\0 0100@-<00 CR,0010 BR0 0000@-8 0R (0P@0100 R0 p-L MP` 0@R$K0S ]0 &00$0s 0s 0 01$ Kpl0@-P 0S0S0X@0^! 00S 0SN00^0 0AP<00 r0s  P@-p@0\`0 0r0s 00000\0  0P PPB@ -LM\X@TLD@0 840 ,{(0Tp<  p-LM@@`P8 0S BPl   @0  p88 -0LMK0K00K 0-L M8P0@K 0 . 0S h09 0-L M8P0@K 0 N 0S R09 0-LM8P0(@K 0 n 0S <09ꬮ -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓88788888887888D88888888888888888X7t77777888887788888888888t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\P8p0| p-LMB@6Pl<=h:=======0;===;===<=============9::=:==;==;;==;==l<<===<pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?~@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@ut0 u SR?P@09 \p0 s2  0 _0 S*P(Rph=Fp0 s ph| |0S0S S00CS00S S p@,0RP phph-p8p( 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf(>@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?(>@?(>@?@?@?@?@?@?@?(>@?@?@?(>0B0C2S=?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4??4?4?4?4?4?4?4? ?4?4??4?4?4?4?4?4?8?0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g8p 0 -D0L<080`00 ,0b A0 (p|(0$0 0b0c0A}  -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00<x;\00SH00S800SSS00SP\H0S r0000000S0S<000  $00S00SX($ -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp< -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV -LU0S, ,h0S000hV< -PlpL† @<0SX EL0S G@0S90P($X -LM@PF0 $( p-LMP `@ (0K l0 0"T\`PP (0 00 pX($ 0-DPLP @T000  00H@@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q,<@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@L@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 TTP -LM@K=0s0s n0 c -Lr 0 0S0 h,< -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u T -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH|, -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P X,<TP -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0@Hp@-`^@P  \\ 0S 0\ 0SP@Up^p 000| 000| 000| -@LMTP oDl< gdah]XXX -81LMXH @@ K}sC@bc:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   i|Xd( -LM0$ KK 0 0 AP$ - LJ P00x -LML0K Ap@T0[S00KT[ -GMLM7GnK, 7ǟ`F `F@0pxX D D Xd'Ep 20@FS]l]|c|c|c|c|c|c|c|c|c|c|c|c|c|c|c|c(\|c|c|c|c]|c|c(\|c|c|c(\|c ^|cT^l^|c|c|c|c|c|c|c|c|c|c|cx^^^^|c|c^|cH_|c|cT_|c|c`_|c|caaa|c|c8bb$6 R6 p6 R0%<0UK1 L腵4S 30(8UK1 Lr4S d <%tT5  n@5k$UK0 LW4S 08:$000S000;ꬤK0 L94P@S A04@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L萴4S >0$000QK1 Lz4S (0,0dQK1 Lg4S d0 0QK1L T4S000 !1 bXq$B^KPEPE@dP  3P $0P <`0-S | }9'@DH@X8<p4@@7l -L4M0 4 00[ ,0 zZP@K0@hP@P 0L0uP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ $8#8L0 T3 M 00CS0|S0 004P@7-+)@ 000<g 0SC0S #0P _000 2܃L< C444 00 0hBD@0pxꔽd2 R  4@ 0SZ ,K00D cPPJ ?D080 ` 1B< @K0 00!P@$ P 1 xᑼ2q@ R xᇼd|2`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @P`VP$@Z -@L MX /&>opn00}X$`pZ p-LM&> @`@[ NP PU$@p0  -LM@_d0q,' QPQ 9P@   :z,` bv  V  {W0 0H -LM4@_d0q,' PQ PP    zp00P0S@,0  ,@  ,0P @t  T @  /W0 0Q  ,@Hsd -GMLM 0`p,0 MK@D@D 0P]%0 )K oO~@0  pW `V@$p,0 S ,|{9D  -LM堐|WZ>,0 }nP 0  @hP@$Z,0X H0\S ,0 Z,00XP`p,0  +P p  8 - 0 S\Rp -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@&0! o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Vp  -L ESU  -`q00 L 0p0S2 @ڝ PP#Uw 11>p U11>.QQ$ DU<S pU<$LT l 0-LM P R|@|K  0S@ pX BS@0TD  <-S  0V  p-MLM`@0 0 Pᰣp* AK@@+0 \P! T*AKAA 0r00000S  r\00000S 0S@\:+0 Swvp9<X-Q* rh000000S  r@00000S0S QQ:< p-PLMU`x x0d X+ 0@0PP0Pr0pP p-LM 0@Px 0`0X0S 00 0 0|@P @G plP -0 SL0S S h0 hr  -0LS S h h  -LM0@S S _   h -0L Dbu: -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPN0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@'P 0, 00 0!0 0 000|        0-LPcP ۸@Te 0hU 0-LMdPnP@ 0 SEK P0@  0H l -9L Mɟ 000`fS eS gS )))000P@00GS񟗳\hPȨШl,4<P|ԩܩT u6 0 00 R5 5 5R95 ! 0 B 5E ,K0, R( P00R0S p AW\5 \EPD%00@%6 ,KƠ0, R P00R0Sp44u44  44 4 G$4 4=$$000ktt0 0 0( X4]TT 0@4S<4Q4APC3#0000E3 3<3   83 33/3)3 t3$3"3 333$C|P03\ P DP 05(3 L3P0@S@# 2 `2pp5D2P2U0`c .TPV00 S'V00 S`F1p0S "@0003@2 0T$223 0 h10QS0  00BP !X1 m#P 1!<tl!00@T410SPNV00S0  VQP0P p `Fvp ?`FvpWr    <p l      t:(       x |D<L 7   l: -LM@PpK# p P0Sʄ0 Q T p`p  00 0e D -LM@>" h5@- 0@R:T 0 S* 0R S R  :0 0b0000X 00 0\`  -@L0P00  h T00 0D S0<PP4 0 0PS0h\`dl8 4R00C0 R0 \d` -LM@T- -LP p-0LM0Q 0R0SP  {2P` 3S S S 0TkPq3P@L0S  p    -PLM`bPP20S|P P `20S7DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0iO fOP0SXL@X00 R00SLX 0S0S0SL 0Y0 R00S <00SD;O H  llh      8 h -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0BEP10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR K0 0R00Rh0 : -00C0 x  |    lhpT -@L`P 1T T0p4T0S` 0U  R00000ӑ00Q000 Q0 ZQ0a !00S  R<000ӑ0!0a00Q  8x; -LM@Pxpt ttt00S$S 0,p 0 0`^S0p0C0 3t0 S 3 0S00 B B0 0 S ㄗP0@ zP00C0044   0RI r<200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, P0Q,10S 10S p, R X00b0CS0X40h0j`C 0fQ0ZQ a01 p00S  Rh000ӑ0!0a0 Q4S  < 8  x; -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y:Np50O00O4S  0 0 Sr400000S00S_S   P0S r@400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr300000S>00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,< -LP Է -LoP 阾0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0  8-\0Q 0\ a p-1LM0`S@PXP10S U t0 CR 0R0 S 0@00+,_KP$10S U 0 CR 0R0 S 0@00AKPU 0 CR 0R0 S 0@0TL@0 00CS0 ph0  0p : d ! -LM@PG`p!+pF@K 0PD` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$   X  7d p-LMK_P @P`J011QhTZ P@Tj_EZpD]P TP`xLo -LKM MCNK@D0@D,0 p|KKKPPPM.KAAiP@4: S  S \H,0 S <,mK`F`F P@ PP  㠓P@h 2 R_2 R BRPO ㉓P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K GKKNN( 0<K @xyP`! &04 1D MNK !0P -0 0mxcJ{p I@㪮P p @TD@0 0Pd :㗮P $$  pT:0P 0 2P T]] (P@T Ph5mK`F`F P89   dHl -LMp(K#PP3 @T `W@ W Tjo(TRPZ ( D (00(@PZ ( D (00TI| 0-x0L0PS0@Q  をP 0S(0 R00 R0X   P-L` 0S7nS 0@ ,ӭP@l0PP@p` ,Pp@0oS`  X  p-PLM@ PPp2P .㚭P 00&P @Q T`P. 六P 00P 0Sp  -L 0KM#+  -L 0'Ei:(D -OML M\3PJK@@| ,  X0c(#(ph 90@?S_ppppppppppppppppppppppppppppppppppppppppppppp pppp ,p@pppp\ppx04004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQHPB 0 4 04 $ 0* ) T XQKAgp* Z5<4 Y584 X5;;44 J>K 0CP4DP P| +D{0$\-PPL 0<1 bh9h78H, -LM@wP L  q0@0  R\< <4 -LM@P L  q0@0  R\ <L 0-LM0P00CSK @ 0$ ϓ0 R  s00@b` -L0Q gx: -LM`PmP( @(K,pK 0  (0@S` -L M0@p00 0Si FPP 0S nSZ =ɫP0`0@Q QP QLQJ  0V0P 1 0* Y0  0000V 0`0-C00 ,K, ?R0S@p @C0"Sl 0Y000 LPH00D 0oSP  \t| -L$M<@K`PPD  P40KsPsC圃 -0,0K * K#&pr ?0L:Sl8P(0000S  @@Kp| @ ?@O庍2000,K +K.0Se D 00|!0`VQF `Fv  7P9Pp   0z`Fv P@ p寪P 媪P 奪P WP@D0S  Dp\0l 0 aF#40K`zX    7dL\8d -LM0@S\ [PH VP8PKP dL -ML M0ß0`@( ,0 @33P`d088 B~KpGpGP"04 0X 048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0D08@Tn l7p@` P- U947X@ 1 ,0S ,eKAA DP<8#4P ,  \PIE0:pP%|1 R\!0S0  D=0S0C00 =:D>=:0 R s=P` 0  @@\PD0lP\ 0 \ @@x Է4 -LMA$QB\|@xx0  Q d\0S P 0R 0000$@]HX -86L M P(R@`,P 0 4P {0gS 5@DT%U0-S 50 , K P5 RP ttt%<00@DT\5\%0Q4  S4  040 5 s 54 PppRp@3900 /PP )903S %90S4 R0S ,Q  0S ,0@ \0gS 9,4` R484P4$ ,00S<0SU V  V=C<U7V  7<U00T00S 3 R3%<0@S 3 R 0kX<T[9 b0 0, K4 [0@,SA|  ,@Tdp`,40 0<2 z|@T , KO4 0 @T  B@T p!00000@T  @T 000 0 w@T {$1 1w @T  w{@T >eyyph0$ @T {|M\ 4D4,@@XdDTd|< H p-@@LMTP` 0-S*@P!t|P`@DTD0ph^`,0 `` 8-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S  0-LM@0 S  0S 0S0S0SP 00 S 0 S |[00 K 0 (0 $0 0 PDPU <ᲟP , 000H9Tv -L$MğP`P4 t4E @ Qd  l    t        |                 s3 @ `PU U ß 000U000DS񟗿 X X X X X X X X X X X X X X 0 H X X X X X  HKLK 0D@ H @ < 8 4 0 , FkP7L R/0S ,Lс R R H0S U 00S S0S 1#$0$0 0 00S  0H kP X00U @ UP DP X0 PH1Z@ 0\ P P 0 ( "# v P P0 R   $00?Yl dp`p\pXp@PpH@ ,@<d -LMP@00S p SpBT  0ϒ005Q^` ^ T0 U   V 5PW 0\Y  5X +5A5! d, R 52H5$0, L 5$0( L p50Q#$0\ L 5L1 R 0 05,! 00CS00  ä0 oAo<$000`00i5 Rt Rq0Sn0Sj R, gN doG XDJ!!"<"("<":P" `"t"""""""" p-LMHPH`@D/5$ q0)5  k L@ph:h  #,# Q-L`pX0L0CS00  ä0(m8  A 4!A00CS00  ä0/ P@ WT% T# 0B00RPP@ P@ W T T <T4 0B00RPP@pp :8#% Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh@0 R \70R \ .0 S0 S 0-,@LP0S P@0  0-LBMP0\0 @ \ xo 0S dsU0" L/4\F/K <* T 9:H#P#`#p# -0`PL@ p* 00B S0B a0BSWBA0BS7BR@P! "!""("("` `Q:0e0b``` -L@LM "00P 0;02# -L M0 K@M 0R # -LP,MDKHK`@  0D @ ,@ -P0 Pk& ANK @D@D'P X0 \pPX& 80 V 0S( F9@a0.Xe(L.d.p. -PLMd   KK^+P 0@S 8080 >(0 0't.@a|.Xe -PL M0 , ,K0K0!9+P 00  11 00 1 0 圽4 1$ R0  0S 00B,0S Z0S0@0S 0P0.,P0P000 8+P0`@4h@((@aXehI4Z0Q@`t.<`?l(. -PLM   KK*P 0| SKK*P 0\S T0T0 D0 00S$0 ...@a.Xe. -P0LM0P01@0P1 ۉp 0\``щP ",P0 PÉP 00|S ,P +Pp0  X0,0姷PU h0@a.///Xe /V -PL$M0 , ,K0K!>*P ,0S ,K0K!5*P00 1, 001 4  4@ jP 400|S 4K+P 4\C+PP1 00@ <1 41 }< $1p0S. ,00CW*Ww0a050K00`!50K4G0pS0@0S 0P000 +P0P00h00S ,00CW<C4@0 P,0 a('8/@a0 /XehI4Z0Q@`/<`?l( -ML Mq0$0 `P5P@P@@T |PP 0S`Q/ &P@Lq@BnK-0 K@`F4!0⩈ 很P+0 K0 10S A^~ 寶X00 ! !*$0  YDBK@dP㽻㺻`Pt00P$@ $0S<$D9V@aDZlXe\/l/ -L`Mq Px t `tKxKh!)t0x 0CSP1 H}D1C<SP.t0S$x0t00t0 x0CPt0S@}pPK5 PmP   P`x0 Pt00t0 x0 `"P \0|} Vt0Sx0T  P0 0S< D9t/@a/Xe////0://0Z 0-L@0LDP0P 0000}S$0}P0@/Xe/@a0 0-LMMlPANK@D0@D0 $P DD @0g}Q# 0S$0 C09$080@aXe@0 -PLM   KK](P 0S |0|0 =}l0 0PH00}S <0<0S 02}0$H0X0@a`0Xe@|00 -PLM   KK$(P 0S |0|0 }l0 0^PH00}S <0<0S 0|0$MH00@a`0Xe@00 -PLMX   KK 'P<800 |(0  '01@aXe  -PLMX   KK 'P<800 |(0  11@aXe81 -LMM(BNK@D0@DP+(0 ӆU)0`P00V00S B.KQ B B 0BNKp0@D@DQ+a 糆`P00V00SBKA0A@)0KPP (0S(B9l@1 -PLM   KKR'P 0d SKKI'P 0DS <0<0 )|,0 0,qH1@a\1Xe 0-0@0P 0 0RLnP0@x11 0-0@0P 0 0RL[P0@11 0-0@0P 0 0RLHP0@11 -LM4@0S 0SA0Z 0-T@L0LPSH %Pɰ40,0P 000Zn14`@ P- L<80 {,0  h1@aXe1/ -L-800S7 (0( 0S00/㱸4`0Ze? -PL M0 , ,K0K!&P00 1g{=00 #p4 tAte{平d14  40SDAL 4  0S$A0Q{女hP˸`4  0S 0PU @8{匳㵸0 PP@ d ,040@ L0 P0R  㑸鴸1@a2Xe2,2?n0Zh)8Q e -0L 6 0H2\eXe -0L * 0X2heXe -`VLt Pl@lph000z000H000V ,00ht2ZXe@aDe0:@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 000:De 0-PLM  1A00sz P KKv%P 0S 0 0Wz 0 00 P0 ㆄ0@0S 0 S  @z@00D0HD 0 S , ,0@a(`222XeDZ4`DaV p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(xppDaV<@a2 -$0L \00'0@?2Xe -0L  02d:Xe -0L  02(ZXe -TL P D00}S8080S00x( P 0  3Xe@3@a438` 0-0LMS0 lKnP@tPu @0 \ ,0x0x000<3\3x3@a 3 -L MTr0$ S( D P8"$K(Kw#P $0S (0 2Xx 2 10S1Vx(0a ㊂0S1 0 1Dx1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0`@t0 S@  1 0U UP 00PUP00CS00@Ӥ0@@ T tt 00CS01 P0 R0@0w@334@aXe?4t:AX4Q0:|4 0-PLM   KK"P 0S t0t0 wd0 00$pP@0<u   Pw0@0鄁@a4Xe4 -PLM   KKʞ"P 0Sp0p0 ~w 0$0sK0  DJ( 0   kw 0 鄁@a44Xe 0R 44 -LM00 @P  0 0hHwV4@a -PLM0 ,  !,K0KL"P ,0S00 0-w0 8 #P0 <P  0S 4K↺p `0 p吀@ 00 h04dP_n400080S鄁4@aXe55V@(( -MML M<ğ P,   % OKAOKA$@!P4  S0X C4 eP@ 0X30X 4 3v3 NKI I tt#1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 fᢀ4@iQ4 Z% P 4("  f᐀4 `000SP0S0q0#00p`18v1`CP 0S 10SX1'vP1 1h10S ,A0v O0@0P,0 B xQ  |A "  UkBΟP  PB $B (B   |dPp d ~dP@p H udPPp"(U`/P` 0ST PV 0ST  "Rt! t t1S t10ST ^ QB0T00V jx x1STE x$ /dPx1p x 'dP$x1pW 0S /FiP 0S00@`P`( 0S% 00:UP$  0S *ㆿ$ *0$":>0p@S *000@SpbU ̵| |1s  |}Kp<o/K<00t:P;01  t+宵 1S0 1 P|T <P@< 0! pǏ" 1P E;b  !ep` P 10`S1 l;0S, `;0S(`+0S!0S:L;# 0C\0\00u:0 pÏR0S*:Ϭ|*8P :0S3 |:0S/|ʟP*0S'P:0/P0S*@:#0 CR 0R004: 00CS00ä0)9召AT .O"90S9 ,t㭱 B )0[S ]P 0:SSPp :P0@080S 9th 0`s^K  ?<8T0~Kl1 0h1 $8  0oJp80X L@K 'P0 0^JP  LQ0U|1 G SOK <P`,}70S7 @s`| |1s(ǟ $ | "Ps0S o|1@ h0@|1  L@K0@̼PPU`|1Sp|hNF( 0S6P"msxQU% 0S6,"cs$P ƟQ$BƟ&0(@0JRşUş%0(#=0%(:x}P hP@2 %m}PP(d%0ڽ(%0X ,z}P0 %(4\ 0ğ%(850S05 F(^  ^p /K(P  !R 00S S S B B0! 0!R0 0S S S 30Sx4,"r }P` NK` 3}K0 h2SPKPP P 3R P R R xũpV3(/K]P  !R[ 00S S S  B0! 0!R0M 0S S S 1SF `20S3"yr baP"N0`0K  (h2S2 j2S P HaPh2B0 `SX2$ Or(RU R|1s|x "  Tt$|P101  t  ! 1St-01 HP 1S) 㨯%H㤯L1P@H1 0! pǏ0 廼 P0 1 M39L\9990/9999$:L:d:0:eԙx:V: Qd:: l::: 667 7<7T7w\7`7l777777788VPZ0`@8 Z8ZT8@@ah8888899":(H  b0@PP  \p` P PU00S, 00S( 0S!0S:0# 0C\0\00o,1$0 pÏR0S*D1ɩ1S|10S3 10S/P*0S'10/P0S*1#0 CR 0R0032 00CS00ä0(02厩1SX-Ndp0s 1S"0S 0R 20S 2q20S2q㑮P R ! t(\ |1s|8嚻x嘻喻P#,0 S`,F7 -LM$@F"p.@a:e -LM$@4"p@a;e -ML M60H ,0 0L P$ D4 ͭP@ 60SD4& #x尾PX  0SX T妾P\  0 S \$ D4H`D SpD4L$:zPi D4LT f P `   S_P   M_P5\P$   A_P @gX$R P$ p/+@/z:P{z@pwzPW3 W1*P0#03U0S* TD @@dz`@ _zPVV*4= T4S 0S Y 0SD4L$ttT.T +T :;z/`7zVP P`3V U  R0305`1:` :"zPT 0S U ppU 0S /nPpP30S t3tT$ 0PP o30S@3 0V@4 10S 1U! 0KoV BNK@D@D0!}x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 O1!0?2cS D40`4 ȹD4`$0RD4 D4HSD0`$0Sr5` ,0 S,f59 _0Z0T ;,;8;90/9`;V@ap;?;A;h8`@ ;t 9?<)XeQ; P-L`7 YHP@! 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g;<p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@< -LMl @H]0SX  A]0S<  :]0S$ A0P 0990/< -LMP0  冗d& -PL 0   -P- L0  |0 -$LYM0@,0 4p@` [KL Hp4Kl  0h d `A xDpP4"0L@KFxP AxP $LK 07xP#LK P0|L0[S LK 0RDPU u  ᥬ 3 p1Q,,d\wpAP#P3T N p10S S_K <߶P,w2 m@P`آ* PPT0S U 0S S_K <崶P`,wTS8P4<P`@TV C1 p uZcQ o0pt1 @jZ]/KpA P*J0S x ^?K PxA00p0dQS PP> H10S 08 0mgPPP | _?K,ҹP00Sp0\0 ;0 ,0S,O39 `hL6<d<$<Xe4Q@a: :@<lfX<H gVnt<@<V |< -LMd@, 0 0CS00ä0 ((0 0 S թ@af --p1pq0LS00`& TATlH M[P8 4 E[Pl H{00CS00  ä0 cʤP@T0  ! @({^l岤0 |vP0PST̩V@a<<<<<n<Xeh7l:1 0-x0L0p@SlPl h0 `0 l P0 Wt00S0 0 00Vn<@a - 00LS g0 p-LM@P `Pk00S x0 pk=d 0 00LP@0T)0@T 0 pnV@a= 0-TPL0L@S 0S g0 0cS0h~g0 -LAM M8B>K0C0C0 +, ߺ %@$  p< 8 4 BK J4`J U0@S񟗾<<DP 0tDPp 0Pek£u04S1440S (D(\k尣$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 #kX30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A$ PP210SS5V4Vڐ10StA0 CR 0R0 S 0P04$RB>K 0C c R+#$t8Q 00 S Y44044 1V 0  < 0 YRE 00S <$`0RR0F<,0 S x,0< 0 9;Xen =@@a=@e 4Q<?gjl:X= -LM00 (@(0 7j勢[@a0Qd=g -JML M@͟@<͟KK`4͟VSp(=(͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$iTU< i<@T $q < <Rxp

K0C 0C)00P ʦǦ4S ¦4 S9T 9Pz OPpI 0SG |sP wsP=T9`0S 0CS00[` 4P90㉸pq `v  4S8P@80<HKP 4TSt8P- 84 $R 5P& \Y4DS8@4$P KH4TS7P @4S 4  4S  ,p7 0S m0CSjg ppT7/4 APp``@VP70S> 60S 60S6&4S.ʸ4S 4S'46# 0C\0\00KK.K6 B BƟ0O4Sʸ4S 4S5圠BNK4@D@D+,P`60S7 50S 50S/pşP*0S'<50/P0S*45#0 CR 0R004 00CS00ä04UV W 0 S 4" VOl4#0 CR 0R00,4.K.K3 B B0Oh40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00@3P@ 0 CR 0R0 S 0`0w2P@ p`$30S2 20S 20S*|"4Sʸ4S4 S4T2#0 CR 0R00B2 00CS00ä071坟40@$ 40@  0 S 1 N4$Sx1 4&t#㥤㢤4S2  㜤.㘤㕤4DS0@ 10S$1 "@PA004SC4 S0  4S4T 0S0S ,0 S,8-0`@9Z=8Z ZPZ@a==4`@?Vgl:000:H lT(1=Xe8(0(=(d^V== -LM00 (@(0 fţ@a0Q=i -LM$ϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` pPH H0S > 0RS ,0S X,00-S h>, `MfQL>P FfD>0S H0S , .0 80 R@0  D0 H0 S  L PP! =0S {=0S$NPh00@0S@<0S<8= p 8=p.X㑣P0@0 匣< X,,UpPS ,00|SO ,P@/, @0S 0 S , @h<e = T00,0T  T,| [T/0p0W\<0S 0 S,eP(<0S 0 S <0S ,x , ,0S HQ;0S 4 ; ;R,pL;"PX 嬢PH0S h 0S T P0S  4 ( P@ 4 40S pW%,oP:00 x:p) ,00|S ݢD ,'0 00S,  *0S:p: ,W0 00SP:,  R80 00KP0S;0 Z0 SI̯启P0`0 `20: S ()0S00$9 %T9@T 0DS< 0S 000tQpp\#Pp90  p@0 S pWPdUOLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST74077 )P`ʐ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00Hh6 00CS00ä0=<6壜V0 S) 6 W W,hT$V 0S 0 WPPU 0p P@0S@0 WP, 80pS45p85 080> VP00P0  V[5#0 CR 0R004F4XK 0O50S p40S t40S \$T0ST0SX0 SX0(ğ@04 ( P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0@3P@ 4p`~P0S CP ycch30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00CT2 00CS00ä08(2垛400@ 0 St" 1 000@ , N80 S1p 1p080@㧠<㤠D0SD 4f@ RH0S R0S10S 8 d1Rp ^00 0,K0 /p{Kj05 0$, bD0S`0d0D ]Zl00S70 @ P<M0`PZ(>Z8Z(: Z(@@a==4`heil:\00(Lo0 (Z@?=d^lH :VT1ԷV4><>L>>>Xe8ZP4 0@P@@80S 00S08040S4l 0S0Sh@< -LM0 S 01 `0, 1 a 0 S00SS m 0S( p͟|` XP L "B00$= =0 >K P 0S S5 Q<0S) |0S%̟L0P 0 j< <P?B1cSQ < ! b1SA l< 0R0P<X a\H 1  B< \kP,:(:?B1cSQ< `Va  V@ 'jKiKKgK qK mKo/K=KnOK@/ PW1S_1S\1SY 8 |!1 (,10$10 <4<  4 KP"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpP0DS00p\ PaV00 0Sd >KͬP@0S S >K  廬P >K ) 宬PPC P430 >K 嗬PxXC0r/K1 P@SePQ ZOK3(K0S S 220S3 20S/L3(KKoK\0P1 \ S_K <@@PP 0P R d2 0S82  @2Hp_ QA Q^ ^ 8 0@\@)0@0 0  (         $ ( , 04<8@@D  ! 1S0s`0a 0 \^(1  0S >K  ׫P X@G0P00  ,0 S,T%f9>?h Z?@ `?@Xegfff@a$?VL?t?|?Q??;??$@@@@x@@}~@h@Z@@Az(A0A@AXAX<A -0L,MP؀0p0U$0 D @KD K `唯@T00?[\H0K @H \P<oX $0S $$?9fAX<A -LM?4 0S@0SZ2@8Z -L 000 -|@0Lp0՛T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,ohBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 $h h h h0+11b0 hb+ h +h+g D0S00 4`(0Z4Qhfgn?@l:d:(ZZ\eDe0:(`DaV -LM`@00CS00  ä0 |, 0$0000媚@agf0Q -DL$M0D ,0 H 00 @ gP4@ 3#3Q040 3@T 30S 30S@@S0SP 3I]t30S \3d>]T3 0S44P(HPP7㪚c0@H ,0 wP@ ,㝚㞩00000 4D cP`B000QM,82`D H0P\r4"0@0K 0C0$  0 K(4 0BK @@ Pʰz00S0  ]U 0K0 +PP@00S 0S8 !n9TBgXe =xxBg'B -BML M7|'|70 t't7t L , ed'P  0 SD70@7+ 87PP07@P(7(wP$7$gP 7 @7@@PP7 7@6@9P@ 0S rePP keP dePP ^ePPP6TeP@6  h d&P 0SL60V0S 060@T$@PP@ 0S .eP )eP $ePPE5P\5  5X P UP y40NBS񟗩`htt$08`  T4_#00#0\84Q440 0 0 Q33 I|3CKL1 OH3\  +6 <3033 dP#h3% '2 2\3 2LCKL1 OH03\  +3  l2 0"LpI2202 2l0 2L L 塹P oZP BNK@D@D+dX2@% HX04SBL4aP 10L P4ܖP@ < 9L@1 0@$ D4 < 8 4D 0CKhAA A0QS R  1l1 Y0S 1 ,娖P@@T  @96`e< QLC@<0`A???(:Q@p:PZle `\C@55hdCCC$` BBBB0:<`@aTZZVB0:@C? C74`he@Zl:X" _0T0Z1 P@@PR50S1:PYP@ TK O0 @KI 5} 1@o0ef2f2c BDٞP ֞0Ϡ#PE0l 2lADd`0 @]@KĞ0 S00<@,0 Sh,.A>P?@9 :8Z 4ZX@K Zų4K@aLK -LM0`V *0獞0`YV@: H1 PUP@`VA0S,0 :p0AT0N 0S :000CS00  ä0#  T P@| 0 @0 C\0\00 T,0p0S,0 `Ve@a -L MuD00 K4@Hp( P0 1[SP00d@@aht@e -0L M@K 0 K  膛 -T4LK0C( P$0 05R++P&00S" 0V0 05R01Sd0 05R X H00QDf  : $0S($~9} },}VVV -4L M@P  B B'P#h1x111111111111111111p4 l4 h4 T4 X4L4 ?<$pc@$40@cTQ2T̋dP bċ#P 㼋sP  TP0S00# p Y3  |C@PtmF ԙ`3 0000C<0PRP8 @  rJ 30SsJT Â꡿徂0"0Z ڨ_JTL2+n0ST. XKJT H2p@4K 8ķPP(y$彷PP> 0K_p9 ,0'0o,1" pPa@' ;1P U !0QL   l1pd \ÖpT PpH  ᐙp0 p  ᖍp #L0⚙@0 00Jx}|V7}V }V40}WW0W8WPW }}(}:\W lWxWlWWWxW$}WV$XXV X@XLXLoTX`XlXyl -,0LM$@ II:xXX p-LMP 0S 000` ph `@<,0OP0080 04 ,0 $00800<`ph }}0} -t@LM0 \D0,000 0000 04 $0 0080hH }}0} -Lq0P@T Ut` ,`\ 0SP0 UV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h"T8 }dEXX}0} Mp-L$MDb}(Y 0-PL0 D0,000AT 00忕0@<0 04000 (0080 000h }}0} M-L$M̂r  8K$ 嚕`,D"2PPP\0S4K8= \X0;0S 80;01 S+l 0S0@T 0S PΖP_ @T(8K`vP@Y1|qS000000|<0,0hgP1 T1P 40PP^`  ᚖP0000@00S 000SP00 0S@  0S 0S@0 0bS`V ʷ pKdmXDT $0SD$7 9 }PY\YhY0}XtYX}|YYT8dEY M-LM B  @K, єp#PPi!4@!0 S0 P`E X@la0 P0委1S 100l0S AP@$# @ l⑔$ 0@0$ P@$$$@1S 1000S ːP@( 3p-H0 a( 00,0 S(, 94Y }YZZ@ZhZ Mp-LM`@  0K =P, D0R!0SS S S,K0lr0d0Sl  00< 00 0SV p9 }xZZJZ -d2LM\bXT24 0bXPm0S$20S B <0S0P<0<0S0!P0 <00<$0<dPUA# P`80S|1 10 q0 8ᙑ800Hq80P Ta80 SڢO_0 爑@@8@80S0 1080@0 0804 0 S0l080X8#8#$0$ ࣸ$0P$#~0  488<#8`X0H G080<m }0}} ZZ }}Z(}dE p-LM$B0 P@0S 0SCAa0 0S4 0 00,0Z0QUP0  S000 0`bh0P0d008^9? Q0 00 0 0S 0S0 R0 0 00 00 00 R UPR\@0|0QTl 00T0T 0H00ph }[}[4[ YV<[$>\[x[V0}7 -LMHHc0 (0 K0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S \ 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \?p }0}`\} p-LMP$P(P㾌@`40S8`V@Zph鲌 p-LMP0S  `Sz 40 @T @T0P@z0 ^0phl$\ } -QLM`PDB0S00`00@r0S  A00A1  A 0 A( RA$ RA, R A`@4 Q 0 8h!0!\A`V@D 0 @ v> 0iA . 0 v>  0TA 0 v>  0\?APEAhy n$\\\}\\\\]N ]4]\]]] p- LM0Qq`P$0  $ 0 0 囐$0000 f K@ {$K w$ Rrᆐ(K0 (0 j( f 0{p$} -Pd 0L&@`6pSW06S 60 6h 060S 0P&00D0D  V $,$ h }]] }ؿVV -MLM P, |p < 0BS8@<K⹎<0@pK@0 @G 00T`K0T0 S" DY 1 S@KHK0hPK0h0 S X> ( R h{$ R XvT` Pg D@ QN 40S0@L 18SG \\4\\8@4@1 0@冡940!1ZsNK@D0 @DD1804 04 1`1Z\H1X!WsNK@D @D8+ 1 40!"0 04 R8@Z ZK'P  0^ 7`0V P7 {NK@D @D0h N  T,0 S@,09]^^,^N0}8^H^X^dl^t^ -LM( 0R@40 ,0 00  ., $P )0 X $4 , K 04 (pK0!=0 ( $0  `40`V0 Zc;0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0,}4$} -LM$;0 @ 0$0 @ tp$`KP 0 0 $0 $4Q< 0( S8 (K(,}$}^^ -LM:0p 00@00f$@ p 尵PP(p  (K-P00P@@TP D(@ $K ǚ$([0},}$ }^^^ -L M]q`0P60S 0 6 -P@0610=S 0`61SQ0&P d0AV2pႉP@0U0(F0F0F0v0 61 p 0V@ 0@@@061S @0@$S `S0Td : @ 0@0@6@ 0 L }^_P_x_ p-LMd`0P60S 0@60&010P61S 0 06p }-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@apT 0s B?<D00p}_ -LM⁁@P4 8 0V 4 8`@Ujijiiiiiiiiiijjiijjjjjjjjjjjijjjjjjjjjjjiiijiijjijjjjjijjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj^@Th00pW 0<  084pp000___ -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @<_ 0-LM@P@ .R r0\00000S0S0 S0 S K)PP 0< -PLMp Qi@S0T3* Rr000000S 0RQ 0 dJ᪋``P0'S"S $S `S \S`F\000`F0@0T:V00K$n4`<T`l p-L M`Pᜲp P 1p 0@⭋# %# PK0  ` 1KOp@0DST 0 pl`LoTX}x`` p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< *-P@ PKW 0s ? @pD0Ppx0} (`$H P} -LMp@B d,P@ K r 40R ,R p|H  ` 0-LMP@K  @@%P񟗮rsssssssssssqrrs,sDssssssssq|rss\stssr4rTrssrT2c0 cqP 0SpB 0H0 T  P00 S$0 S $9}i e6i(e p-!LM@`TP 0S0P0 @TT P0@00 ~P@y Pt` R 0S @p@p0S  0S0S0@0p4}(eT Q0S 0R00Q$ 00 Q4}( -L0Mp0` 0 ЪpP- H@K( ^ V> pp0SlQ N0  ,00 S0 0 S X9@e6i(ee -L8Mp0P 0 T`K0 2B tP@P0`S PPP0D spP 4 0 S  #9ff}lB (fXf 0-LMdP0  ( ,  Up@8  0Knp 00@0}hff p-LMQ0@ 0 (0( K-pP1[S1[Sh0 @K(X pP8QH~0@( pP0v0(($ K pPn $080@8}4 40S8a 0@<@0 @@0D0D0,`K, ( ( oPL0< 0, Q0( <00( oPt:0l( oP\2p}qB@ffpBfyBgfB@HghggBg?wBgvB g -LQM0Pps`KKWK, KK\q  @@0@Ɯ WKD\1@< 81 4 0ƞs`OK VK0 0 ,v 0 T1 0XQ P L1 0VK ᰸p@0  0 ,0S,%9 }}gh -LMp`A< @0R 8 (4'P`i 0<0 00@0 Q@<0lS<W44K  㰀"[<0,@0 R!(0P0<0 <43P<0 0<0,0 `, <408P<0, 000<0%<00<0,0` P,  <0000<0h@-@━0< 4@, f, <0000<0,V } } -L M0\S, `Q*\ 0H , Ypӕp0, 00 0S 1 \ZQ0S40 sP@0   4  prP@p0|    0 00 |@0 0, \S:NLhphhh -L M, pY0  `, 匁00S" P0 0a00 SU0`  U@@`@, `0  4 PU`4\ V00Ƿ0` 0h -L4Mlǟp, XP T Xp @gY@8Z,\    \ !00 S T0S 0 X 0LKX 0 0A0C3Sgꘘ`hhhhhhPhhPhhhhhhXhhhhhhhhhhhhh`hh`hhhhhPhhhhhhX0X 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  &!0 0Sx W4  0T|00 W00S4 g TP |T TQڗ Q@4 aLT R ZT Xp WL K0B0C6SDlDtXPPP"00 0PET3* Rr200000SP 0RQ 0">P``0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P 8 #" 5~ Z:P` z0!G>pPRP`@/08C808#8d!2>pPP`@:0pP/ 0!S :P$P`WP`U`X0\ :\RX 00ƴPERpT0S\ PE ƴUT0Z 0hd,0 ST,90hiN<,iPixiixd4}8c@ciT`li M-M LM‒@K  , }d2`@@QLD2 R\P~~KpGpG+~K ~PM.+P` 6S 6S 0  `V 60 l@ `6lSP 0SXQX SLQL SDQDV 0S Q,,1 (1@TU @K0P <K@ P{@TUU 00@K@>K0C 0C1 BS 1Sy@T ,0SH,V9 }i}h  :h>\YTDhPY0}0(h@hP0-H0@0 80840400,0 D}nP}n2n<}nH}@} -0 0CS00LӤ0c ^00# P 0 000t0 00p PPQ8 00C 0000n2nH}n<}nn p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00pnn<L}8}0nn 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000nL}nn<}@}8}n -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000n8}L}nnH}@}n -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0pjn jn -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0n<nLjn -pLPBo@P -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h n<n Tjn -LM$@" 0jPM --LM @0| (xp #0S \[|T ㊣H ㆣ<#0S ,,,$ extl`klk: --Ll i0T T(LD #D080S '|$ V Rxtl --Ll C0T T(LD v#D080S |$ 0 ,xtl --Ll 0T Ti(LD P#D080S {$   xtl -L`@P pR %R0mSW,0L m:p` PD"@`PT@D ń R00l --L@ 0C<0 2/P@\H+P@`@@T_0@@0 /P@5 P@.TM0D0 P@#TB0H0 :P@P@T00L0 :P@pP@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @<|\|lt||||}}H}d}}` 0-LPgP@4 q0S0Fq P0} p-RLMP@` 0S(0 t000p} p-LM`@ 0 c#PPhx u 0 0bU *Ho,0#S (0S uc qphp}}~ -Lp`P P@TPVtTF;t 0S 0#S h9~4~T~ -MLM$0KA ,0 `hQR Q Q d8 SKAA ld8 S:qX lPP fPP0 l(KA Al K+B 0d(0Rp8:spP@ fP@ p(~tprp>K0C0C`#8 ud8! SD5;<#fKA A`t(d8!M@S:rtP fP t( GKA Bxd(0@R:q|xP fPT x( )KA A#|(d8@S:rv|Pp ffPpk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rG:f0P1(> (PUڈ< 8 m o ooP(1S>K0CoPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S ,N9d~f4}~~ 1 P-L`( 1ȁ 0@Qd 01 00PVq` Qxh!0 PTP ,@ 0O  Q0 Q@L00noP 0@0CS0@0 0{, 00CS0p@0 0e,< 0RX}l}t}p}TP~r~ -LMPnPpC 0@ S 0 S`ev 0S쀟쐟0 ZPP *,i n`0$0O` Pr@00,(, C ~l}p}t}~~r 0-DP@L,000 @@0 0 0 0d~d0 S- L 0S S 0SP S  X}  p-xQxALM00P06T1 P!Q+ } 0~~`0p}4 0-l@L0S0X XP@000-X0S40(0+W 0p}l}t}`L -,0LM@P'Xip}` -LMHH P@000 00@@T0:~X}|}p@-@@`@Q 0PA0UPEpt|}\ X X0-0PPL0000000000@n@T0|~~ 0-T@TP0 SL@R00 00000 ~ 0-`@ 0PSLLH  0S0, Pç000w 00~ 0-lP@0 SLXT  0DS \P00U 00~ p-L M|P0x0 ]@0$`KS 0S @p q0 0 $0 9dp P-L heH"0@6PZX`hx 0@ 0@QQQQQQ Q Q  Q  Q  Q Q QQ -LM `0RP  0XSxS00@PGK GKk0p1h@  T00R00ST01@T@FK!1 020@T0 90R0BSbS0@PGK GK40p1@  T00R00S?T01@?T@0! P @T|~ -x0LM0Sd@ 0 R<0<0^ڽP h~ Q-L@Pp`  ao@@0 0#0@T` 0P@ 0hVtd@0 0#0@T` 0P@ n ~|~ -LMp 0( PP`30K n 0XP$@0 0#0@T@ np@ H(0 S \(`VDT8PP,K9|~ -LMQ0@ T< T: JP1 0S0@0`0PVppP`@ 0 \0 p帻0S00 S 0PVPBc~~~~0 -PL M@0 P2n*PR1P@ "댂PvZdBP0S P & P 0 RP0 P BXP, 1 0R S0`00\Hd \Z \L ,KPP= q, Qᐑ mPtal0 Q@L00jP 0@0CS0(A0,/0'00CS0@000)PUlxP0<)Pc ,P,KRPPX~Жd0:~rLPd -Q00SLp0 q00`Ԡ0L00jP 0@0CS0@0 w0"'da00CS0D@0`0~~~rPA- @0^p`P 1S \0 A\ ^@p P01 0 0CR  ~~~@-tt@ R `0!R 00S01S 0P 00~~~ -P0 @ | |`@@t0t @L@Vi0\p0CS@00h#0~~~~~ -0L!SPp+ E^P@! /P`0!S ySP t0 l0Phhf`0 g]&LT&,.H  :d| -L M@xp"Phh"0 `TS, @2@"0 p(2@ P`<B2  P PWP 00CS0A0T0 Pp00CS0`A0|80X00 S 0 ,0RS 00S Y 000 S 0S 0 0)R00SX`00PY0H H, S00 (0 00cw~~~d~: -LM`0S00CS00@Ӥ0t TG "PUʜŸ0  @2 ꀂtŸ0 Up|00BhP <2 Bp42R ,r0 0M%00CS0A001 Q( Tx0 @ 0@Z P1 0 0T1  00(! 00S $1 RZ J  %Kp0 QP\00gP 0 BP0R P0 ~:0$X$00CS00`Y 'R@R#~~~r~Ԁ -LMP!\@`- P@#  /Pp0!S QP t0tp0P dV0f$D$$ m :V -L@p`0PS;T00T00S 0S00c`^ 0 T 0 0 `P @00T00SP,0 R 0 Rm~~~ -PBuL`@ Xp0S PPEu$]Z  -L MS , 0 0 S@`T,x3@AP , 00L3TDդ j00 @D S 00B @DPPx 00 S R"pWЂ W`l000fPp 0"0C`"S0b0_Z iUAfP 00 @G S 00B  Q 00, pQ Q@L000kfP 0!0C@!S0A0 0v#X00CS08A000X#00CS0p夐0 T`l00fP 0l0CS`0E``0? <0+#,j00CS0~D@~rd -$LM` ,` 00CS00@Ӥ0xtV 聟 0R,0 !0@1   T`0 00 00qp0 RP\00eP 0<0CSP04Q0 b0"00CS0@0K0 @,0` Vp0 ,` Vdl 0P00\"X08`0 0  O@0:~~~h~r@4 -PL`@pPEuȂ `V 2p W\0P0 @^R00S$ 0t CR 00PEu@0@0CS00  ä0 A0R P90\ CR ^00 pQ=0"#CQ0!-000 80 B1R0 \00 0 B0R0 ,00p0R P0R P0Q P긠 .$P  0 jC0Q| 000Q P0RΐH ,0Op_0 CfpI:HT` $' -L|M, 0 g50 5iP@00  0RrS5E,%0gp sP5   pP5   NxPL4d5\0 !0 ,00a,0 , R 00 -Q ,0 S5 00000 ,  B, QTP@ QPVVVxVPP 4 Ot`U<4P P@PLd0S 4 Rc (4 PP WPP 3 4PPu5 0u C0 N0S3 3P30S l3 d3P`4X30D#S4,#ubB0 N0S2 2PR0 N0S 2 x2Ptl2 E0P`00@iL2 0R Sy 84"P0`00[ BP[0ST !O!00,Q 00 Q,0S< h1 xPN00 Q 01 R.c+p009P 00P 00 !Q 00 "0 RUK |P0: S  0g 00 00 <9WP\X7h==X: ~~dh  d~d0::|? -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00pd~~~~ -LMtD`ğ0 q00  R 0  R3 P 0EUST                      T    L   TTT    T                              T0<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u pP ^U-U```\kP 0  P`P 0.U001``P  pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U00d~<8 ~~~ -`OLMp0 q00  R 0  R?0P E0pR""""""""""""""""""""""""""""""""""""""""""""""""" """""""""""""""p p""""<""""""""""D 4 < d  L$ l"p,L<`!" "͟ 0nS` lS0 P 0 R0= R =y P W`0pS`0= = P@=  P<= R8ʚPp̟0 0nS` #lS0 P 0 R0W0L e< R GLB `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;˺{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1e*P+P&\!\\: R \t P Md:)9@ {  | k`0pS`0 ] Y9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S  .`0pS`0"8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'A PPaT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SPALy`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E 4*`0pS`0p4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+M|`0pS`0r0 PR0& 0nS` lS0 P 0 R0T^ PS`0pS`0@G1P* 0nS` lS0 P 0 R0 1  P``0pS`0<~~t(:XL`0t8 ~<~~0V~Ă؂~~ d~0?PR$dPPI\0 RA pW0 RX W, 0nS` lS0 P 0 R0 41 R PBd(`0pS`0|1P( 0nS` lS0 P 0 R0 1$" ; P@_`0pS`0H2Pp( 0nS` lS0 P 0 R0 2"  P ,`0pS`0,3 R4$ 0nS lS00P 0 R0 3 R 3 RqU ``pS0q40  00S[ 4 RD4D$Pp8L 0nS` ?lS09 P 0 R0-4 R' D0S!\  \0S 5\PH 05 P C 05 @<^@`0pS`0U 0gS S 00C S pP 4 6 p W 0 Rd6 R d6   0 S 0 S W0006P  PP &U P6 P7 00CS0W0vqW8f '0S00000Y00#000# 00 0nSK ClS ; X L7pPt. 0nS` !lS0 P 0 R0(0S 08(8 P`0pS`00 00pS0 000ܨ p P 09*[q00CS08I00p |  9  W- ` ppS rS0p00p0p9PJYPA9 R9 pW0: Rd ^ 0nS` lS0 P 0 R0 : R JP ;`0pS`0 /; R# 0nS` lS0 P 0 R0Pt  `0pS`0 +pWE;UP=GUgU>P3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  m\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  ~~~8 -`0` LRTLL0<SS,0 0Qڄ0~~~ ~ -LMܠPp@* W* 0 0S@@T0TbW`BPP l0 R   0卩P 0#T 0EE@d~ ~ -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00~XP 0@0CS0@0 $000CS0@0 0`00P @@0@ۯ~<|r,~ -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 :[5 P %Q00!Q`uTş0 R`l00WP 0 0CS`0e0 |80"00CS0D0e!0 0 Pdt Q`l000WP 0$0C`$S0d0 =|00S? h@(\3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000WWP 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000"WP 0@"0Cp8"S08r0 0-l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000VP 0!0C@!S0A0 x4000CS0u`匐0 QP\00VP 0T0CSP0PP0z Lw0@~`~~rĂP -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00d~~~~0: -43L M0 00,  R W,T P@` ;PpX آ 0S2,Y0@` T QڐR2 Q@L000UP] 0P"0C@H"S0FX p-L M@&dP0@D`P K`CP 2[![SC$0BR0 `pht@ -`0LM @R 0D!S 0S/$^YPT@ -L P> P4 000 S/ S- @PP pP `0S oQP@` @@ (~P|0p p0q\Q@TV,@P0$ ~D'r0 -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| T `1 @ RD1 0o(0 Q`l00]QP 0`0CS0`0 0j00CS0@000 SH@P@(~LH~r ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 up00 PP 0P0 P ~8t -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000nPP 0,"0C@$"S0B0 0y 00CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000PP 0 B0R@ q@0k ho0 lY00CS0@8h0SL(@00Pi0F~l|tr~0:~t -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0~~d p -LM " P2 P@" " q ğ0S   ?KǟPW"R 20R2 84bPU$0S4 TR"0S \ 2 1    ?K嘟P 3 `d 0Q,V,K 0S 2Pß0SH# !R030 R\ 0 0%rŸ0 QP\00NP 0"0CP"S0R0 W0 P00CS00B0 B0 0o࡟0 Up|00uNP 0!0Cp!S0Uq0O L0 X00CS0$b"P U" 0S  Q0 K9P0x 0uꬠ0 Up|000(NP 0d 0Cp\ S0Xp0 0" 0M~xpȃr -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000MP 0t#0C@d#S0\C0 n*0 (00CS0C0W0Ȃ T`l000MP 0"0C`"S0xb0 30 <00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000DMP 0\!0CL!S0D0 0O 00CS0x0 `@0 dQ T2, 0@TP(꘠ Q000MP 0` 0CP S0H0 e0 t|pxr -LMؐԀdP`01 ^, p@PLP@ @q0@0 A0@0,A0 00 (L@@r -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0SVX@X@X00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0Gd~~~ -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@KTd~ -LM@`5%렃0#Pp 1 0#xpN H0@*SF[x[x[x[[x[x[x[([x[<[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[H[x[x[X[x[x[x[x[x[x[p[x[[  0 1 x"Pt2pP8\"pP25D2@2 @bTaz$"0S "0Sn ! 0 g!0S ZY  f1 a1@D]Qq+q  PP*O0S0E= 0 0!Kpp-0S?T%w  q, 0S 0S  BK1: S 0S 0S BKe0: S.  0 0 \rZ DlZ 8'` 78|l -LM/@UP 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|Md$ #P  00 +PP 30CS<_P__P_P__P_P__00  tt00S3 3S0S$   ` P$ $ ` 0 pi/S @ 0T/S/0000a`0 S\t e`Kp 3S @0 Sm 0: S 0: S  0: S9 ( S  S QP00{L2 R Q(Pq Q2 R Q S  S S-mQ1 R1 R 0S 0: SA 00XD!_8,OP40s }J 0S s@ 00 0: S i0: S0 R0S @0Bu@P!3S0@0lW0S܆<^HctTl0# R00R\R0  QQQRQ -LM0  SP #@TH#P (M 1 ?pp 1U@C0Sx3 R! lCl`Dd#00CS00Ӥ0 PpP 0C00CS00Ӥ0 PpyUYU >pP BKaP `1: S``(p P@V h2d2sM\/0a  t r00T0S ,幣T00SFT>Y6 1 R,0  !0S ^^P 嘣KvaP  0R|1 !P H8倣 P]]  !n80^@Mp q\]]2\2Klƣ0S4  Tl,X !LAGP8]뀀:00:lԷ -LMMpA^K PE0PE` @ 0 Jp 0T0 凣Pxph SP\0P 0 S @ x@(9@P\h -QLM@l Y0S\TH0S@4 40 0Rh.Ȣ0Pt -QLM@p 20S`X H?0S@4 40 0Rhꠢ0P p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0KP@BV;  P W0S k@0<0V$ ӱP ]@A0V0 LP 70-S xlK@pL0S LDL4r \ 4@ꈀMb -L 8MP0 R   0-,@,PL $  :: -ML,Md:`:K@(LT:L , @0 `gS0*Kp KKZHLH000JP0K0L0 0uS0nS0 0 0JK(@D@D/P *Pp<K@@ D9PYZ(K00< IJK(@D@DP jK0(`F(K`F  0M>P@ ?hZKK0T(PE(LPEL #% *017>P@0C0*K( B BS1p@ 10DES p p p p p p p p prrrrrrrrrrrrrrrrrrrrqrrrrdqrrrrrrrrrrrrr8pDppprppqrrrpr q qrTqqrqrq$K@@ y0DKHsPppJK W(@D@D KH00Sb U0*KL0Z&P&NꄦK@@ QKH KƟH0 0 0 >  646BK@@+4 P#$%^*,6 (UKJKL(@DL@D0.S 0.  0 l b00l5   %%000h%h5劀p@,L50Xq4(K0SzK(pG$5pGY 50XS4ğ 0X0Q000 0S"UX$0sL40S000 PZ pKd$hL00P0-S0SAAQAAq 0S 000  b0 QŒ00 , P080!Q,000S!Ѐ! -0L0S!Ѐ p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p!ЀQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`ph0%0 0X00L0 0T00P0ᜆ -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b'?(0,0000004PcUP!f ?`V 4f ?(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8@0@ <0e e e@ < @0% WZc 0Jp W⨂⨂;  Q\ `d(pGP0h000h0\S*WZ> 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K =+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K <+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  </ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K m<+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  P</ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#94p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK9x0 009P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K 9U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K 8 G0B @T0D```Vx010 r0᜔ 0`p4 -L4 -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&opH0@ 0S񟗇ꬵĵеܵ```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CSk00,K 0^@c0S0 t,0 R0 X@ 4@ PL qPP `rP@ 30C S|ĸH RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L8P D*`0S @0SD _P Z 0S0SPQ TX :P ZTX H@0<>A r/ l`(^0S# <`^0SP 0!R00Ss ?I4K8 K0K9P0 #80@ 080 Y`V+ `000CS,K@ XP@0S ,0 R D@ @ = P RC@  I눊"00&AP< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@Cᖮ ؕ7l` -LM0@Sp UdP`^0   K  R W0BH -L M0@S {I^ 0 K R 0BX -t0LPd0 R X0XP PP00L '@0( 4P000(,:h p-LM`Z `P0@0@\  0S 0S 0S pd -LM"40Qp,0 x(P^`0@0 P`O 4d[$K4@04  PN$\P4 K` 5"0`\Q(0p004 0PS /1 L40 TX:0 000XG A 00CS*>pp00 0S$ 0!000`\0Q\ p@@QtPP0 \`Qp@@0 \QtPP00 000h 00@ 5/0 4L T:갌""Td`! -@LMT 00C0h@-p0\ ` L00n^@` 4KR>K0C0C @@_`0 fK~KpGdPpGPU0\%S>R0(5 5^ x$=L0OT )H$0\%R !040US  Z$08 3 #00\0P1Q>KR>K0C0CE.KpW B04% 0 45Po0C45 |0\%t3Rh 4!0. H3 \5<#SM>K0C !? 4%1 @ 0 0t/1E $pWZ`P2 ,0S ,Y40 S00X' @BNK @D@D0P&HD"P0\%2R  0S@82 lWM>K0C !RBNK @D@D0&W"PWUd1 \5S0000 /P L1 ?C \5SPP0 P 0 0-LM@T1 T0rP@0 \QpIP# 0 R0 \Q000p \KQ0(00  \TL0$ \8QpHPT\ȌhtyX -LM@ 0l@n HQ\ 00CS x 00 00 Pd -L M0Pp $0 R ğP0P* 30S PU:0U ă@6&0 0 ` !0/x@|#T 3S d@0 &D3T\000@O0* 0 % 0 00 0C R 0  R"  000@ @0"\`Q F p00"\Q(0p  0SH2 00鰠0<"\Qw )0 "\Qm })0"\,KQ00d0X00!\Q,00 ,0 O0!\Q000D00!\Q,00 ,0( O0d!\Q000@00D!\Q,0 0 ,00 O0!\Q00$0H00\%R4040  O0\%R404h0 40 4O 0@0 R0 B6t 0)t)p(j00 S0 00ŠdU `T 0- L8M00 H L0 @0 <0 80 40 00 ,0 (0 $0 0 0 PKD LK@V`0`\0\ ^P,1'<0<   0@00!d;!28!P 0S) 0S2 RXx;P HuK::P! 0S Lx x( =K8 @ < 5P x|@,CN`0 0wr{@T l{@T M^xd{@T d^{@T MLHV{E`K 0O{(x xxxx0={PxV|x"PȌ9dČ,<<#`0|x؊Ttdl`tԋLo8LT@H`̌dXP|{ -80LM, ,0  @P t -L S` @CT`0t0@DT ` 0@#? 0S:0 2 R @ R0SR0;S00"\Qh0 0S "\0!0Qp"0Pd ( cpp0x0 8P`1 R 0!\Q00 00 d1\Q 000  Pw L0(!\Q  ( 0!\Q0h0 0 1N00 R 0 \4Q000w`(P  h0\%R4040 O 00 0S0   9TTdЎ4܊p4p܍čȌ`؊,HȞd l  -L M0` p0P0 ,0 |X00Sk8"> R,A2   (0 PH0 `X(0,0 q! 0 @Q6 P3 VP' `| R0pl0  0R 0S R0R0S 10S0S _P+  0 R t P0,0 0  0@YTn Xl<<H lXTHȌ(l  -80LM, ,0  @P(8 -1L8M 1 q1!00( X (0K\ T P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0T@ \K0S N ꠌ$8#@  (d -LM, p0W`!ؠ؀ @PT 0S 0T @T R 0S @0PpG`W DP0 ,R0 `0 $TX -LM$$ @0 @P,0P -LM88 00 @0Sh$ ,0l -MLlMhF0,0   BRi  | 0 ,.PY &P}0  65]FKL0%ş `% aA5( K焕%5ş Vd$ 0h *0P000Ss` V: 5@%`4ş0 V0 *$E0P00\'` V:ğ0 ` S00*PP  V:$p4 ,0S ,w0S x0 P00S 0 S s S D$4P,$   00C0 #P  000 00C0  S;;SRVKH,l3ɠ \5\S00U.K @@ B @ R01 0#T*sp$#0\%R$0(0   @ R01 0#T: Rr@"0\%R0X0  @TZ0FK`4  A\$ 2BNK @D@D0($2 R) 0̠  _ B0S0?0?00 RP0\%R00  @yq0̠ xd> d<$0Pe0\% 1R$$0 PP PP 0:00909dȏh* ,0!  8#< `ԏ܏TTԆȌL@ l @`Hx -ML08M (8Rp, ,`  Q 8 Q753 575(\C0S  P ^W0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK "P( (\0S#  R0.S (0&(00\ &"F 00CS񟗍# <$ $ $ x% x% (0SX ,0 S ,,妔00  & 5 R E0 S % 00P%00C0 ~0S$ (\NK @D@D0@S^K PE0$ 0%5 R _pP (\00(0S0 R$ 4 R4 R$ hyP v0:  S00044 0 0^(\OR$ 0.SH_00SP[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0(00\P000 Q0hNK0ᴀ(00(02  0`0C0 @@\+0SP (00(0P l"00C0x">KMK \P8"4.00@P \ |P !0l!00S 0S 0D0P>KMK Pe(00(0 1  0`0C0 5崀t$v@?P_ l0S 0x0P\0 R\ 0SY }<00M0 90 LXdp|h`ȌܟؐT܏H|(@- 0$ $00S@T T S -LM$$ @0 @P鰍4 -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPʦ`@P:l000`0  00C00 0@0  갍h8#* 4d` -LM$$ @0 @?Pp8 -!L8M܁ܡ0X  (0 ( K\0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 , `Sq 0!PUT 0P!@U `,0V00 T@ 00CS7- ,. . ,. . . 0QP 0S P0  00M\K I\KB0l \Q  0  0S\KD @0 0FXK0QX^~HK0A$UU<U1U/(W, K0K0P%0` 0/>/1(K^00!1\$ł0R`0V30/>1 10SK0$UK0Lq Q\<^P.0\Q0 T K0010X0P%0\0XK0Q\0K0/>( `0XK0/> ,HKd0A$5S A h $5! l `0S10>!d d0XK`=K 08K(0CPCHK @Q=K(@0@ SHK@AX8 ZK(LDLKD@ HK0A848 00C bPX 0 2X0h̟(K0!,T0-BKHK4AH(KL!00(K!HK 0A,00CR8K01;1 HK 00R# PU^ ^ $0ǟ0 Q$0.`0!008K01HK8 > b0Q0cP4 00XK0Q8K`8Q(K1KHK$!,1A(K<0A(1TXKK0 P5J@Q0S\V P 0S xK0KP%00 0PHK/0A>1/$01^`0U30/>11K0HK=8K010AL 0PP 24R Q$5SXR0S dj0St P8K01X K$20 $ X^a0  0 0"8"00"04" --L K: p-PLM@P`l0l R T D0 Rp80 v j0Sn ̞>.@@@0 > @@ @@>0 0:0lS P`,.P(0D.D<00fPH(n0S@T = ,0S ,=-K B BP =Pd5Tt5x%0%#,0104Pd5@T\͟\X͟XX-X=X id5T8 `j0= R0  V0S  C>000, 0,0 t010C@_aK0Po0E" $`PaNK  0X Z0S0<cQ0L QQ8 ' 000S  f0S} Py  00H0cQ  000cH00S rf0S_ P[  40L0cQ  400cL00S \ Zf0SAP P= 0P0 PR 0 @0i@P0S Af0S# wP 0P4 TR @4i@T0S (f0S ^P Z,5S05 FS.S \ 0a.KS>0S  f0S @P 0*\(5Qx@<@S  0(E0S e0S &P  4iH080@_Q s H0S.0O 0S < e0S0 P  hL0@0@_Q  U L0-0O0S e0SP H9 X0S0,%R0S0L%r P%0 0p/>1/$E0ࠀ1TPo`0W30/>11=L 00@UOX dGP%0 0P/>1/$E01T`0U30/>11=`L 00S Ie0S$ P  $7\%R0000#DC0xQ 0x@0S -e0ScP 6\%R0000A#A0tQ 0t@0S 8e0S,GP E 0S 5 R @ & L L3S 0X%458 p= 0000`d 0hLCV`!@0 `P F|T 00 X@0`P`/>0@@!~ pāO_P``5!?VAQ!o@4PW tpD44PW *4PM "Pp4d7 0,P4P0D,, x#8T0 ?>T(0$4 C000#S P  5 3  93g?0S@0x@tF tPfxHRh *H2 @2 020 R0 0 0V0S8 "0p00Lu 0P5?T5 V>X5P%0 0P/>1/$E01T`0U30/>11=`L 01 p1 p?P 0S" g0 00,%0aKS><0(5 H0S.0O  L00O PP H0 0 0D5S9pČd\hHȌtthĔlDhx(LTxȢT4l dD`llh\ܣ0Ptl<dxČl H0 0 0w<5S_sp0pP O@0 0 0045S+H0S0O L0-0O0s0 P0 P1! P P1 010 DQ0 0 0TT;P  0<0 ]x|1P 00 O$0!S{0e E7f<!Pweo*bz e"br 4we@@ -4L M , RtPp1 tdt@K `ğ0\$ȟʠ 0 oP4ğ4  \5 SS P1s@, Sς S3S0S1s 3ß:0,\,՘ڴP,Ո\%h3R T#h0 S,`0 0B RR,840L\?>\,rd0OSh" #&  ?2ŸPU;,0@ 0@!bh0/n0S ("P! @2 R,0,b1P@h00`T*0 QP@T:aAd!1\%R  1  0COL1H $0C.O (0O 0-O 0?O 0/O0O 0+O  S0LRL,"T(t0lȟ 0 ʠtP@8 <0\%40RR ,$鼌hdTTĤؤ,t<|Ppx -PLM@ 00 R$hdȌy -L$Mp`P@u Pa0@S pt3@  0@T , q830  00S, ,2WC H R R2!" "  0P 00C    4 0C^Q0 0C#0 0 4`0080P40 00pp, ( @| ,000, 80D 0,  ?~ 0 @ y 00P8 H $@ 04 < P U 00S  0E000D0@i  @e `0_ K @G  T0,d 0S d H08/>/1@ 01R`0@\30/>11< 0SU0 0Ŭ ũ,P0(  <0Q`,P<|"Ldh -0LM@H HP0T _ DedA4H 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S @0 R8b S S  S Sꨌ -1LM `RjP@@ 4T1 RU1 RQx0ST X1 R PUbDQXp<Nb~00CS0X0@ӤX0/FT) T 00CS00 R0 0  0 yTYT nTNT 3YT00yT  R 9 P00XG1@@ b40@,ȌHČ0:`̙ -$$1$!@@@L0:PP; 0pP `P`@ @pp0 `V`T$0@0P00T  RP 0X  @@X86KXP̌, -PLM@Tp` 0d #0 S& @T@T$ 0 @TT  0d 0000 0 @P@0S ,  -P@LM `d 0P@Sp T0LL 0000 `00SČd -LM 0@S pW` 1W`  ` `` T 0 V0 `8 = 00d Ls p0@0 j T@Ű, 00 Zh dČ p-X0LM`\ P@ 0 ($OP px2 cȌH8 -L0 M(K0!0 KZ 0pS2\%R PHbp2 R 2 ?f0Su 2 R\ BbZ@T T PPUp@ UQ("(0Y00 0 1 R+ CY1 R AP~P{0K P1!@P:0 F`0 0 \PLP 1 ?0$!P@00 0 0S04PJ 0 84$0@4(0 H4030 3040 40000UX@00K 0gLČTphȌ̌,PXLdh -L$ML"@`_@0K< , )"0$"@@K< $ Q}, pPt  @K,0 Qd 8  _8 0` Q4 J40@`KOA0 ,~ R0,0 @pK@`K0@P`  q$ 4R- @_dXy!?'% @K`pBP@4b`0 pk_80080 @4`00p`V4` 0 18H E/HR_@ l$ ehԚܚ@  -LM@@K  P, 0 eQD`/ᖁ0㒜,@)  QQ,0 00 PF @0K87, 0m Q6`4` _0pV o0  ,0@ 0R, 4pPo@pK`p`@_ H 4@@KlP/l^4`0p`V4` @PK@40 @pKh(0@ t -\2LMPpD08 P,R0SOT 800gP 1` 1S2  800gP80Q/0ORQ\ 0!0R#O\@Pi0 0 !0 / 0!S 3S 705\@0 0 20 0 R!0`000 2\0p/80W0$00C0g0$0\ S|̌xlU ` -L@000c0Q3@T TX0X  0S  R1 018Ġ@#,800CST | @  @ @ @ @ 0S0 #Q00 #LQ0 R0S800CS 0  L     000 10B0  2 R0  00800CS관 Ѐ 000 10B0  2 R0  00800CS\ t H H H H H 0S1 S20#B1  0S 00 -LDM@PP @ <¶XP ( Ķ 㺭ePP fY sY !1 1 !c<p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL    0P ,P 4`  00T|h:tKȦ $$7  x -p-L M$`K a0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0W000S0 --L v --L ٬ --L M((K0(K ެ00 R  $ -LM@F -LM   K 0KK p@lW張 -LM @ \K0   KpHW嘵0 < -L -LM@@0S  hC  -LM@d$p$ pQXt -LMM B~KpGnK0pG`F+`F(0 m+irPÏ+PP"KAA NK@D,X  4h 0X V(Y|,`4 0X Y`L$BpDa008 ZP6KAA Zp@V0S' T 880S@WT 0S 0@T8800 |  SplJT(0 SH({9Kܧ$,`$  Ш p-L$M>+P`*4@K P 0` ,` 4P M I*10AS1 0K(0 $@ ` B(KhXd\ {Ip H<0! YP8K Yp@ #V0S  gpRT80[S [@WT80SS S 0 0R0<0 <K`!40LLL DpK$ܨXK  X$@ |,L ܑ 0-LMP0@S P UP 0@DPU  00ȍԩ -l0LM@ 0K $0  K$ K 0P U0 ȍ -X0L M00 0@0 K P {U˳ ȍ -\0LM K"@ 0$ KK@  P (K0$(0ȍ p-LM@PP` HP@`pP`pL -LM@ 0S 0S  h - 0LP`p 0S 0S,@, {0ll ppX| PPV0(0 0$`$`@(@PW p-LMP`P  0mpO rP@ @p0S P吨P@PpUP@ ,@ppd^PW0H p-LM`@PT 0SR(0@VT00P <pbP@0PS  p -LM@>) r`RK !Z9P0 V 0 \h -LM@N 0`p`(Kpj )pPP V $(K vP( 0[ 1S00 0V% (!pP T0S T0S T0S$ ($v) $($omW0`S|10S p0 ,K,0 "V0  X8 p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phoUp, ,0 p᢭php $@ P)ꘖ Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė Ė 00,00$0 000$ ؛ @ p-LM`00P 0@T PU 0sp00 0G(@T8@0S Vpd0S 0p$ -LM`@pT? 00 0(@T8@pT`/ ┻P `(@T$T" 0 0R 0 0Ap 0 0S 00 0P / 00 0S  PPa80@T 0  S (@T ` (0 R 00 0( R 0 č 0:0$ p-1LM@T 000 0S(@T6!M p6 _'p`2 P#$@K P  ` ` $P l h8I K l$! 1`T  0o(K U(0#40S 0:0@0TSpKR0S P0 0a Upv0S9R0 S5R0 S @TDx00i4p,LL XKK$Pč 0-LD60 R 00 0( R !@0SpQ0S P0 0 LUp*0SQ0 SQ0 S @T ,0,LL \č 82P *0P ": -LM`PឥP( @(K,pK 0  (0@S0 -L M0@p00 0Si TPP 0S nSZ =P0`0@Q ႞P QLQJ  0V0P 1 0* Y0  0000V 0`0^Q00 ,K, ?R0S@p @LQ0"Sl 0 Y000 LPH00D 0oSP   \t| -BML M ?? p , ZK*KKP0 K . ..MAKEDEVconsole tty memkmemjƫnulljƬzerojƭstdinjƮstdoutƯstderrưksymsjƱdrumjƲklogjƳbpf0jƴwd0ajƵrwd0ajƶwd0bjƷrwd0bjƸwd0cjƹrwd0cjƺwd0djƻrwd0djƼwd0ejƽrwd0ejƾwd0fjƿrwd0fjwd0gjrwd0gjwd0hjrwd0hjwd0ijơ ... ... . ..misc5ƥkeymaps . ..-termcap ... . ..MAKEDEVconsole tty memkmemjƫnulljƬzerojƭstdinjƮstdoutƯstderrưksymsjƱdrumjƲklogjƳbpf0jƴwd0ajƵrwd0ajƶwd0bjƷrwd0bjƸwd0cjƹrwd0cjƺwd0djƻrwd0djƼwd0ejƽrwd0ejƾwd0fjƿrwd0fjwd0gjrwd0gjwd0hjrwd0hjwd0ijrwd0ijwd0jjrwd0jjwd0kjrwd0kjwd0ljrwd0ljwd0mjrwd0mjwd0njrwd0njwd0ojrwd0ojwd0pjrwd0pjwd1ajrwd1ajwd1bjrwd1bjwd1cjrwd1cjwd1djrwd1djwd1ejrwd1ejwd1fjrwd1fjwd1gjrwd1gjwd1hjrwd1hjwd1ij|0 夐  >.WKP ʄ^AmK|.|>Q(`F`F  4p> ?0@5S ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ | < ܴ ܴ P ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ 4 x @ ܴ ܴ ܴ ܴ ij ܴ L ܴ T T= XT=X pb 0 00cSNK@DP m0KS  KP KP{\0SK/IVK KP |< R Kr h\0S MP]Kp*KP|LKjKA|\P<?: S 0S/ 㼸:KPPP P`PjK``0P p;  0P KK|n*K Kx qd;0  00SZKxP:Kx0 2WC J0@@0  0 S ˟ R0@@ 0. @0`p  \ 0SX0S 0S Kx(0S0J0S 0PP 00C   0SڌZ0S  R1 0 # 0Sjڀ*0S010p: RʄJ0S p: rR 0S9 R00#1ѣ10)^K(iPE \  ȟPo̠0 (0 @@00 00|h0S AK(A&rP Xtp8(K h8(K0 KX(0(0K j:KZK `jK`KKZK| 0`   R@PĠ?T00tG0S K| `0S KHHt L'04xOSH7 0$8 0(8 ' W #p@s PH nK`F`F&0u~KpG"A]K0(PES PE-0STZ 0SHD  ARp P!4+sH ^ dP:K0S   XK NNK@D@D0%+7 5 3 jK ,H `0V00S00 ,0@ PN K A TP0S[jK WK:KZKx  RIں@PP@ ?4 Q49 \ڀ4{`tǏ%,!0@@0W a P&V30@!0001 S90Kx(0 S;30xr\K.P@ P0PDjK`  *Kq!NoK `NfZK <GjKPx Kx夠 *K:KP>AK(JJ 8Pp, K ܚP K``pWpJP @К0Sr0@0b0S \P :K8T P0pWj?0ZNMK BM jK 9ZKP!1PKAZpp K #!p1PjKtP NK@D@De/>KKK0C^x@ (!P$1(`K(K!<9 (K;9 @ 㔠@9) ,9 )0) ( K   (0K0`(PK`I9t\%pث78<xl,<,LoD8P`t | 4%h<%ԭ@%8%DP%\T%xD%p$X%{L%H%̮\%^KPEKPE0 q KBNKP@DjK@D` 0`cK@O 0`Y*K6O ZKPMR>K0C0C``l8 A0 `帠0!S IT1K00 hA1 `塠1\   11"A8 P`芠82\  HB1 `yt2\  LB1 `h2\  B8 P`X2\  B1 `G$3\  4C1 `6`3\  pXC1 P`&3\  Cc0 `3\  r0S 3#KfD圴P$000Z0呴P848$Q DNL4J@00 `0\> x0| !F6;F6;F6;r~!F6;F6;F6;aF6;F6;F@)K -!F6;F6;F@) 1.aF6;F6;F@)W!F6;F6;F@)֣aF6;F6;F@)M!F}4F}4F@)忝aF}4F}4F@)!F}4F}4F@)JaF}4F}4F@)KF)!F}4F}4F@)_aF}4F}4F@)!F}4F}4F@)aFAFAF@)O頩!FAFAF@)ΠNyaFAFAF@)J!FAFAF@)% aFAFAF@)[!FAFAF@)!߃aFAFAF@) Q=y!FAFAF@) aFAFAF@) B1sc!FAFAF@) PaFAFAF@) !FAFAF@) NAaFזFזF@) ( !FזFזF@) "saFזFזF@) \ц!FזFזF@) oaFזFזF@)(y!FזFזF@)ƭaFזFזF@)T!FזFזF@) o9aFזFזF@)kpN!FזFזF@)ѯaFזFזF@)? !FזFזF@):V)aFn/Fn/F@)t-N!Fn/Fn/F@),aFn/Fn/F@)D!Fn/Fn/F@)taFn/Fn/F@)*!Fn/Fn/F@)m%AaFn/Fn/F@)k"!Fn/Fn/F@)a'aFn/Fn/F@)H͞ !Fn/Fn/F@)4aFn/Fn/F@)fP!Fn/Fn/F@))aqaFFF@)uP!FđFđF@)SyaFZ*FZ*F@)u!FZ*FZ*F@)aFZ*FZ*F@)&!FZ*FZ*F@)uaFFF@)~a!FFF@)m{aFFF@)Z(C!FFF@)6-aFFF@)!FFF@)^6aFFF@)@;!FFF@)u(aFFF@)7V!FFF@)SWaFFF@)͕!F[F[F@)aF[F[F@)M#!F[F[F@)DaF[F[F@)sP!F[F[F@)փaF[F[F@)L? !F[F[F@)w&gaF[F[F@)Zn!F[F[F@)aF[F[F@)LV!F[F[F@)aFFF@)l!FFF@)/WaFFF@)1!FFF@)FsaFFF@)\!FFF@):2+aFFF@) 1y!FFF@) ZoaFFF@) l4]!FFF@) rNaFFF@) !FK% FK% F@) qaFK% FK% F@) *-+r!FK% FK% F@) UϞaFK% FK% F@) ,b!FK% FK% F@) gL6<aFK% FK% F@)h !FK% FK% F@)Csi<aFK% FK% F@)!FK% FK% F@)F!FK% FK% F((% Bu!FK% FK% F(Z& ;(BuaF F F@)} !F F F@)ѲNaF F F@)&K!F F F@)9!F F F ?c5=!F F F ?aF F F@)w^!F F F@)|aF F F@)B!F F F@)6aF F F*]ba!FxV FxV F*#aFxV FxV F*>!FxV FxV F*t!FxV FxV FxV <st!F0 F0 F0 (tc!F7 F7 F7 (Y!F0θ F0θ F0θ (H!F0θ F0θ F0θ (ew!F0θ F0θ F0θ (hӬ!F0θ F0θ F0θ =zl!F0θ F0θ F0θ "|b:!F0θ F0θ F0θ "(Ju F8 FFH I=|&ͣ{aovB15!Hx'j9xbEb >2[6~3P00 04 000cH0400cL0 H0S.0 OL00OP0~ P@4z T 00TS180@8Po `P4%h d@6d CN@TP4|0Xp Pu0p$7\5 R' ,%0? 001t000#4x0 x0(5PJ4 B ?8P 0Eo 0 50P4 ?8@@00" 8 00000S010CO 00pǏtSΌ/1`G P$p0`0S0 `Z$@@ T0xRZ <4/S84S*8d tx00P`0xQ08@@ 0P0S`P @zx@@u0P`0xQm08@@e 0P0S`P @Yx@@T0PP%0 0/>1/$ŕ01\0Z`0^30/>1 10S:0 4 a PR ,ß` ` r ?CΌP ^࠳ @08 00P` @x@@0@lRCPU ?# ?WᣎVP0 0/>$101^0``0U30/>110S 8 0a0b0P @x@@00 Rʼ `C 0B ?,P`0xQ08@@<4`S84S:PC>⼀0 ?@0W BV@0> 800c0P @yx@@t0꜓VxP%T%<%8% 8@%hijD%H%TT\%`Գdtp4%9l:D h 删\ ?d0S4ڴP%0 0P/>1/$E01T`0U30/>11=`L 0@`0xQ 0 00 0-O ,@5L 200 XPI P@5LV>00h0h0 S:h01 1< 1\ R0E> XT0P P0HU 00@u0Pp40@ ,C> l0` 0UOS/}P=` Sp`8_@0VO 8C>N0 0+S  0c, 0C@ @0?. S/0OCΌC RWڔS0S 0SPP@ # [*0\%4R @SLd0*T$T4Q0`\5 R XP `0 00D S0:10P&z 4 L* p,0W$p0吀KS%d{ p,0W0Sp D5 R PeP \0SNڔPG@T0*G 0P`0 0 8P40 I @@IA 0,;0 Q ,j`=0T0Q̠ d DFVP0 0 e R 000 PUP  " 0P  3030 4040 O00@`T#d0>ᥱ@cTc@#0t  P\6\ HdcP2 |7+E(7 7\5[*0'P KC>0C@4C/ @Kd p`0 P@0CH@p,P4h#/ `P80 'H 04 0@4(0 H4030 3040 40|0 00 00,00C @d+QQ0PJ?0 Q00#1t0003x0 R0(% 0,50 0084$0 <0@D000 0Xà <0(50,50 # 0 S0S 0s  ED0 xD@0 h0004 Ϡ΃H}h>h@hд4%,Xx| -*LM, 0 0, <ȟ`Q84S*C>0:,,@00 `:$X: d0@C<@*@0_S0S*(ʟ,@P0 0 0#   h04 hY40@9,0 Œ8 7ɟ00/0l9h0 ,p 0 t x00Sx0x9ɟ 0S0\p8ȟ 0\0/>` 0`0/>(d0d Rʸ 0,0\ 0hH,`X0 S\00 0 2$0 ` 0V0C 0, R$40X ǟ@87 R`0 0   'QTdǟ408 XH 08@aP% @7` ǟ!40040800`Z G0 S`00 0 20 $0Z0$0&6 80 0Sl#@8Dhh6 R`0 1<0   0&Q6Ɵ 800S0 X! h!400400X5Q`0 0ς 0!| $00$0 0XPX8(%00 Spz ğ0x 0 R``p@VP $0\QO P\`V4 ,00P@ d00\0S0$08 Ղ`$0x@`TV0PU@0,   @ dP0 008 `A|ßl0Px @U7l@Hß0d{H#H3 RT000T0003` 3 R' Ÿ0dapPZd;@PQ0 10` -D뀐000@XP@Pd7P5Ÿ0d-"2 RT000T0001`1 R) 0dpP%R< d@P0 0` <0뀐000fXP@PdP5,,00CP00 !  0 00 0t x0H TpT0 1X0@0$X0 0\0%,(렓hdxU 4%`T  -LMIK@Pp, `1Y A RA A Pp ` 4 0,K2B0 RGoK&GoK@04P0 0L`| p0Ġ/ d4  08],00 p4%'`%A -LAMJK@, i_0KB/K00Q `000 00 08 A^0 d S00K 20`K@d ?11 RT000T00C0P1 RS @0Kd l ?@4 8@ PUU@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yUeb ,9ܷ \:0: p-LMP`P @5@P0/S+ /@P0.S P0S@p0S .S0S`V d 00 Q P0S0P,   @@P0/S ȓ  -0L 崘^:, -L0M0`@/>@d#P000LP< CR 000Ri0 Rd \ 0R R R0R lt: -40L R(0$0$    ]+ԓ\:t -L⏌<0 R4  g 0 'Г ̓\ - L 뜹 -LV뜹 -LMhq0S \\PPL ~@!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0NP 0;C 0 0d@d @Bˠ$0K $ @:8~\,l/ ,Гع̓ -0LS \|0H0  00S_\-\0S V < p-LCM``GOK0PL  _80 Y 0S }\p9 , -LM$@0 S A00,`5 0-D0L R 4410P@@T00, ؗ 0-LBMdP0FOK\0 P 04 0S /\09$,4 p-LM`@?,0 m P7Uph̓ p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x ;K⧂0 S X[pCNK@D@D 0 <0[FS 0  9@t, -$0LM K YP [̓ p-QLMP`@00Ho @l ph0PE S U@00p逺 -LM`P媹Xဋᨋh!pXq mP pP P@(@ =!0AT3 T`7 @@P0/S Z  1P0S@!`VP X: p`:  @@P0/S Q@  fZ 7l` -LpM`@pKb7@|6 00RPP4YP0: SU/00 Ô X j60S U P _60S  s:Lol -0L {Z: -\@LM80(0( 0逪 -LMp P( :   Qq00  R(  R00#R@@T;Rp 0P00 p  (0x\P`@@(X0S 0DH00S (S 0S(0 0V0 S񟗫 0 <  |  <  $   (0\(   Qq00  R( 0000((0\( ,  Qq00  R( 0;Sp( \ pSg  Eb(0\(   Qq00  R( 0\S  d*(\( 8  Qq00  R( 0S  /  (0\(   Qq00  R( (0pS0Z00 0PX(0\(   Qq00  R( 0S 0(0;Sx  ( K_ (0\(   Qq00  R( | ( KF 0S P(0\(   Qq00  R(  $s(0\(   Qq00  R( 0S  3 @T00pp#(p}4( 0HWt8S(( ( 0\SS, (tP(  L( ( (P( t  Qq00  R( 0;S @l(\(0 ( P(   Qq00  R( 0;S S ( `_QZT(@(KP( `  Qq00  R( 0,S00\(   Qq00  R( w(P( `\  Qq00  R( Z l<4,D\ $8XȽ 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ !00X@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 v U ZP T0S5 0S 0 xW 9 -L M@X, 02 ,0 p1 100 ,0 0=P0S4P  \S  RE ZQ@D0S4 0bp00 g R APU0 00 !P \00, 0 S0`B 0V, 0S`3\Q&Q\00 S SP$ 4  0bp@, 0ꈪԾ -LMr ` 0 ( P0 (P`Ÿ  Qq00  R( 0gS{ 09S,1SUK A A ׃pP@P@(S S (0(8 0 S x V;SpSD wSP( 4  Qq00  R( 0NK @D@DS  S ( 0(0S0R0 ᧅ0PU ( p 1  0tvdr00U0P0e(9<(P  -MLM` P( 0\SSL ~KpGpGPP ? jK$`FP@ `FPP3 0Qq0  00SP@T 000S0S   0S(0 S H(U8,9̿<,T -ML MԀ0S P R" 0pW ` 0@ ,0 S0 ,3N)0S P)yPJK(@DP@D *03\ 40 s᩼0kp9:xH  -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@)0Sj ) \10R,0R P($0\ CR #00\P 0 C0 b\ 00`0\ P1,`0Rto)`vdP tfL$ KP2[S<00Z4.:<\ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 0"P P &D <0S1| -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@꠪< -LM@P P`p W00  0 0  W P0-L@P 0wS! sS @T0 p &P 0 0'0 d[{Sp P00'څ 0Cb00 0-PLP @TT000 0-LPP@0 0R0 @@0cH 0-SL@p  P`NP@4 U@@V@DH hP @\0000Q00 -L,MS @P D #mp LP ?PPP|#0SA lGdOH \LL Q 0S 0S0#0S$ WP0 #PPe2p D 2`a"P  P0@ |"@ PPd2d ; 00 , D00 0<80 4 jp pP ?P VPvPp 3U 0a,0 X0?0,0 pX,00,0 0*W0S9 @T6 0(Y00SP0(U00SU W 0BRSh_E 0BSET U U U U T U W,0*W0S 0*W0S 0S@ >E>4DP  0p00  00S& @wPp6 P`7dHP`2 dhxP.(T.X.gfffh <T 0-@0PTL 0Qc@@0 -XRLMP"@c?P 0A`V PU / 0S 㫄0S @>1 LPl 0S0@  $0 S  1SqQ0S 10Sl> @P@Ic?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00z0@ ;0 Q m K0P@@ RV  0 ݀ @, 00>(P.4X`t -PL@p` bp lP ?PmPp`t 0P0 PP =-0P0 0PPS0fP p-0LM` P@b?P 0AT K0Q3\0 S0 1 !0l p$R=pM=P.$8 -LM0@P,0 #obp ?P SPP,0 S ,@3 AT #0 P 00LS!00LS0B \L =p\ p]  Qf` ᓄXIP@PR  Q8 凄P3 0X0C Stt s s s s s s s s s s s s s s t s s s s s s s t s s lt s s t s t |t PI PQP'SP0-V +V ,Q@ AP \ \ =V1h0l.P 0a0CSu u u u u u u u u u u u u u u u u u u u u Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<<39H<PT`lt| p-(QLM !@`a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPp,|y P;P< (;pkypP.( 0-PLM @ a?P 0PPKPK@P 0@0 SR R 0P. -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKl=PX L;sP uP`PX  L K<PX L <|;0T0 0P0 0!R40*X<$X e?@P` 00XPT0Sc 0 00 ,  00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHK[pP800c R8K[`Y U u P2 P$ R X婰 P %PX2 SP0\U00Su US 0"0  40VG 0S 00a|0`71 R,4 }P# 0SLeT0S Xu XuX^<\00 000D28D<+e  0!e U0S4V  V 00S`FV 0V0 R fPF\`0  @0 < ;@0p0H0 D 4:TYtDl -pLM P_0?Sl@ M0P 1 00S<0< `W@9P.@ p-ALM!Pc_?P4 0P@ P 0SPU @Zp: `:4sP``V 0-S Pp%sP@P et0S,9p0S`P.  p-ALM P_?P`p0AT K[\P 0 ! 0 rR @0S qXX~@P00`h0 R 00C8S` RV 0  9P.@8 p-DAL Mqp2P 0 (4 K 0B0`CY | 0X 2T Z P< p@10W 0 P9 pPU @< 1P7U<  01PUX!<`4,0^ *00,10 ` 4 18  00@` DA %A@,@ 0 4 dZP PpI  SU@1 14 1uP11P @T<080  L`P. 0 -LR  ì/` P 00U0S0  'P "P `P =P :P PEU0\\S @T0 'P "P `P =P :P \P0 @0S0XE Q  p00  RAQpPEuP U0/S QQpppeP<h -LMp`@(K 0 {0P(0 U(0Sl,0K  P X(00,00 0 (0S\ ԫ Q-L`p90  Mp0PS@   \R% [Q*Q ?Q $Q 0(S /Rp RQ0~S  *00W 4tP  0S@p p-PLM`P@TQ 0RQ@Tpp -@TLP`@p8p@PTh -QLM@% T! AP0Q/S P /S @P0/S0S1d0/S@P0/S 0閹 -L M0K` e e 0pS  JOP P0hU`5*00L@ @dDA [A0@P0 -L$M@ @D U2  000 , H %00T0`80 4 V :4@sPpc W 80  cRP8KL@V*0 R 0PU0:/00H0 80 cR8KL@H D寷@B4  0BDACTP`0<0 < KP@ 1 1 P@T10 R` W4,  <0S 0ոp -@LPpnvn`T@X00V00Ses0S _sP 0SD@P`d@@Vx| -"LM2"2"22"@2@x"t2p"00dRd2d,KC,0DPD"`0e<088"Pp@@0c00B"0c0C0 gC0STA^ 1!10n 0cCPB00p<_ P91 R p|t!0@ 4@`01 !06S<1` تЪ -D0D L0\0 P H ܪت P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` ڴ00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0Uتܪ -L -L -LZ 00ت -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SwتЪ< -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0-تܪ< p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0Tت -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00< -hP@L` P Lp0T*0V  0S 0T*0V  - PLM@ pH 0 0  R ^T@?hh< -D0D 0L0Q0 P`0TyتЪ -D0D 0L0S0 P0<aتܪ -p0 @L 8`P00Cs0 U0 T o @R 00Cs0(0oP@/ܪتЪ 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00تЪܪ - L 0   ܪ -$0L; \ -0L? -0L6 - 0L0@* - 0L0 -D0L R80000 ,00@D -0P LU:0` pUh0P0@  `n p0 )` `01 0Rh?$ ЪܪԪت-000 0 0 bL1C 00ND 000 0Q 0 R LܪЪ -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$*U 00eU@  9Ъ -pQL@@0 @dT` :%PP 0@DT*d0 XD0@]@0@^S@D} Ъ 0- L^RP@ }6P00d0= uRP0 -p0xP @L@b\`00YD0 <0 40,0 !ܪЪت -0L,ܪ -0L#Ъ -L -lpLMP\r\`  P3 0Rs 4"42@PTk 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00<ĪŪ P0-L@P T t$|0 0h S`0 ! XT0hb$H0<\$40 U$<.l8. -LM⠢pQ, S |,@01Q 0` 0@:T+$Pp 0B,a dP00S S sYS 0S@ WG@01 R;0@:T;T 01  l[#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P (jP @, 6 ,Pd00@TTPUXxWT$# ̪ p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPU㐄P@ DmjP80  p,djP̪ @-?>,1@LQ 00  -LM@Q  Q Q Q Q$ h0 ت p-LMP` R @0@0R@PcPbS3@ptت -L0Qh0 9ت - LM0 0 p` P0@@cP0 PPt 00p 0L0L H0@ @0@p`EޮT TЪԪܪتL -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @}T$0n$0P 0S@@TPphܪتЪ\ T. -h1L M`` 0(K n0n4@K0K,K @P@P? X04 D?0P0,0KpC*P00T0S`T XU U 04 $P00  0R/S \P(0+ 00( ) PFܪتЪT.\ -\0\X0X T0L0 L08\000 5 hЪت0@. -T L0LS00P0 S  0S0@.ܫ p- P PP0PLM`0 0@R 0 R R00CRphp0DS 00C000 p-LM@,`PP 0S 0U p 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P< -LMPp0` ` K"`@T 0 0@0@ &T f`ЪܪԪت p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@Y@pᷬP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S /PULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs02000 r0 0  R Q Dتܪ<8x; -LMtQlh0h @ PT *Tp0Q`ITP*0U@00ܪ -tt`0@0LpU2@@PP+ P4p0mMD` -LM0@S`pn P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 c$ @`DA ZA@ @ $ ( ` O $ (  p-L Ml`0P0@'0 $K 0 $0 9$ K 0B #1P PMpP. p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ !pP. -PL`M@ ` `   /0S 0S0S @0  00 , 00p(0p 80 4 P@ Lp p p p  `K 800c R8KY>PW񟗩 ` V񟗜\ `X 00 "" " V  R X V X 08.0004, `}@[0T. @0T* @(0V0 0 0  00 , A004 080 PL=@` DA JA0@0@0@0T * 00 E  < @`DA )A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh H p 0 H p p   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP dP 0 UPuX p=40UfOP  @0T*  0@8@` DA A0@0@hu0`0  `   $00(   0 S 8  b R8Kڎ<P00 0S )00 HKPp c  000  $00(   0S 8  b R8KZ<P00 0S )006 0 | dK@K 0dc000 X^0@S 8  b R8K,<0P00S00  00@0 =c KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S- d d d d d d d d d d d d d d d d d d d d d d d d D d p 00 ?00A `@0  (CXUl4pIZ C0  0A 0  00#0CSO L L L L L L L L L L L L L L L L L L L L L L L L L ` 00)  000p 40P]  H R000 0p 40Pħ"@ 0 ]a]0p00 0 40@U ᤧ k  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D D3[SpO0DsF `A MF`pN 40 U B GH0`VH0 `Pク ,`  `.4DH@D@ (Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X ll@-X=X ?X @4R44@T0@@ [0=X[aP 0@S*S0]S =X Z\@00  #0HS` p ` p p p p p p p p p p p p p p p p p p p p p p p ` p ` 2 0,0 0 4 vbZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 [0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[e`P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080 Z2[l0`P`@aZL0 0`S`Z Z P.l -LMtP+\aPP@pNPcUpG 0S ,K| ,A@B`(P  ((2N100@0 R0`V 0S 00S 00P2AP@`40( UD -L@P_@%Tp? #T U@` :P`T`T TU@ :P@T0e  m;8P@:p`p :P`DT*P@: s:P@DT* p-LM 0CP`CA)P @0T *00፤ TpX0 @`DA rA0@@0@`AdphS<0  -0LMpH`C P<1: S70  -LMPp]P`2 @eT: ạ@0S PgU * R 0S  0gSP:00 L]P 00 S0PgU(0304W  ] -LM` ( $ p @P (0R000 , , 00 R00RP@$,T 0S  b RD60P R 000SP@,!0 /R T0   b R0K%6000S0 /R T :R:R - L0SX +S -Q <0P0S$WX0SPP.$/ 0-L@L PMP0 00VP0  50 00` -L$M, 4 0 Pp@\Pp 0{SpW 0@0S S~ 0SX0X0W0SNT 0 S80 p 0Pj l< @P 0 S Rp{Q  8 @0bC<0}Q D $ ,QX L1< 0P` @}8 y @ uD @00@4 0, 8 X 4, @0T*0,00 `t0@` DA A0,@0@+0,o0{S| }SHy ,SX@u - L ? ? P.lT.X. -L,MH, \00 p4 L H  0S 0@S \ |<V T,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0>0 0 R^ D 0`XVL@Q D0@ 0J 0!RPU7 ,0S 6 R /XP0H, , 00CS D# |# T# & T# T# & ,4 0044 |6 Y/, 0@3,0 R,0 R @ ,0rN00 ~040 0,0 0-PaH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00P@> @48|$,,#0< <00, 0< S 0DS % % % % % % % % 44 4 c/ 0\/a,0 , 00, 000,,0 FP,00 3@  00 0@(hM, 0T F,0  ,0 R  : ,0M.B\ 00 2,  0 p00 0S B @KK <$ U,0 R X0Uc:cQuR$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` u0S00p000 PU  , ,0S,P |=xT.X.@@ <\\h(l W , p-LMP`PQP@ 0ST 0S`@0 0@h^L0 $ 0 0@ 0-L@F 0FPP$ 0h A  -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`XF  @0;` 000W YM0  0S;0 GV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p -LM`pF3/VPP` @0T00SV 0 S PTQ 0S 0 U @2 Tx2x2 0P@ T2U  H.T  829000 OP2P 0 PQ0@00Y @ @ Q0000 )F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 إP 00000 0 PP 0dLO^P\0P 0 d4 E@G`P. p-L M PK`pFFP@  V 0 /R 0(00 0p -LpMPK`@ePpkP@U WV 0Sp : S  S pp@Ip -SLM0@< /0TP < P  (H1  000 , 00PT080 4 4 :4@TpW7 `eW 80 0c S8Kڒ-@ @ᙘ/0080  cR8KPڀ-@  ቘ<4 zP 0SPU4,4`, ֙p -x0tp00lL @`0PP}60D02 @P70000Xt -LM0X pP `ጣ $ Q bP8 R 6000"L 0-LMPK $x0p\ 0d 0 P  }0 @ 0L , -L M$`K@  pTpP, (KP 0PS  @ ۅT0d0 ҅ ̅( R p0!h`0\ @0 0S \ 0S\D|H -L M$pK` P坅(KP@$  R 0S ᖄP ㇅7 hNUU  m(0! 8| -L M, KDX0K PPP 0S X0@ pT `0ŸS0``pS" @T$W0 0qX 0SB0S  z0S pB hPW00H0 U00 0S X 2 R0">0,K  PX`A00 R  0S AQP ,K ׄ(7 X 7 0,1!0  ,K㷄70 h 0 } 0< }9K,K 㔄lc,K ㍄T00 !HPP.X.hT/PTl`|| 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@H t| 0-LMPK@ *80@0S 0@S 0H -L M,K`PD p V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  Ѓ ȃ000!(@H| -LM pK` ᭃ@T P0S 0@  00CS0<0@T@T 0 H@T0" ㆃH -LM@K 8s00 \000i 0PT -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$PX\TH00 000S  0S$4 0S000` -LMP00좟000 SQr`0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? " 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  l 0  <l\40 `劁P0h;0l`0P@j 0`00@0000@00Za Q_MlhT/l8 -LM0` V 2 0S{ `VpKb뼠K  aPPhڸpKV`V 0@T 0S @T`VH ?V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H 00 0S0 0SS0000000 H?B` p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phdPX`l -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S(  T lK@ 5=V 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,)"0 SVt  V  PU 0S0 S t\h10}"x 0P@LDTr"l0[S (!T100l Kx` e" `" p0Z"V 0SlK~ lK@ W"{0l0Kx @VT0 SS 02f 0lK2a R4P x X+"9HlP.\EX.T. ( -8#0L` %^0?Sat t t t 2P Z0010S P 1 @T 0S @TDp1@PT 0 u PX@TX Z 001@T 0PU pUP XPU@TZ 00Q00p @T 40S 0S @T@T 0S S @TZ0H -p LP00 X R 0S R 0SRl㢫pH -L,,0@ S00 鐫 t0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00H tXpLP- RR  RRR00Q00Q <R 0S  R 0S H p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB |20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RKCp Vꄜ ؞ h $ \ H < X ȱ = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 KBP; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKnp P\P ʟ 0S  00   00X    20c RKEp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKlpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 0057P )K P 0@S " b RKp  00 R<4\n0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`~|q0FSGLAz@T *Xl (Q d9|X0A0EA0US2 " / AE'2`A2&  f'P@ 0 0S 0S <0S 0( @ 0, <0T `9D<pDL x|@(AE ''P@  P0R }R\ & 300T*X 0S0 0 0զU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S ꀭ X 8 X ` (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P ax000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T: -LM 0, !B0001 < 40 0 ٤408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K` @P`S UU( P\P 0P 0R0 P U<K U$ <  b R: @P<00c R1 @P8 0 08 @@0 `0 00C00,|DxT --hLM 00CS0< 00CS0$@@ QDP. p-LM@@`70DSp0P B    $ < (`8 , 0 4 p<408`400,P. p-LM0`%0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  uX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 AuaD\.p 0-0LPp@P0@0t -0@L MTP@ T J,\-0E,W- 0, 000 L e@TP0H , W 0 0x| -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 r wXPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄$ X x x x x x x x x  @  , P p  D  0 T h B^KPEpPE0K,0A+K0+0Bv`XP@p86B^K PE0PE0&)5p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%5pl"lGB^KPEPEl%0l"l:B^KPEPE<%`}0 P00{RPPU B^KPEPE0$4~KpGpG+0}0PPlh"lB^KPEPE0 c}0@p}B^KPEPElO"lB^KPEPE0$B^KPEPE +0w*+uB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDl"lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPEZ.`0P0p0"3B^KPEPE0)}P QuP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl!lgB^KPEPE "B^KPEPEo 0P   0P B^KPE@PE+ 0 )*@)*@u`0P l)* 0P B^KPE~0KKpPE,0L+A$)* ]P0/S)*B^KPE0PE 0B^KPEPE0 30 S Sh8`8  p S \Sd80#pd8 h Y`00`8 9DdH/\ PLo 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(L X #U` 00``` 00c R*@P000  V[U(K8P/ P(0PS  b R0@00S(x0₟P\P L0 R0P0 P0 `Dx -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `V00Dx p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0xDP. p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00p|Dx 0-8 P0@0L f @=00 -LM0@=C0 0 ∞] -LtM 0S00cS0P@$ T P0 0@TKLPx0: SH K 0S 0X S `0S X ,'P 0@@ꔬ0ᘬ 0-LpMP0@S|0lS`t0 TK  P|0: S\0 0 00ꄬ -LMp@:``OPP :-`PP%-P@ 0T\S T 00U0L0 R T?u-@r Dpꀬ P0-L@ P@(T 廝T0嶝 p-LtM@PHr08`KP0: S`0 0 0p 0-L@D' P(,0P0h+x -LM0S L " 0@QOK08"G/r00 K(h@*&#&a    @ 0@S P@1PSg@0S P@1PSXgX7 0P<&8 /(0$00,Pw'00  A6 ! P PP @0 @*0SAƟ@P0PP @ *|o&`'0@/SP@ P P60S0@6T  'q@$V&F(R& '0USqUe%5Q00>&0@ 0S 0PP PT5P` `$PP,00S"P@T $@@45p 0= -ZPK㱅P2: Sx 0`@S@` 0hDSk4$02 e0L0  T$P0``P 0SO 0S<@T 0,33 R$P PUY00 0S3  000%&P %&@ R  0X 0@T<- 0$U 0S YPs @$@$  $ 0 00 g$2kp00  P P 0m 0T1X1pSP00] 1SPCp@pTW&#\+P &0S 0S0S p!0SmKPKP!$2R! 2RTM+Pq spPppmp0 @=+P`@\<P IPG@0`   7L/\`@h.xp /|P.Hxt0 @ -TL$  @0 <0R4S0 h*%0;  -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1Y]P@. ,P,0 00S X00 4 0 0DS( @ ( @ 4 ` ` @ 1D R&0 R  @0S 0 @000 <00P4, ,0H 8 ,@ ,%,0@ L00S 00 40@ -,0LM@@@h -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2\P@) 0@S񟗙X X L X L L <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  D$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 =:,LCy@  0 ` ,DP.p@X.8 P0-L@ 0S PP0 R @P 0S| l l l l l [T 000%0S TT  -P`LpG&P@pP P00 Q @ -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  h$`V#0 R!0 P0@CTT WU@ bh0 P\ :0P$ @ p-LMl`PU \ @0 @Rڋ~ T Ә0 0PU 00p -(0LM@T @T -,@LM0 01hc P0-L@ (P 0R @T0b -LM/@P@r+(P0 0P0 -LM0P0@cSZ bSZ w `K 8 0pR R +  0R `V  $40"WĂ d,(0 ("4S q`Pq ;X8 0-L@ᅣPP0X P!- X 00Q0ڰ000Q0  Q -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$h x -H`0DpL0f@Pi00f&iP@鰬 p-PLM`0P l@h@P E'0p 0Q0-@PLU0 00hЂ0 p-LM0`S0 00@ 0PSPf0P00p p-LM<`P@1S@$Tp'Ppx 0-LM@4P,,P$ 0 0< -PLNMP! p0PH1 `AT P$UHR?K olQ?K-KAQH1`PH TP@<`0S 1<SP$U(x X. 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 09x -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`k @K$ kP0 _V 0000`QR n -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  ~0  goU<PP@ 2 V 21   N<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S O$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( E%jl@0* P<%|jLT@0@S 00$T000갬جx0  $ 0-LM@P KZ0 S  P00 Q0 Sp 0 0-L@PP 0R8 -LDM耟0QP`@$0 P$0 S $j0pjUP!P0dP@UdpK  $P40ٔp 0e9, -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |e$P X pX Y X R0!S@ R0]S@ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  "P``Fv1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P" 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh "Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?$00P000:S00P 0T HD0L0-SX^U0 00  ,GDP.` 0-LP0 S@5 0  0S0h}0S 0\@ 'Se U 0S C  0  00SU0<0h\4XPUP0l5 -LMh4 4  , 00 @a4q8 cPPP@cTX` U`V`P40cbp0S0W<0 ^ ~,@\8   00@T pWP8o\, 4 0, T < 0d.8@P. -QLM@ XOPp `PP*PU e*0S GO0S0@e PdUp:0h0 -L`p PPZ =0#S90@P2@ -LM @,rP 00  rP00 p-@LMTP` ᨽTP pU eP0  ⣐P00⾐0[` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ c 0 SP/R/00040 Ae @0 bRP c8 R00 4+e0 cR@P ,c,  P0 S/R/000.S0S/S  8 P.0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` dP0 Ulp BcT X0T L0h鰏P劏0P@@|P. -LM@d|0     V00 K 0  P 0P/0000 `W -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /P`dU VO V> 0/ c 0 0c RPBNK ` P@Db@D` aP0`(K P/R P PP X@,0 S ,N0S 0.S0.S U0u/S U0.Sc`0/S 9D -LM@p|0`ᫎ00 0,0< (p0P UP@20 P00S 0`` S`` og opmtW@,嵎 -PLM`lp@82 T& V`0 0,0$ (` p ` P oꘀ[Dx0\<00@0P oP PP PPPPT -pPLM`l@*$ T P (0S0W< 00$  `  bo\c YoP P PPpPPPt -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@P៍kpl☍@ 0- 0PSL@FP qsPP0 , 0,屍 0- 0PSL@ +P Vs 0P 0 P0 0-0L@P  0S0 0  00 0,~ 0- L @ 0  0 0S[ :Q0a0 /Ib0 P0    0h ꈴ$0 0  -@L P 0 Sw p   0:0@ #  = S , @0  d0d@0 0 90   0p``V  Pp``V@ 90 000S@ ;0 0W$ 0  _000@$00@ -LM @   0S9 / &:0  P س0S0 0S0:00;0ij0 00$ 0:p  鰳$00  -LMP `p* V# @T T@ _0 `d d0V0 pX f0;p @T |x -P Lp7 WpG2 @Tdp) @T!  8JP @0a@T@` _pW00 V dP  X@00 -LM @T 0S  0C 0 P 0S D 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S \ p-LM @`A v" + 0`KS" PK  ㋇P P0S   ;0啲0 $0p  ꋲ$0 0\  R 0 B `0p   xt P0-L@P ` 0h0 -LMP `pZ XS@T 0PI T@ ^0 0 d0 `dpV&p" VQ@ \\@`T`d  Pp@`TV  i^ 0 0f0 0S 0 ;0 00$ 0X  --LM 2 -p-PQ LP@4MH`KH 0 0  @p --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS% & &  & & & & & & % % & % % & % & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & @TYT A0DS 0@%0DSSk% % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % @% 0! % % % % 0! % % % % % 0! ,! % % d% % 0! % % 0! 0 <0<00 <0 d0D,pK< S/! ," ," ," ," ! ," ," ," ," ," $ $ ," ," ," ," ! ," ," $ Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< c]08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C9 0-0@ LP0 SlPl0  R0S RR 010000 D -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P -LPP`p 0S0@0 p0T d0T 0P <T2P^@X -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @D p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPyD -LML0@S 80  Q 0P -LM$`Kp@H P 0b -(L P0 @`DA ZA@,@ 0 4 ,0@ @dDA HA@,@ 4 0  p -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 VPp Z 000F@0@߂ P0P0 :00 0p0 p@Ȃ 0p P{  0 UD\ -LMq@⩂Q@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA ♂A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `( |  w10 0 $ ( ⏂D;P00 ;`4 p-LMP`@@P`p -LMl@ll P 0S0S $l0 00 0 0L 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK }PK 0t `PE\X K0P <@ 0 0bDD@- 000D0 -@0LM@ 㛁  @      -4404 LM,@0D 0-0L R@0x SP 0c0SXPZ0S8 T0S$ NP0$P 0S $0<P 0S -LMPR0@SD2Q00@A2p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Ep`0T0 W P@0T*0p0@1@` DA A000 000P0 pP P0`p V P 0P`)Q``(Q``P H0`PL0Q``,0 RD p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA ⅀A000 000P00P 0 P. -0Q0L0 7(0 0 00S  0S R   -PpL@T`01@T 1?A1cX0P`+ @ Tm6QU 0   @ T'0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5TP0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0T@~000 P@ 00 1S00C0PdP 00 0000CS 0 0P0 000CS0> p-LM0P80`P@ 0T S0 0 R@0P@fDA %01p hI -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< o$(\  P 00DS `[ [ [ [ \ \ T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P R `0-0L@P^$,@0h'S^$!? -LP`p@ T<] ,] @] x] ] ^ 4^ D^ ^ ^ ^ ^ W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S` t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ ` t_ t_ t_ (a @a Xa t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ ` a t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ t_ pa t_ a p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G y p 0 S P 00P @0S`x@PP200P @0S`x@PP00 P0 00000SP p-LM`P@ex phkL p-LM@`P0 SXd `d `d 4d 4d c c hd |d d d d 0S Tdp@P0SVU@ PEP0TVU S 0-L0MDPK@ B 0 P8e (e (e De e d d e ,f  q q ! -PLM@ 0T0   R0 0Q [R P@-0S00 0\00 Q\0[S 0S0 [S ]SQ -LM@P0 0S00 -LM@P  0S 0=S   -1L M p< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 p0@` DA pA@,@ 0 4  pL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Q0<0  0 REX/ -LM@0 $P 0 P -LM@ {P hP -LM@@P:꼅  l l l T l l l l l l l p 0<00<00 b0 <00 <00S REyA0T <00< <040 0<0\X/` p-LtMPy@P 0 t ԇ  , T p ̈ BPtV00XpXop@ 42 p0<01@ "@`@0<0p0<0qyupqp0<00<0D!0<0дUpQQp<:0 ! P 0Ӫ0p p0  0 S0`P-0@/SOPKtP0: S`pL|o000<0qD0 b< @0<0k`.\X/d.H` -LM@@P-\ Њ Ċ Њ Њ Њ Њ Њ Њ Ԋ @P000h錩t4old0 hh<@P o00h`.H -LM` pC0 :0W0 PU 0SPU 0SU 0S  n@  0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@T0Sd 0  h -LMpP%0`KW1S} @1S\ -LM Q#pt`a0S  @T 0 S C@t 1 R Q 0T2 0T/ 0T! :PN N LHt @ XQ ;A 0  0 0  R X0 Q\@X# TK} \ -|XL0@ SL ,  h t 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iPX  h p7 R cQsQ CQ  P  700BPX h p 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @SB   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 000_dȽLLo<h\̽g p-|0LM@`@P|\\0P P0D D0< <0@#phȽĽ P0 0 .PP h p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c p> 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT- $ $ $ $  $ $  ܚ $ $ ܚ $ $ $ $ $ $ $ $ $ $ $ $ pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c= 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l =0 0d c 00dR0c00P@$h@0S\0PpH0P0  c=0  A P\Ƚx/Ľ -LMPP`0  @P0 04? R 0LyS{L X   H              p        |                       L  `  $   `      D   h    $   X   8     ̩  @    D  L  P   |     ܬ -0S= R 0R0B00\=! R  04=" M  mP 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0 , a0PPS 0 ؋P P 0S  0R B>@Q0 0cc i  p<00@Q@@@pp` <83i @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P㭬PGUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P@;0 0P 0000AA 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000h ̽t/ |/Dн<T.l8x;q00  R 0P0QP HX@ 000 59  0 0 0 00P'9 Pb 0P0 P00S@K -LP0Lp`tS񟗀괳 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ H X @ @ @ @ @ @  @ @ @  @ @ @ @ @ @ @ @ @ @  @ @ @ @ @ @ @ @ 4 @ @ @ @ @ @ @ @ @ @ @ @ @ 4 @ @  @ @ @ @ @ @ 4 @ @ @  @ @ 4 @ @ @ @ @ @ @ @ @ @ @ 4 @ @ L @ @ @ @ | R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%긵p/< p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`Ƚ-n$0 Q 0t7н[P(P)P{P]P}P 0-4@4P0L O70 0 0鸵XX, ,000 0 87긵XX p-\`LM@cPc 70 0 p 0-@P L7 0 00h 0- P@Ld0hc -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0c0 c _8 [8 0 0bd 0C0\0T0T P0\/d.H8,40@<PTXL p-QLM@PpR `0 Q 0Q 0  g6 000ppD`  0S0 cQ6 00 0긵 p-LM@`@P 0S d ;6 0 e0b 0p鸵p@-P @Q` L| T  0P 0 QL|VT @pppPZ긵E-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 P긵<@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q 긵<G-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R 긵<A-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEu踵<0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0踵<E-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dt踵< Q-LP@,0 Q()0P `V Ttp@N6 0P0C 0 T4 ,0P匩 -PLM @`; 00CQU5 0U@@A^S`00 PpXƥ`P@6 0P0C 0 4 00TU (PX -l0LM` `0@ 5T 2404 00 w wL@H0,P 0-PT0P0L@@P8P 00` r00c00%TL@ 0-pPL0 0S0R@@0 P0 0B0@ T긵< -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`긵< -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S v000u@p 0 00S  R+@S<@P0S 0 1v@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWur<0,P p-LM`@PT# 0dR 0@P0@pjv0S0C0 bvt 0S00Xv0S00<0 P bPHv0S00,0 -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,03,0 {0S @TYP p300(Q 0ppx/ @ T. -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @ yPs Ve `FVV80S940qv3`@M,03,0!0zP00SP 1T0 S/R  P4qy|1|!x1l1l!@@4@Pvy1UpU 4@ly0P PU48 1v4?y540P``pyx0 @ x00qQk D0@@ P[  00頭x/@ T.  -L$MK0 K @KK @]xP@ ux6 0 RPP -T0LM @R 8 TT^htt@@$t@0P00 48 -Ltht -LM,@0(S]0000  -LMp@Pb`p !hp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K&P w0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S   7<gfff -0L `~: -L7! -GML M<2 88@Pp`, $"hp fPp` iPp` 1 @bTQou1IKaAA⮦Pp4: S Tc;qBKHH+W P: L<10Y/S/00@Tt p/ᓉP`` 0SP :0/S$ V:0/S `FV:0/S`f10 SV0@T4 P  g/P40`FV:0/S 94<78 -LjM M(kKH0 H`p,0 ~GP;2Q 2<P2 R2 RV5P,0 S ,Y0S  |l6: S" KA AJGP L6: S ҇P $T6: S Y 1MK@D @DẇPnVuKEPKPaV;P KA AụP]NK@D @DL~F DA P@A1( K ! Q@10 `P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`A>;PRL 89l4<84<L\pM \:0:0 -0L$M@  H0 < !H@PPD@ <_@-!Pp BhPb0S| t -@T ]WP @@劆@P@@@ }a@D0SFP=V00LP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , /P@P @LN<ĆP0<E$@@$0-S @8L0S @0H@@ 0 R@"@0;0<lH0\0*P@q @H D ^@z,0lMb4 -LM0 4 参P= ,K $p# ,00#4 |P ,K p ,0 #4 TT|弅|@0xx x0Ihᯅ@40(@4,8 ,06  LltTlx 0-,@,PL $ 㹥: -LM@*P 0? 0-@L)PU '0S?000 -LM0@S h**p@-0PS00p-\@@T \ P`r00 P 0 R0ATap< -LM0@SK P ) 00 -LM@08SK  "p 00  `?d 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP eD@H -LI9 0-XPL0S S 0@ S0 00H@ -LOM\0X,0 0P S ,0 S ,,OKKK`VT UP W?K+yPW?K \!QH1SD1 L1@_0P S Tb818S <3 89H l -Lp`@T TT#6P0S! P T0  0S T *@T TT *8H -Lp`PU U @0S P U0 0 00b0bPU U `8H -L MP`p@T T T TT T$KPKP@ (KFP; 0D S 8 $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S ( Y*PppýR*PppK*F*pPp@*PppӤ9*pH p-LM^`P0S p.T@0S 0S uP0S H p-LM``@0S pP0S {@0S tH 0-@LP|UTp0 \0@ R0S<6PP DH(T -@L8Mp` M\l2` N\X2@ L"ibp5&LKTpK`H P K0T L` )P@P00P0 &PP7 P +0H P0 T @@)P |<<K *P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \wC0[SD[0 CR 0R P 00xSlP0 pW@X D00CS00  ä0 S(0Hp:l -0L : p-0LAM @P` ap sP` /0 @bTQ!P a+PpGOKPP V:~.PP<947 -0L ˡ: -LMnQ@0,T  hf}00000 0 000  -LM0p (0 PP@/UoKK/PKU  S?K\ $0SKK,L1 H1 D1 @1 <1 81 41 01 *,K-L0* R;(0 S (奡9 -LaMb>K0C 0Cp( @ᮟPv$6: Sg  S*PW(0 S (y/PBnK`F`F|!|1A*0S*@aDPP$[NK@D@D  P5;2W>C R0 RW W ;庀|0S N*@PPW d妀BnK`F`F+5Q0)0KW 9tedA 2@l -LM@KX C0s aaaT0:at -SL Mp@PH|00!1/P`!  ?Vx 0|0S@ 0P P* (W@|?00 \@a` X0Px P* W@|?00H  LH\ -LM@ K K 0K @@8'P -LM8 < @ P`pm 4KP@h 4 0R SB k$P`Z 4 (40@##P0PS ,KL ~PP 0 P@ U10  iPP 00S0 KP 0 R ;;S SPP 8P GPP 0< @0T ;PPV @$hH t| -ML M0$ , p( P`:F{?000!c1 ,0S ,ϟAP@ PP 0  9P #{0S08{0S !07BKHH F\'0@COfPP- o0@S" 0S 0S+ 00LH \ 0$ 0:z?000, 0e$9h0 T -L`S$Mp0K,  Qq00  Rp0+S-S-S +S 0+S-S QLq430  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/^z "00Z Uz 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PU*z"00 pL1  0P81@@K1`E% 80 ,,8 2p0@0KX0 4 W$0K J40K5 B"0@Z$$ `JPU *0 K0 P00KU:@ K00K ,@ }V`-V`<2x;2 -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sy"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0 0d|8^,Q@00 K00cPE: UcU pP/PxtgfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  R<|2~ -LMp`#0P@ r _\P \0 P@2 -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 g? -L Mp`@P@ <K4K0H0S񟗦 (  H  h    X    8  | 4 X ! ! H" # $ $ |% h& ' l( ( ) * * H+ + \, , - 0. . h/ P0 1                                                            (  H  h    X    8  | 4 X ! ! H" # $ $ |% h& ' l( ( ) * * H+ + \, , - 0. . h/ P0 1 8D3#cX Q0@ 0 KD0  DK5P0S s!000PKp Hs!00CP3L#cX Q0@ 0 KD0  DKP0S s!00 Hs!002cX" 00D0 ?0PKQ@  DKP0S s!00h kHs!00ŸH2D"cX 0QD0 @ 0 KH0S DKPfs"00bs"0020K00!1cX! 0QD0 @ >0PKA0S DKPpBs"00l>s"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLs"00Hs"00D00K000 0cX @ 0Q@D0 00K DK\P,r"00(r"00$G: ( 08<@TX\p<2@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R r!00 Gr!000_00KP0 cX 0QD0 @ O0 KA0S DKP01 R r!00l mGr!00x1100KQ1!cX 0QD0 @ kO0 KA0S DKP1 R ^r!00 ?GUr!000200KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R 0r!00Z G'r!00Q200KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R r!00, Fq!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R q!00 Fq!002y00KR2"cX 0QD0 @ 0 K0S DKPq"00q"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R q!00 cFyq!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R Uq!00 6FLq"00v000KP0 cX 0QD0 @ 0 K@0S DKPY0 R 'q!00QL Fq!00HD000Kp <28@?G?PJX @@$8XU*P*UP0Pb+@7X H Hb a@@7&41D XrXP P !X'8,Ƞ HXAUX @@ L *P*UP0Pb  @L 8#8HT*@*T@0pbV#3T< 8 @@K00`K0|T*T"4 0 0 0sH0 @PWU:Up@ 4Qe @ 8p < @0KP]HPH Pe@ 65L725|$8 T0 DP P P TPH%X @'8XTP l@ *@*XI20bPPPT 8#8XU*P@*U@2P0Pb 8#&Ƞ ( Ȍ"!Ȭ\@ 00^00S 0^4@T H D@@`Q p6247r<0 8p @PK`4`T#3wr 66+*'* p-PLMP 0S 1. @ p0 CR 0S/S- R0/S  BR0/SR  BR0/S 0e` V*p@ 700d@?008 /P0.(@00 BR0/S 1 xB 02 #4xB 024=> 0&v@-O@d4xB 02d @-M0Ѝ@4=> 0Q k9 -L MQ@0K00#  0 d0T0P00S00#0 -LM K K![P -LM K K!OP -L 0KM#M( -@@L0MP0  0 L0  00S00 K( K P(&d00 -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  岇90S 00Q -0S 0  0\\00 PX X X X Y Y Y Y $Y ,Y 4Y KC/JK X1 0Q ,Q J _?K A xA D0 bKd1 t DQ c 0S Sp9l QQ *vv * -LMP -LMl"  2 ,  " !H p^0P2 0 PP 0Sx P P 0S ]$481!`)!\0`X0 `{0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ   51  /1 OK @D'1 ~P-?(K R!  ~0S 1?(K R2S "RK K \Z0 40  MK0iPMK@ P+ 1MK6 P[4  b [0S [& L* 41`[LD 0 h[0#S [ ߹ R@]K 0@,"|@B"2@@&P 0S"2P9 l/A: :d8Ht  -L,Mp`@ KD0K< 8 @ 4 0 , ( $ PDP@  0`4PP @TD哦D另 -LMp@P `p08K8 (P , 4` p7K0 8K (0S (9 -MLM Z,   4 `a V $ 0P@Q ,X1X1 - &Pp' B^KPEPE0$!O@~`~V INK@D@DP 4: S  R 0 0 ,0S ,QPt $R 0R\ 4 L 8孪`92H 4P\t -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ 9 -LEM@pKK, 4! bK081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S RPPUb ?? UP[|,0 S t,J~0S @S 1P K?K,`0S @S K?K|,0SP @S  4.P`8~ 81S  K?Kd, 4t8 0SP @S 8~ 81S  K?KL, 4\8 9<x; -LM8KKPp <, PP `P@ ,0 S ,}P/K%>KH D LB @B KH L @B 0S I "00V:`P@ `8%0==0` 0 @ a0AS" @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖 $ $ $ IPI< @\  @ R  @0<@0 X V:H   ₑ H P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H ]P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 BP@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 G 0@'͌@ G <@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!!E* --LM p-P0LM@`P8 4ST   hk:y - 0p@L` GPP0S @TP1@ -L 0S 0-0@SPL(( 00 00H L  0-0PS@LPP PP0P -LM0`Sp (KmPP (QC 0#S@ S> 0 S RA(  #P0e(0 (P@} ( (0PP2P@ P0 S S0 S S #P0P0,K /,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@ >PP 000  b*F0@N%F0@00P0#P 0V L H 0 -L>0S \\*;;* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @  -p`LFPP ዐP @P აP 0S0S  0-@P@0LS00z$ 0000ᩓH   -LM(@0S0 00 -LM0St (K Q@`Tg ( 0 S RL0L(  S *(0#` @Rq PU`@0S0T`ÅᾔPP `0 S S0 S S ᯔP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\傔PP 00PP@Ņ,,ےP X H @-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L<k*AϠg* -PLM@` RB00P,K0K 0, ( PPp VT000Pp  0 PP|p  ᗪ B0@B@* 0-! L0TT!P@BT @@ T 0A0 0d\ -LMp`P@匀T ;0S0d0 @ȥX00U@ <:%("A3`d -LM@(@T0 @`3   B00! RA R0000000000000000Z* * --LM -L@`plA`0 XXP哟T  8]8 $0W᪟  傟e:y,G 0-LMP@ 00"0 ?0-1pQ LR@` 0S ?P @@ ᘩZ0@< 剭0v000S@A ?0-1pQ LR@` 0S P @@ dZ0@< U0 000S@A 0-LM 0xr.0l@hPTX0 RP 0 PP@ 0 p-LM@hP`\ 0 @4zTp`0@ R 0-@LP 00c,@r.0 ] 0h -rSLM"0@P` :g@p 0P \@0pW@ p-LM@hP`,M \0 @4"Tp`0@ Rm 0-@LP 00 ,@r.0  0h -rSLM"0@P` :@p 0P @0p? p-LM\@0PSP`PP 4@0PPPpPp H  0-LP(P0@P @0 p-LMDP0@S8`p$0P@@@ -@LMh -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KB\d QR dPPBDBPP XK X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,cUT@PPh@T P@K0h LK@{Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @ϙPULD0LP 0H3LK2 P@K@P`ᮌP: h0S@- h@ )R ɌP  T P@ 00CS0 0Ӥ0 P p 0+S:P P P ]P TKA\ d0@RSA00Vh PDP \QP!00 DQ0SG d0S7 ,0d LKP@K@ȘPPP LLL/P0T@KPT AAAPP d@T XKX 0SpR`@@K` `0ᒪH0 P9" $ A4 ]]**IϠ$ * -LMğ !  \ ,    !4@R@ `h4@K K 0  K K,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  D`PP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00^=L0@X XKK, PGK EK AK =K 9K 5K 1K -K )K %V0S :=x!,>l0S3 0CS/=u@41 ,0S 4,a KOp=0S   WK{P7KXKL00L0 60[S0X K60K#:<00Hp`< 09P <x;8@ x 00 -L0Mp0P 0 `@ LKL@KD00D0 Q Q <00 0 S 8 'a, eQ9t,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd*KK **%*%oo* *R0S 0S0S0  R00 -MLM00  0PP `^@T T 0T,S 0S ,P   0PU  0PP  0PPPd  p-LMP0 S0 `@0 P P0Sa0X S0L@0Sp00P M J44  -L M̀0`Sp(` +P@# P\  0үP x$ K10P(K,{P ( 80  $4 l 4L@-0S@ @ 0 0 0 4 -LMha ^( @Pp$ < 0傯PD ( K100P= (P8U00T00S*0U0T00SW ᶀP` "P 0 $@J$ 02P $ 03$Kz l  --L 0-<0@ PL,,ˊT 喙 0hy: 0-0L@P 0SP0 CR 0P0 00R Pk, 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``zfp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' ,p"00@40S\00pgS \,00E0XSxS@`P< -PL4MPL p` 0 S@P X 0 S @P L0@KEP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\)<{} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u< -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h mrP & P0S1*8  `rP+ 8000< -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi qP0S PP PP  000   PP0S &0PS< 4 -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , pP0 R 0S4px0   0 R PX 00p , 00  RP <x;8 p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4 < p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00SiLWTWTWTWXXXXXWWxXXXXXXXXX` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S   -LM P p0 0@W` 1R V[@0S P0 Q0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ P@ 0^?>1  ^0C0@dP@ 0@04p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p~0 00R0ePU@  P g i& 0S  Pi- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0BP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<Ph eE -LuMp0 (, 1 P`_ PPQ 0@p1 0$P}K@{K 0oK. ̡ ȑ q uKU#P! 1@p@P oK 00 ,0S ,jD 0ɳ10SD0 <嶳 0孳987:P07 -LbMȠ0JK(0 jp! @)@Kp~Z_K`Pl0 \ TjKjK11 P 0L(0 S (D97 -$0L!00  -LMp 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S !,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@aP77777 7t7 -LM 0c -L M@@Y -L M@@O*tt**PP***33* P-L h/00 -PL`0\p \=|# 0 0  R3 @  h P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00Sr0 0/\@- \ V t0j T ڊ>j1!W pG T S(00 0S @S@S@@@0j!T@QQ10  00S V؁P@ ᐃh P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ :dP`a\ h000X0 WpGk 0002XpGH<Xd0x;D -LM0  xl: -L M@ 0@x\:RR*ZZ* -QLM  0K  0   0-LP@Gp PKp U T 0\ hpP UZlLo{{P*L* -LM@`p(PP< 0@0@@@@@@@@@0$` $0 P tP@5 mP, 03`P1ZY(ʐ \P ` 03$0 Y  < P$00$0e  `0S $ )@TD0 003$  3S03Z`` 0SV,0`@,@ ,@ 00|0 0 0  -LM( Dp$ ` V/UPP P P:@ F(@00 00 0S p-LMP`P 3@S0S0@B3S=P(P#5$0 #10#0V@@T(0p#B0`KP`$05` -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` P3ա 03š0 #0$0@P$0 :.$0P3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P  0@@$0 @2 ui @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8PJ3 03 PU 0  PU:$000# 0B8S 3S  $0H 'P3ԡ 03ġ0 #0 0 T R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h ϶Pp P66000  -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z :PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DTܿ0{ 40$0:$0?00puP  W $0 P T 0phTP0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03`00 <0 |@X400420#4 0 BH  L ,0S V4 #A400T -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`Pp` p b 0 0pP 00 -0LRP@` V P  0X @T` 0@T000(00巾PpPppꅾ -LM$0HPPp`=P@ 0 $ 0I00D @0(`0 -PLM@ @UT 0-00L@ :0S00b?0 00<0_PP 0S P, R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL00UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@gp  PP -P@0$pSL$0  0` 嬽 媽0S᤽h=0S 9 -LpMp㶳p`  KPP0: S 0 0 p# 87P@ (0 0P (PP 0 PުD0@000$P `p$PPP.7 O -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ Tѽ4 , d/ʽ  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPA?TPP\5 `@L  0%0DPc`H0S[`@0\ PP׾p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ώP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|< -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g< -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0h<G-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4 ᥹ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$tqoTPPYe$c $d@L  0'0DP^dH0SVCA$?d@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|< -LMp, 00 Q,(P4 0 8 0 Y50000AϠ0 P0P 4 < 0Y04 `_<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8塴0 4圴0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X< -LMp, 00 Q4(P4 0 8 0 YM00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< +P ,Y 0 8崳0 4寳0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0Y<G-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE117* -4L|MHK0 @K0PԤ1e/ ᐳ@ \ \ R *0S0\  \ 0|S :S 00hh$@``$@X: @PX0D0L K@X0pL0<P K @(0P0T K @00T0X K@,0X0@\ K40P\d K@p00, d0h K@80}p408 h0l K@<0sp6[>dp K@4kp7[0Ht K@4cp7[0,x K@4[p7[0| K@4Sp|00 K@P0Kp00 K@T0Cp0: K@0;p0,K: 0m 0Km 4Km. 0 XRxR @@00 :S0-LP 0:S0@0h@0- 0 Sn@S -LM K"ϚvtOO**$$* -LM0`=S`pPᏭ,KP@; U郭 P:0P00@S=S 0S=Sg! P,@\P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q⍨P@ 0 0S Ϋ0 @0@, 0p" p-L@`M@PKyP 0! 0S0 pp 0-L M@ H0P (0 $ 00K K(0@  0  ,P ^P 0鰙: BBG*A``A*##=* 0-Lъ@@-@0S  S 0Sd@(*(*Q0 =L 09L$hh*$%%* -LM< 08 rSwS@T 00  ㆧ, ,0SZ 4K>PTpPH P < 0rS <0ѕ@4D,0@, P,00,  4忕@00@T 0+@T< 0rS 0"4P 80M㩛 40@4T 40,e,a" -LM☀@`T 0S `@TT $pK pP]0S V00003u$" -0-LMP0 S@   R1 00 cQ  R!,0 , 0S "09p -0-LMP0 S@   R1 00 cQ  R!  0S "09 -0-LMP0 S@   R1 00 cQ  R! 0S L"09 -0L 崷p -BMLMh#0P,0 0L4  0S 00,3 ,0S ,#"/ePL$H$ K˩2P@@000 cBK J JH eMK@DPpP 0Sr`0CK0A S A P2D4 H2@ K0C0C0  A  ;100C=S񟗗0 S  1S!00 c0؏ pC0L4 dꉪPnL$R 060S3/90 p@-@^  0 S SS00N0 --L i: 0-LM@Pe0S 0g0S e0S  e\ 0 @@Pl -LM@`PeP pW哦W0S `U @YT :0S #000@0PTP:@T TW̤PP  㖩 0: -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`YT < h000 Z phYy:,GP 0000ӑ8 p-LM(0`S/ F   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ uv0 0 -L s* -2MLM#0@,0 ]0/S  P BKAA + cp Y W3*WY 0P/S00@83 ,0S $,/ cP<P"P@aTnK`F`F l0Z0pd  ئ 0 S/R  Rm/0 0 x2(K RW\cP LcP@ Y 0C/0h@+@Y!PBKAAݾP@L<: S< S0< ?nK`F`F!ݥPP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +Y Pp* +cp?00^ 0@C/Z0@h>00SZ I, D\+b>00S8 B>K0C0C+< b!90 T p-Q00P00LMSP@`P 0s p&p[P@`;00p 0S S5* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0ꁍP %T 0S 0S0 0C` 8,0 S |,ccP 8P@pzT|DL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L LL L L L L XXXXXXXXXXL L L L L L L L L L l L  L L L L d L L p L L L L L L L L < L L  L L L L L L L  p      L  L  t   L   ( L L < L x iz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 ʲP MTZ  @ T *000噌P d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `\P T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 2P XZ @&43@4 0qL9  00S 0Z0C0   0S P 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSa00DDDDDDD\\||||||||||||<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXo"P  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SF  , 8 8 @00CS0000?Z  /@xeTET& 3NK0d@3K2s =K43@ 4C  43 43 K83083 43@84# 4# @x3KXx3.KXgP    9 S9UP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o9<8 @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ 5000zP`dp@V % 0 f0 0  f -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K &0KP@@K 貊<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N@"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I< -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 ֌@K !@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S }p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `< -LM0 @0pP `冀GPP @ በ00@P0  ӜPP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0aP0000G% 0-P@LT a DA0DSR0D@TP0 \(\P.T.Q0( -EMLM@H$ 0r/, d'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l 8PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l 8Pp\DDPV `V)* :` VX !*:`V H*9`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$HtD4@ cTH*[D4 0D$ YYX^ X Y^ X P k@@ c@t X`@t0%<H$G Y[ XY d^`` D|?PC3 WX^. `P! D4 0b3 Rd%D "d %o*3TP:hQh fdT4  T4 Q`D40D4 D4 0D400D4 <K 㔞<0S80S40s@2 D4%WG9YDl*?P%D4H$D 0 l 7PpDdPdd ``QD4 "0 ,2P^D45p#04P 5wz D巟pCNK@D@D 0^7Pp;Pdd សD4 cPdp `d OZD$pl$ 0D4 P1PP*CNK@D<@D 007PpPd$ d$ D4P0P jD4 00D4 cD4 cP`p ZD$p0D4 L0 D4< 0M,00H4 D400D4 OY9#,t$l#@#u(8#p$ 0-0L@r/tWP80s 0  0S 00 -L Mr/0P.k8p X X0c. 0YP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn ,0[S6 `S@ 0fS+ "bS @TV0S 㗙P Ƞ 0/P 0L` ὙySX`{ ?Y,0[q0@T t1  0 D0S:R .R 0P.S  <P,Yh!hh1H @0 p@@81  :XPz0P.Sl  <Pp,X < 00 @p@0 0x@v+h0K ^/PP'\0 ]/00c0[#<t$x(@## -BMLM3@0r/, 8 V7p XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn 2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,s~P< Ƞ@ <4-PP&@$< 02Pp Q<堘  ᵂ!0X0P 1 8$0  0 0 <傘ySX p  b0 X@tP. K`g0 , ![P@p PPUZ.0K gWpt00 0  0 @ [\`/00L00SS (  h9tx(@#  0-8P@0LS((C?0@0t?9H 9 0-,PLP 0@T 0S@99 -L M0r/븢4 0S ,K >P@ ,0 S R@0@,  S*h G,0`` @#R #WWP`,@PP r` :P], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`\@PP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4+@PP @, :Pn4 0 ,  P H0 DDu>P W9t$ x(#@##p$H  -pL` 3P@ 0SA;P PP 9;P 0S t0 -pL `P P@ 0S 0S 0P# -鬁L0M 0嘡0 0` px1Z>*p?P@P7 P p90 S S0 S S ?P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4U?P@ P4VP $0W`4#@##"8# p$ -L(Mp젟0 S( P^;P 0@`8PK P@YP00,XΞ    t@@0p!lL0\S@0 !$ 0^A( 9= =-L,@,,,G-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ,@,,,}p+m- -LM`0(K\p@P.  _($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ 8s 9 -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ oPᯕ@a 01S  9(9@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:u p-@L$MaP2 ` 0( TX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S   m9= -BMLMr0D`K@P ,0 宓02S0$S aS@ l,0 S \, @0$S2P 0KY @ P TKDAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 ASTK ႔ tK @TK  T:m9T9,=(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:000004E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` a4H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !ZX9 -LM@t@ğ0 8`, 倏 .P 00 0S$S 00R5:0PK c c ] K P  F(>.=VUUU$I >.00@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ oԌ @Jy?Z@p Ȍ n fpP -L 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,99. 0-PL@U !", 1#80!"$ 11PX 0h}0 -LDM@@ hKN p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆU*#Q*# -LqL0`SK @0 T P0S1 0@T 0R 000 00 @0S$0PP 0P 00S$ 0R @0S$ߊ$ۊ9 Q-L@ 0Q`Q p 0R /0勊0 0 0R9P  0R0Q 0-L P@ T @ T0  R 00d0R0S 000 告P@ 0 p-LMD`0@S$ 0PS$pkh9 -LM`0PSp"P@   ⶈ0ST000$GX0S 0SQ$:$69O*Π0K* -LM0p@ LP ੉00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'4thtttxttttDttttt4t0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 n0 SP:00,>9 -LMrt0p Rd0`V @@TJQ 0PES@TZ`xVx< 0-LtPM@KT 0K 0 %  @@Xp 0 S 00 0@0@9 p-0LTMP`XK <@KhK0 0h0 K0XK< K0@0 dK`0 \0 d0 3NAHx9..0 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PPCP_00 0@T0@Tlpk0@Pለ0SHp0TSCP00t>::+D/U/ -)MLP|M0pU K,0 $ P 0:S /S . CP PU  0:S0/S XhV G@D@@ T*BNK@D@D+B+8+8.BPP 4Pvyp@+ )K(JdJ'  *KݘP :K4S! K *K $(P2U ,`^ ^\K\P2P :KPP K0P0P@@T00<"  %# K *K0 K$ja0Qy T PXy @ T`@ T 0 0@Q_ T@T^ؕP` 0^- S@P0L00 SGT@ Tx 0@ T0 T5Q@]PX/ `0@T`P@T"^- KQ  0S 0@T @T^- KP 0S0@T @0LT 1 R@@@T4(K R K0j c@ KT$00 :K4@TXʈX KQPڠ3(K R4 @2T00 S00 X2> P 0SP @ß2D0  R P,0 S ,!1tPPP nP0\ S0 S3K0(AA 0LP2(K Rp" 0 02Sn-K( B B@0@T00Z,2( K0@T{KNPN 1@ T 1(K@T3K0(NN1 R @T1Sڄ1( K0T p \3KmK(N(`FN`F Q :K 0 K@$T0P Q0nK0(A^ A0 0nK^ 00(A :V^ ZtPU/@PTr P09/LoHq+[[//T0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ.*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ ?P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \>d h0^@ `>@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  du\@P0` ^!@d T //Q -@LMWhT꬝ 0- LⷁP@< P0S=P2 PP%^@00 , =0h&l P 0:S H P 0 ,=00h0t>. -@LMh꬝ -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  At>Q": p- p-LM``@PT T0S < 00 BU(0(0(0(0p00q객m: -LM@  -LM(@, 0P h鴝p> 괝H0 - /2bL"ρL1c#bQ00Q -L M\4 @ pE J!0P B#\Z5 e BXa02c2c@0` U0` $22a11V3a11V4!U$$0CaQ@aU(K` 2P,@@0@,K 0C,`!11@`Pc0` Pd``W\/ Oa}_340 BXag02c2c@ pJ3XHHXpWxC d#2a11V3a11V1W #22a11V3a11V2!0KpbP0` `P`0R{N@@D/0C!b!b@p@b#0t@@`@@4? B1c1c0cS000820 `2`2c"H0a"a!H   !22a11\3a11\ 0"00W0  1paW40 0 $0@KaP0`1Ϡ&2l1!3l1V1V 1pJOXpG?0`P\PP Uڌ1 \L 0 0R0 0RA pD0 U?E.²QT# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQ -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   mt> 0-4PL@}h  W@}0鬝0 0 I` 0 0C`@0  R J1 0Q R@Zt> -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠh& }0` PP   0@T P`;00P@@T 00 ,0S 8,3W009 0'0@X000 -LM0H @0$|PH  h( -P`LV@|p0S  SP@D -``LMwPp !0@ `0`VQ0@JDX ({0P00SC/D|`VX@E_Z, 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/ |0!8; -LM:L@0cP0S @0cP0SP8;:e> -PLM\\`p@P0SpC/0p{PUX`EOZdd0 \x -L0M0 @00 R/긫 (0<HĬЬܬ ,8DP\ht0 (0 $ (K, K00Kiyp, 0 0K0}Pd 0 K0 (0 $ (K, K00KDyp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`2vP{ 0 p`d(vPPk 0`0`KX0唱0S   00 R 4 40  1@ 0 (@\`$@TpPVw`8@ X0pX L H T` Pp l/XK.P* <0 0PS` 00.0 @d@  P0 0d Kg@@ 0000UuXu0 D0D a ,0$@(a 0000D;~fH:0 M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0.nP0S0S 3`0K KP L 困 32a/@#b! $P pj `@? B7c011N0 d 0!T 0 L0L " Ժ\;/u̺ƺȺĺEنʺº^;0p;0t;P 0-0PLr/8l4@0, ,lB@0S0hH -0PL4r/k0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S kPp 0@W0 0 R@ 0TP 0P -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $, P93 -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S93 -LMH L p r/0, jH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢 p)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 厑P00D"PpPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ<x; -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑx; -OMLM@ 0r/ , f05 - 0fUT U U U 0O`= K AAH !fp7 To!4oS* I>K0C 0C000S000@S0005\ =000@Q dY/0`00n0`A ` kP@ \ `Ppa  H D< (K OKAPPF $ R*EnK`F`Fd4@@ ;P@(K R  ;P&+(K0 S S %R0P S S \ \ \00\``V`@, 4 P`e  P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS}D PW *(PK0 S SQ\n0P S S \ \ \00\@@T\`, 6 * P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  xPx((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  #N.K B0 B0C P0S  R4E}c4 R2% % P kecT ,d P&(@K0 S S U UP 1115  \ \ \ \ 0 SS} ;S`z 0 SL KP ;Q Qq6  0P NKJ J  FPE %4!@% h1 %P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt P`#(K0 S SHY?P  E " GI`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D[PPV:00ٶP0:0 000,0 S <,q0 bPP ENK@D@D+P./P ,`2bP@ `p,(`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0Sw1S9h|;<5H P5|oT5\5d5<Ap585W|5555 -0LMP0r/c0pSD Y@ S S@0TP S S  P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0t P0; X P0; < P015<l555<4<("4 <1QS0 g 0-L@PP@]T0] 0-LM@ P K 0K  P @@_p0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S P0^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP< P-L \hB/00h -LMP@`T,`K,pK 4P 010jP VX`@TX ,K `0V0.T00S` X 5 -$"L$M0P@ <K ,0 a0:Q]p0 Q-LpP@00S  R 1S01pW   R)`R@1@!  H\ 00d0 ^pW0 00 @f0d0 ]0 0@EP  X -p 0LP6]P`P @Q  P 0S Z P @TPD@ - L00S 0-0@SPL((_ 00 00H p= 0-0PS@LZPPZ PP0jDP -LM0pS (K P@ (QD 0#SA S? 0 S RA(  #GP0d(0 (ZPP ( V](0`<`P@ `0 S S0 S S PP 00,K ,0S ?R0SP0("("48<#80 P R 00(oYP @ D `ePP 00U 0S  R00 RZP U 0S 000 ! BV P;PP YP@ 000  b`ꃰ0@7~0@0 P 0G =p=H   -L.0S 0-H0@SLP:0DUYP0HPD0 - LRPE $GP@ 0@`c` *f@ `PP j#D q\CP GP@ 0@pc`P D  X\0@0g0`D000`CP  00 p-0LMK`mGPP0 @T0|  NP 0 ıX0X $0, P0P (0 P@ 00p.GPAAAPB -LM@ O0`00ᮯ00 -L|M@K\7 ( R / Z Z 00`PpQ 40 S :x4P$ ;0FP0K 0 p 0P @0P HX0000 0 0q PKRqP0: S 0P ;L 0Z KW0 v P0`00PUoSf <0PUo0S` 80P< paoPU`p60# V0 U   0 SR0e c00 P @0P W000 0 0jL00cPo  0 p 0p0P @0P W0p0pX 00 IuBPZ RW:0 g0 0qN0paPU`p 0 p`P }v7KpP2`0K0K dCZ BE " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v j 0A0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqMXcXYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d ߭"00@\00T00SL, ͭ00S ^,00E 0XSxS@`P< p-LM`K$P PP@ 0S 0S @TxU p陭00P 0Pp -LDM@@KD`KH @  0P < 0 8 4 , XP PpL T DVPP P0 XPD@0U*0S 0 @T:L 0 0S 1gAL  UPp  ZD\p 0pU 0` \`T0 @*0S 0 @T: V\ `FV0#0%H0% %:H00\U0 S2 S00T0  `T  0T0  \`VY `00p ` T ` HYT0S00pp0pP` p D :Y D `DpT R 0ST0S 0 P 00   X  `62` V`06` V  D `0S0V V p QX ZXp X pVp p 0SV X hUH@@aU0 S S#00T0  T0 S000T TL000pDL0 T R 0S7T0S   X p`6 ` V`6 ` V0S V PX0 0S V X WU p-LMPY@TP`0  eX0p M-L(MPP@0P HK0D0 Up` T LKP:L0P p`R 0S  0SH K1 0߫D0K!X p`PW UTv W Vw0"S꺫0"S= -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K B0KP@@K @<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N-"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I< --LM 0 ;0;;; -- L 0 -MLM@P, `T< p 4Q& #$0K$K0 S2|4 ,0S t,-铪X 0H$@W KHH 0($$4PP4 `W \ Q\ #0S0 0 #P PJ `0S ZJZ:00 00J žKIIR PK %R| T @D R@T<@ s 0P PJ >K 0CPcT RL K0 A ,P@)t W~ { 0  IP`K> @u>K 0C1Kc@@2AlA H D< L @L Kth07S  K A 0P@07S  0\KclA18 A 4< 0 < KmQ T00%Q00S  `@Dvr `W!X< PPD@`PeX  0곩 0  P PJ `81 K@@G 0| P PJ ` 1 K@@#@ 9;===lKh7==> > -LM0@s g0000 -LtMp0|@ $0 " 0jP`KS  $0S $Vth KPK叀K \pPgP ~p +c|94>D> -PLM@R  ?  000 -LM@~g 0 0 0P0 -LMJ -LMp@`P0T@$K P,0 P00g Z@ -L\M `\, l Pt 0%S U 000S,0 S ,B@zTCXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXACXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXACCD0DALD FTDpDXAXAXADXAAXAXADDDD FD@ELEdEXAXAXAXAXAXAEl@H@I*T@?$I:\@Qnm`@h@x dt@0@ -LMTp,@KP` 0    0S 9@Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q@I -L M@KPT `0 -L"ɠ2l3c13@"c1MP 1K0  _G C -L^M⸠p`OKPC/MK@( h < 8 )SVat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (+9@ -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @O$"(0K!48<#8 S*S 0H T H0L P J I@O  LOh@hA Hp\ 0L0p4Slgp PBNK@D@DhL!L1=Bp@) QpP,0#SEKEKALK 0 LAIP4 \ X T QX4P$0P ahPaap$RhPV09@@;;@@x: ADATA`A -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000hK -LM$@0 S QK0 -LMPp`P@b ,K0,px!0p  P @\T`E,0S ZZZZZZ`[ZZ`[ZZZZZZZZ( 000,(0 $ p P@T` (pP0P (0L 0 (0 AAAlBЖ,B -Lh\:P0pA4D -L  hB: -LM`TPpP 0 S S 0d f 0 0 @0$ U@5HPD -Lh:P0A --LM  -LM@$ vO0$0KQ \  0  K 1S015 -@LM z 0-LBP|@ 0S L| 0SPeT 0S \00LS `0000O0 -LDM@ d JP dJP`} 0Sh 0S0J0@ @@`KoPKLpP dP00 H XP L T@ fXKP0SVJXJ _P0P0H0STTA 0@81H  uP TP0@ 0000p0d  N X%4 40II  `0X@\4 0000 00(@,4 00Ԡ00^ -RL4M`T  12l/A#b08KQ0 2KHKX PpK 0KNS@ᜟ0@K岃<04 8 c@0Rc=9H =  AH 0X H0bQc=9 @ =P P 0 0P/2a@#bQU@T/ ti0S (0$0 Tp P0$06  ( O0 $0T2[  C00? 00Mb -RLMp`P  tp@P`` U! 0$0(  p-LMP@@T$ < 0R P0`K( p   1.,0<,00S #>P@ 8; -80L0S ( < 0  0-L@P4  P@>00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0; 0-0 0 0LS@P 00S 0S 0S  0S 0hPkkkkkk000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ <;@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 I<4(<"4!<0  -LM0@SK C < 4 00WZ=P 0) 4P: ; -LM@pP`~P  R 0S  RV  -LM0@S`pP7 S3 KP RpW :W =00<PU 00 e=PP 0 ,0(U dB PP:  P  (0    -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*700B 0P0XR00S @( K @  0IZSx((((((((d(hx($444444444((((((((((|((((((((((((((((((((((((0((4$|( (((|.(K0S 0(K0  00A SP cX˟1  UPb #U0PB 00@ S $P7 2S"12 202 2 02 PP ` " " ] 0 0" 2Sd P ?KP f02 Pʟ,0 S D ,lb\ R \ 202 b  K).K?K b+ >(K *Y 00I SP 1UPi U0PB00I S$Y@2R SjK).K?K 6b 00A SP =ɟ0! UPc0U0PC00@ S $P 2S"12 2P202 0U@@B\ R \ 2PB  K).K?K P1UPi IU0PBF00I S$YR   p 2S"12 2`202 VZTB   00\0S㬀K Q. :Q  >`>(K VR  "202 @"PaUUژ&0 "2 0RPEK2 " pUT6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTc PfUU[E00@ "2 0RPEK2 " pFU0 "2 0R2 " p3ʬ" `` "2 0R2 " pNʬ" "2PcUUğ00 "2 0RPEK2 " p/Uʤ! "2 0R2 " ʴ"1Q0lQ g2S 0K 2 KP 0@ XKP PK KPKeYV K/ PPQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCU}UC00@ "2 0RPEK2 " pU0 "2 0^PK BKPKKPK"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 t1 0 2Q02  K4PCK/PK <AK&P5K20 "2 0R2 " p!ʸ0 0 20Q2  p K 0C0K@ "2 0KPKKPK9< P`<0 p< 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q^KPKPK \AKPKKPK2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0KEPTK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " PK ,$CKP%K00 " 2R0KPKPK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pxڠKPKqPK lDKPKa^ K00$0(0K0 "2 0R2 " LKPK4PK# % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 ?'0h0 %`PV P00 U- >(K Pu`  2"S 12 2`0" 2  2S12 2  Po " y2 "  2S 12 2 Po  d"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 6" ^   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2"SK1 2 2`0" 2  >(K t@ GYgYT@ 2S"1 -K2 2202 -KP K/ P- >(K ` -KP㔃2̌S 3KL -KK K2 +GYgY |\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K N2 S``2 2 KS12 2  2@02 ʌ lQ  " O Q 2S12 2  2 g@ 2 KS P12 2 202 S  2 KS"P12 2 202 ?   2S"12 2 202 )  2S"12 22 /202 PPt2S 12 2 2  02LS1x2 2  P`" 0" 2 q2 0Y2S12 2"0X T "  !P`h`F8P`̌:@ Y K >(K`2S0 2 +KP % FK PK0S"\ 00z -LM4j @PK  4pK, 0 p 4K3K2K1K0K/K.K-K7 K 0KZP*ڸ0@%SP@D0p! @ 0BZSHH HHpHPPPPPPPPP`x 000C S`K1Q,0!cQ00C& 00B S$R 0X0  0Z|KK0̀ Q0  @Z0̀jKKꏉ 00^ 4 K^ 0f^00 f,0 S ,  *R 00B SF 00B SA000C S`"x1Q0!cQ00C 00B S$R0Ѐ Q0  @Z0ЀKK 0ş1 Pb0P0C 00B S$R0p  0X 0Z KKW 9  0X KKJ  0X KK? 0X KK4@ 0X0  ZKK$0X KK0X KK0pp  0X KK   0X KK  0X KK 0X KK@ 0X wKK0X nKK 0X cKK0X ZKK0hS0{@pH0lS0pC pA  0X BKK 0X 7KK@ 0X ,KK  0X !KK  0X KKt  0X KKi0X KK`0X KKW00X KKL0|RZ  p`0 5ppt  Pd0Q0SP P>P0{9< P -LM0@p`PW10S 0 H5pP  g3\P  b5pD0 +5p ~p -LM @`PfT40 p ETeTpG/  P090 ,K0K0RgTGTp400  fT@ o P0@ 0 R*00SC 00 0:0 g 00S 0@8  P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  儫9gfffP p-LMP4 0Ae10T0d1 P40 00p <00c1S1@0`g/@(0<p -@LMT( 4  10Ah4(0 -PLM @ 0S@@ 0-@LP0 S0 0S0U 0 0@2 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P`n !@ 2p -Lp B/ bR@P`0ڃ0RN V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@00@ -LMp`PW, `pP 00 R0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp3EQ ܀`V@" P @T `3@T 3Z@S0ph@3<?`@$2 0 1pp,q< -LM0b 0PUp@ڂ U R0  R00@ d 040 Q2 :RP 0E0 0Q0: P!0 <01R\3# -L@PP`9 @P``p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@3 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@94Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -LDM< |0P|C00KHP L L  q0 0  RLL 0-S +SL0L0 0 SY 0S L`/RP T` p9RTW1000CT0 10W0`CLp /RL 9RRDp C @EReR@@ 30 0. L +RL @0 -R- 00B SL #0R! 10BSࠃ@ L0B0 /RL0 9R L@10 0C/RL@ 9RL@!0aPS^@ `@ W D @R lT@ D  T@WT0K ZD0KHL " VP@0 0 K0W`0 @@0jPU6 0K 0KPd MU4"000`0@KP X5\3d1`/h-<@TLH^ 0 K00K<NP<Q||@??ER+ U@LT`@P 0K 0KU`,056C,0 0@K 0K, `0`V0V,00 56,0 ,0 0 PD T0H` l `0@K`0\  l! .4 K80KUX @d \ P48@ 0p!`n`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQdXd @XX@ VX>X X\\ U\2\ Wd,d \Xv0h 0d1 hdE/O P@sP/O ZP@p`p`AP/O p`,  3PT _ T0 S3.O 5P /O  Zp`p`0Kr0 0K0 0 K,0c`T0S X\dh< 0 ZP@00S,046S / P/ Pڷ/ P00K,00K56C,0 #0 0K0 h0 K,2"0S,056,0 2Y ,0 000 x~Z %N0p`h00S,046S 00S !N0!nX,0S"0 K]`0S"00cr/ P m/ KP@7N0Z1 ,0!46S! 00D Z0 K0@K0 0K0K- KP10@K0K0 0K%00s, 006,0 0 ,046S00S, 00C **0, 00 Z00S,046Shdh P5?55?5???|QPA8Pe ,0 K 00KP+ ERU`U@lt`@P 0K 0KU`ʄ10K0 K0 0 00K0K O P`0 o0K0 K 0 00K0@KM/O P0,` 00 !Pp@@T #Tg@0PeʔA0 K @ n@ l0K@A 0@Kd0Kx0K [0Ko@~E0 KL g00Kc/O !P@+/O  PWL UL 0RL L L L0W L0 60R- 10BSL0BPP QP U ETW! pT 1W`^WT p1Ѓ0T0 W1Ѓ`PL0 L0 00B SL@P 0RL@ 0B Q{L@0 0SL@ SQL H L E -LM, 0 0 S0 J 1P,  4 p*P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LdM@K4 \ 80 ̳00 0 1#:@":SZ @K/ gP  @K00K, Kp ,:ც᪪Z K0K J$6E0ƄJ l KY/  .  W/ P@ R/ 0  p` P RPP 0RX0 P@K 5PP 0 BP X0 0j@SP`@ U@dB@SC<@ U<@ E` EQ`0 0@ d `0 40 S0S40 0C40 4@\ @Q#(P0X?aCoc?`(?yPD?QP PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `x$hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hhT$` 0 Q 2RhF0P13P1 <2 Q-(0(   8%<<P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp<<< p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD<<< -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p< -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";<Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  < -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 <t<<<! !TM0( 1S Ѝ0SM0D #2::S Ѝ046S0S Q0 R0 P0000S00 0-0LS@6 00S  R011( 0PS00 P @0P 0 00DP0000 0y0D0tPP+l 0 0 -LM00@S  R 1S01P 00 0 0 S 0-p1L @RU 0 P0#<2 %000S 0 $0P:0000 0@0 00 0P0P00Pl 0@0000 P @0P 0 P<0S0 8000镝2 p-LM@ P$K, ,0K $0 (` ` P `#p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000P P*0P` 0PU:ZP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P \0 0e 0  R000P E  P0g0,0 j 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000: p-L M0K K@C 00p!`:PUhC 0 SP P000pP` 0 0 px p-LtM@PP`Kf,P0@: S  Q  SL  p( 40R p; 0p0+ 0 pA -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P 9< -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 [p@ 0E#1, 0@S9< 0-LTPM@KT 0K  0  @@p -L4M4@0@K0 0 S 9 W Nt,@ P-L 0 hgi 00h*> p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`8;R @0S R Mp-LM0`0 @`KJp p-0LM`KuPP $ "P@  R 00RP P0 0<0@0@ $0, 808 `(0  ph0 0PAAAPB -LM@fPP/0:0 p-LMP `@0 : 0ph}=H -LM@?pP  0:0q0:0& -0LrS aS ph0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wyPPN 0X1A  <p  3"K(*P`O\ K 0SJWH  P`P5 Z QX0a0 100410$1$P@ 1!01 ! 01 !01  P0 g0`g`g`UZ&g`Z 0S 11 !A/|@}t AT O` 0R00CS  @0P0(P !D010CS1!N1 g`g00$FL\FK8LO`J<a(W P0-PL @[0 -PLM0 0At 0jg00 -X1LtM@0 00 8p̠ 40$18p` DP @ V KP H hU P0S400S 10SQ l `0QQPg00B00S 0< p-LMP@4KP+@0 H$0D @0`D 6R@D0C ,0P0320<00@(@&0 03S0php -L4!`yPpGP/eP W& 1PU@8PP@UPP p!%W0f0pywu1fpn10Cs1 1!0C1c10Cs1\zfp -QLMP @4P  P P0 \f0 0 -LBM`4P0 0  NKQ@pS0A/pp AP@18!0R@T,IP fO00f0,1a(W -LM@S0 h;f00,1 -LMSS@0  \h!e00,1e0 -LMR@ 0 he00,1e0 -LM4  4< 0 @ 80  0 \PpZ 0@00P`V R0b<0lP @`V0P$NMM$N 4 80nP00000@ < =P 0Q[pNN$NO@ 0S 800 0 c 000  80bP  yP 4 80*P  kR   R< @0P`p(Kp!   ,  0Pp @ P`~,p~ -LMSS`p@ S$!S00/ 0(1 !$! \Z (0 RP0 0P > (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0:P 0S( P0U(1( d0 0,1 -LM(0 p7b00VP(pVAv %P! @AP 1!0 1!( 0P1D!D, W00  ,0i -L`p@ PP   d P -0LM@ ,0( P00 0-@LPIP UQ0<P Q0!311Qc0@"c@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 `P@ $ PP    P@ 1S0C1H 00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT  0:P @-0@0 @0!00 Q'  0R!```````` 2 2 2 2 2 2 2 2Q 0S !0S: 0-PU@L P :^ PP * 0` 0 0 -LM@PU 0 0 000 0\0 p`-p  0P 0\ -LM@PU 0 0 0000000000 0\0 p` p  0TP 00X 00\ 00X -1LM@h p R 0#P' X R 0#P R8 Q5 0#P: 0#P  0#P* R 0#P*  R 0#P:R  0#5S  R 0#P:  R 0#P*P P0 0 S0 0#P:  R 0#P* p-0L,M P@ w 0< @8 p 040 0@ k 0,0 (P f \0`@K $ 0 ` 880 00AR`pd TxD< 0-0L(M @RP#0 R0 < 6 |08 4 0 000 ,P + 0(0 $@ & @0 <K 0  X0<4W T -L$MSF`2 p< ` P0 0(6,& 0Q4 80 P8@r n x"4@0Th2@P,K8 PhP@P P@P @pWm,P X`pBU 0#V < F* 1Š P,P @,0p, ,0 R,00,00,P V0#03V00St 0 0 V( 4T!L   000 0V,P @` Vp,@ P@0Y:0 <@i 30,P UP0  V p8@ 0@`040@ 0 d"6h0< P@`0K p< 0p4Pg3^ 00<  \^< <L -#LTM0,0 ^3 p R`V V @TQ 0SN 匣p<0C>S񟗹ltmktmtmltmtmtmtmllltmltmtmtmmtmmtmmtmtmtmtmtmmtm mtmtmtmtmtmtm(mtmtmtmtm0m@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  B Z&fQ *6 p,K(2,  R 2Pi@0T1 *aP,0@ 0, PT1:0S QP,0 0, P11 0F0 Q 000S P!0S0 0 v P  , R0000@ 0f00   R,  0#P R,  0#PR 0#P L\0 0 0 ,0 `<(H,@PW -LMp 6P`J 1PPW WK0p0@0@0001300` P1@P" @0d!ST 21 @!T &6 ` K?0 @ T@0 0@xQ 10 Q *02'70 p `0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0w &P`VP@@`@P3P<@ - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S  # X,[P 00T bP0<<W -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K72,P UP2 2p\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 c0GP@ 0 ZR Z 10 % r P :#:S `5P PU,P ; @$ET P, UU` !@1SpWPU,P   @$ETP,p U0 00 SR0 :JR|0 R0P@   W0WX$@0XHXhXX -0LMR@0 0 80 t R h:#:ST,K0[,@(< <00010 pPP,`,0`V,`   @$ET @`,` 00PVP" '1 S01p7@Pp,`,0`V,`   @$ET `,p 7 F RǟW0 0d aQ0  0 6 Y01 @0D0 6 R6 RvP 0<& 0Q@0 \600LP0D 0 ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@ThU -LM@\Pp` h^\QU0SD R 0S=W00  00CSꐒhȒȒȒȒȒȒȒȒԒ0 0pT00 1 0 0 ;00 0 0 R 0;S< W  4 DT 00?T 0, @- 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S&TU  TU00 <100*2 P@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10p -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`30S  0Sb RCA 0\R! B Mp-LM0`0 @`u3p22**"*xx*JJ** -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b~ Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ )PD p <0 Px D0@ 00  0 ZH P L *P0<S`R0000 l , -@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8( 40PoQ P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 ,Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W + P@0P1p  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pjp  P NO0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 "M001 "Md@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`SY -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h&}` -LAMp0P 0 NANK0AnK @D `FS@D `F) \0 0 ᇹAK A0A $4 ᙸ0s1 Q   0 pS $ q@9@o\YY -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap R0 Rp8! ,5P8q8wp -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < 'X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 80`0l0C0 , ` m8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00PU@BPT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C80 0 R -LMP`  a("H T p 0 ʲ0S T0 P  `Q0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0tP  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,OP   04p  0 S \1 0J0 00 0S0+P 张@`0 0S0P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0  =J0 0  pP!P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"P 0 P 0, S 0  I0 0 0 0S0`P  0Pp -LMP<0 80K0 Kp `P@Q0, l0 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0P -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnameP<h@@X̉ I@@0cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputLXdhp|userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rs:cd9660%s: Filesystem not supported by kernelsession number is %s: %srealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] [-s offset] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %smsdos%s%s=%u, %s=%u%s%s=0%oshortnowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseLXdhp|mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/trackwarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track hp x|     {8:  # 3(#0382@3H3P#X@`@|@h@px  @ @$,4<DL`T\dlt|   (4@HPX`@h@t@|@    @@  (C$CC$$C,8DP\dlt|  @@discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.15 2007/07/31 03:03:12 ray Exp $Ffhnslinkit%s: disappeared%s and %s are identical (nothing done).%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.118 2007/06/25 22:53:45 deraadt Exp $%h%h<0,%%T4;T%%%%%\{sqO+PrreWŵ+9Jn^ٹHC`@N8 W׼Jڵ% gߜ]WzQZQѝۗ7ٛ#^fɌMvSg*[L4*sՔ7KcoN7yV>:.޽Nj>NȊo9MfȆtY_eU\e /_e%Wg,&;eQc*_eUutn)h|gYak?6*ElKh;F}pCpx #WYKchEdC|,RWpZx\x1YڏO;'҄~}9F^yxG9:@YvS}7E %fjG|hsA2wjk>߶$kuCcٛ["F>e^͠4~qFto` /Cgѩ~0DV{dj7u3rcy+^JfҬsv°0SxƭB%'+Sk~Ƃ(Rla׹yu;2@|նzJ-Qj0ۮ6!Slbs _`m ScO( LaO'vݫ-Im@o|oX`R}Z #0f!#fqM^gV}DAuDdQ?cW!_)ŽdmsFt4(76 z7(%M>Y#rMƒ~uiNLX cmIp&$LFo@2'LJ-?[Np*i&0nzcA1II~O{79\-Li}mRfav%W V!Y/{-^L:! 'p?7E݋:@ ؂EfKU /f234msUE^49,}}$ݑ2x+4p:VʽM杲^@- CӅH6֍yGڼ(NoH@\ⴑS QF -rŗ 1A@A?m \4S#VR~j4M_OM<85*d]{0ey4x;78q'~VrIbH2 `u vIm !5#K1fbÆ}8cvOlwLӌQ%Ȅ F -nw[dMt 0z&TXe05t-"g[РZmGÐI`ͤ<^Ae8^uUl)ЌmhuxJ8Y̭G B}+ dfmóy6k!K_Rؒs[!|npU úb)q"Aí\t:f2GTvSƥ@\FXiPM}G1˕#-gxin$Nh9d{p8{:6K"B i 1['q1w;U V^bN 2̙"!qTI1?ld>(Q |j D=? IrRf@'⁴XfVl6_eRf>ʉpL^` OѺ VWvXw1䝥>nuD5U*N|rB0(1b+1w۱!W0- ;`[ٺ]-np+/ۭMK,>FL <Ԕ[ 1KW7!g{r&oݺ g]L`?A&PGx `=oB.7? 8'nf- ͙c j91@5{~/>=^uq8F2,HC s'?,s_h: V_!6)kb^9C$ ?b zKe\I2nfsvdt%b!ɜ=#-K^G 4S80 g?!{S FTH]qJ2J=:BJl>I3E[N("Mdfe uډAS͈S4uaQ@tB/nA׵}b;q1'o&of hg0ʘ@QC`ON-5cʮ7RdwMW Q6Z___{+z|P-4}̥-/YȌ6t7i#FTH$"Pm5;LtM pЙΜb./6S:ꄱs~hs5]DmđH*x\[SоHv=2w.phrOQ V[5BsJ*UyvV=zbpeaXK.-8ATfag"+tw\û֘]}B\d<$ $K2f)ļ独: ' ApBa=LY-m"ğO-n%}Oo|]`F(r^}e۾*ٚv?9Cq5ynu n#$)Y9 ҄D&7X;#$I| *r$mU)fɧdo.E[-r7o\Kp'S bgA!x&mBϑH7TaT`9޲ %y w`)AUr/_$O⢹՚XM5"$cL\8gQ'I?ʈ4p=Y yiDz 3qz?C&\ :Sf(Fmz%pܶ7qPGƤ  ~L;]a̩O#Ԥ} IN䞹A)ƖyF8:.^=^ sDK.)iGh5;@s8P s! nڱ.U}UszIcP/- K^l{|")߇݅f;Vx,4JbbGDAd9c6FElE=Xl @;zbr-1>#K4O8!D i?Th1nP>iY`$6Fu5YP߁Ta jL8Ȕytز )-;vEKyF!OȪ1T6:ta];ښ"}U,W2JYS8{ԔobimAۡ==HleɎ>fx)DTTI]$jpxrHyZ$q?xNDi }bsʚl9yoށj0C\Xb\U'N%mwDg#_KŎCδ{@)S,8g.Ⴢf#XӪ+\Y]h0r*NȻf*߻ 8''i>Dp$2ؘd$ǣCQ9ߥi { NБeran$e;.˾L^l>SK+x.'hi%U8m|3O.>?}tpf4?0rn!d3!c'GԷP>hW!=Uzou|~6:GZj2Oxږ/^<q|,dzkV1S8KB&>.˖2(V(V''2tSp"UZyAKnf40gܶ @隊H/]KhgxbQOCq+eo"vKNqMhg ˯Z$hgqACp3̮`dkhpfS6b7Y/f&3D{ntqc]r )u]FaGie^0H&sy8W;%2  j̀^x > Tvבf#uǒ >MnNʩ6f%-Z\{Z.m@.$6pdzĕ LvՑ{ߞ8ųg?6wVPYadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgtioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)warning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %15.*f%c %15.*f%c %7.7s%7d%19.19s# %s %5u %5u %4hu %5u %5u %4.4s %c: %16llu %16llu device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %16.16s %16.16s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %llu total sectors: %llu flags: vendor badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cVISUALEDITOR/usr/bin/vi/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: too few fieldsline %d: bad partition name: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldwarning, partition %c: size 0, but offset %lldwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk.Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?editorunable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %llu sectors but there are only %llu free. Setting size to %llu. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %llu sectors in size (%llu free). new sizeSize of the partition. You may also say +/- amount for a relative change.Only %llu sectors free, you asked for %llu 'c' partition may not be larger than the disk Invalid entry partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%llu] Rounding to cylinder: %llu getuint%lldhas_overlap Error, partitions %c and %c overlap: # %13.13s %13.13s fstype [fsize bsize cpg] Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %llu sectors (only %llu sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [d|u] - use [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %llu, you tried to add a partition at %llu. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %llu, you tried to add a partition at %llu. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %llu sectors left The OpenBSD portion of the disk ends at sector %llu, you tried to add a partition ending at sector %llu. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %llu sectors fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceYou must enter either 'd', 'b', or 'u'. BIOS geometry not defined. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.31 2006/11/17 08:38:04 otto Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.27 2006/12/26 20:58:25 otto Exp $$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.67 2007/02/24 09:50:55 jmc Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.24 2006/11/17 08:38:04 otto Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == -> %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdiknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [file ...] %6d `؇tM؇HT`؇d؇l؇t؇0|č@`ȥ`Х0إ0XXЗ$D,؈4؈@؈L؈X`h$pDx؇؇ ؇؇@؇؇(PȦ,Ȧ@Ԧ@ܦDD$Hhi i@\|i ix  `ȰаܰhE### #$$ $($,%4%<%D%H&P&\'d'p(x())**++,ȱ,Ա,ر---../ /0 0,040@1H1T2\2h2p3|33444ccȲd̲dزe eܲ (08@HPTD1\hpгܳ    ȳ ( 0`8`DHPX`l t| `̵صȳtrailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwid-nwidbssid-bssidnwkey-nwkeychan-chanpowersave-powersavepowersavesleepbroadcastipdstanycast-anycasttentative-tentativepltimevltimeeui64destroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrdescriptiondescr-description-descrinetinet6interface name '%s' too long%s: bad value'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRSIOCGIFFLAGSSIOCGIFMETRICprintgroupSIOCGIFGMEMBSIOCGIFGATTR carp demote count %dprintgroupattribsinvalid carp demotion: %scarpdemoteSIOCSIFGATTRsetgroupattribsstrdupgetifaddrs%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCSIFDESCRNote: trailers are no longer sent, but always receivedSIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeyinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleep ieee80211: nwid chan %u bssid %s %udB %u%% nwkey %d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTSIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4Single-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types? media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%xin6_getaddrusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFmemory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a usage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host ioctl SMODEmmapWSMOUSEIO_SCALIBCOORDS/dev/ttyC0open /dev/ttyC0/dev/wsmousemouse.scale=%d,%d,%d,%d,%d,%d,%d WSMOUSEIO_GCALIBCOORDSopen /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offLXdhp|D8A @X6 @`lbgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[o:~+$N,ߝ<,&6&9EmD͐Ns`a 7(r83_Ǣۨ\ōLRe~2n`zōw{"ȋ'q"n}QX(U"@M.3>8__x]~_N<)O^_y$1󂙷y̋f^2™f^6”I~aXϼԬ1=^gޜG ;mcX+0_z =x@!.Jh0 "S&d\y)L"])iyJf#d@ MrM4TޢΎ Xzh8%&zok(3{8N_a=+b.'a*p0I$}I*AӃB]݋8n0^G Zl*NEJ:\-D MEN,s:> "tnͷ|jĴ9KG`akQQ spo>tgb"&`Ev*4x,]c 4+v"P`e1l%2;"0 VPkݧkOQ=1wYdT v+0#? P)wVaIgnX䀦"i\$X7H(D,Y_*02϶,/m+ R໭݁BqaEeddǬ-:KǤ"}P&*H6"I|ĸ\>AlA r&#je  Yk sua5N\k"=T֢8QfW+ 2hBQNuF R=}X( Q:2cJ&+Τ%/ ܗd~6I`̻yw33v] ~{P Ks5F`|͈]BJ"qI"J叇`[p ֌B!2K?AFr+% $A |_kmDAB J*ފ>% 6YPȺmiB%ZfSb8AN%y:nui`#Ai+t!$Q FodA `߁aX zHA( *gOF#u21Rz-YrUaG0jQHT^Ar8jDp*Wp5Mx|Ft8ݦ.( 9I#M]}p>r k 2&yM:xiDDo&`! E(fF"7 1BrO'H(~~$ x 9~eG,Fw VڐPe6BEA'`F9=[N@\zi?2~oÃ"v p1)A+!''{cӻ XEzt.p \G,FZb>d p>% 6TEx`P&p_Y?\<\|ΧI=\@K[_YHDg.Cd4&eEC3Knh0퍆7&3% X_Vi\s.Iw9>FfLI u#U蛉?Mn}-^ 9<&MzScgZFZB8õ7H8t_e3~l#$f&^)lEyT CLQ؝)-` %zzYEj (ıEӒ D᫾qQHeUe̺Z`w_7"$7 |\qɡG{_9}]&KIp+2C1o2 w)6r ɧX2gt43QG;wqڗz ABX”p4i9 l3,{bm M_G<&ZUxrM2A\ }mȆP~I+=ۄ,8eݝzsJe7y5$*K\(/E*oq>r9 +4aQ|LReW橱;Ӻ(2L΢HuD gcѳu>"k `ҙöȥ&%.n(%p>ﯮ@ȁ tjN?..?^Ϯ|8T!vPFH)q+<v.9gw+j|j_AM UmYÉ CϓzA,ޫ1JIFͰzYjC%?zU{'PN18ڪ r^jApXh/ ~37ki az? j> %F9mПbmLGI ^  p&lY /0q|jі 'L6zd M?`p,p:'t0 p8L~px;{%l߆8}` /jUNWϗ΃?V7V ^Ƕ}mz 17Sa}gDƽiEoo<@=7+X3٤?'3x<ΤZpU;/HrS|8QڢT?76 XttCAN7s-+y4gwWHH{oi(zGV.Eޕ-Y?zhof!7*5 t!16uJt;һn|/[Cl`t{#߃E,mWmMJ=cUt8``]0!\9jdRGɉbͶA59[抵)䂐-QM-|-rLS?G|:lw ĸ Ǹ*Fb7\q TxZ؜+H82E+k +UnQ CQIUuy׬˖ԎsiʾDaM,Y'5@TU4Ln@>`<*VZuŲf]۫n[Y\2Erj 4(5jtY4DMo/( |pO*K2ih2;LR3+=0~lI%7|ۤQUfVs=kw^{HkTNAD!q,WkA;oBKQK]f atHۧ7Z/t_e i#,I @EjSƊkL5o)We:o[g~ T^v @j֪' FJ.j6fi!ú5c`_u96=ZՐj9j"jLIM,޹Po(O]XG9AW>&ܢJ1"_~7כze6HWZ9.HdL=֒IW~>\{ןOƦ):TAw=tck'gdM";̥7+uNꑮ/VOpjM@6As'릜`y=D|$cdrAxaU\U̜G^U{ W)W %U2tQُhFAy- ~Xpsnv2,)bx?FN:XhWžEb;D3<7\`E-Xusage: %s [-ieuy] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:yCylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s: [%u] Rounding to nearest cylinder: %u %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFODisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %6u %3u %2u - %6u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %@ . .. catchmodhchgrph cp dd df edexprhhostname7 ksh sh ln lsmkdirh mtejecth mv pax tarcpioh rmsttyhsynchsleephA ...B . ..chownhdhclient7 disklabel7dmesghfdiskhfsckh fsck_ext2fsfsck_ffs7ifconfig7inithmknodhmounth mount_cd9660* mount_ext2fs* mount_ffs7 mount_msdos mount_nfs7newfsh newfs_msdospinghping6hreboothalthroutehrtsolh$umountC . ..D tmpE dbF runempty5D .C..E .C..F .C..s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]LXdhp|sl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p  `̵صȳUGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, table: %u, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: link %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s p_rtentry%-6.6s %6d %8ld %6ld %6s %.16sInternet Protocol Family %d: AppleTalkInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %slink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. PWDPWD command not 08`F<  F;`[~ [~F`@@<@TU Fu PPbFuuAFEF 2F 2 c8eAF )%(F )%(F )%( ے AF VV)F2T F2T = )g AF/F1F1 CF8`}0F8`}0F8`}0 |AF8`}0F8`}0F8`}0 %0AF8`}0F8`}0F1 uK F2T F"O F00 P Jp|'{Ќ!jSˢ ug[tkbmiȓ$qtVЦWpQ ѩkl7_SL]˲ToߜhM!+/_7Jgr=oceGZ΋153aZc!pn zqݟAjK+LVSL>ʃmMll̒&Jj2c¶vylcd  E Cy+GP޷=[mF ' K6<ԩ=)]AJNJx*D Y0 ʑVXu9b*t -SȪBk]7HU>tہ&?j}!dľ`퀚!zG~d |L#M}< PfRVs/&w{(YطˈS]LRe%DrºWG#ҤnV2^; u.E Y'tc;~`G".Vg9B:SeHG*aQEa׳z9Q98,recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroUser-Agent: OpenBSD ftpGET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s%s Writing HTTP requestreceived '%s' Too many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_getExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Retrieving %s/%s auto_fetchCan't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.---> %c ---> %s %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46Aac:dEegik:mno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-c cookie] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] stringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@Name (%s:%s): Name (%s): Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] LXdhp|@8MDreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node 0XU"xjj,jj"j%jjj ؿj j&Vj#j$k< kkk$k0 4k @k!LkTk z lllllllll mlml(ml4mlDml`mxlmxmxmxmmxmxmmmmmn: nE8nPnTndnxnnnnnnmn oE o8o:HoE`oxoxololotololo:oxplpl,pDpETp:lp:ppppxppEpEqx qt8qtDqtPqx`qlpqxqxqlqlqlqlqlqlqlql rl4rx@rtLrtXrtdrtprt|rtrtrlrtrtrtrtrtrtrtrtststst(st4st@stLstXstdstpst|stststststststststststtt tttt$tt0ttpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory $(, `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@$ ̔ؔ %s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.21 2007/06/25 19:59:55 otto Exp $$OpenBSD: inode.c,v 1.30 2007/06/25 19:59:55 otto Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.32 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1.c,v 1.26 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1b.c,v 1.15 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass2.c,v 1.27 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.17 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass5.c,v 1.36 2007/07/17 18:54:40 otto Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: setup.c,v 1.37 2007/06/01 23:42:35 pedro Exp $ $OpenBSD: utilities.c,v 1.34 2007/06/25 19:59:55 otto Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory list%lld %s I=%uCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld,%lld blocks missing %lld files missing phase 1, inode %d/%dcheckinodeINCORRECT BLOCK COUNT I=%u (%ld should be %d)bad indirect addr: %ld bad direct addr: %ld convert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS FREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE SUMMARY INFORMATION BADCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d NCG OUT OF RANGECPG OUT OF RANGESBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld NCYL LESS THAN NCG*CPG%s: NOT LABELED AS A BSD FILE SYSTEM (%s) WRITING %sZERO'ED BLOCK %lld TO DISK CANNOT %s: BLK %lldUPDATE STANDARD SUPERBLOCK %lld (%lld),catchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNO:S:T:b:c:e:f:g:h:i:m:o:qs:t:P:T:b:c:e:f:i:m:o:s:%s: can't figure out file system partitionmfs:%dwarning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: maximum file system size on the `%c' partition is %lld%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size is %s: %sinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragements-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-t fstype] special %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfoblock size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %ddensity reduced from %d to %d bytes per inodereduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failedcannot allocate I/O buffermkfsfsinit2 failedfsinit1 failedsuper-block backups (for fsck -b #) at:%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each file system size %jd < minimum size of %dcan't honour -c: minimum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size must be a power of 2, not %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldfragment size %d is too small, minimum with block size %d is %dinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacefsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dilog2: %d is not a power of 2 dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.24 2007/03/20 03:50:39 tedu Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.11 2007/03/20 06:07:57 ray Exp $$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $$OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nuusage: sed script [-anu] [file ...] sed [-anu] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty_ G  W LM $W tL n ,g xi f tFLM 6K $W $W 4e S h h zp 0v |q     }   |q  (h 0q 8@ @~ Hx Px X `|q hx pdr xl | -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$<<t@tTfdcxdslmnKp x  \  p   @ < 00 < D < e0 TD В d t X   |  6( @      | ( 8\ HP P ` t |   t   `    |  0 @ L \ lt x$ hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDaTY++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():P.IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }t@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $acBeitkXGl(Xlm4Cn@fHPbXu`ltpr@sh6vlxletxP5  ,   {{}tH ||&&!()]]<>P.\ x@oP    @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: sscanfrcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s pResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_afABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6$0418<DLPT\`hlt|( Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2 (0nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.dbttyname_r/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem$\dpx ,DXdp0D\$\dpx ,DXdp0D\HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" b0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call0000gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~d9h9p9t9|9< ;W999999999:: :: $:(: 4:<: D:H: h:l: :::::::::::;;;;,;4;<;L;l:@X;d;h;|;;;;;;;;; <<!4<8<"L<T<p<x<<<<<<<d<<e==f,=0=#H=P=|9h=INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/`="``"too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log??? ????? ?$?(?,?0?8?D?L??T?\?d?l?x??????????????????@@ @$@(@JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/bindingTBdBBBBBBBC4CTCpCCCCCCD`DtDDDDDDE; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATHdGxGGGGGGHH,H@HTHLpHHHHHHHHII,ILI`IIIIIIIIJ(JLJhJJJJJJK,KHK`KKKKKKL4LXLtLLLLL M M4MXMlM|MMMMMMMN,N@NTNlNNNNNNO$O8OPO`OtOOUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceled$\dpx ,DXdp0D\xdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)aTb@ LB<dcdAD e8Thf4Fg, ,XhHA$i|4j\lJ!lHL m( n",DXpHDPxqr"H4s!tS!@u"\Vw"8,Px(<XAPy4zLXp"T~!?<#X.A0$l (press RETURN)... (interrupt to abort)<382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU(\pt0ș8x\\tF  P Dx p\X@h@ABrCLDE$F4GDUVaLbcXe(f`hlixLlnqqrsvwxu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.18 2007/01/28 16:23:58 bluhm Exp $$OpenBSD: mount_msdos.c,v 1.22 2007/03/20 03:45:54 tedu Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $ @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.15 2006/12/16 08:49:18 jmc Exp $k"   9   ؿ$(,4<@DlPX\ d!D"p#x$%&'()*+,-.  D\ < d     pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABELLo&<D&&1&Epe tl|bld<5l?@[\\ ]8^D^X_d_p`{{|}}~fff|gh? LTX`hpxL (04<<D       8   @  <  H  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz|.0123456789abcdef ::0:PBPAAA\:PBPAAAp :PBPAAA$:0:8<43 apd$d?$@B%b+<<5=><C< J<Q=Z==_=f=q44~=mq=#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio xfs0 ss0 ss1 ch0 hotplug R ptm local wscons uall tuner0 radio0 audio0 uk0 random lkm R tty00 tty01 tty02 tty03 apm crypto pf systrace wd0 wd1 wd2 R wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi B . ..chownhdhclient7 disklabel7dmesghfdiskhfsckh fsck_ext2fsfsck_ffs7ifconfig7inithmknodhmounth mount_cd9660* mount_ext2fs* mount_ffs7 mount_msdos mount_nfs7newfsh newfs_msdospinghping6hreboothalthroutehrtsolh$umountGdhclient-scriptrwd1ijwd1jjrwd1jjwd1kjrwd1kjwd1ljrwd1ljwd1mjrwd1mjwd1njrwd1njwd1ojrwd1ojwd1pjrwd1pjsd0ajrsd0ajsd0bjrsd0bjsd0cjrsd0cjsd0djrsd0djsd0ejrsd0ejsd0fjrsd0fjsd0gjrsd0gjsd0hjrsd0hjsd0ijƠ . ..MAKEDEVconsole tty memkmemjƫnulljƬzerojƭstdinjƮstdoutƯstderrưksymsjƱdrumjƲklogjƳbpf0jƴwd0ajƵrwd0ajƶwd0bjƷrwd0bjƸwd0cjƹrwd0cjƺwd0djƻrwd0djƼwd0ejƽrwd0ejƾwd0fjƿrwd0fjwd0gjrwd0gjwd0hjrwd0hjwd0ijrwd0ijwd0jjrwd0jjwd0kjrwd0kjwd0ljrwd0ljwd0mjrwd0mjwd0njrwd0njwd0ojrwd0ojwd0pjrwd0pjwd1ajrwd1ajwd1bjrwd1bjwd1cjrwd1cjwd1djrwd1djwd1ejrwd1ejwd1fjrwd1fjwd1gjrwd1gjwd1hjrwd1hjwd1ijrwd1ijwd1jjrwd1jjwd1kjrwd1kjwd1ljrwd1ljwd1mjrwd1mjwd1njrwd1njwd1ojrwd1ojwd1pjrwd1pjsd0ajrsd0ajsd0bjrsd0bjsd0cjrsd0cjsd0djrsd0djsd0ejrsd0ejsd0fjrsd0fjsd0gjrsd0gjsd0hjrsd0hjsd0ijrsd0ijsd0jjrsd0jjsd0kj rsd0kj sd0lj rsd0lj sd0mj rsd0mjsd0njrsd0njsd0ojrsd0ojsd0pjrsd0pjtty00jcua00jrd0ajrrd0ajrd0cjrrd0cjwsmousewskbdj st0rst0jnst0jnrst0j est0j!erst0j"enst0j#enrst0$ttyC0j%random&srandom'urandom(prandom)arandom*wskbd0+ apm,apmctl dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0  . .. pppfirmwarejgroup7spwd.db protocolshservicesqh disktab fstab* resolv.confL hosts* ... . .. binmdec5sbin5ƣshare5 . .. ftpgrephfgrephegrephgziphgunzipgzcathlesshmoreh sedP disknames7 ... .C..wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _hoststated:*:89: dialer:*:117: nogroup:*:32766: nobody:*:32767: a  un}of!NI u p + & H  H _hoststated*YYHostState Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3d 08`F<  F;`[~ [~F`@@<@TU F bF?AFL/"F F }AF<*%F<*%F<*% ;،AF8,F83L/F83L/ (AFo-F F  MAFo-Fo-F8.  AF1F1F1 BdFXb/F%1F%1NFFXv3F6;F6;`hpxP3O)FFFiF l`FF1˷F F F /tmp/disktab.shadowĭF F F /tmp/fstab.shadowpùF F F /tmp/resolv.conf.shadowDٻ: F F F /tmp/hosts=Dyӑi,&h $uHϭLQ&k'!MvAzuClEG>Қ['BĩʼnI#L+33FA#928azOotH/ 3* k m:*jR0&^ 0lgV_P&˺ԱpG,+9k(l< _f0*p]Fɲm@>}iZjX u\_ &nzm lwqidd=k+'[,ϡau,g9mK/Il'E| ~X꒙7:iK +x4>_'R}$VbL=J6:G|[UvRyxOS`}k.MaimGhLiZX.w?*Z$<T LM@jgh2|FkRjP# ށS|9Cx- bqU5sdr!Qe+:ke2Jc/gF@jO{$)t*6 ivJM>`eK0YrLGhc" ? : X S   nobody*Unprivileged user/nonexistent/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"yt:5 _ Z  z u , ' _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hoststated*YYHostState Daemon/var/empty/sbin/nologin1_hoststated_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 [ V   E _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_hoststated*YYHostState Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 J E   p k * * _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerdip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask "NTP server? (or 'none' or 'default')" none if [[ $resp != none ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=42 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable 0123456789abcdefJ_)Dg--H--J_8)|)У-4)X)J_,) t))h)xr))J_ E.LK.J.S.S.J_:"-LK.J.S.S.-R-b-J_<h -J_+-J_,0-J_))LK.S.S.)J_)LK.S.S.J_ E.LK.S.S.E.\6xH_J_H)'@,,@ X Xd$`@K_DK_dM_hM_lM_pM_tM_TK_PK_M_lK_pK_M_ ʚ;5ym8@ E8(@AAA==(A*J_J_J_K_K_,K_ K_K_K_K_J_K_ K_K_J_J_$K_Q M_M_ !6x"d!6|"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6"d!6Wa].!6Wa^.!6WaD^.N_T"6h. O_0k.$k.$6k.l.l.l.l.l. m.Du4Lu4\u4y4$.T+$T+$,$,,+$,+$,+$,+$4+$4+$4+$4+$4+$4+$4+$r$,+$s$4+$4+$4+$4+$4+$T+$4+$4+$,+$4+$###,+$0#,+$(#,+$#${",+$,+$,+$,+$,+$,+$,+$4+$4+$4+$,+$,+$,+$L>$,+$4+$4+$,+$4+$4+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4 p x < r$,+$s$4+$4+$,+$,+$4+$,+$,+$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$0040t00,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$\C!C!C!(D!E!,+$L>$,+$4+$4+$4+$4+$4+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$4+$4+$4+$,+$L>$,+$&T&&&&,+$(&,+$Ե&,+$,+$,+$,+$,+$,+$L>$,+$`////0/,+$L>$,+$4+$4+$4+$4+$4+$,+$L>$,+$M/@P/$,+$4+$4+$,+$,+$4+$,+$,+$,+$4+$4+$,+$,+$4+$,+$,+$,+$4+$4+$4+$,+$4+$T+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$4+$4+$4+$,+$4+$,+$4+$D00,+$,+$h0,+$,+$,+$04+$4+$,+$,+$4+$,+$,+$,+$4+$4+$4+$4+$4+$,+$4+$4+$4+$4+$4+$4+$,+$4+$,+$4+$,+$4+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$X!x!L!D! !,+$X!,+$!,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$,+$,+$4+$,+$,+$,+$4+$4+$4+$4+$4+$,+$,+$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$4+$4+$4+$,+$,+$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$,+$,+$4+$,+$,+$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$4+$4+$4+$4+$4+$r$,+$s$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$4+$4+$4+$,+$4+$,+$4+$4+$4+$4+$4+$,+$4+$,+$,+$,+$,+$,+$,+$,+$L>$,+$(11( 1 1 1 18 1r$11L1M1M1,+$$N1,+$PT1,+$\s1t1t1,+$Lu1,+$$,+$4+$4+$4+$4+$4+$,+$4+$,+$4+$4+$4+$4+$4+$4+$4+$r$,+$s$4+$4+$4+$4+$4+$,+$4+$,+$4+$4+$4+$4+$4+$4+$,+$4+$,+$4+$4+$4+$4+$4+$4+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$,+$,+$,+$,+$,+$,+$L>$,+$4+$4+$,+$,+$4+$,+$,+$,+$4+$4+$4+$4+$4+$,+$,+$,+$4+$4+$,+$4+$4+$,+$L>$,+$adG\b@%K@p0A @ 0,@Ph=6?6?6@6@6 @60@6@@6P@6`@6l@6|@6@6@6@6@6@6</ >/6\K/K/L/L/P6lQ/~/R/U/p~/0/\/T/6//T//@D/L/x6 ///>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy6k1k1pl1`l1|w1w1u1y1z1|{1t11p:5L1l1t1T1t11@111L1x1146<6D6L6T6\6d6l6t6|666666666ĸ6̸6Ը6ظ6ܸ666666666666????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 _wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp__  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް__2_)#_aL___`_p______  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~h_o&______&_!_-6P6T6X6\6`6 1|16<dB2B2XJ2I2  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  6(6i2i2i2"(\5|66*66# # ,6660w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-6{{66Da3b3e3@i3hj3i3p3v3v3w3Tw3v3066P336h 3(363`3383(3@63383(3l63383(363383(363$383(363H383(3064h483(364483(364 483(36 4 483(3 64483(3<64$483(3644483(364$483(36D4p483(3X64483(3,6@"4l"483(36%4%483(36)4)483(36.4D.4.4@64 44̦#$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident  ! ?(7(._?4_? V9?D?9M?KP?   paAxY  7__  87H H$$/]"8:`0E4cRL! ]2$f7,D m3C7+7<x^.,%+0[(4 0O,i.Y:!pC3dh -,#<_<73`E 8d5?7(&"%Hc(0 Tb c"d%4h1xM(c^,cdx#hj7u,$$}$x1x_D1/H"h $#1P+<d%(<4!T! 708)?(/Tu4d;7n*"dxP;(l_O4%| 40u4L'`N!.\ b {!* i'T= .D (Z |+l  s p_ t $ 1| q5  G7( &7 1 0d x&l xc y), H$(? L4J PG7a @%dq V(H 2 < 4  0( /x 80 ) 8V1 27 p8%0 V$0& +d 1 $h8 3K C7x^ ch #4u Q_ | xc HT( ]("n܄ \xc_ Xt+ 2@1`0#е/`bg5N D!4*3.9dD%Qy$<YT,bK1,q84px\;#T~40(17+5'L/$"01b\_l7X1$&\0344LZ$hT@/'a{3ts1d|1d-tx008%d|2D%d%2xl?7T&h`52/2$:"dJ$X,2`W3@o@|2|/2$?7`Z3|K3P2$^(LT1 "b  (I4H) G4</XXt.Dd+m37zP"$ }2T4-X++21&d&}"l&d(7# c%40&<؟.\W0ce@(xq%@|x/$Lj!_+dz4b!8h4<2( 7L,26I1`B_K07a,nD4z10 2"dl.ģ2$#1$*TT(T0]"\<cHlbQ"]`'8r,bytK%tb@5"p6+4"P / Du4c/8t!TA7'#X"1@%7F'PT/]` /@g-7z T'0h8ccPܶ/T c*78O4$ 3y0Pt_|?7,?7=.NpbX'o/{.(tq+Tw*A7l(%l.#,%74c\&  <{&T$({/5t4CpA18Pd X/e;,dx(bx3$,@'T`2'<c0bT'7=3\`<7̏4!xH%d&"27 0x <27$!$2L#!1(7!s#hK!X!\!X|3h!( r!4&{!L#L!P%7!2!'!x#!L,!P0d!<(0!&`!/ "#"4$ "P9#+"#!<".XG"l24W"(o"8#|","c"67"<&7"!"7"x4"|* ";2P"4.d #&#.t3#}'E#2L\#ck#`_y#lm%x#M%#$Q_#!`##`# #j+#<&#2#lb#4 #P_$J_$_%$2`/$8c=$@5K$.a$P! p$,I4@$Tw3d$97$"$&'x$2($,l$\($.1%dm,,%O)&%5!4@%0TT%;%[%$_e%7h%3t%,.<%p!%}%% %h2%$%&7%24%P%d&(2 &hI'"&p[%L*&w3`7&.B&(cU&%',d&q_n& &t3`&t_&3&,08&/T&/7&(X%(&p0&$'#'\"'!''1,9'5@'F"0Q' dg'<+r't7'"' c'P2'.p' *'3p'h1'4'!("8( ,l)(@'T7(8&F(cN(.[(dK_s(г"\|((x(4 (/X($&\(l. (̶&\(!(2$(1p)+) 28")&0<2)#d >)!dS)6/H[)G7g)g- t)$7)@u4)1,);"L)T! )${"),"@)x.)427 *p_*Q,#*"dx,*1d7*)&`B*D/N*y/a*p'z*7*<7*<_*c*,%* *+*T%d** +D\1+)d"+39+PcA+$5!V+(7^+0_k+4z%w+*+<2p+pM_+T$+57+ !X+v3@+0@+&+W%,\"8,*D&,|47;,|_E,P" X,v_b, &m,u"`t,\,,c,/,h-',/,?7,"d, ,. -}2#-H" 1-|%8-d @-450W-l&g- o-,{-h0-(%-/7-L/t-%"@- !-4$$-l3$-/d-,K_ .p*.Է0$".`J16.N_?.L N.1%xe.ps"\l.~0d.`$L.z(l.x.`.P/.0<._.A7.0L /)/4c/v%2/2xC//K/z4^/"f/,"r/x1/q,X/ q_/t*! /7/43d/*/U!/U /4 0l!`0j2'0P%840"?0 (0^0+l042H{0(,0`,%X0k'\0$f!0/00y40%0,70pz3`1 (1(-1P'B1H/'M1n_U1y4h1Y2v1<4L|1Z$ 1|u#1 F5 1D%131L!x17 3H7%<S78#he74$m7?778!LI8m5 U8T+j8 c{8938(7808978#88K_8T(H8Ԕ+,8$(94+$ 9%9_ 97/91\I9`H_T9p._9$q5 k9_9P)X9"92 9 o39)39h+9$A1L9p_`94 :!$:4:+2.:l/H5:%A:*3O:"[:27$j:p)t: ?7|: H:!5x:l!4:d44H:\/`:&H: 0:n#:@2:97 ;82L; 7H!;p"(;_2;%7 A;L!T;$|_; j;(Q_s;,_5 ;/d0;$*; |;T%;3;$; #`;$L3x;|w1;t%<?18 <0<P8+&<@r'D9<о4A<Q3K<X4Q<{#0]<#i<<0{< ,<2<d55 <;.<82</<,^%T>c!>_ *>x1=>{(H>4M>to5 Y>Ȅ_f>'d{>h7,D>p0>86#>,$>C"> 2p>"0L>(T>$7 ? !?c?xZ2'?H$/? w!074cAt1oA4vA $Al"\A02A2AT6/`Aܣ#0Av%A 10AT@7A)A 1pB@& B?7+B$79BQ!LFB(SB#lB_"8wB#dB0/BobB"`BL3B2B2B\- BO+B,7(BHB!B3HCb%Ch* 0Cd*`9C$B7ECds_PC*3dC g-$xCX-7Cr$C.&C(#lC"C6/PC84dCY!xCh pC$D7 D# Dw4%D*0P5D.xLDd!<VD3bDh*DoD!D2D+dDP# D&HDpbD$-+PD$PDtbD$7 EL&PEG# )E`4x8E n+$KE8(7YE04<cE$`Klt_Kk*lK @Kܺ2LKt*dK|)Kt_K0R+\K-L8%7 Ld4L 3Lk1+L27AL OLt$]Lh,0pLcwL(" L),L4,L@7L1'LbL4&L, \L/McM}_M&+MF$7M67IM%VM-(aM#0hpM%xM&MX 3tM+M4M"lM|+M(Mj4M@"`MDa3Np4 N@7 N"L#N3d.N!<BN#!8TN4x_N4jN%uNbxN{.xN(%NP$N0%N 4 N07N%@Nx_dN(O+@O_!Oĉ%(ODH75OG7IOp,$VO0b]O\&7iO/zO0OE1lOX%dO^28O "(OԻ/(OT%7O@K_PHF7P5&%P8^!L:P|4BP"LHPtbTPD(4aPT^2yPA1lPf(@PH!<P,*XP@"P%P,1dP !hP4P0/$PP_Q P$Q)<3Q'2CQt1YQ;)hQ+dsQ@*$QU! Q\"HQ$"Q/Q45 Q!dQ`S', QLn(HR/7$Rt"$RT/<=R<7QR7dR1 vR`0DR_R>7R(XRz&8RbRJ_R<(,RK4S@/`S$ ,S|#\6SX0BS 1$XSe(bS$,dsSR"SH&S(.S'LS2tS0S1,S$tS<$D TcT$*T",8T|!\OT7`T1xT1T)tT cT1dT<" T (T!dTL2pTL.T$0U3U c#U#l/Uh+BUU!VU4#d^U"pU|!XU,U(O_U_* U"U[+$J[ #S[p $c[0&7m[tbx[d.[(4[\'["[![38[82[D7[48[) \ud,Iu`#d_uL&7fu "zuXu_Pu67(uT82 u v0u$N&u< %u@#up5 u(3u0$ v$v+x$v!x,v%5v0H?v@bHv#8Uv4`vh'7pv27v4vXcv`'vLc#,vTcv` &vdq_vJ3v+2vh"(vX!\wd2|wd%d!w-l-w4Ew?!\w_iwq)Ltw#Dwb3w1w00w/w,w?+|w)4XwD+"@xp! x3,x+T"xM/\)x)7xd_Cx24Sxp_[x, exp_lx'4 {x04`x0K1dx"8x؈4xj2xPI&Dx$cxP'lxC1y(y4%y285y_?y)dJy74\y0& gy8V#qyį yP,py8#yȖ!y &xy&ye#y1yD&y.Dz&8$zT$-zF4H=z2Pzl0dzdoz"T{z(D!@zbzP'0z4O$z"z3zK1Xz.|z`!\{3{Ⱦ4!{&x/{P4<{L',H{DbU{;!Hi{H{0x{T {"T{q/ {!{2<{/{h7{/3 {w14{*{X#{\"8|$j01|04=|/4R|@7a|@'7 o|3\|<'4|U! |@ H|D+$|8"|pN'\|H7(|+7|P%D|d |1d}зb}L>2D.}./C}_L}xG+^}cp}(2(<}tb} 4}m3}x*}\C!}a&};&}l-H}+X~+~B.,~ c(5~ "xC~HbK~<"V~P$k~*(y~pC.~J!d~8y0,~c~u4~/~.~Z*|~H(H~s3 ],###P(=lm2XK2X &j7vr.7$i5 $x?7 4(*<x%`0*@#0t#dPb 4E.!$d1!:)0MP#Y#i`R!pt,l~T$h'1/@\$$"|Ā~!΀q_ր-,߀24/\d)/ *4$0,@-44,58 2Pp|%Y$a,.rp+}G+&T"4~+bl!<|d!d́ 7ԁ7Ć0&ن@ 2TDm+T,7%|k3D$#+23@+C&Ju_Vv+c*$do\Q!~})X) 300.LJ1݇b4pW1pd + 0u_())< $924Gf*X-%`&l~&|%@n#tPM!w'4_2Ĉ ((ވ#"L+$&`34 *0x!<ܯbC2W/g'20l'7#؍#,ɉ\B5|ԉ&߉؃%LL/.8dA7T HV( A7&",hD!7$ ?`31hV4a -8q07|&<1\| 44d73NJ{3\Ҋx&<݊H'0T&\,3h%D_(J_443I.a"jy0~(O,A4,3N1#Ӌ7Pދr'L,' 3`\X!$0: obE97\cf+o17$H14:'0d$&\hs)ʌ`'<ތT!D3Hct!"\,+~!=|:'$J7SH<%ZH>1fcu< p214h%70$K_э\$ۍ3||F1,7$t_<='@4<)ș!<$2LH)R@7a;'\kD&8rp/~+7_02$<4-'ǎ!֎2#p-+7 Ȅ4Q$0 &L+[h&Hil7 p4Hty3@20*X34.,ˏ7.4\!p$4/t$%th%d.2A7>l&7Jh"Y2Piȱ*x$7 424@4P2ɐ\0/(T cp 5h &4u&% b+U$L52IcT-0Hh1dz*(p @3,3,s_ʑu!֑1'T('807'4[2>|'7ObXP:&iob|pb<1/32\./I+Β +7ޒb0/Lu1dbz4 84<  3*4 3<4|!C$9!0Z4'clz4vc*T Tb<x0((d˓ذ#tؓز4ޓ4$`n5 а3`0g$ h<7!#)b0,7Gx$P,7Zu38ilI4Hyha*lz1$PF7xPK_Ԁ4ǔ,24ڔ_L!0#7 $ 13$#F4]LR4nLz48,t&HH 442ɕ/dڕh&$H\$x5!L;7X93p',724$:LbEȪ!8R /`&Hjx3wz0@|*DbX!$!\ŖX17ܖ$43dv_%DTq_317$*T1:+L&W|#,dM_(  &h6!001v0җ( u_l.$3d7&%<2p'Gp$hR3(b0ltcE @7'Ƙ$'ߘm2&%В/{ &%le 2x0l7,7"20-h+;4:LbGx3U0``X,(o4bw$!|\0(T$E"40d.ǦtbӦ 2r+lx%7/ cH(7!40|M_=(K_Dt+W\*fcq&{Du40(%Ll"44(_)1PЧ4ۧ.X(72-7$$dQ!0*< &G:/Ux3'Hc\o/LlbvD!0A/T4\7*& 57=̘3HPv%tQ8;14i$*Lxc%$$b1ĭ,pd& &4Ʈ)8ԮTB7ݮ&'<$ "p_&Ю"(0#L,825h1?\$ RPp4de'r1H\%d97\. $ԅ%L t%d̷ t)lڷY!$"2l<*"5 =.&ԃ+T8D ,Qt d[n(f/7{TbX0Hd%|L1@7 cɸP &ָ'$($!%2;(14L*7\4Ld<7w]./@HK_D$?&H2p0xx%T˹2չy*X# t%H7$b2\1&A4&7M, 8bPU/0l cvȭ 14(pºز4Ⱥ+ٺD 2T8,@4)X"&#h2&%p0t44(= ,K8$dUd#dk+L|$p%"'7d31\34ǻ@}#`һ&<ۻ,# 82 55H$0r_2 (DL4 Rd#T^p:#j$x _G7|"2`)\t%@ü2xԼ̦#bp74p\4y%h %4!TT2/,dB}_8[|bxcH,v(+xl%Ȇ4t%@8_5 Ľ@/ڽ<7m5 3L r,,5!4'p1,@&Q,b _/\r&~dx"d$$H~_!P0ɾL'%վ,!/*@l'%l_)0+9@ubGtbT07[*dj4/y(8%t0HC(pT_",7ɿ<3dӿ'&b,bbІ4.1\? 1U55a#g 4y`s4l3@2 &L>$ 2d&'t_* c p %, 'd0lJ 9 O+Gv4WT"pr`27$/40@cܕ"7_dg)ho4x'0\x%d ܁1N7`d< <q7t_4,&P%u4J+ |%d$377 &DX!XT+7\# h u /4%d/Hq_@7Xb(l23)7! b#!\$'3*2HF& |X54l2#d3 A*|7Dz1X!@/@$%&(h&H_00B7$;7+T+$2M4pE,U 1tb j7sV#h{0d8!4o5  (H]"8Xg43`%73 2du4#i+2tQ!A%1pN|-^D0n$u_864pL)|l! H[27pВ4.$̿(d&< !3 ! *P/`5#t<~/OPz(L[3lL/<z cg&%D$[#x3< bX&'"4!T&< @1X%0*'!:&\BlQ/@MXbW"dg<+x{78"$ @<1%T@P/,%ll4h /(&bw0|@(-b7_=dE3F3Z(t$jPa4DcXe2l.$ %xH_<;7487@3|P,&[0ip*<r-7P"l4+@c#ȁ*D4hT%H/4x.p+ 302'd|'0?4$I3He0n+s&d@bD.4|(\L&܀_/h-P1x. K2HL/ d(Lsb\&10r5db?,8`4<, h c6! 73!_3y0M(YPB! `)t-9'(%_|21%<p5 0', 417$M1$ p#0q_ L008_*O$#Zk1iЈ#hy4Q$xX/x(*$)!X"4w_\ -443T0d! 3 25(/DX(WL,1a/k\$px&7$"H"X2o5 _`!l2 4,1@3$((1'DD<2Nب!t\1k|+t|L.(0<7d!o2_3/q2L|18b4nD _*].4(Ll$8&7x 0H{14 2 X0?7`/(t/Pw!p6\*Je.l_r_h uA2ch.]#21ph_!Tn5 I-\4+8X#d 3 K2 'h#d741'C!XQ0^.7$n,3tF)/dN!p/4$pj($ '8 X%/10+(0X;L0E0Q_UT$$`X25p.\z*4'4%dL4t*%Dg-#Lcr2 c )D&09Lb2XCA7N@$Wt+hX*py02P cc*3@Ԧ0 *H%Q!&Tԥ3D0P,<)_247/T> %$J/PT/\XO_ qx"dLzn'$_0c+Lh Pt4(c%@2P_,,/,)<$X4 7>*D(W $Pȣ,\& f"$t3 ~A5<3 ,|-'ܔ"dA7\A7D3p L7s* $(@)$0P L:,7I,XV*,bh634p>/~ #O1\-7Db0e(cl(` p~'` cd/7$(p210/7Ey4Wp3hh& s@3T3 (m5xh0`})l#4D4T]!ȫ)(?(x ! %p (38%?7#,Nl7f@4z2\Hu$++h'7$27$/@/m(  3x"<(l#dGd07 ]\)He(bh4.`44T"ܲ #d`(T_0(-L(+@"d HQ_$&#:/Q' a&oȿ"X2h1H̏0 >/-, \.7$33 L/D40P!5<'/8-'LC.$P3`,$dny4b2`(^"lJ!$DV3`h2%|p Xt1 (4/<A,B7LlO"Z0\k4r+hu,xH10,@_1.tU/0̧%&@H3\ c,!X+ Hz&,Z+84CV%V#!@h &<s2 \!(L'#L[+ c3L 2T4/pw$8 ! L3*T_ Gp_Q,x"X07$h< q2T_*&|]"4L3Dr_@~/dK_ Z,PX%40<)D/9t"P0d]0#it*0LX"Ld!T($^03dn%db8#$ ,0X0%,|',8n+8?7H.J'0C1$$a2h X |1(D1dR0ht'<d#_$.p*t)<\bhv'/@) '(3 !\44/+|?<+(Ol&PY`bd|&4w#$t &X.1H(p+t &` V!1 41d &D*n"3Xb9(4Ap $QPz&_pT+ nx/Dy["`%'!tt-\h-H32, t`4,d \/7!\/$.<*9Lu4H)V/h\br,34'),$.7$h 'P-0,.|X+h1.P*tbH#"*1HD04U%La!Ds2lM100- +7L1(U*(@,1w0 $s)D4$`,+c=cJl.\3n 144'8<%8Xs"\O4tK_T'1|R/Hq4XTX%($`)d%.(=d2HcU^!cA!0zY3PY2xD1_XO!T!# 7b(\_4 X)X-,X683LK_<XM1hch,n ȯ.,E .*T T9!4n @_u h 4 Tn2T :' 2l t (  db -  0i-  U# _ s3T  v4 ;7* %9 x(4F 8'HY 0lj 97 \'7 04d $T 8F5 T`2 E7 d0 G7 (+@ $ (E7 0 `#> R2K `"R  [ T)i H0<w -p @p5  L{' ' 3$ D1P ^0 #$  1t! 4.<2 '= Hv4M \%V 1p W%< x.t 13 _ l$\ XF" |v!L 0 7Rr#ahZ$j0Ptd0L/3TK_+7g#P_-, (W!4 cx/ 38/t$2-$N1483DA(3N)'\8%cXF+ rhbz$/7y3L2@,1P(7#`|+b.}_ cDl3302U/< cJlbR_\ E.g+0zXA7`'7'\2dT$tt.H0/d_7 z/h.\,..P<l(R$ZX!k, s4C(\350tbd u480d$ A/d.0:(W#C$OA%HZ4@_(7lxe4~00Pb@*!4L_-0y48/7$3HD0d4/"%p1Ģ!h8XK_GX%xQ,`̷bsT1P0$d@7^!_p#dl#@$,|" (!H!d'71\2:0%7G4,S7[%4,g45rd}HG12dt Z3-ph!0cD& $ Q!o 0  /@*|/(7d<3@AH'W<37n_5w x4@\%<%({$L$!8 &|,{' ;7\#P} q_01p0tKL/WU!s(4%0f0p0.LD%7"P#(32$`H&7#2/%d9\) Cp_P1dacg@'LsX/@}*8R"z"Hb7Vk3&&0z4D7\?4X/>7<Pc$E)S %Lid4x` "P( 3<X/\37T3d,0pb3Pi2 d$4$}0:/Nx4`k!,m401T#8h#0A!_0/3s$$T!$"\ (l" T 24%?h)HIh"]\"dl .Xy##d#)#/q4 cxcc(3(H,1dp%7"h+ :"<K+_#@l43dq$LzTQ23 !X!$D1@Hc?$$D%tb!d  2\0 e1<C2Y$i+,s\&0\'x}/@P%t`4l#"б%Db`'X 5(| ,+$'k*3D)D$,d[1kc~`c4|$+d ct7%5%<I4H~_z1H%dc  1"P.('_0_9h \L4f#\o+dx"x!he321j0HbD) 2P 0& l/`8  cD h$XM 3X _e #lv y, /( 80d  c /$ Ly4 1 p( &7  /< D0!|-0!dt#!,'!15!D&$F!%Q!?!(h!A7}!0%!Lb !_!0d!0K_!4\!38! ('<!@4!Dm.!L*L" c"t+ %"$.$3"4$d?"$@G"d?7Y"n_a"_g"8 1Xt"H2}"N#$"2"x%"46%@""T"_"D4",d"(."H7 "7,\#5!#15#ء E#K4 S#D.x`#1l#4|#0c#/#,#8#|&L#((<#R(# c#34 $+$tc($|U(A$ U$@2Dj$/4~$$$"X$p"0L$$' $ (L$d#@$'0$2`$ԫ!@$@3 % |%(!,%2G%.LY%G&e%@3Pz%X'%+x%>1%$%" %l"(%( 1%*/%&X%X1#%@!$&/ &7 &.5&A7I&L'7R&c\&x @d&J,q&o2}&p*&|1&T0&P~_&7x&ܯ,|& "&d4(&4#'h"$ 'h"'|/,'\G$6'T/E'&M'%`X' 7f'@2,v'-'3 ' )'$',2'%d'!#'p2'*'@<7'#(%d (D7(ظ0 *(`"$3(L49(`2L(6(,e(x$m(v_}(t3(Գ2(H# (t_(x/(x7( ( 3d (k/(Z#)94)2d#)<)4)q5 A)&HK)$Y)L7_) cg)#@)lM_)!)03)h50$)M_)\u4)O!0)b *4*!4%*@D3T5*)@C*7H*3h[*0Xo* O_*8r5*i48*,%<*?/*18*P4*@c*|b*\k.D*S3+ P+L$`#+/9+y%0D+P'7M+q_X+l$0f+*`r+T(8|+`$14+,+%`+'+(&+$#+/$+'<+(T+@Z%,7,$k.8$,H)'h6,"`G,\#|X,x?7k,+ l{,dz',$%,3 ,1,g/,X'7,",%,\55,$&->/p-<c!-~_ .- +G-(O+xW-*.f-Tb4P}-`% -37$-+--7$-'-53-`_-$-%P .P/0. $.Lb0.4)2=.(1K.%U.@8$`.0du.4.b.d..~_$.04.#d.%'.&\.T(P/c/.d#/c4/a#B/!M/>3X/M_b/1u/,c/ܝ%/3/1/>$/dh*,/,!/,!l/82/_ 0U!,0l%(0 .50`!I0p7a0%n0@!p~0`l10,,/0S.\0404Q_0/0!0430T"10d'%1$ 19710!,1X*91@ 2K1Xv*@W1 &$e1` s18%~1b1<0,1 D1 ,L1f(1541n/d1|"#x1y$,1~22I!X2t0@ 2`?732+E2']2`/\d2| )Hn23|2d)2|!L2p42 42Pb27 2B/2x.L2&2x2X2$!3X $!3- L23D4,>3xY-xT3c ]3 07s3@_|3c&3p 4T3H)d343_3dn/3.3n)30*P3%40"84%\#4dy0247@4!`J4C/PV4{)`f4&0o4+7z4"\4l0481 4k.42D4dM_474$$4D*4X2H435L_ 5z$05#,5l XA5|,O54Y5!Hh51$t5q#|5%d5\35b25,5D753P52515*h6D)%0 6$6\-!6K_.6h"(66!C6& U6)d6+w6 c6 '6D.(640P6>76t $6t4636q364 7!783<(7l417U1`?7)7 G77b7D5l7W3y7?77TY%x7X! 7@47_73`7/7T.%747*1p8.d 85H'8t'768b=8\0HO80`8f&l8Hbw8,3d8hQ+8`,7$8P!$8`q08%|8b8b8x48(9<79.9!)9 0C92V9*f93Hv91L90#$9p5 9`w49. 9P4$9b.<9|#91p917: &!:0-:1d9:'T:2a:`1 p:x#:0:m1|:4: l:`&7:%:3:2`:${0:4;t#d;V(&;|'8; bB;`.X;X>+Hl;|;"~;K ; );T';܏4;|+> 3p'>h3 :>" G>HcR>z.c>p'<z>(!>#8>@&>L!D>10>d,>H0H>y_\?XY.P?8'*?hb3? @?0 M? 7V?5,dg?,Hx?!d?.7?Ԕ.?_*?7?\/P?,?0$(?hS#@c @ @p/P4@&PE@dh#\Q@3Hc@1s@y't@L&H@L&h@p,8@$1@ @t.+@hY$X@LW1\@2@#ApbA 4(A,K20(AT/2A30BA m.UAlk!_A}.$sA ,7@~AH4#hA$A74APbAlu4A`%A. HA%dAdR(ADK_B$ B10B07$>BXG7(IB@1hZBT55oBD,vBx+Bu4B,) B-Bw4B07 B$cBD)HCx(tC?&(C7$Cx0(6CT'RC" cC8'{Ch5C@,C|+HC+3C@"4,C4dC! Cش0Cu4CC1h DdD|B()D$4D8D"FD(0XDȀ_eD4&qD%@|D+@Dl<)DD(D17D@7D4,|D97D$! E51 E+0EX_9Ex3@QE|(_E%@hE,%TrEbzEly0El"E\/E pE+xE8Q_EI_HI18WIy4jI_yI,+PI!IJ_IxbI 2I,{0I|!PI02<I0) Jp?7Jc#JX7L.J2(=J cKJ !`YJ caJ S& pJ&|~J &7J"#J@7J%lJv!J$,+J"1DJp'7J>1$K8*Kr_K&0X,Kȓ!=Ku_DKh_\K8s_gK K_tK$0KW/,KԶ.K-XKx)<K|+$ KLbK^#K6!K/7 L0`L{1@L{+-L&=LL1KL cULL3dL<1wL[,@L#'XL2XLX%L ,L$K'pL@D(LhQ'L08& L}0M''M18MXp)AMclJMA7VM4'lnMP$xMD37$M1,M&"M M((Mp_(MȻ(pM_M_M*N -pN&8$NL(&L/NK4>N1hLN% XNl)dhN4oN(lN$8N&,N/7$Nԇ!Nz4N.(N67N. Ol(t"O@w&T1Oz4DOcNO0'h]OP(4pOp_O8"LOh27$O<0dOcOh{#8O!O=5ObOd)dO@)#Pc'P#0P12PxM_>P'<UPD3`ePq_oP(vP)`P TP- P2XP\0P7Pp2PP|)P3QK4Qd3+Q#|=Q$1OQ(XQ7eQ T{Q4QA7Q<5-0Q*7Q"Q3Q-QT#QHH7(QLz*dQ03 R+R!#R`*<-R#8RP4GR%4@TR8b`RtblRq_wR%\R'HRY"<R2RY.dSY_ZYc"eY_nY87spec_vnodeop_opv_descwi_set_nwkeypfslowtimonanouptimezkbd_poweruvm_map_callrandomreadaxe_tickuvm_page_lookup_freelistlongjmpwi_usb_rx_list_initffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodepcmcia_printarpresolvedp8390_readchange_displayparamchrtoblktblsys_minheritputcharural_update_promiscbufq_default_allocchild_returnrtlabel_unrefne2000_write_mbufuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidext2fs_vnodeopv_descsdofilewritevsdmmc_intr_establishwi_inquire_usbdumpmagieee80211_derive_ptkttyflushsys_setsockoptvop_lookup_vp_offsetscomdefaultrateieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswpowerhook_establishohci_powerwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpxa2x0_gpio_intr_stringuvm_maxkaddrnsphy_cdicsphy_resetrlphyattachpxa2x0_gpio_intr_establishipmforwardingmainbusprintohci_waitintrzssp_read_max1111sys_closeusbd_do_request_flagsrtflushclone1in6_purgemkludgeffs_inode_allocsys_setsidieee80211_encapax88190_init_cardusbd_intr_transferzaurusmod__ashldi3vn_statvop_getattr_descunp_detachnd6_nud_hintether_ip6multicast_minusbd_submatchtcp_secretrti_find__mainwdc_ioctl_getaue_stopufs_quota_deletehardclockwi_read_data_iomyip_ifpwdc_reset_channelin6_domifdetachieee80211_get_authvtagswskbd_cndetachdb_get_variablecd9660_vgetieee80211_inputgeneric_armv4_bs_wm_2if_group_routechangewsdisplay_burnerpxa2x0_apm_sleepfiq_claimohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addrfilt_seltruecomspeedlogusbkqfilteruvm_rb_subtree_spacevn_writechkin_ifscrubarmv4_tlb_flushIdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablesys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszdb_force_whitespaceieee80211_ifattachmmmmapieee80211_clean_nodesuvm_map_spacefitssetjmpprefetch_abort_handler_addresswdc_disable_intrwsdisplay_switchurlphy_funcsuvm_deviceopslogread_filtopsrasops_cursorvndxfer_poolfilt_fifowriteffs_specop_ptcp6_mtudisc_callbackieee80211_add_wpa1copyoutstrext2fs_fifoop_opv_descpte_l2_s_prot_uieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepxammc_matchapm_suspendscoop0_set_card_powertcp_attachwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writesystempagem_zeroural_alloc_tx_listffs_specop_entriesunp_gcingreaddoslabelbdevswbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnamelockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterwi_headttyunblockremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachpxaudc_showufs_quota_free_inode2filt_procdetach__divdi3sys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnamesdisk_busydb_breakpoint_alloctcp_pulloutofbandevcount_sysctlsqphy_statussddetachmouse_copy_extend_linezapm_power_infoarprequestsiginitvn_default_errorusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stalldb_vnode_print_cmdsetdisklabelknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocroutedomainusbf_interface_numberhid_locateicmp6_errorieee80211_hmac_sha1VOP_MKDIRrtl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyip_initidaddloguvm_page_physgetusbf_add_taskmsdosfs_synccheckdisklabelscoop_pcic_attachscsi_mode_senseip_savecontrolstackgap_randomfiq_setregsffs_clrblockusbd_set_hub_featurebpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremque__adddi3uvm_map_inheritfifo_printinfousbf_rem_taskapmopencd9660_syncin6_ifawithscopevop_inactive_descuvm_schedulerzts_pollsync_printnchashvnopsieee80211_rssadapt_inputpool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdwdc_set_driveuvm_map_protectusbd_get_xfer_statuswsfont_enumpxammc_clock_stopprintfpxa2x0_splraisesched_lockcdce_devsrandomwritepxa2x0_cpu_suspendprelist_updateip6_protoxsys_recvfromttrstrtsys_sbrkwskbd_mux_openrandomsysctl_doprockcopyzts_sync_sendwsdisplayopenext2fs_initrtfreepxaudc_freemcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdcd9660_specop_entriesusb_needs_reattachzkbd_cnpollcxscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohnd6_ioctlzssp_ic_stoplcd_set_brightness_internalphyslockaxe_miibus_statchgpte_l1_s_protousbd_get_stringipsec_exp_allocationsbpfcloseusbd_probe_and_attachsys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrwsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultisdmmc_io_write_2sdmmc_io_rw_directpxa2x0_init_interrupt_maskspmap_procwruvm_forkvfs_op_descsuid_findumass_activatend6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromfifo_ioctlttydefcharssigexithidirtypagesin6mask128dead_lookupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPpxa2x0_lcd_powerdb_shift_exprapm_pxaip_caphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputacphy_cdvop_rename_vp_offsetssys_ovadvisesdmmc_printwsmux_attach_scusbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initbufq_default_freewsdisplay_kbdholdscreenufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesocket_poolpgrphashsys_setpgidieee80211_crc_updateprofhzcache_enterdb_watch_tableexec_elf32_makecmdsext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1amap_listpxa2x0_lcd_suspenddb_traptcp_do_rfc3390ieee80211_req2nodesys_setresuidsimple_lock_debuggerrn_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogpcmcia_poweripsec_def_compfc_lmdistancepxa2x0_intr_stringnch_poolsomaxconnsdmmc_card_intrural_readpxapcic_socket_enablepxaudc_ctrl_methodsipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduihashtblieee80211_node_getrssiscsi_get_xsieee80211_get_rtsamap_initffs_flushfilesetherip_allowicmp_sysctlsys_lseekmainbus_bs_subregionpool_cache_getnprocsllinfo_arpmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicewsevent_finiip6statpxaudc_setupuvm_pageboot_allocconfig_pendingmii_phy_updateswwriteether_crc32_leaue_csr_write_1rn_searchipipstatsecureleveldb_consoleurl_matcharpt_keepsavectxdb_printsympte_l2_l_cache_mode_ptsys_seteuidpxa2x0_bs_allocwskbdpolluvm_map_checkprotmax_protohdrcdce_activateural_rf_writedb_access_irq_spzapm_poweroffieee80211_add_qos_capabilityieee80211_cipher_keylensdmmc_alloc_ccbsumass_scsi_attachbufpagesrandomkqfilterusbrev_strsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopsrasops_rotate_fontsysctl_sensorstsleepkern_sysctlnd6_delayin_pcbinitsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremovepxaudc_softintruvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTscsi_user_doneuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortvop_pathconf_vp_offsetsrt_mpath_matchgatecdce_startapmioctluvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstatwddkdrivera4x_bs_r_2db_break_tableuvm_anon_poolfillmapentrytcp_timer_persistrelookupwsemul_vt100_output_esc_hashudav_newbufsys_umasksyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookuppxaudc_hidescsi_inquire_vpdmemmoveicmp_rediracceptapmclosevop_reclaim_descusbd_get_hub_statuswsemul_vt100_detachworkq_create_threaddb_boot_halt_cmdural_attachip_outputbpf_mtapfindblknamenkmempages_maxkue_rx_list_initieee80211_aes_key_wrappool_inituvn_referencelcd_ioctlpcmcia_card_attachbpfreadpxaudc_ep0_intrpool_putm_copym2sysctl_structohci_hash_rem_tdpmap_pinitaxe_ifmedia_stsieee80211_add_fh_paramssysctl_rdstringuvn_attachlasttimefiforead_filtopssysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapieee80211_decryptusbd_get_device_statusspec_vnodeop_psdmmc_verboselookupnchinitexec_mapdb_qualifysnprintfcomcngetcext2fs_readlinkether_ioctlumass_bbb_transferrnd_attachedtqphy_servicescoop_pcic_functionsip6_forwardingural_cdkue_resetarp_allocatedrasops_isgray_bus_dmamap_load_mbufwdc_print_capssdmmc_io_write_1wi_watchdog_usbifindex2ifnetcd9660_ioctlrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallmouse_copy_worduvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreenincoreurlphy_cdhzusbf_attachdefrouter_resetcd9660_ihashinscheckaliasdl10019_mediachangecue_activatettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzapm_enable_chargingsdclosevop_poll_vp_offsetsvop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuiddb_set_cmduvm_unlock_fpageqcpuidsexec_setup_stackpager_map_wanted_lockuao_createdb_free_watchpointssensor_detachbuf_mapaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufwskbd_load_keymapxscale_cache_cleanD_rngcd9660_bufatoffgroupmemberuvmspace_initether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbackssys_forkip_setmoptions__qdivrempxagpio_reg_readspec_openpmap_vac_me_kpmapfilt_bpfreaddb_watchpoint_freeaue_shutdownwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackip6_forward_rtableidsi_freevm_nphyssegip6_randomidproc_filtopsfiq_nullhandleruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesfiledescopensys_vforkpmap_vac_me_uservop_reclaim_vp_offsetscomcnspeeduvm_pager_initcpufuncsCopybufferwinChkNamepxaip_matchdvd_read_copyrightieee80211_recv_4way_msg1db_history_prevmyip_initializedpxapcic_scoop_casync_vnodeop_psys_mkdirdl10019_media_finiuao_reference_lockedpmap_devmap_tableufs_fhtovpwskbd_translatedumppcbusbf_string_descriptorrttrashohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessys_socketdead_vnodeop_opv_descohci_shutdownwi_init_usbzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimeufsspec_writedead_vnodeop_entrieslxtphy_caiso_disklabelspoofpcmcia_cafifo_badopfdfreeuvn_detachtty_countpxaudc_intrraw_disconnectpxaudc_ctrl_closeipsec_ipcomp_default_levelsensor_task_registerKERNEL_BASE_virtremove_coproc_handlerumass_polled_transfersensor_attachbrelvpwdc_loggpio_strobe_pins_c3000msdosfs_mountfswi_stopip6_sprintfzts_ioctlsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmuserconf_parseural_tx_bcnpxaudc_intr1ip6_keepfaithext2fs_alloczapm_ac_onwskbd_deliver_eventdb_eregscom_fifo_probebread_cluster_callbackfdcopypxapcic_event_processb_to_qin_len2maskbus_space_read_raw_multi_2pxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacescoop_gpio_pin_readSHA1Updateifg_headvfs_rootmountalloccue_tx_list_initnetintrbs_notimpl_bs_sr_2rw_initcd9660_openwsemul_vt100_output_dcsuvmcnt_dumpglass_consoleohci_root_ctrl_startcmask_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_lineuhidkqfilterVOP_ISLOCKEDsys_kqueueieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipein6_addrscopebuf_getieee80211_ifdetachdb_searchapm_get_eventbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_node_leave_11gieee80211_free_nodeieee80211_recv_eapolraw_usrreqnblkdevbs_notimpl_bs_wm_2uhidev_detachscancttyinput__stack_smash_handlerukbd_consopsbiodoneural_activatedb_set_breakpointwi_usb_txfrmmaxslpext2fs_makeinodecue_startaue_csr_read_2usb_eventsufsread_filtopsufs_symlinkufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initural_newassocin_iawithaddr__anddi3rt_missmsgdofilereadVOP_BMAPip_dooptionsvn_lockcue_tick_taskrip6_ctlinputcdce_cawsemul_vt100_handle_csiumass_cbi_adscsbdropmsgbufphysscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocsys_setegidwdc_wait_for_statusbus_space_write_raw_multi_4rn_matchfifo_readcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoreceivepxaudc_connect_intrpool_getuextralocsdmmc_discover_tasksharp_zaurus_C3000db_show_radix_nodeudav_csr_read1ohci_root_intr_startffs_dirprefrip6_outputscsibus_cdndflushpxaudc_allocxcompose_tab_cmppxa2x0_lcd_start_dmaieee80211_parse_wmm_paramsrn_insertspec_pollfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defer_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventbsearchif_attachlcd_get_brightnessm_reclaimnameibs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_polltqphy_funcsversionwihap_init_bus_dmamap_synckqueue_initaxe_rx_list_initata_dmaerruvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcbs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputudav_initVOP_REVOKEconfig_deactivateclallocipsec_esp_trans_default_levelbiowaitusbf_insert_transferfilt_ufsreadunixswsccsdb_stop_at_pctqphy_cawsdisplaymmapccpupmap_updateuvm_map_replacepxa2x0_gpio_intr_maskgeneric_bs_sr_1boothowtofdinitarc4randomnsphy_funcsuvm_map_entry_unwiretcp_delack_ticksupl_stopttopenata_get_paramsether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdusb_cdrnd_event_headwsdisplay_switchtoconsolein6_maxmtupmap_enteramphy_funcsundefined_handler_addressSHA1Initsys_setreuidusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecomcnattachdb_var_rw_inta4x_bs_w_2usbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanvop_print_desctcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolsdmmc_disablescsi_initmsdosfs_advlockdl10019_mediastatuswdog_registerkue_attachif_indexlimusbd_free_xferdb_varsfalloclxtphy_cddeadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqufs_lockcomintrsys_accessnsphy_statususerconf_initkillpg1url_tx_list_initwsmouse_mux_openvputonfreelistmouse_removewdioctlext2fs_mountrootieee80211_findrateregyearurl_ioctlpage0setrunnablepool_do_putpxa2x0_pi2c_closewi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkcue_attachpxa2x0_stray_interruptosversionelf32_read_fromhid_is_collectionnsgphy_statuswi_usb_tx_list_initapm_power_infotvtohzieee80211_get_eapol_keyudp6_usrreqratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalbuf_stubieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controllmaxrlphy_funcswsmux_srcopsieee80211_derive_gtkuvm_pagecopyzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDrddkdriverohci_freemmbstatuhidev_intrttyinfodb_flush_lexusbf_transferttyinramdisk_devsohci_root_ctrl_donegetnulldevusb_get_next_eventdb_dmesg_cmdextent_destroydb_lpip6_forward_srcrtif_group_egress_buildzapm_pollloop_clonerwhichqsgetcttsetwaterfilt_apmrdetachdb_last_addrural_update_slotmouse_copy_startpmap_enter_pvmsgbufenabledunp_disconnectufsfifo_writesys_listensys_mountpgsignalfirstcdb_read_bytestcp_rndiss_inituhub_detachuvm_page_rehashvop_getattr_vp_offsetsvop_islocked_vp_offsetsusbf_set_addressffs_fsyncwsmux_mux_openrasops8_putchar12wsdisplay_consinetdomainwsfont_findmemcpywdc_enable_intrkthread_exitaxe_activatecue_newbufsi_getdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrreqfilt_usbrdetachspec_writeipsec_esp_network_default_levelkq_timeoutmaxdb_map_equalin_broadcastpool_page_free_oldnointrfd_getfilemsgbufaddrsdioctlutsnameexit2usbf_set_configaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateieee80211_send_4way_msg2rddumpusbf_set_endpoint_featurecpu_setperfufs_lookupufs_bmapdoasyncfreepxagpio_cdudav_miibus_readregip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createsi_findsdmmc_mmc_commanddb_elf_sym_initwdc_default_read_raw_multi_2ffs_fifoop_entrieslogclosegeneric_bs_wr_4pcmcia_submatchinstall_coproc_handlerohci_rhscudav_detachufs_strategyohci_device_requestkue_watchdogphysical_freeendbounds_check_with_labelif_qflusharc4_timeoutext2fs_checkpathsocantrcvmoreprocess_poolfile_filtopsmsdosfs_renamesysctl_proc_argssdmmc_mem_initext2fsfifo_reclaimpipe_wfiltops__lshldi3cd_load_unloadpxa2x0_rtc_getsecspmap_activatebmtphy_resetvop_create_vp_offsetsconfig_make_softcunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutessdmmc_set_relative_addrnsphyter_cdwsemul_vt100_output_csiin6_are_prefix_equalin6_controlsdmmc_get_ccbpxaudc_bulk_startleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96trapsignalpxaohci_enablemainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterfdcloseexecevcount_attachlimcopybio_doreadwi_do_hostencrypttcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initnd6_useloopbackieee80211_next_modeputsaxe_tx_list_initrip6stattcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsrv_ipohci_add_edwdc_xfer_poolcdce_newbufbus_space_copy_2soacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsdb_call_depthlcdintrdb_printfuhidreadin6_ifaddloopufs_creatend6_optionscd9660_seeknd6_llinfo_settimersdmmc_mem_write_blockfreqmsdosfs_unmountelf32_load_psectionrn_mpath_nextarm_pcache_unifieddb_add_symbol_tablem_tag_nextohci_intr1msdosfs_writebs_notimpl_bs_w_1cue_resetexec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootdb_unaryiophyattachzts_readposne_pcmcia_get_enaddrselrecordpxaudc_caffs_validatecomstopaxe_ax88772_initffs1_compat_readrip_outputpxaudc_bulk_methodsext2fs_accessmld6_fasttimeokthread_qimaxcdcef_txeofwsmouse_matchvop_unlock_vp_offsetsohci_free_seduserconf_pdevuvm_object_printitmbpoolclock_secs_to_ymdhmstcp_canceltimerstqphymatchrip_recvspaceroute_initdb_store_countlink_rtrequestwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdspec_lookuppipe_createfifowrite_filtopssysctl_vnodend6_sysctlpxa2x0_setperfvn_openif_clone_createcdce_tx_list_inituao_detachcpufunc_controlmallocamap_pp_adjrefin_pcbrtentrysdmmc_put_ccbknote_dequeuewi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1umass_cdvcountrd_root_sizevm_page_zero_enablein6_delmultistathzwdog_ctl_cbpxagpio_dispatchwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportsys_getloginpxa2x0_gpio_intr_disestablishbuckstring_initicmp6_rediracceptext2fs_vnodeop_opv_descdetruncdb_elf_symbol_valuescopyoutpfindcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallwsdisplaypollohci_allocxcopyrightsdattachxscale_optionswdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpwsemul_vt100_cnattachtcp_mss_updatefree_pagesffsfifo_reclaimdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufgpio_sense_pins_c3000ip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidpxa2x0_gpio_set_functionhostzeroisbroadcastdb_output_positionrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodcd9660_specop_pip6_defmcasthlimsys_munmapsdmmc_io_write_multi_1pxa2x0_lcd_initializefilt_solistenvsnprintfpxammc_intrwsemuldisplaydevprintarplookupuvm_map_pageableproftimer_trampolinechainallocpmap_copy_page_xscaleifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmdtcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablewsemul_vt100_scrolldownwsdisplay_getc_dummyip_mloopbackbpf_iflistPaste_availwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbufnd6_rs_inputsoabortusbf_clear_endpoint_haltunp_inologkqfilteruvm_tree_RB_INSERTdb_extent_print_cmduprintfsensordev_installdb_clear_single_stepuvm_page_printitmainbus_casoftdep_flushworklistsys_issetugidinitclockssdmmc_decode_cidcd9660_mmapsd_reassign_blocksif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolvfs_bufstatsext2fs_specop_opv_descunp_connectuvm_pagermapinif_detached_startpool_serialxscale_cache_flushD_SEscsi_probe_lunirq_entryaue_ioctlsdrestartvfs_mountedondb_expressioncputypepmap_deactivatert_lookupfc_lookup__bss_start__usbf_alloc_xferif_downndqbfilt_rndreadallocsysVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1uvm_km_pages_headwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headertcp6_usrreqdb_historyeephy_cdinphy_cdukbd_parse_descttytstamptcp_rndiss_cntural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillhw_seriallcd_pxaip_caapm_thread_createuvm_unmap_pcdattachuserconf_devicein_localaddrsys_sigaltstacksdmmc_cisptrsoisdisconnectingwi_media_changesyn_hash2rttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectuvm_map_printitdb_read_variablensgphy_casoftintr_initdb_regsdb_stack_dumpttymodemdb_lbuf_endwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitallcftablesuhub_activateax88190_mii_bitbang_opsin6_ifattach_linklocalVOP_REALLOCBLKSsys_setresgidmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctlwsdisplay_clearoncloseudp6_recvspaceuvm_km_freesys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirinsw16rt_setmetricssys_getegiddb_set_single_stepusbf_config_descriptorumass_init_insystemdirchkexphy_resetipip_outputpipecloseext2fs_fifoop_entriesVOP_REMOVEwi_usb_activateconsinitsdmmc_scsi_minphysurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrsensordev_listminidatacleanrt_timer_queue_destroyzkbd_syncwi_cdsd_cdicmp_mtudiscipport_hifirstautosys_fstatlcd_show_screenuserconf_enableukbd_sunlayoutext2fs_vinitdb_endlpumass_bbb_resetffs_alloccggeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinituvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmacieee80211_dump_pktsys_unmountbootdvapmkqfiltermainbus_bs_tagelf32_probesin6ifa_ifpwithaddrvgonelsofreeeephyattachinphyattachctrl_eventcomsiraddrdb_del_symbol_tabledb_add_exprpmap_removebpf_mtap_afusbf_free_xfermtx_initicmp6_fasttimoext2fs_removeif_clone_destroywdccommandcdcef_ioctlpxaintc_attachmyipbpf_setfuserconf_historyuvm_page_unbusytk_noutext2fs_mountpmap_collectukbd_enabledb_symformat_elfgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstampip_randomidaue_tx_list_initsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachvop_poll_desccddumpdb_search_cmdpxa2x0_lcd_alloc_screenasttcp_disconnectvop_open_vp_offsetsuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborwsemul_vt100_output_normalunp_rightshostnamedb_print_llinfowsdisplay_emulbellupl_outputext2fs_bmapuvmexpsensordev_getufs_diremptyreinsertfinishdupsleep_setup_timeoutukphy_serviceqsphy_resetpool_destroylogwakeupdl10019_mii_readregshutdownhook_listip_dosourceroutesoread_filtopsieee80211_media2ratebdevsw_lookupdisk_changewsemul_vt100_resetopsdmmc_create_threadsc_devsamap_lookupsdoreallocblkscache_revlookupbpfread_filtopssoinitVOP_MKNODuvmpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometryhw_uuidext2fs_truncatecd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorax88190_media_finiprefetch_abort_handleruvm_km_threadlminscsi_probe_bussys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopenscsi_test_unit_readyural_set_bssidarc4random_bytesnmbclustural_get_rfvop_reallocblks_vp_offsetssominconnpcmcia_matchnchashtbluvm_vnp_syncusbf_end_configusbf_add_configwsmux_set_displayieee80211_get_disassocwihap_assoc_reqarpt_downwsmoused_wakeuprdgetdisklabelarm_pdcache_line_sizebpf_tapdb_lookupmii_phy_autorasops15_putchar12wsmousedmax_datalenwsfont_rotatemsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2db_lastsymurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1usbd_dopollvinvalbufmii_bitbang_writeregsys_ftruncatem_splitsoftintr_disestablishfifo_pollurl_stopzts_irqtcp_timer_initdb_tab_stop_widthdb_putncharsmainbus_bs_unmapnd6_maxnudhinttcp6_inputsosetopttcp_msscache_purgeudav_stop_taskbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0pcmcia_intr_disestablishfork1curpcbdb_activevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquenumbufpagesttreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriespxaintc_matchtcp_rndiss_msbsys_chmodprelist_removeffs_vgetaxe_encapinitproc__umoddi3arm_dcache_alignip6_log_intervalwihap_auth_requvm_page_physdumpwsemul_vt100_nextlineX_db_sym_initsyn_cache_timervt100_initchartableslcd_paramieee80211_auth_opensolisten_filtopsprocess_kernel_argsin6_update_ifa__wdcerrorcdce_detachpxa2x0_intr_disestablishvop_bmap_descsuser_ucredsd_shutdowncom_is_consolewi_shutdownmem_noext2fs_buf_allocdp8390_starthicleanpageswihap_sta_deletemainbus_bs_rm_2pmap_free_l2_bucketrevarprequestkernel_mapwi_init_iodumpdevwsmouseioctlcd9660_lockieee80211_mgt_subtype_namedb_not_taken_bkptvfs_mount_foreach_vnodekqueue_kqfilterwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsohci_device_bulk_start__guardtcp_mss_advin_ifaddrzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readm_freepxaudc_ctrl_startvop_default_descne_pcmcia_dl10019_get_enaddrurlphy_attachieee80211_get_assoc_reqscsi_inqmatchfdesc_poolusbd_add_drv_eventvop_strategy_vp_offsetspool_page_allocscoop_powerin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollpool_head_slockbadaddr_read_4bzerotickfixintervalmii_bitbang_syncarmv4_drain_writebufufs_closefixjobcsdmmc_matchdb_show_all_cmdsusbf_set_endpoint_haltscsi_execute_xsin6_addmultirn_newpairvop_setattr_descdb_find_breakpoint_heresd_kill_bufferszts_enable__udivdi3sys_obreaksdmmc_intr_enablepxapcic_attach_cardpxa2x0_gpio_set_intr_levelusbd_set_config_nousbpollieee80211_parse_wpa1lastddatepmap_curmaxkvaddrin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinittcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdamap_allocVOP_LOCKMD5Finalwskbd_matchieee80211_aes_key_unwrapcp_timeaxe_rxeofcd9660_vget_internaldb_page_print_cmdwi_intrrw_casvgetrd_attachpxa27x_cpu_speed_91ieee80211_create_ibsswsmouseopenwinChksumfreeclusterchainmld6_initmainbus_bs_w_4disk_initpxapcic_intr_establishcd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsrip6_ctloutputnetioaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createpxammc_intr_cmdusbd_bulk_transfer_cbwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_cabmtphyattachsysctl_dopoolcd9660_fifoop_puhub_matchpmtu_expiretcp_respondsys_readvamap_cow_nowroundrobinsa11x0_intr_establishbadaddr_readuvm_map_createvfs_opv_initissignalwdprintCopybuffer_sizenetclsfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvpuvm_pglistalloc_simple_setsoftintrigmp_joingrouprandompolluiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_allocdb_loop_countwi_intr_ackfiq_releasebpf_reset_dnd6_dad_stophid_start_parseuseloopbackscoop_pcic_socket_setupuvm_waitfilt_apmreadnexecszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micpmap_bootstrapbs_notimpl_bs_wr_2ipsec_auth_default_levelsys_mqueryarm_picache_line_sizebigadjkmeminit_nkmempagesspeedtablesspec_vnodeop_entriesusbd_new_devicewi_pcmcia_detachfillinusemaprecvitfill_kproc2bmtphy_funcsusbf_get_descriptorscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blanklog_openevcount_initfragtbl124userconf_totdevvop_inactive_vp_offsetsxscale_cache_flushIDrt_tablesrt_ifmsgrealitexpireipstatunix2dostimescsibus_caurl_newbufusbd_delay_mscrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrdl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_swap_getext2fs_reloadurlphy_matchelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemuvn_flushurl_cdnsgphy_servicesdmmc_del_taskwskbd_holdscreeninferiorxscale_cache_purgeD_Eukbd_attachclusterallocext2fs_fifoop_prt_if_remove_rtdeletewskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_caudp_notifysdmmc_app_commandnetrndintrendtsleepwihap_check_txuvm_pageratopsigactssharedb_set_watchpointbpfattachif_detach_queuesitimerdecrusb_create_event_threadether_outputpmap_bootstrap_pv_page_freebpfilter_lookupm_copym0sdmmc_io_detachaxe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriternd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocnetlckbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrpxapcic_attachcomprobe1getphysbufcdsizedb_symbol_valuesumass_lookupscsi_deinitdb_evarsupl_activatewsmouse_mux_closeufsfifo_closewakeupgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2pxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_bufferrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2iduvm_vnodeopsvfsconfVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesmsdosfs_vnodeop_pieee80211_send_eapol_keycomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopendoscheckpathpcbmapnd6_option_inituvm_km_alloc_poolpage1ext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfilt_ufswritert6_flushrd_ioctl_serverpxapcic_io_freeuvm_mlk_callgeneric_bs_r_4pxaudc_epN_intrmmrwffs_bufatoffieee80211_add_ds_paramswi_usb_rridrespuvm_errno2vmerrordohooksieee80211_rssadapt_chooseukbd_activateaue_setmultiif_detached_ioctllocnampvop_close_descwi_usb_causerconf_showip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodespeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachsysctl_emulsys_sigprocmaskdb_commandin6_if_upfilt_pipereadskip_spc_rightpxa2x0_intr_establishsoreservepidtakendb_formatconsoleuvm_mmapusb_activatepxaost_attachscsi_report_lunsufs_quotactlaroundin6_pcbnotifystrrchrusbd_clear_endpoint_togglegetdevvpm_clgetdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangetickdeltaisodirinodb_strlcpycfrootsscsiprintwsmousepollchrtoblkuserconf_pdevnamminphysukbd_matchurl_tickztsavgloadedtimeout_mutexcd9660_specop_opv_descether_addmultivop_mknod_desccdce_cdip6qffs_vptofhifunitvfs_isbusyirqstackbawritetputcharwskbd_detachpmap_postinitpool_print_pagelistffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowndb_breakpoint_cmdcd_powerhookvwaitforiopxagpio_camii_phy_ticksdmmc_io_function_enablecd_read_subchannelextendfilelortrequesticmp6_inputwsemul_vt100_outputuserconf_addsdmmc_io_write_4ohci_device_intr_methodswi_func_iocreatedesbreleasedb_history_sizemsdosfs_islockedieee80211_getmbufmax_linkhdrumass_attachwsdisplayioctludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetssqphy_serviceuserconf_hist_eocuvm_map_reference_amapext2fs_getattrrtlabel_id2nameusbf_setup_default_xfersbdroprecorduvm_coredumppxaip_searchwdsizesdmmc_io_scanacphy_statusip6_sysctlsuserusbf_devinfo_setupdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opssdmmc_io_function_readyclusterfreeieee80211_alloc_node_helperrootdevufs_ihash_slockm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptordumpsysicmptstampreplif_detached_watchdogusbd_ar_pipeext2fs_fsyncdoforcesys_fsyncwi_usb_stopuserconf_add_readusbd_reset_portuvm_mapent_copyifconfcpu_apmwarnamap_wipeoutuser_configdb_map_currenttcp_rndiss_nexttcp_outputnsphyattachpxammc_intr_data_bus_dmamem_mmapwsdisplay_emul_attachsdmmc_mem_read_blockupdate_ledsext2fs_updatepxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodebuf_putif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppfifo_lookupsdmmc_enableffs_reallocblksrandomcloserootvpaxe_miibus_writeregpxagpio_intrlowieee80211_eapol_key_decryptpcmcia_intr_establishuserconf_maxlocnamespool_reclaiminitdisklabelusb_quirksbpf_sysctlvflushcddetachpmap_clear_modifytcpctl_varsarptimertcp_reass_limitruaddrdstrategym_copymmouse_copy_extend_charbcopy_pageip6_freepcboptsdb_free_breakpointsif_upwsfont_getflgne2000_ring_copysdmmc_set_bus_powerupl_intrural_matchVOP_BWRITErt_timer_queue_createwddonemsdosfs_ioctlupl_matchsys_openrasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangepgdeletepxapcic_intr_stringuvm_pageidlezerosdmmc_io_initusbf_do_requestwskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabsieee80211_media_changeraw_attachural_set_rxantennadb_boot_sync_cmdmax1111_adc_value_avgastpendingether_ip6multicast_maxpipe_pooluao_initvop_abortop_descsdmmc_needs_discoverifa_ifwithroutescoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolrandomattachsys_sstkdb_print_positionrtflushclonedb_radixgetblkmouse_pastedead_vnodeop_pdl10019_stop_cardmouse_copy_endxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initwskbd_repeatvtypesdata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrtcp_identtcp_rst_ppslimrtrequestifinitcd_load_tocunpst_recvspacene_pcmcia_attachkue_initxscale_cache_purgeIDraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachnd6_ifattachunpdg_recvspaceoutswm8pipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathcdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkdb_elf_lookupm_tag_findinittodrvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrusbd_get_configufs_quota_initkqread_filtopsusbd_setup_pipexscale_setttbxscale_cache_cleanIDaue_csr_read_1pcmcia_check_cis_quirksieee80211_beacon_allocbioopscpu_classesbpf_setdltmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocpcmcia_card_gettypepxa2x0_clkman_iohufs_ihashinsin_setpeeraddrwdcactivateeephymatchinphymatchpxa2x0_a4x_bs_tagdb_readlinewsdisplay_delscreenether_ifdetachieee80211_recv_probe_reqvop_fsync_vp_offsetsuhidev_get_report_descuserconf_histcurrndstatsmsdosfs_inactivecurrent_intr_depthpanicstrwsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeunpdg_sendspacesession0viscpywsmouse_do_ioctlhw_vercopyin__umodsi3comparamural_stopudav_sendcd9660_defattrohci_device_bulk_closertalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetne2000_read_hdrsigacts0scoop_mmc_attachpager_mapfindblkmajorntohlsorflushiophy_funcsusbf_create_threadlcd_matchttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelaywi_usb_infofrmsdmmc_io_read_2ffs_mountwsmux_mux_closeext2fs_specop_entriesicmp6errppslimbadaddr_read_2usb_desc_iter_initusb_neventsdp8390_mediachangeconfig_process_deferred_childrenohci_ifcdwsdisplaywritepool_cache_reclaimxscale_cache_purgeID_Esdmmc_decode_csdbs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootmii_bitbang_sendbitstqphyattachusbd_finishsoftnet_intrhandbpf_getdltlistm_tag_getsb_lockohci_root_intr_abortrt_labelsupl_watchdogsuid_clearttwriteswapdev_vpdp8390_resetpxa2x0_bs_mapdead_readusbf_reallocpxapcic_socket_disableufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutvop_symlink_vp_offsetsunputcendpcmcia_verboseVOP_CREATEprobe_switchcdce_stopvop_readlink_descrasops_copycharuvm_map_referencespec_ebadfphtree_SPLAYnd6_recalc_reachtm_intervalin_ifinitfifo_closeohci_device_ctrl_closerasops15_makestampwi_pcmcia_activatein_pcbhashlookupapmread_filtopsmainbus_bs_mmapural_writecd9660_vnodeop_opv_descVOP_ABORTOPieee80211_hmac_md5_vsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_poolwi_inquiretcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachif_clone_listsys_futimessdgetdisklabelwi_do_hostdecryptinternal_commandmalloc_errintvlin_losingVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchvn_ioctlwi_usb_ctl_lockufsspec_readdb_show_calloutaxe_cdpipespacefiqvectorohci_alloc_stdip6_sendredirectsddb_sysctlukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsieee80211_node_join_11gaxe_setmultisyn_cache_countieee80211_add_xratesusbf_errstrnd6_timer_chne_pcmcia_ax88190_set_iobasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachwsmouse_add_muxbdevvpifa_ifwithdstaddrdb_watchpoint_allocudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pageuihashpxaudc_read_epNrijndaelEncrypttcp_keepintvlvop_reallocblks_descvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchzts_sampleswihap_sta_findusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocwrite_multi_1aue_tick_taskcpufunc_faultaddressdb_preveephy_funcsinphy_funcsbswap32ipsec_exp_first_usecdcef_cdrlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreepool_prime_pagesys_chownuvm_pagewirerasops_putchar_rotatedin6_joingroupsys_munlockuvm_anfreedofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlemclpoolscoopmatchvfs_getcwd_commonset_cpufuncscttyioctlffs_vnodeop_psys_lstatfilt_rndwritescoop_gpio_pin_ctlieee80211_recv_wpa_group_msg1ohci_timeout_taskohci_hash_add_tdiso_uiodirurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapfifo_vnoperatedisknamesumass_quirksdumplomsdosfs_mountacphy_funcsffs_clusterallocnullcnpollcuvm_km_initbzero_pageffs_sbupdateudp_sysctlax88190_mii_bitbang_readbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolnkmempages_minvop_mkdir_descukbd_accessopspxapcic_io_allocusbcloseudav_matchpxauart_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbllcd_set_brightnessetextifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_masksysctl_cptime2sdmmc_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argsvt100_selectattributeumass_scsi_setuppxammc_clock_startproc_poolaue_intrmainbus_bs_wm_1udp6_inputsys_writemap_forwmergedb_get_valueural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immed__bss_end__wsdisplay_maxscreenidxcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2db_inst_countdb_read_linewdc_ioctl_findwsdisplay_switch1wd_get_paramsbread_clustersys_readlinkext2fs_sizecpufunc_faultstatus__ashrdi3bs_notimpl_bs_mmapohci_intrxscale_cache_flushI_SEwsdisplay_burnpmap_dump_ncpgip6_auto_flowlabellf_splitifafreeVOP_STRATEGYtzpxammc_card_intrxscale_cache_syncIrip_sendspacexscale_cache_cleanID_rnguhidev_writeamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcsdmmc_read_cissoftclock_siwi_usb_threadzkbd_ioctlin6_pcbsetportalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnpxammc_exec_commandpmap_dumpcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufdehashtblsocketopsX_db_sym_numargsnd6_maxndoptip6_iduvm_map_clip_startffs_fragextendrawcbtablespec_readfiq_nullhandler_endunp_markacphyattachicmp_mtudisc_timeoutnwsmuxskip_char_righta4x_bs_r_1pmap_zero_page_xscalettyread_filtopsusbd_bulk_transfervop_lookup_descdb_map_addrgetinoquotafifo_ebadfscsi_do_ioctlrtable_existscd_resettimedeltaX_db_forallscsi_detach_busudpstatsetrootcsr2cd_read_tocural_amrr_updatecdioctlcue_stopifmedia_addlxtphy_funcsusbd_set_config_indexlogopenieee80211_add_rsn_bodybreadntcp_hdrsztcbtableieee80211_recv_4way_msg2__xordi3frag6_draindosdiremptyidleigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupvop_fsync_descwi_usb_intrusbd_alloc_buffermask_rnheadproc_isundersi_headpte_l2_s_protoufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRusbreadpmap_kremovesigactsinitsdmmc_io_rw_extendedusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttywdc_pcmcia_cauvm_pagealloc_stratural_bbp_readpxammc_host_resetusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discoip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoltcp_drainpmap_l2dtable_ctorm_pullupenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEMPFailwsemul_vt100_output_string_escpxa2x0_rtc_getalarmcnbellm_copydatainswm8cd_setchanuvm_cnt_headieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedieee80211_recv_probe_respwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctldb_nextumass_matchsendsigsdmmc_print_cisohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlvfs_busymouse_copy_extend_afterfilt_ufsdetachlf_getlocksolistenwskbd_compose_valueip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnuserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachpxammc_card_detectpxaost_matchieee80211_ibss_mergeboot_filefilt_sordetachpsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadamap_pp_establishuvm_anon_initffs_reclaimbmtphy_causb_free_devicexscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spaceieee80211_eapol_key_check_micpage0_endusb_disconnect_portieee80211_add_capinfobpfpollupdatepriohci_activatebmtphy_serviceuhid_cdwskbd_cnbellvt100_decmodeoutswwi_seekfilt_soreadpmap_remove_allrtable_addzeropageipsec_def_encpool_logsizeffs_nodealloccgsoftintr_establishpxaudc_detachip4_input6pdevinit__iordi3nsphytermatchinetctlerrmapffs_specop_opv_descresetpriorityusbf_device_descriptorrasops4_putchar16enoioctlwi_usb_start_threadsigacts_poolexecsigsconfig_initcpufunc_null_fixupip_weadvertiseicmp6_redirect_inputrw_enteraue_read_macdb_access_abt_spscsistrategynd6_ra_inputffs1_blkprefin6addr_loopbackttypendin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyieee80211_wep_cryptX_db_symbol_valuesusbd_reload_device_descext2fs_advlockknote_fdcloseif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpvfs_opv_numopsvfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startmouse_hidezssp_matchin_interfacessyn_cache_respondif_creategrouppxa2x0_gpio_set_dirllinfo_nd6sbcheckreserveuvm_iopreemptieee80211_begin_scanunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatnsgphy_cdsyn_hash1ulminwihap_data_inputpxa2x0_lcd_free_screendb_last_symtabproc0paddrrn_addmaskusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_poll_randseedrtafidx_maxsig_filtopsohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapnet_sysctlcom_cdusbf_devinfo_freexscale_cache_cleanD_Ewskbd_do_ioctldead_ioctlfill_eprocaue_initusb_match__wdccommand_startsdmmc_complete_xssysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputdb_stack_trace_cmdusb_allocmemufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputvop_ioctl_vp_offsetskmemusagezapm_suspendlf_getblockusbd_add_dev_eventtcp_rttdfltcleanerprocfifo_reclaimieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainohci_handoverusbd_intr_transfer_cbusb_event_threadsowrite_filtopsstrncpyrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipeupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastrrticks_initusbd_set_port_featurebpfilter_createsysctl_lockax88190_mii_writeregcdrestartlockfpoolwihap_disassoc_reqrasops_copycols_rotatedcpu_switchtoieee80211_find_nodehtonluvm_km_kmemallocusb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactiondeupdatzapm_get_event__negdi2in6_purgeaddrcpu_modelarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagdl10019_init_cardbmtphy_statusdisk_unbusysysctl_filesoisconnectedurlphydebugamap_clean_worksusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modesdmmc_delayxscale_cpwaitvattr_nullsys_getsockoptuhidev_attachfrag6_nfragpacketspxapcic_pcmcia_functionsdb_linein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKumass_cbi_methodspxa2x0_intr_bootstrapdb_ed_stylensphyter_funcsmii_submatchuvmexp_printohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelpxa2x0_setsoftintrbpf_m_xhalfaverunnablecd9660_getattrttyfreettysleeplcd_cddp8390_initzapm_bcintrunp_disposerd_open_hookscsi_inquireufs_getattrieee80211_mhz2ieeevfs_exportpxammc_scoop_cauvm_km_pgremoveramdisk_ndevsex_region_plfscaleffs_alloccgblkpxaudc_disableip_optcopyvfs_registerscoop_mmc_matchieee80211_proto_attachsys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_totimeout_tododb_lccpu_read_cache_configrasops8_putchar8wsemul_vt100_scrollupzkbdsleeptvpanicget_pc_str_offsetL_cksumdataural_rxeofcue_rxeofmsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordieee80211_recv_group_msg2softdep_initializencvhashtblunp_shutdownieee80211_tkip_encryptwi_resetext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuevop_lock_vp_offsetspxa2x0_gpio_bootstrapwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initsdmmc_start_xspcmcia_attachpte_l2_s_cache_mode_ptdeferred_config_queuedp8390_getmcafipport_lastautowsmux_detach_sccd9660_fifoop_entriescom_raisedtrdb_last_commandpxaudc_bus_methodsicsphy_statuswinSlotCntvn_kqfilterfiq_getregsext2fs_syncpte_l2_s_prot_maskudav_ioctlcache_purgevfspostsigsys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdmaxrasops_reconfigumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templatemsdosfs_readdb_object_print_cmdohci_initcomopenusbd_setup_xferieee80211_tree_RB_MINMAXbcopywsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physwsemul_vt100_output_scs94scoop_cageneric_bs_rr_1axe_resetlcd_get_backlightdefrouter_addreqin6_clearscopefifo_vnodeop_entriesusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaitmemcmpwskbd_init_keymapmsdosfs_createcd9660_startdb_output_linezkbd_hingecomstartdb_examinecfroots_sizedb_end_linetickadjvop_rmdir_vp_offsetstcp_secret_initsbreserveundefined_initvrecycleextent_printieee80211_alloc_nodecrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_listsysctl_stringsys_rebootpxammc_host_maxblklenpmap_dump_allbufpooldl10019_mii_bitbang_writeMCFailwdccommandext_bus_dmamap_load_buffercpu_forkwi_write_data_ioscoop_checkdiskdb_print_ifattylistwdopenuvm_vslockttyoutputkue_causbf_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configpcmcia_scan_cispxa2x0_memctl_iohclockintrrn_mkfreelistvop_bwrite_descVOP_READin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimegetdisksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureufs_quota_free_blocks2senditudp_detachlcd_bpp16_screencluster_writernd_event_tailusbf_add_endpointuvm_setpagesizetcp_xmit_timerin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bittickmclpool_warnmsgdb_termscsi_preventmmcloseieee80211_get_assoc_respnumfreepagescd9660_accessffs_statfsscoop_set_sdmmc_powerrijndael_set_keywdcprobeiophy_cdudp_recvspacewdc_ioctl_strategya4x_bs_w_1bus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputstuck_keysufs_dirremoveworkq_init_syswqpxagpio_reg_writeieee80211_add_timcinitif_attachsetuppipe_writevop_symlink_descin_pcblookup_listensbappendm_copybackpxammc_cduvm_swap_puticmpbmcastechofifo_advlockdb_continue_cmdbufheadconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitpmap_copy_page_funcpxa2x0_lcd_attach_subscsi_runningripsrciso_nchstatskue_txeofural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_alloc__wdccommand_donesdmmc_function_freeumass_adjust_transfersignal_initnsphyter_serviceffs_updatedb_print_formatwsmuxclosedp8390_getpxaudc_is_deviceunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopsdmmc_intr_disableip6_ecn_ingressusb_discovercomdiagextralocunsleepwdprobeX_db_lookupmtdphy_funcsohci_alloc_std_chainipintrgetnanouptimesdmmc_scsi_detachudav_activatemaxdmapural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontroldevice_registerq_to_bmountrootsdmmc_scansyn_cache_resetdb_inputcharuhidev_opendb_boot_cmdsundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportsysctl_rdintcd_interpret_sensein_mask2lenural_eeprom_readpxagpio_matchlodirtypagesfindwin95VOP_WRITEsys_nanosleepusbf_free_bufferstart_init_execifa_ifwithaddrclock_ymdhms_to_secsdb_write_cmdif_clone_attachwsmoused_releasesys_getfsstatohci_abort_xferbpfopencdstrategykmemstatsnd6_slowtimo_chuvm_km_valloc_aligndb_max_widthmalloc_printitcomwritemouse_copy_selectionVOP_RENAMEcdclosesys_fchdirsdmmc_scsi_cmdgreen_onsysctl_ifqprocess0pxapcic_mem_freeieee80211_send_eapol_key_reqrandompidwd_cdurl_initusbf_open_pipe_ivalfilt_ttyrdetachsdmmc_mem_send_op_condarp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdieee80211_hmac_sha1_vpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswdog_timeoutwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strsusbd_sync_transferffs_vnodeop_entriescdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initsync_vnodeop_entriesproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallspr_rmpageffs_initsdmmc_submatchcluster_wbuildpxa2x0_gpio_clear_intrbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featuresys_xfspioctlif_free_sadldb_dotsdmmc_attachieee80211_node_joinfilt_bpfrdetachwsdisplay_emul_capxa2x0_clkman_configicmp6_initrasops15_putchar16disassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrrandom_statebpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_poollastpiduvm_page_physloadreset_entrywdc_exec_xferwdcresetipintrqohci_noopmaxprocusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizerijndaelKeySetupEncip6_nexthdrrtdeletemsgsize2cqueue__bss_startkue_rxeofrasops4_putchar12VOP_KQFILTERukphy_funcssys_msyncvop_rmdir_descwskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachconfig_activatememsetpipe_free_kmempxa2x0_splxufs_getlbnsohci_strphysiopcmcia_3cxem556_func0_cfe0in6_selecthlimupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncpxauart_attachicmp_mtudisc_cloneclass_cmp_spllowersodisconnectpool_allocator_oldnointrsys_setgroupsmainaue_csr_write_2lxtphy971_funcsthreads_pendingohci_device_bulk_doneusbd_initmtdphymatchrasops_init_devcmapural_set_basicratesip_flushieee80211_crc_initkue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1icmp_errorinpcb_pool_initalizeddb_hangmanukbd_delayed_decodewsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbadkqueueopsvholddb_help_cmdrt_if_removeusbd_no_quirkm_adjmld6_stop_listeningpmap_map_chunkppsratecheckscsi_free_xskmemlimitlcd_poweramap_copyphysical_enduvm_rb_spaceuhidpollieee80211_ieee2mhzieee80211_dup_bsslf_findoverlaplf_wakelockdb_sym_numargskue_attachhookdumpconfwi_rxeoffilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badoppxaudc_is_hostcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closestrlcatwsdisplaystoppte_l2_s_cache_modeuvn_initifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8cdce_matchsoftintr_dispatchdisk_unlockufs_ihashremcttywrite_bus_dmamap_createurl_stop_tasksdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumberudav_attachusbd_get_hid_descriptorrt_ifannouncemsgsoo_readscoop_resumeufs_opencopyout_statfspmap_modify_pvm_catsplxpxa2x0_rtc_setalarmrtinittqphy_statuscluster_collectbufswi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initunp_gcsys_clock_gettimeip6_hdrnestlimitpool_catchupxscale_cache_syncI_rngfrag6_initbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msftimeout_setrdread__subdi3wsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelrw_exitdupfdopenifmedia_list_addpidhashvfs_mountrootcdcef_encappxaohci_detachxscale_context_switchuvm_totalencdebugdb_unread_chartimedl10019_mii_bitbang_opssdmmc_io_attachstart_initelf32_olf_check_headeruhub_attachieee80211_recv_assoc_reqtcp_mssdfltuvm_swap_freetcp_rndiss_sboxdata_abort_handlerusbf_setup_xferbs_notimpl_bs_r_1axe_initrnd_wseldb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updcd_sizettycheckoutqread_multi_1icmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachaue_carnd_event_spacepmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabip_forwardextent_createrdclosebpf_freeddisklistsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblockuvm_map_lookup_entryhztoicsphymatchvop_pathconf_descbs_notimpl_bs_w_4m_pullup2ieee80211_get_probe_respdead_strategyswi_handlerusbf_new_devicespec_fsync__wdcwait_resetcom_pxaip_caip6_optlenuvm_map_deallocateicmp_reflectzkbd_attachmii_phy_activateext2fs_reclaimffs_ballocsys_getgroupsieee80211_node_attachuhub_cduvm_km_pages_freewi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8uvn_sync_lockpcmcia_function_enableurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donedoclockintruvm_anon_pageinspec_closecd9660_closepxaost_casys_shutdowncngetczkbd_cdrnd_statesm_gethdrconfig_rootfoundcue_cdputcieee80211_phymode_namesysctl_rdstruct__divsi3uhidev_cdumass_scsi_devwsmousereadxscale_minidata_clean_sizeschedcpuurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1wihap_sta_timeoutsoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlusbd_interface2device_handleapm_matchipforwardingieee80211_get_cts_to_selfdb_lexohci_device_isoc_transferusbd_open_pipe_ivalbufhashtblpxa2x0_wakeup_statussyn_cache_lookuparc4random_stateprtactiveksym_upcaseufs_makeinoderasops_copyrowsip6_process_hopoptsufsfifo_readusbd_find_edescwsdisplay_set_cons_kbdfifo_writefilt_ttyreadsys_getpgidcom_common_putccache_lookuprdioctlin6_purgeifrijndaelKeySetupDecdb_boot_crash_cmdurl_detachbs_notimpl_bs_rr_1sdmmc_intr_disestablishumass_scsi_sense_cbrijndael_encryptdp8390_intrrasops_do_cursorwsemul_vt100_handle_dcsin6_ifawithifpieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizesdmmc_io_read_multi_1ukbd_keydesctabirda_onextent_freeuvm_aiodone_daemonusb_cookie_noaddupc_tasksched_syncusbd_clear_hub_featuresc_err1ieee80211_send_4way_msg3db_mount_print_cmdcomclosepcmcia_print_cissetsigvecsys_sendmsguhidopenvn_marktextstrcmpsys_quotactluhidev_matchvop_close_vp_offsetsrndread_filtopstcp_mtudisc_increaseulmaxsdmmc_card_attachin6_pcbconnectdehashkue_cdhook_disestablishexphy_funcsbpf_catchpacketffs_isblockdb_stack_trace_printpxaip_cdzaurus_startusbd_find_quirkuvm_aobj_pooldb_show_frame_cmdsys_adjfreqmouse_copy_extenddb_examine_cmdqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initdp8390_detachata_set_modevop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointspxaudc_bulk_transferttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedpxaudc_bulk_closewsemul_vt100_output_stringwsscreen_attachzts_powerbufcachepercentm_pulldownlcd_screen_listpmap_initufs_rmdirrlphymatchieee80211_next_scanminpmap_zero_page_funcarmv4_tlb_flushD_SEbuf_initip6_initconfig_detach_childrenrawcbukbd_cngetctcpcb_poolmii_bitbang_readregpxa2x0_cpuspeeduhidcloseipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configvnode_hold_listlastdosdateudav_unlock_miiscoop_timeoutufs_linksys_mkfifodb_cmd_searchifa_ifwithafural_read_eeprompcmcia_parse_cis_tuplein6_leavegroupsqphy_caiminsddumpsys_chflagsdelaysdstartdb_machine_command_tableddb_regsieee80211_media_initvt100_outputipforward_rtableiduvm_km_putpagecom_enable_debugportpage0_dataext2fs_vnodeop_pvn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultiuvn_clusterfifo_opencd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregdb_maxoffffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusdb_cmd_loop_donearptfreeipq_lockeddb_show_arptabcom_detachieee80211_ccmp_encryptfifo_vnodeop_pvop_write_descaxe_stopvop_read_vp_offsetsbs_notimpl_bs_w_2ural_set_macaddrdead_printeephy_serviceinphy_servicemii_media_tablewdstrategytcp_rndiss_encryptttyprintfsigcodedb_elf_search_symbolipip_inputieee80211_send_group_msg2db_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringdb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachuvm_tree_RB_INSERT_COLORamap_swap_offpool_allocator_nointrvop_unlock_descsys_sysarchpxaohci_powerigmp_initmii_phy_add_mediaputphysbufcpu_reset_needs_v4_MMU_disablevop_remove_vp_offsetsMD5Initqsbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputusb_dev_openlcd_burnerfrag6_slowtimouvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorphtree_SPLAY_REMOVEpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initpxammc_intr_donescsibusactivatend6_timercomcnpollcvop_open_descusbf_stall_pipeqsphy_servicepxaip_attach__cmpdi2cd_patternssd_ioctl_inquiryraw_detachpmap_get_pdeural_read_multibooted_kernelbs_notimpl_bs_wr_1domainnamelenusbd_get_report_descriptorip_rtaddrfiledesc_initrd_server_loopurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consoleprtrealloccheck_consoleapm_record_eventamap_freein6_domifattachwsdisplay_cnputczapm_restartswreadusb_blk_nfreend6_prefix_lookupcddonesync_inactivespec_printusbf_start_nextlocleanpagesarc4_stirext2fs_lookupmsdosfs_openext2fs_linkcpu_switchvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachext2fs_renameipsec_def_authmii_activateusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_desccomioctlumass_cbi_resetsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagcd_kill_buffersip6_dad_countuvm_pager_dropclusterfilt_generic_detachzssp_powerhookpxa2x0_lcd_mmapsensor_task_unregisterzssp_ic_sendpool_print1pcmcia_card_deactivatepxaudc_allocmdb_breakpoint_listwi_pcmcia_matchip6_copypktoptscd_get_parmszkbd_cngetcpmap_extractnd6_ifptomacwsmousedoioctlamap_unaddural_watchdoglcd_cnattachcd9660_printohci_rhsc_enableif_congestionnfilescd9660_islockedbqpagesin6if_do_dadrevarpwhoarewecue_txeofaue_detachieee80211_iserp_stapipe_kqfilterext2fs_openpmap_devmap_find_pausb_insert_transferaxe_matchrasops4_copycolsmsdosfs_vnodeop_entriesukbd_keymapdatastopprofclockdb_hangnullioctlukbd_is_consolepte_l2_l_cache_modeisohashparsediskwi_set_debugzkbd_onbreadieee80211_node_copyamap_lookupipctl_varspmap_page_removert_timer_remove_allzkbd_irqwskbddevprintuhid_intrwdc_output_bytesieee80211_classifyzkbd_modstatewsdisplay_closescreenieee80211_media_statusproc_stop_sweepiophy_capmap_set_pt_cache_modemichael_keytcp_usrreqdb_playsieee80211_setbasicratessd_interpret_senseudp_usrreqifmedia_initusbf_open_pipeext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilterfifo_pathconfcpu_startupwsemul_vt100_output_dcs_dollaramap_reffilt_fifordetachdb_command_loopwdc_ioctlamphyattachapm_suspendsfilt_fiforeadfdexpandtickssrandomwdc_ata_presentmsdosfs_closeext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrurl_setmultiusbd_get_device_descwdc_default_write_raw_multi_2uvm_pagedeactivatevop_write_vp_offsetsearly_clkmanufs_unlockmainbus_bs_r_2tcp_ctloutputpxa2x0_turbo_modemono_timeukphy_statusieee80211_derive_pmkidMD5Updateblktochrvop_create_descifmedia_setpcmcia_function_initpmap_createuvm_map_extractnd6_prelist_addufs_removeboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputunpst_sendspacewsemul_vt100_output_escffs_indirtruncieee80211_add_ratesrasops8_makestamppxapcic_mem_maptcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpmap_pageidlezeromii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsieee80211_hmac_md5VOP_PRINTfdsharesdmmc_intr_taskicmpv6ctl_varsinverse_regioncdstartsdmmc_stimeoutfilt_generic_readwriteuserconf_disablevrefin_scrubprefixusb_detachipforward_rtdb_elf_forallohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimoderasops_lmaskdb_set_temp_breakpointdb_buf_print_cmdsys_nosysat_pollallproccdevswxscale_cache_flushDne2000_attachsys_mlockallusbf_config_endpointgallant12x22wskbdcloseuvm_sysctlmalloc_lasterrpxaudc_powerstatintrgetsn_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolpxa2x0_pi2c_readrt_timer_countvfs_buf_printpowerhook_disestablishworkq_destroyzssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putohci_device_bulk_abortudav_caip6_ecn_egressin_canforwardrasops_unpack_attrremove_selectionwsdisplay_shutdownhookpxa2x0_bs_subregionohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyscsi_mode_selectkernel_pt_listpowerhook_listetherbroadcastaddrieee80211_rssadapt_updatestatscdcef_do_requestrasops4_makestampvfs_getnewfsidaue_rxeofudp6_ctlinputitimerroundarm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrrtioctlkue_ctlieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputsleep_finish_signalicsphy_cdwi_usb_cmdrespgeneric_armv4_bs_rm_2route_srcspeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsdmmc_add_taskm_getptrukbd_cauhid_activateufsvnode_filtopsscoop_pcic_set_powerreadbuffersuvm_fault_unwireuserconf_common_attr_valext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartetherip_inputcpu_configureip6_freemoptionssqphy_funcsieee80211_amrr_chooseieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchpool_page_alloc_oldnointrwsfont_rotate_internalpmap_fault_fixuprn_refinesgeneric_bs_rm_4sockargswsdisplay_getactivescreenvop_generic_abortopsetregsupl_rxeofusbread_filtopssobindvmcmd_map_zerodb_read_charzkbd_pollpxagpio_intr1vfsinitupl_cacnclosedb_tok_numbersddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutipqmaxlenext2fs_vptofhnam2blkip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gvop_readlink_vp_offsetswi_pcmcia_cadequeue_randomnesscue_casyncer_maxdelaywsdisplay_getscreendeadprocstart_reaperuvmspace_unsharesys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createuvm_map_cleanicmp_redirtimeoutworkq_add_taskttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememicmp6_nodeinfomaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcachepxaudc_write_epNural_write_multicpu_initclockscue_sendwskbdioctlmii_downcdcef_attachrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miiwsdisplay_switch3ttyoutdevice_lookupuvm_map_pDebuggerwdc_pcmcia_prbqpagelowwi_usb_txeofcdcef_start_timeoutcdminphysnumcleanpagesschedhzurlphy_carip6_inputuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baselooutputcue_setmultisoisdisconnectedcpu_coredumppxa2x0_bs_barrierxscale_cache_clean_addrrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitieee80211_mgmt_outputclrbitsdb_boot_dump_cmduvn_putxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetgeneric_armv4_bs_r_2pxaic_basesoclosescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcrd_sleep_prisdmmc_scsi_attachpxammc_bus_clockpxammc_bus_powerdb_leohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8vop_read_desccdcef_stopcsr1switch_exitboard_startupsys_socketpaircnreadudp6_sendspacedounmountuvm_swap_allockthread_create_nowwskbd_pickfreekbd_resettcp_ackdrop_ppslim_countdb_elf_line_at_pcusbf_cdarm_picache_sizepool_cache_destroyttspeedtabkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevcue_initfork_tfmratelxtphymatchpv_sizensgphymatchzkbdhalttvuvn_sync_qwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevpxaudc_matchupl_inputieee80211_recv_pspollvop_advlock_vp_offsetsumass_cageneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthif_attachdomain1ieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printpxaudc_opendb_machine_commands_installieee80211_state_namesys_preadne_pcmcia_activatewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachaxe_startsoqinsquediskstatscdce_attachavail_endudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrufs_readdirgeneric_softclocksys_flockarc4random_initializedpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodssdmmc_check_cis_quirksicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdxscale_controlcd9660_quotactlicmp_sendcdce_watchdogpxagpio_intrNvop_bwrite_vp_offsetsusbf_abort_pipewdc_ata_errtime_uptimecdce_intrfilt_uhidreaduvn_wlistsowakeupinsidepxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4db_putstringprefetch_abort_entrymouse_copy_linesigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachttkqfilterm_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsensordev_deinstallrawin6pcbtablepmap_protectpool_cache_invalidatekprintfdevice_unrefrc4_keysetupscsi_startin_cksumvnode_poolvnode_free_listtcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printit_endsogetopthid_report_sizeusbf_endpoint_attributesarc4maybeinitdb_deletewatch_cmdwsemul_vt100_attacharp_intimerpollscandomaininitvflushbuftime_secondip6_forward_rtusbd_get_interfacewskbd_get_mapentryusbd_read_report_descsbcreatecontrolsys_mlockpxa2x0_maxspeedieee80211_setup_nodedvd_read_structvdevgonehtonsdb_show_callout_bucketkqueue_writesys_syncbucketieee80211_reset_scancominitieee80211_add_pmkid_kdeenodevffs_mountfsin_delayed_cksumin6_is_addr_deprecatedwsemul_vt100_edicmperrppslim_lastrtstatttvtimeoutabtstackspeclisthbdwriteversion_to_spcVOP_INACTIVEsdmmc_io_read_4zkbd_cawsmux_do_closepte_l1_c_prototcp_syn_cachewsemul_vt100_translatehalteephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharbootargssys_getsiddb_trace_until_call_cmdwi_write_record_usbcue_csr_read_2rasops15_putchar8wdc_pcmcia_disk_device_interfacefileheadrc4_cryptusbd_alloc_xferscoop_mmc_get_ocrpxaudc_ctrl_abortnextvnodeidcttypollural_startrotatedfontssensor_task_ticksys_swapctlpxaohci_matchpxammc_attachbd_reqpxa2x0_probe_sdrambs_notimpl_bs_rm_2rasops4_initin_selectsrcmsgscpu_exitzapm_batt_lifeip6_initpktoptsworkq_threaduvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamernd_rselusbd_nbusesfrag6_nfragsip6_log_timeeephy_statusinphy_statusrtalloc_mpathxscale_cache_purgeDdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnlid_suspendsbflushipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsysctl_intrcntaxe_tick_taskvn_readbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachwihap_sta_allocsdmmc_io_xchgxscale_setupwsfont_locktcp_timer_funcsipqent_poolpxaip_attach_criticalbufq_default_addif_attachdomainicmp_ratelimitieee80211_rssadapt_raise_rateinvalhashusbf_iface_endpointuvm_km_page_initrttimer_poolieee80211_regdomain2flagax88190_mii_readregusbd_get_config_descpxa2x0_gpio_set_bitsosenddosetrlimitpxa2x0_pi2c_getvoltagern_initieee80211_set_timbufq_default_getloopattachusb_match_devicedp8390_watchdogural_rxratewdc_input_bytesdb_listwatch_cmdusbd_do_request_flags_pipeprocess_read_regschainlengthural_disable_rf_tunern_lookupuvm_map_reserveallocate_copybufferuserconf_show_attrsys_execvefdallocwsdisplayreadscsi_donechkvnlockhw_sysctldb_siftingpxaudc_freexdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitconsintrnumvnodescomreaduvm_pagefreeukbd_decodeext2fs_inode_allocwsdisplay_switch2scoop_check_mcrsdhcdebugdb_examine_formatin6_pcbbindreaperieee80211_add_gtk_kdecoredumpfilt_kqueuemalloc_rounduppxaudc_bulk_donepipe_readpxa2x0_bs_freeifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrusbf_endpoint_addressrip_initsocreateusbd_find_idescpmap_cache_stateureadcaue_startufs_setattrieee80211com_headlogprimemhookdoclusterreadzapm_batt_voltsys_exitsbtryusb_desc_iter_nextieee80211_send_4way_msg1m_applyxscale_maxspeedudav_startaxe_lock_miiwdc_exec_commandpxaohci_capxaudc_bulk_abortdb_watchpoint_listwdcintrusb_seleventcd_playsys_clock_getressdmmc_set_bus_widthaxe_attachsyn_cache_insertnsgphy_funcsspec_bmapttystats_initne_cdncvhashpool_cache_destruct_objectnd6_umaxtriesohci_device_intr_doneusbf_get_stringpcmcia_intr_stringnd6_debugmainbus_bs_r_4db_delete_temp_breakpointcpu_cpuspeedcpufunc_idget_random_bytesurl_csr_write_1SHA1Transformesymusbf_schedsoftintrscoop_mmc_set_powerfiqhandler_stackosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetwsmux_evsrc_set_display__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdogwihap_timeoutuserconf_changepxa2x0_lcd_new_screenmakefstypedb_paniccddkdriveruserconf_helpufs_advlockicmp_initmouse_movereluvm_growvfinddevieee80211_node_cleanupif_detached_initdopowerhooksapm_handle_eventether_delmultisave_rtevfs_op_initdb_history_currmainbusattachrn_mpath_initheadexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleaniophy_servicerasops8_putchar16cd_getvolsplassert_ctlsys_getresuidsys_fhopenzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsdmmc_mem_set_blocklensys_fchmodvop_strategy_descuvm_unmap_detachvop_islocked_descieee80211_recv_authupl_initwskbd_srcopsuserconf_common_devvfs_mount_printpxa2x0_irq_handlerstartwdog_cookieusbd_devinfoskip_spc_leftvn_isdisksys_selectscoop_charge_batterybadaddr_read_1zombprocdb_branch_takenpxammc_functionsin6addr_intfacelocal_allnodeslogreadrn_mpath_capabledead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixwsemul_vt100_resetext2fs_specop_pvfs_unregistermii_phy_flowstatusvt100_setnrcselwakeupffs_reloaddb_set_watchpointscnwriteumass_bbb_get_max_lunzkbd_keymapdatadb_show_panic_cmduipc_usrreqnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodefilt_rndrdetachwsmouse_activatescsi_scsi_cmdrip6_usrreqin6mask96coldpxaudc_ctrl_donedb_clear_watchpointscdcef_startbutton_eventunp_scansbappendaddrbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactivene2000_detachsys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocrevarpinputsdmmc_function_alloccd_pausehashinitttstartumass_setup_transferrd_ioctl_kallocwdwriteipsec_keep_invaliduao_detach_lockedieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3disk_countohci_confdscsi_detach_lunpmap_page_protectdead_openkue_setworddb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsexphy_cdreadeplxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbffs_mapsearchsys_fhstatfself32_load_filesys_getpeernamepxapcic_io_mapdb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusageapm_threadrasops_initmainbus_bs_mapaue_reset_pegasus_IInd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachsdmmc_cdttylclosepool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintworkq_createvn_closeudav_csr_writeuhid_do_readin6_createmkludgedoclusterwritecdcef_initusbd_close_pipewsdisplay_cfg_ioctlffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreedb_show_regs__wdccommand_intretherip_outputuvm_km_free_wakeuprootvnodeifmedia_ioctlpmap_pmap_ctorpxammc_host_ocricmperrpps_countuserconf_modify__one_cmpldi2usbf_setup_pipewi_usb_rxeofcpufunc_nullopcd9660_ihashgetmii_phy_detach__muldi3wskbd_add_muxmbtypesdb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesamphy_causbf_allocmempxaudc_attachbufinitinswskip_char_leftbootconfigscsi_quirk_patternsuserconf_lineslimit0lcd_set_backlightpxa2x0_pi2c_openuniqdosnamedb_recoverusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdwdc_pcmcia_activatebgetvppgrp_poolucred_poolxscale_cache_purgeD_rngip_insertoptionsarp_maxtriespmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcsgeneric_bs_wr_1_bus_dmamap_load_uiostrlendb_machine_initsensor_task_workrasops15_putcharvop_abortop_vp_offsetsfifo_kqfilterzkbd_enablewsfont_initieee80211_parse_rsn_cipherkue_activatewsdisplayparampool_page_freewdactivatewsmouse_inputcopystrwdc_do_resetwdog_ctl_cb_argsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysarp_rtrequestieee80211_encrypthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinepxaudc_read_ep0sys_rmdirdp8390_disablecd9660_vfsopscdcef_methodssocantsendmoreproc_zapvop_revoke_descpxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffarpioctlpxa2x0_read_ccntffs_fifoop_pfs_posix_sysctlif_slowtimowd_shutdownudbtabledb_load_countwi_setdefwdcattachufs_printfatentrywi_update_statsusbd_printBCDntp_tick_accsys_statin_baddynamiclineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcuvm_swapout_threadsural_bbp_writeusbf_add_interfaceknote_attachmax_keylenbus_space_copy_4ieee80211_tkip_decryptdp8390_ioctl__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0udp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsets_bus_dmamap_load_rawffs_mountrootrd_cdpxaudc_write_ep0uvm_map_pageable_alldofilewritesleep_finishipqdl10019_media_initpxa2x0_lcd_show_screenmsdosfs_strategytimeout_delural_media_changewsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufdisk_detachrusage_poolstrchrhid_clear_localscsi_sizeusbf_host_resetmainbus_bs_barrierdb_deleteget_bootconf_optioniftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolmainbus_bs_w_2sys_chrootwdc_ioctl_freeavail_startieee80211_rssadapt_lower_rateicmp6_redirtimeoutsoisconnectingwsdisplay_pollcvop_link_descaobj_pagerrasops4_putchar8zaurus_battery_c3000uvn_iouvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2vop_link_vp_offsetsbpf_d_listsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapieee80211_eapol_key_encryptfilt_timerattachifmedia_delete_instanceurl_cauvn_releasepguvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepzssp_write_lz9jg18generic_bs_w_4wsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKuvm_rb_fixupsyn_cache_initieee80211_find_txnodevop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressether_ipmulticast_maxohci_checkrevmouse_copy_extend_worduvm_init_limitsukphy_cdusbf_softintr_establishin_pcbconnectVOP_POLLVOP_IOCTLsafepripxapcic_io_unmapsys_rforkpxaohci_disablewdc_default_read_raw_multi_4uao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatepool_cache_putwi_usb_rxfrmsdmmc_io_read_1sys_getpidnd6_defifindexipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatedb_print_sadb_elf_sym_numargsural_detachwsscrollbackdb_trapperukbd_cnpollcshmsegdvd_read_manufactundstackconfig_activate_childrenpxaip_printip6_check_rh0hdrremrunqueuesoo_closetcp_recvspaceuvm_meteruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimnd6_lookupieee80211_cache_sizepager_map_wantedurl_openpipesukbd_countrylayoutzts_matchsys_getppidmii_anarrc4_skipVOP_READDIRdomainssdmmc_select_cardsys___sysctlarm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharpxauart_powerneedbufferwsemul_pickusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsuvm_rb_removeohci_root_intr_doneip6_multipathtickfixusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedatamichael_initipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesohci_softintrbufhashmsdosfs_lookupspec_pathconfmountroothook_listhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptymotion_eventuserconf_cntmouse_zaxisext2fs_inode_freepxaip_capcmcia_ccr_writedb_find_variableapm_cdxscale_cache_clean_sizepxaintc_cdip6_rr_prunesbcompressmsf2lbapmap_free_l1nd6_outputrijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimeohci_device_clear_togglevop_kqfilter_vp_offsetswdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opennclruheadural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockuvmspace_sharert_timer_addieee80211_print_essidroute_usrreqdeextendpxapcic_event_threadieee80211_recv_deauthrasops_erasecolstcp_dropicmpstatudpctl_varsieee80211_do_slow_printm_prependvop_advlock_descwsemul_vt100_output_scs96_percentcd9660_pathconfax88190_stop_cardin_pcbrehashin_arpinputpmodzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlunix2winfnsdmmc_io_resetwsfont_unlockreassignbufip_freemoptionsnetconieee80211_release_nodesohasoutofbandspec_vnoperatevop_ioctl_descddb_initbs_notimpl_bs_c_2nd6_dad_duplicatedfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4maxvnodesether_crc32_beieee80211_add_ssidcpu_reset_addresspgfindvop_lock_descsoftint_pendingtcp_ackdrop_ppslim_lastrqinitloadfirmwarerasops_cmapcd9660_ihash_slockip4_inputtcp_inputsysctl_dumpentrydkcksumwsdisplay_cnattachnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2cd_switchiptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spaceusbd_get_endpoint_descriptorudp_ctlinputmii_detachsdmmc_io_send_op_condudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdevice_refrd_root_imageffs_syncusbf_task_threaduvm_map_submapcnioctlufs_vinitpool_primesdmmc_mem_scannsgphyattachpgrphashtblcomconsinitsddkdriversys_getpeereidifmedia_matchstatclockaue_activategetnewbufwi_read_data_usbdvd_read_physicalrw_enter_writemaxcleanpagesuvm_mlk_hintuserconf_argbufpxa2x0_lcd_consolem_tag_copydb_value_of_namepmap_l2ptp_ctordata_abort_entryhid_get_itemmsdosfs_getattrdb_find_breakpointm_devgetntp_tick_permanentwritedisklabelmsdosfs_printkernel_pmap_storewsemul_vt100_opsstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysmsdosfs_readdirdead_ebadfusbd_interface_countpxaudc_enablewddetachuvm_map_unreference_amapsoo_ioctlicmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregieee80211_recv_eapol_key_reqdl10019_mii_statchgicsphy_servicewi_send_packetin6mask64db_lbuf_startohci_rhsc_ablesoftclockieee80211_node_freeupdate_modifierffs1_compat_writedb_breakpoints_insertedswdevtdisk_lockscoop_pcic_readsbwaitufs_reclaimsdwriteohci_device_intr_startxscale_minidata_clean_addrkernel_debuglcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2vmcmdset_extendural_cazapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsuhid_attachzkbd_matchufs_mknodsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreewi_ioctlzts_disablelcd_attachffs_hashallocpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintrtl80x9_init_cardsys_getpgrpukbd_ioctlusbf_add_config_descwsemul_vt100_console_emuldatasonewconndb_fetch_regufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1sdmmc_io_enabletcp_saveti6wdctimeoutwsemul_vt100_initnchrdevundefinedinstructionaue_cdaf2rtafidxqsphy_cashmmaxpgs