lighttpd-1.4.55-bp151.4.6.1<>,|^!M@eeeEbz]_ibdjbBP7mހTOvig78iI]ڻ/aO/I;U;@I_CUr UWy& -Y:u:|^}¹!#7F62ț=#I'6ֽ8ns;wu%_N3Q`Gv_ۑJL9 Qyo,Dq FjUo`#yioNe%b4f&;g=_iaBx>I?d   V"/ Hl AFj8j  j j j .j /$j0j2j5x5j7D7-88-;-(<'8<0%9<%:?%=ё>љ?ѡ@ѩFѱGjHljIjXՀYՔ\j]xj^bhcd߶e߻f߾lujv|,wjxjyhzdtxClighttpd1.4.55bp151.4.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^s390p22SUSE Linux Enterprise 15openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxs390x/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O0f1 }Z}hl0YXz@020CzW21y1CE`DC2p2X0d2x3X31|Ɉ2z 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^^^^^^^^f45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456de724b45cb2c246c1d65850a02012b69ab66c3fe04a14a274d65b9d5b8206d9c16922fd6ae6dfbd9117b39e1e719cd840f66b0ca10d55927295ece61268e2429a3b8b3ff97fc235a80fd0e22432962a20fc33c5d41ce78547c0134475125a35c66e00f6e5ca5150df052629dbbe2114400f1a52008f38b2bbf516c634ba73ad9bd9d98dc5a59d364913779fd128497a2d9bb7b27337babcfe2521cabfd22320d081b2af8c623c42318aa1165387c5e8d2406a168903ad25aaf06b79b3bd8d52395df02a3318f762c09929ebf7f9990e33627e35e6d7c5a59df1427a2b1bc4229c64ea814c3732472970e55e24d7560633e75b3e9e15fbfbb570b91239d499caccb05d0ee398ea530e2465ed680eb6c7ac975d70c4bd434c08c092b89c9ae3d6bec6fbe4dad3718805e15974311b6a07eee187ba2e97953f50c9dbb83e29b9ad7957eca99687431338e69f6c4c1b80164c310ac6d248b43b66d0001dc7fe14066cd793dbc6ff2a51d551cef877659f93c6f40506f06b4c9d48bdfe36c50fa6167fd82f8d271a46079ca3498067529dac6ae1f56a6076bd2455ea1d8fa23f402f84af1a85dc677bfd58b3b88b7460c60bb423f0e4e623dba2dae90283432a9a2712e3bf2ea5183d47981c799469898128ba9f2ebb6bf3ce53ed3132981849be4a2abb6e0ea8e3a4cea0ca1cceb2bd3077c9a6471aeb5c39eb0ee595147453c352e8c9a4bf69fc4db14c24084783d4aea031a7251ad263765f5e94103e8a202773d19a0767ea2bf88f612e0f89293e29a8d0175892426e588512e00bb60498574216e58d49b7c3f807afaf970c9c695701a51deaa0f401da3417748fcea8ee36bd56027c9846893e38823e26e6bbb57eac29d019562b5586299522680309dc98327cce29f730b4a0d3a144a2e3f6fabdb92079a8a8f20cc9d705d747a1aa5725742a4aae157a4a00861bf518e7d9aa86b2e19e69a24b4419e9ace384fea2be8c455b2094d7d8df37e1a55c541e6c739bb81f0fb65cc416afe57958ecffbc4829439995457cca6f32e03414cfcb61fafd7c672f1ed6120bd5813af2df519dbb1a5f80e3051d777bf5af2af2e99234628e81d8139510c6cb3e9d952e37c5f09c9c367b43277ca1bffbc42ad0c1df19600248756fa9c3b1c39c185468c3c8bd6b66de74c50f58548873c055eecfdc10d480eea778ba16085f1cde0d86501cc168122adbaecb7c5c5f4b1beb5915c0b7ff834ccef77570a5fa0660370b1af7fecd009389705729f591cc5ae1ef1c8cdc0e8cad3d224b2b5c0a86f636043f61ec41ced73e153eb3115ff684d431232d4ac330ad6bbdef907ff48962ca51fef00332be6dc69f0f317b6f20ec88ab97cc93b7c0f1f394d8e0927b886d64eb9dd02e8ac3c2bdc846f8b3036decb927bfe8646d00f92e2d39f28179bf20e07b5be7bb60345abcc5057d5356c26abafc352362e856ed9de25cc0271477d47fbe3c8aa1ead0c472ceae824efffcb07f9dc4c32401f1c0d4c904df8c74983a1804da3ecb678dd16d237e165754b93f386022fe29b345f8475aba72c219c6b0f90a5bd2d2bca0c712762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-bp151.4.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(s390-64) @@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgreplibattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.2)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-bp151.4.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shs390p22 1585642657  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-bp151.4.6.11.4.55-bp151.4.6.11.4.55-bp151.4.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protectionobs://build.opensuse.org/openSUSE:Maintenance:12219/openSUSE_Backports_SLE-15-SP1_Update/ce75ac59626a8db83bbf99ea019e86c1-lighttpd.openSUSE_Backports_SLE-15-SP1_Updatedrpmxz5s390x-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=74891dbee49e61961726a94e179c67c2e7165d83, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=edea48bfc348c47206c673b9f9bcb20f8834d740, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=0d49898d69112db59ab5aa188a9a11e16359e85c, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=ade1a10ee16aa17a9900a1bd969000af143c0432, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=f0c2000d0595c2f228527173f33ba902d2153592, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=53f830f0ff9bf9724564346400516734d271146e, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=76c4b3005eab5170e2ba5e4ae7706fe77d6a320d, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=54ad7a17172b33e6172dc465ce942738a470ad41, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=0dc8ced6fe27ba3d944cb5a478c3ce3e956eb542, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=08b59eb8ea7387dfa92b54121d20e7eb55559332, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=ff0b9bebee11bcc203d0530b2c6b4ce20f70d108, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=2ab38dd79735bc8d8d71af72fef87197ca026e6c, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=a05c5f7e6a286440d73e39cb94159b55bae02b21, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=4eefdf7210e1aefd4010bb3a5b2f46f56d36b5ea, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=648d544bbb223fcb9e11f1abb1c0a7ef4082adbb, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=89d446aac8626723ced981c60ebc63f0ca8fb4ae, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=752822f5b7ac06ffd1fd8f1ccca1b6a7ef33d27d, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=1eddecf1d2765e500eef4ff2835efb64def27f8c, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=96c776b67ebcc6ffa913e6d06cf759fe99a54fcc, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=bf207fa05594b3d5b73d054a45b48186df6bddae, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=ba533eb7d3733d70af367f3bfc1530597f71953b, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=1cfdd0e5402c036302e10c7444c0c0eb6d05023e, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=5a10576abe5e752d8e1e3cc9d8cd9406de4b1d15, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=fb8fbba226bd296348cfc4adfbd782db5a49d037, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=24dc444f4f9a4e5a093d939a212db0fbbced776e, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=fd90e1c28779ed655469b22a5dcb93ced3b4507a, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=7aa533e6146c6964296677e3248838823424c5b4, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=a6b74b1475089492b5c0f313b23eb33ec41c9610, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=51d71b31078f6e1402c80b6c57cf91ec2991a357, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=4e8e6d4962766ad9b164aa9e90e5e0ebc281ee6f, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=e07f6d44a96af9b23005222f4ae3a7bb06fdbc7f, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=e19040329d2edf35b83f36fa00651e47798256c4, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=a7350bd923f936f37cab6fd080528c285c424c08, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld6, BuildID[sha1]=88585c7986a0edcc26b91ed5af0dcf359ed867f7, for GNU/Linux 3.2.0, not strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld6, BuildID[sha1]=efd7637390577980378a24178b212004be093d5d, for GNU/Linux 3.2.0, not strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) !%')+/246=@BDFKMOQVX[]_bdi|RR RRR RR RRRRR RRRRRRRR RRR RRR"R R RRR"R R RRRR RR RR RR RRRR RRR RR RR RRRR!R RR RRR RR RR RR RRRRR RR RR RR RRRRR RR RRR RR RR RRR RR RRRRR R RRRR RRRRRRRRRR RRRR RRR oyГ3Q_lighttpd-mod_openssllogrotate1.4.55utf-8ade99d9d645e97d968e0d974661a866009ff7fd59e21e73bb0f01ca02c3e4ce8?p7zXZ !t/Q]"k%{U}g桙Ⲹ9+ځm#GXE9T  9ilnnvŘ(^^z2D h/蛀&Vۇ;Jt# 4DT_1`@{vcOtގv0wZNiU*=a Y9Yi:`XuDa>lICV< nUH`G(`l-{g/:r~ !K|S[RT@]ucO]o M ߑ{6@܄D-!6FPJ&n8_zK4<\0 vVM@d';l:󓽤cR(R>Ei-9`uvMnn0x0z-ǓNs S_DǞ&+U 0§O/l+ {3flk #C3xE-za%5wA2ޑ8(;@nǷΨ{ "( (CL2B';Hi g6X&<[#z%ؔ.f$]ZSpſN+ٗOy670M2H np&qn ɘ-X6#ʀ+ X%#K$8@Âhn"@w*,ZDfKRW 2,AQXf/c!nߣUDKRi*}m5huB͓VAVn}!^sq[SdG+T,oiػ|-*m"Ӕ^S\hoڟyw xN c_WrA @ݛ8X0Ņus@ނ(!9bp!RCH_JPxO\ϟxRWBX-|Z8hl#Ƶx`wDO^ROvMRڶ#!$2$ZTppb*p`^>"LM߭g>azvބ gŬC|?%5ioR9OHo"1_7]+-m$^#_H7ꃥ|E?&xw a[Ce c&/q|O~Ww!n;c̅>d9c(0(-Qr ddFQmv$L<9݂#[E:7oPd@LN5 @srT {*[(X^ԏp#AQyco<AY|i:?*ENjyX:^&-EugrFiYYI5aussE&ܱsCC7^ӵ|񈷽clΰ$XGEU1P(;R-p99i4KK 7PM1e}aKM|`eWFwBzT_3w==+@9GTw :3 c4x먵@&{C)c*W]fjÒzr;ڧu?Aivb`vOGџ~R|66ͤKk1*JF.j9x2ޘ% %twIɑ sXB5c\m MQɪ%QbɐCm/扝 /7ZS2-p'5 6S^|AD&is M{ts3`^Ww+nf{K0Ӵ 5ʰvAw,1O`LLGsWǪXhi8lY^#Ep6V-Ug%H#9^ޠf. \D#O)3)`\[HdaJc+71 H03x_\tN4  4ވ\ﵦ?i_`-},VƍS4󑐀t'FD,\t{ENSMƟS*tћ_aȕ78KofN 1YfGaDuO_rvxx7@(nc糔\!3q՟j5l{8XDĭ+to+K;*RɌm _;@_ܖY $2No*Pi,<&:u?RǗ1 oE[|,v*Jufc}|Q^O=3q4EV(Dv ">CQORmL|C}#/P-Rτn@Mɫѣ)3:jHhp_f?Ѭ:GV}*8q1<}),=_UbD:G֖MxIx&F_( d|m/MwPu̘ G /ahףfz5`pOQwaw( 'ڏ=١[0IZ1Bm'G63&ƍn $n|(6Pg>.\Qy6MJ;ݐiXDZڿhzXZop][6HEȢ 'y"FV1(e>E%ҫ_G#FmmxKsט"Lu9h싸]X76ZL3Di AIUl]-qw`9PqIP<2fVぼfҳ)rg~ % b2:w5r]L_g0ԻS,x =e=aYa8G|4ּRt,?/b Zld?2F +X ~ekap޹ 9xG iGOWgh3[UzN:rmKK[տh%?6O2vO\v.yCwǥ/$q Qr\qz cahG'}P3b9FژLvc,f|b=ՊjSgKaf޼{̓5eF79o aDGp1cWYڬ8 bBV~wA<ު320Θr~iU/Zm#2"~A*D ص7$E38p1)P0m(lR=2 i*뛜kAC ? BŗM(}>qHČe2Ezj|OS0͝O}Tq"::~iXM,};^⃽A۶K>-uߜBÀlJl($PpϠ=-tk*L\+ŰH|a 쨤8L%QƊW%4ohv]Mԩ+h;xְj:;. d9}$G.1jr9|ʼn&/{_SBgrvK[N\0I0tXԪ&Vp F(S I?̾yW!M4, T؝acrˀ]ri;"M3=/~W(1&ш|bPK$}N{ !c)\ʛfeS7g,͖BeoH ı+g}ۉ+lNrǑX-)ũ{4v6#9ޛUb$(@;d.G3 9GP;OFF\MXo?j7[꘏:szjP7" hdw;BJm-Ci۩ (vX#qD.PUvn_N4?7T 3Ǭ^JH%n7!U \ې-~i;ʩM C:ـW԰TPYs%ǃ:E 1x@iyq @ }h羕ލ潧^#zf ḻ "IvRONfF(׸V@yg+'wRPj NB"9D?y3;]{"PQ4il2؃It>{Wl^Zɬ@NG0DC嬖|T^Zy"Q/_B/)oM*ta /YsZd[:XECZ]y[Am [ÒCpZ]Ļe`ns_w2U]`Wois1 Gu J 45q~ z|eU\Y'ڊRb,3]?*K18J|(6in_y;'6Yr̉>WǬ k{- d S?#= Bw%;O h<+ 0Lx-ůns箏=_],}Prm,کM g0aGk{kM'"쨭>ݤ支ӜNG)0Wp tYOܩ>wͭ@ [$'9]՞{6KgVxO$~iykc\^)ё:tD45J ә?=>wc23t,UhwaP/SڳCG6?M;'$_oo~2orì Rm*Eoi s9c3cq!tr{!TsA<;F#4]=C1ų~buPW6óZM= HAH>֚Sџe/hѰV= ՅB:#z%{{ҳ ҃<d*lr=lPxGNj1]"91 D~^q;oGIpZo •0V0F=/qɁƭ[xhs@}]L7EBƜ|7c c0(q>N6CaDnׁm|Mys jU*eB7 Z.)1H"MTXjMIjZ}inϯȋRkx#"}mX?>/+h*5Gs谓4 !xuԀXx;ٲ$5.û,RyYvf\~eQLQxK;~H軤XZo7M aքE?#?)Ը؊qB]ffdmL \LqQ5qVݣ/IAˈcm T6 DMnDn0_Ro2)ܝK#'-F}#c,ú[/0M0C[Df )I!ȨJDu$ߧ ?W_es|vnꇑ;;'O]0~W.RYCgT}時!OlˊP@F+.;8](8:]THnp7`.K5@[$ZPp"Zְ4q|Bx*$^ -bɂC ᅀpZ0e?M:84|LFȨAj)6$kYAAt4w,wsIqU2lƒ1*"2-SUBX܎6dF/}V f?]#aoMB$)2Iʄ빅if.kSB7r [ _z,&+"VX%sаXdE6!%d8L-j$!}l&춂E02hq B˧NnSn4iLTR}C.{>"m?*?Y! M\OXkY'Rcm,ג+hy-YD&&Ω('VXFOԀ[_!py7a;HAUPv-wv[m xӞw}Ws5DM^TauIuG1+QDj)R4 'p$u=&EvǺSM+zz+j6E +p'- TWj& z?fXPG7P8CQ_Ig LS!+24Ha@p7UxYHKC8\C؞dfSetbc~XGOWif _1qDüsX%DLzhhE(FZ;#[F$EC>^#L C?[u;~W\̓>5K ^Nhry՜ e)ݐ!TW7,s7|}HMXr,#6tz~ gnl1؄ZD;*W($[˯-N/Hʋ)x} .T UEho0cy/r冑LsbF<ڬܹ~tO*םIw2=2b5d ze!jrB?,L]A^wNAu6so:аQQ&,#a71;%W8!b0l +>#/h#@$L4V/MR](٠!-#˛K:F2B0o>[/חs'CE"4℈[աr}M&(PK-օYT31;ҮeҀ$h/6W=,.w ƨs`F{xӃ&v52ݺp8CiI d+V۶9z?Ib"6݉s .~[t.|SpW#B:]9A6~4GHOO[-jطcFdV((X\]'q՞@D^ $OڧLYe$ҁ>Ed' v0| Ux{"nx&~NҎ} de~.W_%Pu*h Wi^V !Wd=9"moKgM(]H P.*Z-iJˬ1XXZ5DuRԠG0]DwV}Hyn{Zu$'~sT3 !v6!** ݁etN+(YZ[P 3Fj{pLs~VFvjݳN]x Ań4uBF/i}Ih'YJ,tG*4R){C9ҿ qoR創P)-pg.YV!G 2WWF'#侊p#V`n5Pb4-m-0n'[<]`qwĮ9ZV:DhڑwE6#(ɓ\+W IZ>;Ĵ1Av Qq,2(N\5aWfd |CeD,>5)T H[ԏEOI^]I6ik=@U;}K{ZZBAGRDr# 1]!30꬟2Hl+p*YI}GC{vإjݡPRm!G(DO7k h]JRԻKju_"s5NH$1&id'mGӽd6Ѝ`Ӧ(iR <ߥ*&Bܓ~[lL yQJZBj;zIb{ v~nz)ǖ; ;A4f"I TInjhHe 齀@;aQ]apbx>ں,Ȼ{)WV*L㈖JXȧ_Pꅵ,#Fy!O%G<}-o6a3'_D~` pKoV^ WE$:\T\tvn;%6oy7rvWV߮Fm˾Jm> FL`}`Eձ+u$B8EtXj]TV4O+Zyx K/r@X{y&e7>ץ [S9-e€p=6:?]D l[aiq0'xo.@_Ml%Mo3%=R|tHA؝=Qd߄E^ciXЩa0Kk3" n-f$5'9;r ~.8\^t`S$rwC+ɑ>B؂E0Eu1F,275*TVԉWzyu7^i*|v vXfPSU}S=ہ?Ir_DzJ3\-ĸ}"/8PmHT_'e hrȜH15X3߻`Lj>u3;<_Dۣǰ9N93 C.HgirJZ bMP:0vg0 B bTv:QdMa T&ѹآu XwVY6զ+b>1HUK,~IUIQ>@52նv@$4~3r}iU*J0˲!#_a@RLF A;eLͶVkjF8.W"0~}i&JW/&- Q)w[6Z'@2}$K ڒ-Zw0-kh> ݩM{`MœRnVS qʖ+F>4=AL \p밍|.N7.QpR鎐YwbϞ|6_01fD]]skA](PfUyK1v˄V+pB坙X=5JN^J}]>07|Dϴ2=M^ \tܮ HS(2SR= <̈2er^"V# \=:;ig{G=Wqm%e0^}R7~FVJȗFX"0V~7(gku1j?`fk2 mz}" h p,P[nYrs"Ŋk@J1ꋺpWH1<.۲x`d=VCoQ}ȗ{KEri ѹ|CI~ %E W1ʹ@+y;4t" $Sjad [1mIZOŸ/GO%q` ݏuBuz 7{+d|~kAL ߅^$#6-G={6(՛εؓmC]@;'kN54$X̷o~-] QpcHGۦ6N<_o Ґeкuu4a` djܽޒPiY6!qEfTC^g⿜+>[VbV=W , d{]ߠ^,/0c\em`Z-óY@sUmmR ? 7yoTӔGaDZҨ]-1?]9HpTh~nk\~sfENo142qMp wؽ2CgCh]]O邍Hf;ħ\al 1n SmHI&ݣndth4 +@>GmZ|WZ.IG[Q< RN'hݾXT2D-BQ$B ^dσSy 6Ջ G( $^,ץUڨEl2}]9VE|I]}/jA/ 61Tg jZJ}8m&@{hmƋ!KR\zn*_/bH-5,_dc8F&Y£>w-B%r:7J tK*Eu_vݵ]z%bxeM <9/[Lq}W}=ɾhH?cR\&wO+:uJ@$ikhEh^]:X c im+۫l27_u8AD!g5==\hWV0Vs@c_Ύtk^r'.ϋz8ٺwDR @xBmRg*=ڦ[I@I Y慇qq/I_!z>=_<4]~drR5qXD/."]Xѥ' 6剔l@,]O8 @t$FoT`Oq^bM#Ml:Ⰸz&Gү/YQaɷ=W]TQ,ePBv}ŪxІs|^F*?&92%3:B/fsάiZEl g9@.A|q on_Jgю6Dzߏ`'%]PYxBoh |kIஓ1: d!,'ln;HHL `yRf *Sz6/Ti.dL|G^uS\dSORoyʲ\,C*EɩiasOH ӟz>7,bۼv{Vۅ⩒qŴ:.(df@J_}n2N44,W6&7(H T>p&p:ҕ<{jEzd;WiE.o8N㺫 6'|55kh-EE_ Lzhsl%z3*,b4^`Z] -MIF_Sf7{"δq=q5b ЎK33\x{`kP nc5w6%҉`ށdxoEB<@t+K4R1X?W n^ϗp9Ǘ P ƥe='ƢP"7yO[1jV@U4`ڷ:̟$*"ET9)_R< &ً89;u21l O8abڇ B4YP Fe̥@WIӏm?dY.Hųl`omT3|%&p=8ZbB&O'nҖvwNQmIٴ`ݣ ꢔ,%d'ZKH$psFtk9ԩ{+jƛ}c9.4FqTߒD*pBi!b3 &i/P3ud%x(kUkq5 P DpV˼4+G?%.:m&_Pl|cmžh%kxd:\لXd9,@j0`̣+mKǜ'DBԙziȠUfnAA8(Q/j)= ą͛_ӑ%i }Q?&"e7.??za}#( NpBOfeX !Ǚ6/P{o(Ӵ_g5[p:raّlu--v_ 6Uh.a唇Wn(4j44ùa 64Σވ%ʕ +8 ]T4w/ hEg >)^KK{#hbs,*݀K˕]G 2,|\lTėh F{fVImڟg{tJ_bFD7 t68rˠ5,`1C%!@ YUhj5&9 U֎~n_თl' X◍%"ۚu8 ^qsDC'xK4|PU'}CR D7%]s9"*83Rj{H΂=](p 0 dd/nٯwSkeĩir{ƒA:+tsϼ| L("gwA_,z8ZPY W@D]{%9`V1눥0Br"1{=&2F!ܵ?v=U*@nP%9 '-9wjЙZss[ݘtA\²B: t(:@0 ݷγj闽J)i!Tެ"8]8<s>3!Zo6KzQG,{Nxٽ_\L&n>v0}T H3FuvR|? //a4aJ9 a,#(gS0/C=YQ꣸Ϯ? LxH)]HXjډ:JN j~QUy܌0 y{" ,[} CU>4T^^sq\Cw|8M>Qs#Ӝɉicsq!h{Yw @qOzc "5]Ú5(O3=ݎZufv[a xg"UTx AyqNV)C' rɥT%(P|֒2 cxKd.P YGGEvwMbTGd/߼mӓS[:dܢ{rtP, e v 9v_(!=L^L,~IK%D!:dsv:42Jh43P#$tw=kk,?-lQ4GsvbYl֎ԀQRц f:`-<<^6.#(%c,8U9ݯlE7n`9AOdF/D:[ 4y$ G^~lˣ( ;@.kfJ@Vp\V(sHTptah*A7ZtxX;=gޤ#?!bRS,e=n^M 0-eһ2~ਉ)t**Gf },O DubF Qw(MtԶ#~ MPK..!8@TQ|qJ %eBӊLd,3ALtZƓS//[ N=ໞJUYCy,Y}BڅͰB+Au(`k(4 G-/d(W4L;>XF=!~H~ EA<=/\^nJ %}ɉG1|tl{b1Ƿ{i pcVuMDu|6UPk(Nt Rt'$ߤ Rs%cqi\{tzx0`)ؖ-v &GC}Ĩl{ؓL(q-#cMY[uԚ9uTh|n4 vئBslDAդĤ K"Œc;wN^k7tM x5{_{q@tR'Ա:lar#xb^ MgmV򷈜&#UhyTA&s @bg4S}jJ{[0P|We,4/ {X1jny|)k&Jk 61kuڌ4n@3o4~Z7ӺgE_Л8 rȰ(<YRee>WD*y>a1tտ~T7y4Tg6B5AK3UoY3N"dDn&) 6.}XtV`KӉdA;v%P$KcMFLXA@v-ƺ^& TI@ߒ/oHPJM\8C)͟"> kF&PIE]|+n&uD,эт/W,a:ٸ(w pd^@$छENih_PHe/ɗ|eޗ}^ܿkMthş ^P]qx%;\~9nɕ93Ylq@ I )TiםŐ9t݀H=Mk--rjGcT8K7S딖z?kPA% ?PYp#a=\(kxW[uϩPZ3v;1CQ+4,NŸmkbm&J\;@w"$Y,\_M٨h.|- rrs&~G7e F?@nkd"T uh1{|n u}mϖ'0wn!+[\㯞1,,զF {kU;ThWTڒYd>R̦M ;ڇKhʸe%y@{ L&7b9MwJHrl' @\gp`+q/ԐOB0p2 B>)@4e:/+[X賎-I!OF97]'zC6O*܆;3&85ʅ75.htK="!fx ,1O_6$f$+SBe[;NA˘hGzyb.^0dptYm<~ri[$B솫18OQdsx^0p1{G8g >^2@_fa~71j&,x^&$tYb5C fktI6u\|07K|~njɒFSRZ),OHt tZ?/P{tC!eSMM_O,~Q@_ңfh[.Өr,I{ O^plW< 5 S-ސ-G }^m5Hq#f0!Ld6lHsbP ƘVɴ[(6gT8#G'PSrwECTGEzvG_J"T=dF> ̑wAj"۩=3<@*PxR~$9cx&יt_9nXzYD8,j,(qU.6Ja0~qa 03x(,g}7I/bI+jnG@83r^>__;)jwg{$O zgL-><M+¿OP[_Je3=kJ婣oma]4b[sPuL@Yˌ) V]qg瑯ڪEjf#\w^cF?ѬI}k{J+Kq4f3aSfx6F,&O;ˁ6Pֹ8{ڍ[iK=*)u$kx\J4HƝ?'$&F!I_Rݥ,K}ޮKHyqHT*f*L! _ g~o>.Nu|_"2P,^\s'e/m,afv4 fAKCSo+Y*(Vϫ:+($/,!yε?Cqϲ 5C摱cӮ¸iN>^~AT%lNr 륡9qa:lV5Z:'1C-GP2`&~c0&Z7%ҧ).f1[}`f@[ ޿}b ڮ#5׋1umbK<+߮w\qƿ cpHy{c`vK޽K9[QATvºY^ q@ԣ~ F+C g$8Ljϩ۔&@l; Ėb3Y[ РH?HO8MV7`Gd +4 S'"`k?IѼGMНMq#8r@ZP4l"KRuTd㻨kQQ?RNBM$qiӧK&R%y񀰉.+KdrX\!PfĦvg) תd_䱈emXOf+ {e}WL]_8n҄|]V)'ibcOZKd}4?`ҭ66GTF6;_C$/EW-l^=S6C/KVRМшcmN聍3#0gv(%=uO:/ǥ0B/biyjگ ȔNavO64f^Puw!hM_|lA.ɓ̒ ~T>%u)Kݲj<{IQ>-T5&0|4i_U { L=>aN:T&rnF6N0Ux)+p'AMSykmC%[܈-.􅔗n3 %8=MM)|ÏY~9c%#ҀǴ+i8]YC}7MY4ͱa;>f;8a)Z1AK`K$!q+$%t̰'$"=RUnrKWx1}= %N*b^4c`.fpd9B?7S&rA3%Xh鷒:RlD =[hjw1HMW`)8w4 w5FW)L}8.X$0^s8ҍmc˔5E~wJ҆s64׭D 0,% /UPqKLgE]ʼ+S,@tfwI:b; ޽Ce~1of7Q>wJg HBhfǚ=ԣYW*l*>:f9 gh?u[?-[҅/m` qηYZrwژI<)cg11&=Jb[<| 84@9jT"fb7' ,s\d(IṔy &0c!Ag0`zF(Ɩ<ۜpR@m_0ۈHOQY<a\:E % 4X*-P\ 4aKjsTV@򚚦ĞK@IejaM3B ]oNfqaF6yo[wu0[#@X'>,͟eLXboaPYи:"p*{EtT '-;B0L @:l*Zʗ`.F{/@~tQqd̖ P$3%}PZ{ c̓pΊx8/+~T!»Pb>U)7TQ./{Ƥ%`'WBQe9FzڵHNeM-Soc˻ݍ l{ZHN+}i{ӏ\H1,ta}cDZONy ,l"wdX -kFDe%蠜4|bDv (YG.G .qgxXq W UvƨO/&(K*ڧѐ47Minu^t~ŲAq'N*i~y 9*oLNfX;`e5FG#rƽl_!daScMZ16D_v70[xnmx5zgѵ[P"//@r?~z};Y\ .OSFTQ\1eا 2Z,4.V6zCWY&XݛRZӕ= !aqPAmv)*' UnfT*Ga&v\dx96lkS!0~}W:iK<ܾre 71aZuQTz`~oc%3 &G+dq DtMh<@~RpHEs2g0Fƃ D&\;uDde4$o؇Dt!J;nI:|/,#*Tuxy(-`CcFAms̚ya 27:8=z/j?]_ KalWk+,{\ťC_uhG݌P]{,ES4P_ Y 6ZDP)c.$e L=UOSTT]|e8#NAN.DJbЊFrJ*T1h"}ČֽA?cc6q^CK;i KqQ]~NzmkG@RºL&~qw=ua1p l xBi@_J?>y r'}W÷F3!~Bi4k8b x 0ʪjrm-):)]Ij,'C/-GDsήkunCvoRPEwr%f SRa\ݛ.y煯ܣ#5RAta|QY/ o2itWӤ )6;*@eN[Wh>^beT1$|g#mY/$1 JenNp c:yUS)~6>MI-yeo<ϊ=U.d"܉'0F |?6'|#1ϳ$U"#1w HMᚥ'H`b&rXw*rmO.Q>+:.Gz_Dds`57$]|ǻI~WdW  rJ0Uh>6ɝH$hS֐΢xJπ-hG G"IBH[\i3Āy=i;_4әŖddjHgxJ|v \$*}j?vAܣIۣH[EI~v&'pKI,lz7sM^ipH͙|VQ5= lu4ۋ6_?-V6X? yE5j`~Z}*aÓb~VFWۺb!s7oGSUCqwdVN^c.ͼ,AcbDdPN5WBLg&PA8chڟVmE׈q@%IP\' ˣe Tqdvpe.}dե(Džҵ~Ou*ǵlkT|_It2@?eE^(4_3]Hw[>9ZxcKgT,(l4N'! Ή6=MF O!@Q&u{]z 9jdS*X\Zi˨<1IHHh7D?x/fPT<,@HKn_`Yw#*x\$ϓ9ATj wFM_Im.,`֘vPaJ%C{bam2m S19`2Im[.`7 [< a(xPvҙTehaI R5Hsy{Ljos*$@uGOT@7!wzOc@t8e_V|[Z!VFSE{(q;im[sxc+V$y)eVtl*%CQE$նM(&.R>YTOISzbxmAk ~$ @(xeCI洗ԗcJRОAFr{=Ĥf܊)bW7(xC(Z@DvةAۇ)hTp핥P2ikIbյ!MJBCW0M.VB[hl,v6%nU|-h)rTqHZӶ+[f:>|8jlk]z ky(,NZo p ' U]$)r`.'kM4#j$5 IQbWуOh7$;]Rh8Slv_#-zj!d&)xu¨(Z:½5Hu@5_uKU;@t#rO 2?1"3LVÌ ۊcWtY諞'_JG,᳋28n%kZצ-M)ACbt%g`d =xH`!':=ڐނ}y&(Qն0ur=*CB%Fa}L嫲ȈDro1 !ε٠6x1Әq#fo_DP h&FM_fB@˯&N@14wrq}ދx:򝩅2oGev=hcdMaFoN5JŬ:y*z2/b(RC'["812 aK'% Piűe֗LP]+K~,s_}P}35-9 9ZlgiWzfpϔӂ2 Z-G Mg1LV}#$p5mjgN= e.l//61N<@>w|K՜k%j -[AByVuP-oNJcM@( F5&5p6Pd5 W^.#Qir!;& G=.oC?]r1|LaC' "& E%X^Aa8I=&8P*ynol_0q\½kAt\M!ؼqnKtƚ`3PYԭ:tDYmrp|+ iLS\â 9۫V͍F:g$]a(gVM,B8*yDүƲ'&Tn:&tP̱51Za¬qt!\A g˧Q\OL:L8U/=j3qӸi0@cxGk&;X5<4I qnezU(pyuya囄v_K J8m*0#b|}>`YOGiMgA&Y/~U6j Cy)ƸٗDjiЭyzHOHDqn @|ayBa@joiye4)k~i-!cd;DDEحILkd̃-.tޖqN*g9i;w_̂>⦡boHޣՐHHKj1O CF$'+GBL}T!^Jv9YM$ Oj@Xvp FR~l)q"\fȧj1zsEqRt=!Dn$&C/JB{i×N&zy٨x~\h46 %e^P/B q;zO'TTűJ8Pԏt.4LOÑT*[g_*ؼdX~q+ڃXȏƅ3B9B9>K?-_x}db f!fd>ϫ Dwn? 9AFbp6LEXY <|nc~  2PYK]JktlWC<-rxW4K ّ'@; qj{iG-ffܔx1D*PfI|i\V$oe0'nv `I{3L;@$ň|{Z%Ve|xyent 2gEY @btR՚R@[\h0g\C¼c|5U4a%F*.9BO.tP0I ``͝]N㎤ZK%0p)oI27,ŶW6&MJ:X{#Vз60i[yuk⯯w m5ڪ{T5tC~޶𩣈#BemOs  i3G`Tv`+% ՛Y0ּڠ9ej ^PVfm_`.go@kt%WZl+9]@ @|AEۂ7 7i^G?.V+̛\X]; N"Mt{F.rVqPT [Й>+O0>b/gK0gIjJSxDA,ZؗV6QI+x$^]b'6!5Sy*뾧`O#G ]ۄ\45Hh4sػ_F +eAhH&?ub͑(j$O{jԖiN%sq[B~5<&a;{mT?Q)Ruԓ6CZ>k`JEHwg`2++nl-7%~NWV> 0*|IfX^♻ΠHyXܖi <blؽ~? 0k&Mɫz ڝ}V᧗KkYgѽ:~sHm(kX.?mxZ&I8#eEzOҎK9@ci",kO-'Z] bGsŻY{Y3MH U$64]'j M-O.uu˰ L)rۺ z1V uLz'C%YktѮ@.Ad?M4sH2e.v4%gk۝;f=:駷1KMq6L.G֩lHGw DB's{ϵRȄQ2m`L޽0?~Ტyq.;KBoQzZ9P0P 66!@]%CF3D*7'4c [Vs-F ZŪW24A1 V- z b=ejd+?Sit@we3ALYҪ fy0 #YQ0>z=,%Bw߷S}F6FP.`~WS*d{{(sVJ-.,κaHܨ.)b(F 8`5pk5@2H5R]H a "Z~((o{oa\`*_iֈ { Mƺ)hQPf*P gXO*Dp$db͊~K/S002̛TO_[2AuW-Y|! v9TGt/%ݿjBBd+]Άf߽x(\!$oĎSQ0y<$V3yV $KƦE0̰>F6NǍx-C'H=Ɇ"Yjw;EѢF\ .ehqߵ >޹UpVLxң {s!5P?0:޵}6k#(jewL)]0 ! zUO|v1cf;^O xWsG(;xjp@/W3er|Nx CpV ưŪetX x7"+#d5dO$5'5!DLxtL:#7@gP>+N sO7\>ī`xD\Q|{r I4`D̓=~3#:66P uR$`q|ԥA7Z;, ^=iW΋!Fndt t 4#XT:wd~KsAH*a ;HTTwq_H'rKk7p~#O'jȷA_*w 3zR(W{ƍ!q&_Yl e_|⍍RQ@w`ĩHU.lհfoT~ж6y=R JGR(9oSp^">uU wBRO)*)[*Ֆ4 ʬblDoY{G7t5i4Qњ#3"8H \M>?Yq(+!ݝ{G%aRq$4܁u) v12JĪ:n16|4ɝM@8M\$@ק&oJӬ|r] ,VMg f; sr 6o_0c{H[rD" Na/̰ɣ=ɩﱹ@#T<>ANe4f8R3O>VˆP~_^%Vy& 4t?|֮ˍg_Ȼ0+P瘆9cg/rd8FHDBdXar:g]܂ ~(#`wNJa̽fH\lݚMdH|0L"RPe|@N5}g$>L"c~Vـ?z-ܩzOB%XPk;oJʦmJ4^zoRi],QgݩN_S5b؞ A}y$0Ơy|/]ݢ#FJ cby'c3mX_spf82 N KsC˱J\nlڿWDWL-e-]RE7"zJZ ύ1 By @$`}}LjLp|&7W$"* PN9'D2oTa lrn!o6/.S翆,zTVjJ4h/|BJsCs}Q^\_u5h@g|ɵkuyyo떠OK@ه(oMW[Qu荹M TƔ.z'c&NU ˎ /33kd,lw:?n (:ȇ iUV-Ci^'¡]wXjf۟$  չSNȋMNK#6B>o^ؖ}%Lm!$T:e 9Ƴ|ѯ¤1:/d,ъMlkDHy=!24^ԣ""v%۪<}Vk9/hfN;szPXÌwX`жivFU<2͑2uG0bQtvI 9mνei} dg#}!U%Ke{g@u'iVto CѾ=~LW<^1:+u@\ž/y sԨ C!L~*&n eU~i3`{ vf(gfxIQF|wޛ7LblOJ')@I-չϑrzgEjH}I'sQތmAd T/;!b|:rX[p\t ins&Lx@~ɶ3| ;E6]B@ &ϛ'mȨD#dn2VO^<5W@yjr%n"l䈯m"r#:DҸ5ZgW4Gu˝R* ';ϑClUS@'KJP ؄\~4]P$hDdBP1*{yR6 7%U v+ $Vd~*n.MؗFYÙ2:ݑK!6ׄV rT^n/C#ʛtvz"r9+=O#aI`+ {tOf?1Og@b q2uoyOo(3fR y/gt,/n0@S*B5"HC ~ΚBa -03ƶϕ9t볷 G"ub3vQ+PVذ0UnӱyhƗNJRٵ,:rܵ7Xch/-_l`+mE{93ApҟɻU~4>5'/Q$yDoW1ƁEa6lI;ҜV$m@T78} J3_$?x_~Ȟcyr0%Fj'$ET-@ ᘵlT&QW_(K,R{%QH\.ڥrƩlGZ}8r 4*.T3g}M\[9_wG bMqx#4;$jj"(RP&/λc?y}]!9yC~ScM~b䐥zD_3gI&V%Sd;.B-P)[xaAg |t DZ"޽mĭDcGRAkļ;ّ+pi/4 *;.ު{QsTgWwoZy.=Ż"o_c9+zchT;R:@}AxpO{K3\r%&-OйvLlҳO_*ʵB,Q,R0]$8-݋&fk-~8758^d<5 +V-l-cF/@뻌97孔$nRAoX}eB,`)RmyHI;o}7-] 5<̞tizOυ VQ!٧A}7t0M-Aq$§(Td!Bho?5#aG:H9ZQZR?A^tK0}(SlpeDv{a)p܎Ԁׁ+yyҡ-r>=H<٠8! cWlLa/W 2-xMG7S_x`NOr(xY\Qu%o}K)kt4`̒M3TPw:;5B3OAnc>p@ 5ikWr;;`$L=3}mI~P,#tuQh,f:=mxLEx^>5?. y`DwDmv%CiE/ForyMUV3tcX􀢲{e8U8'jLT#iߙ ]{D rZBssaIS枕u͒rﱍګ#i豙ƽԂ0Dj̷TKVq&oQش;)Y? `ϵv_H-99^EPڙMs8[Fss zN›^0%NHgV&= U( -(}&LpS&ƍj_? <'% 侯TZJdJxQ]NH<9X;!1WbR&$L4  Iߡx"^GhFA%'Cѣ3TAxc@w 9/FL*cf+Zx@s!r0O G2XF:vKנ#?ͽɾ[WɪBa4=U0Lq M. g5~\Mo!2k/`m'Ӫ%~ ,7hRhWRŽ_"2cc0Ÿ XHe^1'3 fpO֗tc|QxL'p2;Bjܪ ޟ>=Qs-1u}]PT_ْY+KH0X zR7|~y62l=UL0ӳo?$bj#7IV^f j!kWg Em5Cb4_PtGB*[mZpcbXJ|i@V)Y@y "rP5?/י:0j!9esJZ"J.cfLE@ɦS6){ETט<"\ 'fstI.Jk1VFj E<&&g'8 n.fR47JCcA~!%9d--\!vɊmPmߍ[ZaUY"w$LU '&=1lc$4kiR_UڋRHTO!4;PRWhXW= 2"E PeAګ GZUÃWK> Mgc.< W?w"߶jS{F]X%%gؓ:"fISxдEut:EjکN)`oٱKٜwdz;`d& ތ\pnѸkOdV2{q#m;<yWc$-76DGiw3*n|GfUSe~&ɨ!}fXzHtj#wZi,B.rג?Ms›L[L@@2m|Jqu8!3h^X|ڳJȡ,jJnP~Xm$z$P7oo Ж[M{*b^G,ΧðvإN"/<:Ll&j~_p_J)#ɒ$gdlA~\k4l|C˴7^TƱujQLJW:GRtBkWHqs.A-T W*$-0<1ӭzZ<}] va Cmt7̜4ϭ0}iGY 2K0R{/>+N|qXrH"bʥú~&oO> M\eF|I1K+\?Y޹ "I0y2f^ź4P?YhqE3?sHQUkIfE wrtCiW:)J^lm+&+VgR?9w'JptSLF7ZDBkJ*a">wHX( ˮwQ~1N[zVY-Mkܜ1.Ub0ɜ8d?d"ŴkFJ×lY W`{h.-U*L&{T5mI PrN2zK:RsNrk)A~KŜ aU6ǥ/>ѢĔx61,Oۂ!UFEݻ*G+xc]78$\bf . D8˜~+}wJTSJ,*T@h&8_'v+@zQ&˽GG @-AMQZ4&GR׉!}!Pi,,zF@(6T7E~'{,3nhT(PjLSǽ~jx2_G\c A)JgM0!!~JD<Ӟyiq_ (9ZդiW TL)R>\+FK%#.ŝ,Sp4`oC5d)F0rD~d:,( ƃzJWU|ϢIC-9wV6>F>bȝ?=ёƈԋYo mr!ĵhUFW̄ @G+#tF\GZv8RD7>EwwE#SaܶWCM݊'-$qm`uԿ ?q+W;=Sw<K Kv r<֍@+ C=:g»X)-s5˳]XxrbЂZaʾh/ -cT&LuOK\;>:w3xaG,OiFeJuOvjYg1{&"ĹSLie*c2y2HFG}Py-HveKo|.UU2y |;:LQ|nUsZY{t!F&IanhG_v^Y!?؛^pA>b_$3S JI ӟܸ 7=|2~n|Ϧ1u׸{F`mC^V"P:~:Muu"^p\CC FYNjs&FV&%dԄ`"{glD λ}˩$\`Va!97TFej" BQņv,ǎ#MXzܢKIfe}UO,xqHwjo 9O#'jT!c Uo DvWXFˈ` ǜF>\`|t"U3VnI(/Vo7+1җ͚ү"b%@ϲE2H؝7word-wx8sz](/::TŎ''J/V_b歧ܵ;_@d{Pc_]Atq\oՃ)a"Uxd/7][{(FR/V ͗!vV5Y%m>ǞG@-ֵO%vB8rAwצŃx"hm{(!熽;@O_a>I\n Bwp(>r:Xd̥$1O@wѻĝ?g!@OwNO,FR;*2'վJn+0pJg ls<`њ6!e:8 XKRH6A \6f7(+ͩ{fQX1)v R-Izfw@dL נNpq QxT"no{JZc7Ax֭hlfׯfO0֦FK=iIQsO}~Գ㧾ƚs`QåUSڶ; y 6?o1‘_ǃX)RTRWsDzX0Z ) '2}ix@+47t^T(_z&lƉ0f.XS\BȞɫA: e }oZO50xИ!7C䍲,PQK{\b/uDL뭠9ezGvKAQr;;7 ݿcqVDj{?ٷ«s Tbcyr#!4n'恏. 1.~; ̝7ӭZi8Ǿ x;i:wC؈9Zæ.CX"=0fvwFUjRh{pwqd&vnH,.$i5ʨ'Da0pDKv7auPO(z=;ծ; p5e WK}NbL[X04\b0H.KA *^n}A&1; b<Q)#v: Qɥ@}!e]`2AԊ'pr_~ .6DEg:e=RC䈣~/2{vʶD2ҷ=e6D:(C_|/s,OoN" y[#-\;D.ګym4qq+c+_,&}'Z%.$9kMRÔ4JJE8/~'g,?W-=~I%oq\ 0-!$󨀊7fѳ\Dƍ):*끟Xk=6 ,̒<R,{HԀ5Y\LJk?YFuX('Dݪ{dv :XB5zV;q%ġVX Q4IWDAL@@t̳h jlky(aP#Tp\\oa_AV҉|?x%k379bߑkE򸇋360Iymѩq땬l 4vubu _`+_Espn+2 Z4  5bgrf7bi7eE˃9\hB&E*%!w?`:+@E30` Kkڡ>7skػi6@hC㮆yZ*eY&QPM${[l[]`su쯾ƭYmjZYFN\ɉKpWQ.ᬥ|Nbhb(aIz9$JW/6]cыJ .Y/n/hN?HkYbM E5W/f /񧫬KR|8Cm0Hj:j|b/hXopZ݄Uy V=$6Û yyH{t" 2+c|%g:1aB'WUSM2q2m(,^%NT")#7/_{ 9Jv9x W |ĵe8n24k)]Nl,ٸ!}VUi}x\hZD0daHOG،,ޫg sR&{hϱ[̙P))˄$SڤR^A~2V!Wz{ޯɭz$ %ê*;#b#^ezߑ'FKfaLw1iKe^d+HF>"vUxmU(Y5ZM鬬L͙ޑל+0;pMq ;0 [?h {btLyE{ ,jbMص6k\Tw׻6Gt#{eѨ-{Kd0ӭ4`$Ӟ 2<፶ PzV6/̦>aYP_x:8bM-)B*gD6Dߥ:i`g=^Q.Wgqc,{__=-~z/׸O=O\_$F}-Зo(] ":"eE}wi~kxl R9åmqG mc eƇ\ Λ!vvmۊ( ?Q죋گwppawPqWqd[/saE-~k_żm^ńyް&ӁS!grΓp§ŵ={጖ ꂀv/K2ĩ8+@6-ńwhr vͣ2S am *,k_Lʵo FeFpzyr]kI3l/e(x7,;>A4kF%3.x*8/igd]2xVybX46J alCʚONgqoقiRu/Ax"Y¥-\l$i?/=@B!WRjNQ>pO.;J0[d&ϯ|W8)͌Eqkd+N'm&xIk뮹.ۧHz'gL\=wY!wnf^[LȔQM2&~?0 O-=(E)ÿtH-{^ wLޡ%ML 1瓖q  YT@Ç ,צJYm߸ :dGY6e΅ ݊\+yq41Mב=dSw$"hz0qbGO~ᒗTh\#2!kʔ/~h XtV;oJ%Bql細{, 'XS#5-ȠPT#—YB^׶;MhHB)tqbǨEE>גP *,e'̶jLQor3ZuNJj;8-НyƣK ˁIZXzbWn#Y\ Rh'DuK޴X2<:?E@t Z={N|Pq6VBSO/X3re /)~iHc*H._i#:M~ DTp @g%ϩV+X$+0rI>Pg) _.F^LFA !K48նYtk&lH3fi.xU}ʑ*ܭPEIȉu-egX.dmEH] ԛRb"һe_1@+G 6b( hNHs^'D%*y~z>ֺ[r뿢.lL"S㞢ÄM%%=I͗Є)SYL!WXɖ9AiqQ1.R1-}CLibtfwoLU$Ih榌ަ*;Oh[_zaZ[DMZtD6͞3]ܕon}qRqFq \a̩Fm0NO\.zPQo .[JZTI]x;nd! A`^Aа M"SfsҴT>rCƀHR;Н&X:\,9}Q$J[s!yKg?$#S3Um(Nj&z?Z7أQ֎TgyW_ܩߊqQ.VdDᢐfW;}_xqƑ}t_n*oRvb޼PI{KR?4t1rHI/A40}T"lU8ChWFo6Wk=3qts# ;7hn[ҡ5 )RM$܏seZvz'Qrh ^z2-dƂj{u.O`uT>PgZ̟qnI@w ShS"[YfLޚw+!a>DtHX00" >/:yZ#لgJϰT@} gfǞ4PNK0N"W*,H`7sۄ0bE}Ss{sgmFg]0[vܵ^"@Ì3OYW%(8%D?s `Um[lm|6@@5n44ֹ^9EP,#dmo["nY@Nz=?,~tӈ_JV Y3wC3+#E[=AN?S K7= ”p`^ APC򈩪QIhk) ϑ? iAxl;&vАYSrݜzB+GVkF&NaeyB3&ADE>];̴>oEQ:+2yIj"`*-YqX"ӹ_k}wڂt-H3N4P4.䤱pzBUsŋjUx $WIΣԄ@'+_ɂd=w~,;Ѓf2+РZԚF+c&^ =!0VdQiTɏژ̈XNgX=UsvARĬ"wM33±wYb;߁qhΎm1;<ԚDx‡` *_@PvUL]>`xż1TL!X%4~dnc,xۓ^ѱVbav Ǎ厀VWClsJt̚%C0oE:6{㜱痮I?B2N C d@&f`Jnc&c4ҿA+ BpjUDl4@w)aoGIxct_09ӥೲ\^ɗ1@Vf\A' Nҕl<( j?>3j -0Y`S< c Ga,+O$ض XI9X*O[KzJH`e;WG: {%t'Ls4TQ'URh023J<2uFIR MOsVi {tml.E]~[ Enp^j]{V:֬ncVAsyw 엽ЊHZ d>YlWulCG! |b<]ײ 9c W_7$Hw,߫/{a2PG3b{[SK ɍJp4v&!_ 'a 9n--B.RyK(2STfW&AF [.i.7 ev ݲJ^tҠ_ƟW='+ <;RМs U1 Ѵ{# 4]+^(p!\;*xn?GUVRD?e o>1Ҡ" (P. 6HT&9Sjcr {ڝ7e Js%ɦ(GK!۶VOVrypSMr`}SI2ڼ]Ѵ?sP#U#5|f ј ?#rb,|)Jfֺzq6 k J ~ݼyZPkc踎dk"^vy/1T>mBZV)zI" 8~њFV -y.>j]X]X5>BcK LyL;0v9itP0<蘇隒#8%8]L.6Ѭgv_IVە0sY_!۩MO?nTT >&<\vS4W/A>M[#:NwU -RQfS(V0*3 6u5hr(Yn7zޙizio4] 4ZcqQ|nl"cQ"{aX.jAIan""ȝ7TEyfMXP&%,Ec`8<}$@)y>Z-<JDOGN<C3᤹?!-O헊7|'D ?zhDbK]O~ g8Z]ඕC%Đ)ap;OXak񛜨(ͻ7'V"D&uF`:E+>Y.Zt#?CQdbVӭ]ìCZ%?;KbXjXre|~};d'd-CP!P)$oL##*q6LN.^[,OPk+6jʥ ~"j֍-5TRπ?lG&3/g\})Y0;uW XLi܈qt>5:e1 -z; %-1 * un&yp =v'j ҈%hF6 y@HzHwOI68NLbybG_xTӲHӉY2< HJBo/uF9_r ;sס>'iЊp>]7Eu)ҟ/`V3(B&f۞q'#o7%_9vijlX;w,&pj%<7T3MO'# (c&y.gL.4q0#Ѽ f8?GҰLmh7#2%Hg 27_v \eޫZlfB')ߟ]#' }la~?Jy('Q9V0bd J3^v"^/8M"sEfbQ}?W>jݐju upLFtig:P=ݛ9N EO k!+ІNJD^Ewhe'p,C.]et1qR%eeGiGЗ?NKt}SbPt0>ҝ K'vE~z"uQe~sL;a_,OQk ;hꀱIof’:@ Dx-.R>%u@AQ^#5>B]PXl >*}Ye--j_F;z:޸lQ#̙3\Th~M-"v<Db4'ܘ ^ɭ}v4Sk Dyst jQ[ƛ ^RCtiGIGm~f"1䁬mv7ۢNJh!pPЯ L/qr>v_iM#*kJi|E,MRS+QA8fDWu *h#A@,{"ŜBojM#B ,Θښ6F;3~:So-FlϗkZS啭PzSY1d6œ~]!SlF)Ae zm82H= v}lrIyl^PLnnGB0eO 䞞b4j$<[k% Sូ<"z3(=ÕL ri.TSM)_f`ѲO[׭u*fϗ'U<"j/y/B7.jQTw~JDPkaQlI? EL|Dq(iXs u0+;ٱ:N}Ci"L@Orm,bcwzC2S7p\噐Rn ͟Q|ِX#0de;/dm,4ً}XF,:RItXn+5;dt?e>urަz:JF*:E,m"XկU !Wy ۞/d":w6V,# 'm@EalK^V\M U$Xd?BgѻN9lR:qw.WT*\tŦXgˀc6 X_x q7"R'֐`#$O'bQ=6zO]Ӧ=+cTK>nIiD85Q~FU1L Dv tsOSkvpܽIPKy%)ح.t6. D5ZP%YjU$^fQ 7>lĆ%'MYb\>̲,.KP:=HX}\Q|84mZ0"M'%o]Mha,CB:aS̒T䃦JO-JjEPI`EQ@{n֢]g`A>D9ZcaВQN ,60^"W*T Lo8Si64زëi6nP "IXH6̖_{$TE* rszALˏ*7V;h'(.&a;|'߅?#4ʊgsomr^ND$jBy~; ͪ)6l#wmtko@SVۀJkhFqJԨC#_[t(~&&/M\=aFc@ N8u.WMܣ0dTS4To$ KSCB e.7MOq=&_y%M\1sΒ(N d_FD lSz7*Cl60ĩ_˱zXX3G 'm>nxA,|{P#IS7Oq@6b=湛}qAw)ۺ#;`\!l#ɮS;86VÄ9OZ uB[|ӓQPԅ-٥8YȪFO G0U\i}2:ac k[3#q@gff$Aa66jCXcSwfږk Zϰ%@#r%%ӌy.fl۾[33|o%󼙢5 _m'"Z%"'*R7C8P̠dxiN.iUY5EARI7=M~ZC2[8T^v).Q]DuSXsrz"<.(}s'b6lYZ}ʾe/ и4inw]UŎpyT\kT ^DWQ2XNp>1S%z=2'㬗XߪYuC9-hkXAT7֦;6$kwh0lɄ@q9͌8pbzokCQ\1˳SC@bʡ?+2vc7X4Rb.~" b(E-!|OKvCϰ)K8\ZIO=g`qC烱aY >Md6{ط5Xc6QL^?Y2qRb5Hl!A :py]l8 * vPQi9uVq6;RkJKvksk j@ﻶZ9.`+=q[yFSe"8,wq'rJ&a9N} D|w30n/vdz||On+226 oV, ɉU;>="k7͆;9a#WiW U W< {[l{Kp=<Es<'^\DHQ_?ϰUT A'V-TWQtB"-|ys\ :y,q$>]ܬl| qy٦?9$`{a_:<;!x@X( @1Ux۫ ?hbYbSa-M5?BTsQ!Q|0rEȁ*\'nEZ]VĒE Z#-3f^/mω{lHҙީpo]&SN`Yύެ.'ʼbK% BZcEhb4aVſc,id_Q ,`>pX-v ~ vD.ƚi1𤹒C3,љ4dz0aIz(O(#Dmx3%mX Mi/O5d@))ߎO}NƊ/Zak;s*iB؟ƭOds3æV<naV2[z ;WgNwV՞cQu&5r;'n"ϸYL{4d IY\wPJQZ}ݰR5W^kyxCݒvpCWP__lˌsw|9wGhb2>Iʹc> nV0K"lNFpA' ?$Rb@W+R@?@~ e{S-%_HFz׫ʜAWH9\Qģ 0>g3<&8<4'}}լka2D+QLӳwNTpon@0#"FGJtzc8n+7o quꇘMS 5##EQ'Y8RgC r+9~gsn7eUj G*ߚg&Xafxyxkũ \r㚅c"CX<yC,nG \Kq@!d@-' N"q̚U'ȑovi:< 2MJg"Մ܇hHs(2Ft{b{V%^Wr:e^:ke~:5 1iq_ Nfnz`(J3.'+],ݖr0L3mS7ҟyG!T%c8g>nD"#)Z3^gfHzR=J1ub )+kKw4P+%^̞4!7 z^}e^`G"2٣RBРaHVw/BrFK?yWH{D]ckp&M/Ei[V1O>|]׳])$ͨt!vƤRȅ% H<Į8"e6|֞4W{,R-H|gCQnrnB"!M,N~H@Z4VYG#BGвYe ò1P:vg-c? _boU~}/>8( G8o{6@1kˊ2;u@n+{Y~pubz۟sW yi=\=v  ^n&*yu'*0I=w !"o9g>8DmQZ(Tmcgh-獄nVV "Ea.]nHZ ]F~iknb*g(_gz~* DGs.m NtuY/'(hpTsQ-r'S:`-0]@X.@L­ԐZj :Jafd=nRw!L?c"q~ݨJۣ/ePx @10lPG 9pbO\"f?8K%}kjM{0I&A!uN" |onq($?=&ah_3VuWkzwlԙ)T"_`W%gaгH~Zm>cF i5q3Kt@KoudFҦ|.?Q<#Ag s<~ 茊Eps0Vy]㕝h)C4qa{LprNӈ}MT\,A!,5AB__'7u}^5uBbȜ|d}y`JND#Jŏ ^WB*GH8'NNǬ<(S+RXsuE7vqs 'WhuPk᥾-:Zc Qܯ.Ca/2uU`״8t[s#=>eIv߻If_|XL-Q!KZ H{ GoHvr%\ox ,`k5#vNAXUAQݩ+T{x] 1axmhcܞSd GWuhxS̗\֯LXsm,c?sVF![TH!3'f};VN]i^߾Q͵tLK7,Ezh#"kP o}'Ua42_&0Q7@tPum㗂YkTQh7n"JVco\MTqʾ^)=CvK $8W\VHxv=+'ûK-tS} c d0S5GF_ ,%v6thC s@v86-C |@Qkb;M-gmWB&P [$J\哵2$X-qk{bbn裉TSr\Ic &7x!<ɖ\ۤd߫WvFO\H(JV pw./`OLsT,_oo"Xiq"۽ AOX`6ߴ6bʮ/[ff[5ީ'mE)0]r^UDWpN 50]>>LM~j殅v4IGrve-GC0mϥ^ f@W.\Қ0jBkfrĥ ԭGYIlE$S2p*Xl*k0,du}r0*Fn{;Pωu|_0Zoj=p=2cDThH[@4Luf)WJx\&9Lɵ>Ԋz=vpWHTG|ӺF8ʵ X{E=+?,۾u^s_ɏ3}^ZOZ-+ k"UI!y+]rQ>8z rh`l08L1xgZ8r}R9͑pAx 3@2&"m)T[q{X eENۀHyWES>"(v'&)mLγ wR ˮ*ޣꂛ9o84Q a`K8@=٦ lbJ͊qn*&ٵw gؿU D 5ƙ(bDt7OdAR e~gnVc͆S*va5jεZCgS/h>,;|2&;m?):,&>SD21h 2^k uF>B1A;oX͘/B)7L`}ޙl9F2ը= ~VS8;_WK2"u?aTr&nĦs≽)st fT[r>݆JB9Mn(3r{h4̇uqH p-Ƶj Fy4ԣ.g=}/bZ3 @/@O*1:KجEv (;hTah늴lDKZtݚ";&^",wXza/pzXY\*YG婏 Vxsk@C*+> v4"$1;k8lRH&S4$dc6 iy/6*PRʎ܊> ws FrA4?/EyIlΒ"S}Lvh WF䝎Au<+_r'qI,\R"Ԝx \Wo e*tE_Y6 E4j#S!As} \u\;HW^9pl6{J(#a Y1NvՓWu-9ܰc֩_蔔Vedzj?7h,Sa!10)zS(~*䩀ϴ^ óKgBPŴ LI6%Y,A7O[V}bL_[ cm .D7s>~ 18AT-AepeBUQD|(د)J3Kx @h0Q]6N_xPg( =uF&o{d'PCe}uD̓CAv9!=*|m[:n)(^~7ˋ l5U:i.]ROW'(PPޕ_Jg5Н,V >N\I6NHtb7)CjjnCUz-f>!",^.DP#[ߐiw#;If䕝 삮Tq嫋 x|s$]jf`&'2oCZGotQdϵW"pgc "MV7w3!iO{d@ww ek} LbnƛϘ#)7F$8$uNyr;b.6סcF]hj:c6 b3(:Ym{.Net64^)z2]V6gԶZtzv J\b}.l 9DpQ)cOLmDXW.|&@MWܤc120||BL[îg a&"ivТ,g%12Fa3NVkYfN=!2Ͱ,l\x0Y.dVV,s |Gi $ݲ% 43t}TMP(ymzxyq;YDP0DFd#KW\U` xݪ]Xע)w;FM@{RCDtVfDY;O>ir3e4rPl/+&L~I,4yt勎. v6syQfЩgH~p~p$ [ %maG_Io.nI`č_0y@;zpiꤥI2ڣNa/Uzh^|L~twk<ŐS)>Z^5JpX{U탳n Lez]Lr! C`fIaϗ 0/ߣҐ1;Rq ag,Vi.yX0P"[cݎQn+ƙƿQzFY2}hv†^ZttY %vLwMQ|>?:v hw˦d; r]|?Ry z8ƇBI䙞ߤ~ 74ڋLc 7\bGYU>soD{zWQڴ_DIur[rHL4ٽc aF!GgG(Ooz_ "w~}A}0 GѢJG2;;>o [2-G,*)lSZ:ҠѦ1}5h<-i% /v:ᮝFqbvZT\^a;>xzⵗ-&Z*`:m*!x 4~q;ddR5(J?q konnU3iuuP#"3Sȏlvva ZƆv C;08PU}3(q묂QEBj/-:ԚPl2A;X6pSE>؏ 0KsP/BB+`.N>#^֣:ױt!@HetvܳŔΎNBhqR0}tz<[#\Y6ZKg뿏s9דҁ+Ns.X2/;aQldw,B3Lw V2'O\u6AK-h:SZ%X~q1svܴeSjUIeM*ܿ+gcE+eec:xm!_+5\[pQ[_~'$,ӫ 4IGCp59Wz$-"ٺpz!o:}}j@fˆm/+059V!D  ?j"[c/F\qG/WE=,dԳZ#P.'f EV׀FM*}HcUF.X %qBT̅"ȹJZMsr,h"1x!M$)mBm̕R筭h>MIm_uwDCwMTyw2x᎝`XNbg^$aLw~Jʁ|Zam ҙl.TLpnģ=+M#@:$ E qD58w{̎Hb#s?QPNM ]km[WUW*^>LeDqX1xy"w|T79=k4}Y~_NikARrugfug_ͤoV-:瓿@;cV#rG!,He6[nUARUPK-S|ye>XA+,>tج \+v6 [Az3د8NNJ=ݐ랅K?Do… pnЋD!bs@XY\=/@t=)XLrfaMܿGK4d*6Zx݆17ŝzzd>=.a[%/@T˖* գ@ VP4+{grvte^LR2.cdڻPB~z-p :NjK|lD4 hpvNqސl!؎u$!UʭSh0L \ >]1e,aW}vyx6 +B/IQ LڼLz7E)f5ha ~v:pw2T쳳w44& {uLȐt[s94bAp3< @QJhB.-`- `$}vϯr6oAp!ZaP6΢Ƙ[_CxoW冀&/rzT~V%~8t&E/BWd:t<߅ȏ8˅>^aON2Z7;C|WM u&"}s\,R%#vS@< ޵r.sˬqm"gWt9 /-lV7(-Pn? _@߉y%a{CT1J ۱3U!gY qPL~C$ 5Z]bx54Ie~x_hE,)RLvV{^b:(3V-*YyHgyT#*rzBmS£3EwNkSVӵJCz@/-!*EXU|8IQnpr&yEy&Pl*|hq3eFG᠅qmdT ERq`g4)v?dUf0N'Z1VHY4M3U 5Y(XHj/ZHdd|Z]Nr^) 9LY^%u@-*>LU?:?S{.. rj!joXrZPZ,*2BeB+qdy.|?i_|;e djĪ{99ƙpT?C?sء֝kMMlxnba~k@~WTӝ=J큞Or:) DW1E=x=P0ԐHjdD {E7urP鸵̤(m6yExL+s,ZH+{P,1mNa?W9L*(T#."0؁5ͣRPDMۧ$C7Yޚĸqp;!T3ɆbJ l7܋Yi>-rXd>Q|Aj1X{k;0LuM#Ot(+2V~ʄ)4gLHWz,a}Z'F|jvHaB) )!5BK<&

D#7yc>A1!+Ҩfq} VNr@ٟoUd|>}YZu[91Ļi {YLpE[Y_&x^s*^`cA&ʊHtAZ_z,Li蹯 HI6^fMZz&o?i-9_I; 0xW\~dzp Ý9ېO KoK6ʙFFʒlSYڋU@k$W :^Ҫn\7`6-沅]Cg5<<($6c˙4NEtAaNF͛jP^ Tℜ^U}G*>Ow?)|WK HkT.`rk(P48(1ڱ(ΰŰ@#˃Sw]D pj4! CF RD91G%AmhQ)::)5SHnM<@ZX||Q  Pwmi &ր|_wF:w;$EԲX xB(H W&@WmG}O2)Mh‰&J-sƘ8% =5"mkH_о- xFQ]`F=郞LZ2Bl5S[ 0Z4ͣIsM$ٔ<*]>w@UOV_.svG1=kCn$%2}RvfKj- Ei,z_ WZPeݸ`ǜ%y-xh])z@y!PdCq0'7qnI@[—t\lr 8MGuj#hUD5Adz{Jp Vup5~!fQЪ3#m9w+@s?A<bCnM=1(TjN@e0q^@؞9e٬k;dz,OWJt9(Sק71ŧ6J ub ލOBkZB'κtWfMw2N~2RϤ[/ _`w îQUH.A }yhtOaoHݳ0gΜ>ρͮ $sxXaHG]jvo$W4bAk%%E՟8ݩg\ֹ3ܨ 9R~UmPQx+M{О}[3*O: 5Dtc>.$^dϑ®=:qHh|.tҕoGpS1ּ֑@FJ;~S8(r@ЇrFt"[s̯1?8q"( +Z4xi |NO `aJdx RU=̽g7m!<"7N[!U!Z4€O8 m7Ηb=70MIBpnxQjŁmSt k/-:egOtcR_jʀ V} m=Win.K?4%:sDhI!Tf4(>Ҩh~Aㅵ9j;>5IXfhj'T,fh9mt|w:ő_C25ɬu{Ϋ@#X%Q__gKAsJ0  \I;h}2iND 5Qxf~%7%#5P45NI6Je]iL~ec>uR0ߪo|Q.JGp2KJ.¯;\KVi ayd2؉OGV>u9b0\i{yW@b `PcI{gN3ON<>Pf42!j¯Kxc.j-Dȕh##N jNP{*R Xr^rmMܻ]z!xu)ؘ o(zpPsOp3@Ύ~0bk}(;R36e6a8VqqIy&ClH \(֤a!W4{:,~KˆA".QQ ri6ˈl?܈U+=Xw/kZ5@?ؑEZT$v 1( P- +Ov;k_ C$E*`"ʸՈRo ε= /vK5k3%Vo1pϲ]; m&|CW KpkGw,F`N2RT#ޞp$H- Rk _A_EE#IT (&i\zdŧ8valSzsqT:W}ow EW3\r>T3 ajL#7QtY lD:NzR^Zm0EI̬ Cok&x@Oi\d[ѪO ibUy^ߙ F~k#,r9-pGyy!!QnaZ]Ṟtowj\Z]'ؽk%)KOv/--W|LrrM8YB]p/,,Ǻ3$bRI<E9u|F{UR vc-_大RV 4@jf $u|?6iA=9mOЮt0?ۆ~Lݑ<{/m# &7{`z&ŭ[hsұ8k~J"Ez69™;yVɋTIrS]k1 N@OAq63?ApHH@hߡF~$"\ם .S&r;'T3YP4Ya[M tY/VH6gM:L}9BNH ?]BM0{jPlϩnjt-݈vZ:*//EPd>ߥxi͔D|ha(A"Dvh_ (vm7UQpPjc»@64H}jǢ/,p W罔֊9~U#s*mt|…裥v}KjםD|X\ޠa;wfI==evWrTx{rqm$7+$GJ ҿ:xZ㉘&z}a;< gyIσf⟡ b`}Usl#7\{꥟\"eX+sYo{RmQqpyw|},p6㉼X }M7 Pnr`5><m9DPDOR]n :5$H6j0uBX7s(U >Ҧ@y[m{U4]nm\`Y(IPs>W IPZ-3S(6d:7 y|(DJ*GcX Ds0i5ـT Z `|eeq^bx4<ŋVszMc4SyKs%qbZ7v,Njȕݜv8h.B6 k@jT ( 4Hף7‹2ci9jgQv၁(,' qSe# 69s$b_ e=u3Ӣ5U)ZdS:'Jj۞K^ڜA*W&0ײZw-m&~SYS\R1$M}vvRÒjߣ+"}zI291ӌUyڽМq30Jy+ 'O9$1x^ERS:K89W4Я'"\M&3." L$֭RjMpÅ"'(s3sNա4vR#LWNdĄ!3Kd-jAZ.D3WєuaP%݂sRsIkx6jQ]r62} zt>%A `:r#?X2~!ڷcaԅcGh}>=,Upo" ş#H#mٙۡtN(SJ1X[r*R8;;fRYNW\6bI!Tx/g MBR\%3v6b/J DFuP ~c |6An gX< wTeǖ~ygf}|aRNaCQi/8g(MKS$@xHAi{A-A翢ws `:[ffJN 2!1BkqbGTz yڈIGӗXr~_bIP(Z/9+z.c}r zy\M\ c Bϧg*p;Sm[A"^Q;P. Z<+<@7 &DRl6ٱ'vgu JSґmf4uqb4'8]Gq~s>=j /Aȍ>T(WA! 1G<y衦;nv= pэ RpQ嫂|0 FdQh@zkɒ$Ğ9'ݯ c'Ih579; 7-fV!D9h!W> W;;*`5hS z U4x&!0k]ƾ ~ k%AaV,%UxnCQqhs$Ɖ: đ򃦺x.P A;4}CQ-+: Z7hh3Y O;*ϸI9>3ůQInH q#aKObϱ?ANg8!:*Y_"l堲yE3BfA 94BM X*Mc8/.>vA:ƶR>cr""KA}Kj"^ siڲ$Qo2>_&Q0TE_㖄((}. x3==73NsЂ zqK3f&|߁ 21 cŪj8P{1kRfIv*uG2Ԇ\DUttRiH6]>@\R^Qq%E~~+bl;'F8]g5IBk/MP I3Bͺsdԥs0b%i+HϮ^G9+D VTѻ@!jŋK9[5Ԉg,<\_KsUEeJ>2ZWȡ,QA@Ҝmd5ll>FWvhcDt?y=DyNRW,*[#=1g!9ܪ"2s /[ݾBY-g#΄P֬ Dz<u!9-?.TPfdO%Bcrjռ p46 Ci\T,hsߗsNKMlI$Kp)\duH @z|Mc>oFX`e 2"5!rK;gC4v9u ֊%W#b x|Yfy@ه4'֦N qלL(Gly@thSy?"9R 9Q1ʁ2!rzyVtOd2#%dB * .,y0K;c0[h}E|EKb<쌟:(duthF=f'0_X䜖}RߨcD_>2I[;{ W+39ژSO磜:?[5Tگݽ&vZj:?6wkcrSrKp"wت|U(Pѽ{ ``Mm'+0:og i jA! fU&Xu|BmG̺z,9WS.E))gFM'tΊ&ѡܱU~(;#>F|ƾdͨ@CV&+nQͣR+"#P&`kx|ޜ1nXgi/&7ҕPګz.EG>3y稭tIuAl&6"_G_k>9>?J` JV,1Mt<̀ዦOZ[h.hOƔN2ŻrGwawC\v-?&n>v;.❺9V#ۅqGMJW]wE#Ce> sɠn3b kuHS{Y*y$es>-XG C]<3v]I ٚE +Lβ9W "GKɃb:O^@ yͷ6R%#KD*nҦ{p/ϋܝ2P򦧴Ǥ&,36QTeO bDHMo|M%Bo(.W:4}{6?tE]gU_[L97S.-G V&\:DoAIQ_!\z,ek.6\eUtgo?imϱ†4ИIs7X~,6TD֠J]uBibS(LѶ#sӴ>pI yV()BM8:YW\JlXNik+M٢PB(U}h)+Pfv[u9Ȇn?a[>DԌK[#!^i5Cx82>ǠT<}\ 7Y8Zk18E"Y5,VVuϤX%[|@-*ps'us-Ŀv~Pj2FJ7pQcqpr&E7厊QݝYeH\x%/lR)"pe ,uYuJ$:5A i &ECoCtK w(͵N=y[@CPykbN9SŭRJQrZ jz(yqwAO {Խ!,c~ |4sgap}^<5gweJ[wIf\px*O#,a]e@ua;w`\df2-U݉}՜+r[*zs`f;BCP@kPP]vdVEz" ($ g|LxVLnaO/:4FMJ(/U[9$>%ځ|/Uhr';4;F+'Ч)Er1q*t+ᡉGnfZӍDAåλ.mF#aO"6Y W%LI ,@v<۝JHq~qsz8qSç '{YN}3݊tE1as@)53e)cEE҂sHas +X1:\ >m#}s@D KAZB̪jYT}R v Heh+GBQ>(Ӄ_WJM`VE!WLnN7Hc.\Gw>]6gHX,~f$ 2xB]-BL.Бҝz8{D]ǢRfnCQi",Zr{g[e ElD H!vah"zŤGݚU+d&xe8DQݝV 5V9EIvyxKE.##_hNXR ~ZEDx:(~ٴu6@ђB6z;lY&bfݙdZUz!aX/./[6zb fJ'5/LDCGi]kc #rgbj;O7zL9.LS!Aєv3-'s߂ԈyQsSSDriI#u4KNԢ6É`L&`8hEm :%w5(e/,K|*x,Ӑ3E[JVz=NTpFj"i}/rʤpxN>O?x- B$zNN_Ūآ;7Ma{{h 6z݌ˆ޴D.}.4 6Q%māȦGoT>R2쵺'u#X]'X^NVsSPqyx& 6yћc0"F:GV;KdN @M/1Y'E8Tt!;^4[K1.=&r㯛%C[|Q溈w>%.^:WjnT`)e.xCŦB()"zjE42>y"ѻNHg' -g= P*#aeWn,5*=3ĥɂ;EZX+ dMWr;Ȯ(u:32;ꖧK\[74*b*g+0.~K;!~+* Z G޶vŇPeI NH>ν&!\S即0Ь@@V;ȹŝpb)϶@fB̿,{(DV_]PV/Ƿf`&-Cs 7ϹbU6{#|nQ?*J7i5Sѐ-VџaFѬ,_.|X2cc%TR*x KZ)[nu#N(/3;%qm-> ITVV NsREUƌZLusV(Շ)bSS<<Ķ\XʭJ5j'٢EU`鈷: xEU!ޮI]ҥ^Z( :7~>쒺-C$ y?X*_aWsWJ-3"H4vAּ*d5N&-x?l|ۏT/AcU/˛"B̵7'ޕ?-lW{#.>ؓLğam!h УCaeU"޺\J3t1 Etyc^( @V? EaC, mtcue*4MnǬ^ luY ]k\ zfMe: $\־A/^jA|>3ûjqa&E&_ȯUUJ<=]/'oTC_T_\]^?ׂ'^ooT]̥]5:n#A] Һ7 aXʚTB;ޢ~f==#Ak|}՛ a$ֶ\py`% LMvO}@ޕ5il)q0ȩɓP7LÎ8?% OªC~݀d8 ^H{ Z#f+vvDvS@U5D|Leh 6}jI9a1Д*wH9'(P+L|I,,u6d‚>=Qx(?$zJ X Ts:_EPdbY?hs/j~zFYŐ'Z#Mb:X%ߵĭz'`-|F/}Պ2+ n|dzmrg88"Us6s_s/Cmp!11rt ʩӌzϘAk)7UU ϜQdY]P6+XkU@yLp|nfH}rꥍ 4(?̑cXp#>3N*(~Y!Qt2E9VMP0@?"|'. ^hw,dػ cw]o)tIz%:R3t&o17E]e}-.ɣ*zұd9V_Z29.Us 5C#эިv??!:2*G3gS^Hu5A`Z\#mu_*RI\+DYXV!C].'"صײeP)BHD"/%hfY:ׂOc1s]"i YRhM߅A-B,cY`ƗIќ᛽]*f{̞]6=Zԙ?R|e4e]WX*S=N&e JA/~)*,*eHc3"ӣsmA ub҅b0ӵu{.KuȂVesPX6NN; yʱf'~뉕S[1K{M}0:{4*p(X"ōۅyQ4ujZ c ү7E0$ Ɋ~x+@?{mX _ސbŎר~X' ,x'+4"Xm 3+=NaQy!D%G!yك# ^ Q#*pP<Ek5ibϺW" x'I7@X  u{\N[ Ü ЫI@eDxG]iR>m)o?F{Gok$Y'%8?Ew6 $a*ԜN!]tsjf(i|tU_^Z|-pVqȳ>$shRMED\`uHQ'ˇ~ I hQ?[ӎJS'Res"HR_M6b~2+Nc.U]G=q8.BfeAc8{l\$zXx{[>buPIIZ'U9sf(z0e O9_7!0iG xڞ9+Dy[@7N6+jP:8w34a [dp>JIG2t 7*m(+c}xS$C{ At; #u¨~X>h!'?Gb7`u2< E۾S[y/|T/ݷׁt/]A1FJ}|(i}Ks?޼Lũx Β^v5m%(8Sw#Όv:є_Y_h,I'2D?P"puf!&.I04;+ ꩩDv 䨩@&&oBe3t,LDn-1)RKRf(iUgrz}/9i]YdJ #m\ !p8|jy)Ln\%etss?1|$#gjE0.]Hn%S ҿ m1[. F `;;SA()4@:ϡ4b1o_hT``VNsvS),gP)]rmz𕾠1ZNyThh9' +K~e}fx)X5p\5|>av>av-ycV_EB !ȄK T HIrwqW"PIAm1=*o{u$]1:K}wv)2Ct-9{:/m $D5AŦU6IYcs`o ơ 92~;O-3%+$u&]EӁ=e# Qh?\O4*\gNlfZ`Q v:NKNK)4&pi0& [:wϳg-JXO6&-d췹S֥w2BG2;QQ,sF‡)A=X zd9k3l{H\]-M-p,I[2m{f0=AC74py s::Bӵ_VNΟMW }D[EZQLԓ %|Cەk߈Gz@\GrPX8S*L sIaah6v$@g;%ptHܚqRVeX$L½QojQ?F> Cu 09wq> }=$wxD)Wz4)xFdO&e1[9dbu5[>}(b8J⎜ϤߢJJHr$j>үs/2AP |T6-?Pq! t>rd±Ő?o2s\1dbtmv ;tʆ:;nd, ׇLŰ`Q"GZ-N9Pb f6^h{YbfmNLm^l 5 rBldtp&DCvPVo? { L3dq_q8MMH'a;r{$4f邓ӕ^ gQXlO .=ho5:s [[%Hft-OCM"w)}ϼ_G${&q90YVZqJi ^qJE:K8+@0hl P]?] s|ޛ .~{M8I%k",@c4FXqճ3:$GzEެW0+xY+6{2H#԰kӈ\c謄-Ǵwn$WUԸYǀh{NaTloghsz"w3^zwcUߍQITg9Qv"ql;)v/!' Py{w^%fu^{ɹAoU3年BߗG,vӎ.yv#\O%5z{c:8ʡEwߌ`o*.^+Q߾\<=p^}ऑApwPt y>qZ7KD6J~B~#@&,liSB I= oJ&kI2[;G;`2YhnoXxumfmF?\\\0xbû#^h%EYII8(v7`Ga(r|V@q֨o̞S_7$|>1YJxLH' \S:X+u"l/8S^;Bˁ ( U(Kc}C~L,‹rǾr+V&|SKA [i"{WeWTr1 M1A!ؖԤ{]pa1 /_<#JVkZ4ԡ| tyKroq/`"PbQn0QMI'5g9' m-2wUt  L!Z.mrjaǷL/kტFFMTkS4ֆڱ/3l^3my9 )c+cޱ᭣y?9yl[ηMODnztz M+Gpt[i(Xɴ9l9‹݋2k6܇rdXTr/M`c!l`oܷ'o^0,fj_ryx $ictae|fcJS<2f<`m?QZcƵJ@O |-&SyhIjrnZfB s -iH[ ~x +|.[`FޖdK"D\ r@(![rE. >Zho ^|TwK+z,l*D0tYk"wE=N!^9̎@L<'>v]ܽX*o .7ǥJgIP"ek=UERE^txr/G4 g}A$'lruԁ#P>,IovxlRWf27;/USp;LZhHA9::uЯDd5AH#'}j EHܛt0e4IdU\2w;Zi [J\4񶿡Q/v_ ==|TT,b˖JS'15 P-M:݌pX0$Atk2Js֤ -ZؖW )_$M'J=n9zI @o>?5+;*"Y0O}B%8J:oعA+q5\z-"L~=piPv;[PB< 2K^\i ԛ7i$5c|N$5NTle_2Y~7BS4sTߦ-P)&^ Vt!/33A#!ZVW6q%~]ҷi0 -h@}癰!dJF_(~jԓB-Jk(M1'%tCNR0-* @]#/$9Wufb${_qw G$`\vvRs,IGXjы}遴ܱZhH^𞭢R'Y0- Ф'xqq [_(S+""&`e|Uj*z>)C$6ͩ safq "7h텇;U Fh ~ΏNI0K+ް51%{\gZR@J"L4G|ex }z#u ~îWrZC-?φsWri 9YtU0ARU-YRl)xӉt%tVmlC[=_-R^~q\Xd3{".C6qT*/bhD:K]w$&IVES.CՌTN &U|uZb3hTd(q +V%:r猡\s.QgjeHuLn=ReX&wm -/l2}[CWMS؊׬Z}FTG :և>YS/o.5B!tdr B=Md /x?\$ Պ&7&6Ȯ)$-#[;dYkq[xI֡ךqN{ D;z $WSyc܁$1}>jI@k-M6`2Tźa>o"͡P$\V}MF[ڑ8L%QY`C&ҁmEo% YRdB8zu-^s{k"{ߡr"y*%dZ8sbB_>n׼3VZFEyzWwC^ ㌲`)灩iSkkTdLw,ZՁ] `%H6$A?2>Ld'|5~ C1moH`+ #}> -70V^HBy|JP)&b.TKyYK)Hb.t$(|cJd!v& P(gP;B 9*4=JPk^14d$p( O)GyH,d Hx +$jx75Q!%_ *GWXA|ruRWppU`S5'3K= 6P p H@%_ z.5݊Rw\~ԑMdh5 W˾Y]k ~lVe{!Bo: Ɲ5Ə?jBsB"C7s|;evDH#?UaMSS-*T SV e m` X:%Jw·/; t;FBGRa X~pb sc2ū4 KDRc1y~ u 9> I_&'o-|2K9&6bDAë:uژ PbX27Pv\mQc0 IAӃQLxB1qc|=\W:lN$eB[5eZgs5O!oA<7"i15$X$\kHU_>ߪ·|J7URbQbuӕR=p3 +F* envDypcE 4Ɣ 0dLbK.VaoCQMY=vSIlx yu7Z.oQmzz{ 99% <#o3YP$ePT¾ʏBt2X]auuK*1&na07 eO;T`GC8 i4/%w.S[bdJn2-ͣm=a LA"idgwkA./5pyYgXUnsexV رgsy ZCrTS1DgE9Ju7f| p 4;ϑdgE%)w=M!ۖ`D܎&(~OVV$M@n,GR$@Q&1[f vkK,#')ƒywB#Xy*1,D)C芲̏8'Ķ<1atCs<ӵۂd%tbHAgZEac3-ȯy^ӝUm` ,*V])7߱#z2o07VA` )v:="0岁AC1@nQӝlCbfJ.Q C tKm%7d|j˶jM_9X G -xW /NJAEvm=GyP nnMUago`Y֐:~?/>(o"ZASۢ ق]G0.?Zv>6^3cf=eheE >N+~5~# EC%CM@&2gVzc%7D4*Ί>t56/wslo&]w58 YMmNPJGq'?vw"+W!G4-V^2I(~YbYqQmP S+Mq-*x4݉d%<^cjƓEWJKHsִlPW.!%`Nt=@bEv- ds 9;AGQ3C; B|[$8Kj0Des⌓he% 87L6jc=Kؤ-x@;kYvnt2 GWAU̺i 2AGi4{Z&ظ"'/n`B:`NR?ƞ I5L?  'PA<{=%J AKJWLHoHf[)INTj! j/b[o{g1JcVL[)XSĘ(*=A:^D$z1tb^CLs`VADjK(HS0ޱ2Pag^UΣ 54(DQ50]7/6æxC -{DB P)ߖ4ʫ\tf5v֕~v|WC4GIܟvNO)>g_B"w_3HFzQoYA0mt`+9RQ|, (ޣN D]wUYn$YR@Ubh&;̯3G!(2|(xLrU$bФAsATkw:ڻBJy|rU*'kx,/Ƣ!6{.D3lֻ 0S ʆHl?S-[ZDDU)ć~Chdb;"DR(L![J3OvQhW|mfFC693y𦷙3R7-OdW%X#ںqNf+2dy>VR G^!G;Pޯݎm@ɂ#؞.0nGi&Y|:edE1~[W9 H:֍soHA9M?ʸŠUl޹|͇)i _o$d ?y&Н.g]U'OQ8jz7tAG&+^"eW_5P*֜T5}u66۲BK!jP1 {s3 T쌉8~ hd@/d'kyo8TLa SX#oK˿,;}([3NrmGeCКe$nEC4;?E3?Ba!nl}܈[ɤG~b2PTIWּByz:;OV)e:1- "ŎL?6\V,/ z R;,R/dwbcR:q7 +(‹AI*^j ^őǚs <g(zׯĜ1"aV_/tWy s0sf"ؗ <e~l6mŏԀb.5=<7=$u |qC{#1mAa͙"A.:n:;dGa2*&[5א#yS8V D^hEn5$pDkHHrnIWg俜 :맸/^y|>#>6~ ٺ9<0~5O35N;tT>۠_Vsov?$8~+SxSn3,1yLUfkMbVƕ JVv:>tq:N_9Cؓ+-f!.[ dO[ $hkf9ІpB>(:hs'_b$A'%Le_m5J*#8ܺ!VUZ=KpY*x} tR{,PYwߨV n6n](E%M!5uU2Fբ8 GջM娳8$ :O G"՘AY` p4P# N r|d(;>@ Zj߲*eJOUtT|j,-$} 0X|/L0Mi+cY$ޭmB(%QUrNƖƷűڦM-EB[ Js0CHAf>xȽk_@nYɺj4%+[I m8d-IWߖAr+u\gۉduJL '/xP(f^lZ8s:ڔo2@(VeSsiFǙە%,98xc9p/t!QJvڶJĹ%g 5x8/a#AʫJ3PW%hZ ˙y PE6jZ{ R$#V,Gm8[i9_S+eB~E^ ƌ1ə:|)7 f#A"H];ʜwq*Rp&DXC6o;#Shk .J5;4W ÷CG+`2l^6 +P:zsU:Y Nj&wV:}> g2kD툒 huՋ;'ZI+ 'r];NND/InS%LW-$Ka0>®Q4dۋ\ .[ٰ}@7K04udg#<ܜ {7%K΁ IY)'2G.{%ZRF- C5eG^XOYy)̆ẕʥ<ɩ6fQ-(<["_;[*~| xr9K1ߦÅ.^ ҭt5miės星 W0 616bH&z=(VH;$d\0/&xV"fN֝)ekl)7xfouN&WPW>Mu'AnMJ7WBH^b0ܽؒ?ۂ>dMj7Ɋ-5~8~:drڰ,hQqLpr)FLհDWqpR*g~zsS/4Aɻewh\5(P/7 SZ8Cxܟr)UZduWlѽF7'M5SD=*}psNhώ1ysQwaOdKtQ>A+č˚ e+e)8S38S$vd(1&nh#T[1Q8ҫk:\zTܴP^z7hARx_BywV2QYZdIwt ƞGc"(Su ardg;kk4J=W (I[1XP3ַVvmᔨk~vV&؀uìn\΂Io?k$žOrK,#EI*Ia5khcRhykagkHzw꥟P5;"Y d6/sf^A/L!B+f#!&E} l8~&eU~ű'hruƝOsWu{[kEwbivưE+bD~D@1\w@o5PTpÎo+Vl>,@% ъhp|ƀh#t)S ;:fЊhqe@K`}!"g:Mt%Rࡀ݀y 6$Q/@aY!I9ogk *OmE뾏 s*y\ es &۵wK"1(=ۜ*AAFr$#dYdFjml2eB&=佋rm_ށd ~tF-`} Sl4>PG򡐽`W^oj{L)m@!9FuFcN$"MV)\{G9APuO' 4ͣ?{$J2'ޏ=R!uiy'ݱ\ͤ 7B rL&INjAђ 1bu7)yPuvxJik,x{bx::<5 >2rm(4Y3,iCz,~j")jA2!{N9"S zb3za*Ab[oE zE.UWF R Dp1ӷ9_DJ)o\A$zt\>)YH;SK EށOfnr/V"Dqbd8W[I]6I".B,KRƸBč ~D"@lnS 庳XB3rZnN&QgHN <p[j0eOS"hl qYg;V_/B&g~TY >W4^;n0aA,D%(q'_٫U"`U^x1DAhn3r@)HC]ql[@ߴOrA~]8Bg } Y+B'&Ո`BܜtX^6C[d`.Xbܭq|r;:J@ĆֲUO3v_ P]aF$YK^"63Bϸݐ:8ZJ4N˃>1r_Ftf2ܖ%j)|F%kl" 1 GЬt_ W|+Mdvǎ4xs8Rt=PC'!3iQz@FOglKt]mIQv kL}2=/?9%ƱCǓ8.&j/Jj${M]3Q78@d-,xTG r`Ezw̫/ K hJGفQ+2(c榰׎XG?KoPtS{ eџIˌmxc>@a'u(WKp+ԿhϢ=J|9/g5ϝzGyq(%cL bY!埧zR@(,Ox=vϽ2Y6Kj>2* V/9В,֩A raֹj|>QٙFqhtWnFBO􅳅- W%x< L FcmF]$NXKS^Ү:lm-޶tbB"9}JbSy`vxQLH!6eK;1'S7Vg\; Tg}^p}݋p1Wgp|$/|QiV{_ g;>r]W؆Z j+CP^'J!0[z̥cQ?k ++E %ݼ2*iEET7E;bCG.E* %h6Qyd@6z1v aUnJl5n .۱4pI&M }+:;K"ZHp^>PۍvOQ4?oLQ!j[:>=.amAp 9zⷚ:MqF{G@݅i/*8T;}xNa_ZQ+f,K'z$du㎪>Bzʅbd`I;kt0%2QbcEbHLm4_2VuLvDͳU~V ͕RFq`c o,[oͧ 86I6Me1PQވ#= ?=`C雿$*~(BŞ+?{&T{9ќYe-E>(/Ӳ/ ˿޵EԺJ7{A݄&7]{BIߏ H̴uHߪCb=]A+ KC6xUX7`-aZY0QgU\t +\js)\}'&{hŴПOF.3 Dp_\Un_d"s`y<_ֹq!mg\N6qjE@syARsmOy^j7|hwbj,LxvxoѮHK}7V}s[)V $'?U{4NPI/cNiTG .KAqJ[8N27|\$+j}L{)8 65(7[Û?y"^}mv >ڄ /,$t9nMzJlb}=[9OaO {iv}ZJQ#$g%`P枝oQp*c?A/NZ2>;&4;ZGKѹZ] nڞuTñq%EfV 4CZh (pf! gbG,$sl 6';y7t?TeԲ,䇓)wW\ @^1G;NUvX_ؾj굚,YXYǎC \{HV6 NaQ;L{rE}z9%u*D}Tmf0f<ֆ;h +E.$_f7ȿG$- L?bFДc$lࠞ^Z_Y@pTy˼-}5ZOk l$;آN _S0*mNNhwZ-! "3ĪrLM#f%> m寕 m}aZSqmQT"g3lcHdh[;RK:ŴOdHoDŽ|A#s-5.s#w'xDbA\T Z]&P2jםf#6O;-sL*VÊ"mI ȼdDi5fgJ j ԣ T +۷c6^0`C$Ovٻ(Ԁ* AVgDF7Xgt?v@L%4ަVT}]J`ZE0ȳ2x4:Wu]_p VH2$jmʠ~v9c#^hwpQUl"v%@GAiUatº1;{.c~ʵX[~NVwZVgbHv=j\>n%_Y.8,z5X-Df.lkm#$2aa&e0!2m)6AA⹯1[ ;k#Yi)I߭^!V\CEo]V”+Sc)xLZ3mH/sn@ R9ؿG̗Js:WfR>*=z?2h.y(Rȼ=uDiV\(XEĩK`Fo.MK)=B`H[wb6mlX;h;P9Mp"Cbń8#ʤ(pXs$2 ){ lA` ^ HSg#DO;> qi޴i̝x IƊX?&r{*9Y_-_wxgD$mmY)N꼼=74^CXW0l*bH4R.viw+u`݈cևaKi!::YJOm'J/'iCl';a[.~/zVZ5ƴ"j/g}|@@ {J+*cD4Bt<;p u>%@3 b]ߘƝJ }km>n%8u)x{Kx@Uri38B}PzDZ6t]e(8^b;vk|zk3-ӤʷV#=~;wFy ;{ِv}<[!Umĝ.DSʗNfᔸmW(b@膯ݍoM͢Dr$C*S!:cVo^ cUA'V  "?~#ueArX! &.ܖ74)ŶZWk[㗡rIR"۸섇c U