lighttpd-1.4.55-bp151.4.6.1<>,Ɣ^!M@eee=X>XzG\F6{G8$dt;O &Z;ր(G75H"_ChnfIN`Sf&q>iX(y s3^IGnlW4>k7jmU[{t5uQ0!&W%bE-`.Щ6q-t+D<-<̧f|Н/'>%Dn<ŏGYa._?޶(oDI a>I?d   V"/ Hl BGj<j j j j .j /(j0j2j5|5j7H7.8@.;.(?@FGjHӘjI@jXլY\j]פj^bޔc:deflujv,wjxjy(z@PTs|Clighttpd1.4.55bp151.4.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^lamb15#SUSE Linux Enterprise 15openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxx86_64/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O0W1h|[8mXl(Y8z02xCzpG2`2(i13`E@C22p2h0d23(3H1|8[3Pz 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^^^^^^^^f45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456df2460bcc851567bd5be8249fd74603298b37acba384efad84799d961b6dcf41cef1c2953c3b1e5ed2e20d2a5b4de11431c9a94fd5bc61b9a25914a658aec17f4cce2753c0e9ee7ef0001c744198c1ae9aadeee7238e528cce264190f9f7e414b1a854dfc862d5d53faa185feffc61758aaff5a218fed913e714e36ec59c4bee742ffa6d685d870d52917d79bd7fe6247f0eb338f791afad29ca69560b0a73bb158112be9dccf58d809234cceba071c8ba4d3dfdd03a8fe486c4059b360ffeda54a04e461a3b20442a6d36006768fc1ded2b116d6e801754f5d81a61104d28cb2c4cad8aae1a0deaccdc5d7674550ba43670748cbd98ae9740edf646190ce5fdc7edf3b9394cbfda5aeb327fac41e1197ceebbcdbb61845c2ad46d20d386c92b39dc5c2945eba4c653440bf1c966ebf2ff03c2ab09486482a5efa3bd1b7a682a580b6ca298e4adc7a07c3118d4eb770898f6ece247997c143e926d0fd5d9e3288f12108c775876fcafc5c008d900da7386b5ec601477e36575860bbff5ba1d8c97431f1d65142a62339082bb23bea1019516fc2a7a7fe7956d8fcd8578a3d4660899f92318a3b64bcbd0edc9346d9d6889e3442bcc8caadac7568c673c918e8d5c5089caf91937cf6ac171cbeaa624c9e76245cb07ea4e464256a5616e19928f163b2f16006af84d68b85c1370b02a1d237018b509ec5a257d10e341967bb5c78f4373b806bcedb4cd24bf06fecf9b055733e9217beb2d9a06c26ca961d5710aa2bb762bf7a8a50c418da440be02fdd945a9c164647a362f7efa7f4441bbf68c3aabbfb5217051b719da2905d1ad318785e409d9bc405143c784ded59e0f054d0e9f4730aada74f767ab03f5716b18bbe7020dfcbc379d1dadd0878cad16e9a63af97eeda49da0ea7d6e1944df08fa9d4b51a1661ec2c852e54369790d812a26d56a6508a2eb88cda4cbb5fd2e0fa68f5ec2e674c86378f0eeaf164c0892faea868251038d955a6d72a58701fffa2880f07fb8a2b520497bf4f6b29340bd3afb6bfe824211461c81a8e6c876be759e1d1ac8605b93e59abcc4df180da1b184582c225d400e02498747a04f03a8343ee311b4b3d172dd31c043cd9067dc2964340cbeeb8ad65eb5f91678145c7b4ad3f1f7b32dbc188474c7f76fb04a56cfc64b1e6da57c04479afb2a824e8f62c28540991998851672eee16aefc65ed85929c30c75d70ab54b95bcd767a76a9f283836de6a1b083a2cf7e47be8ee491d80ad20aeceb15ba8c19ad97896a432153196cc25715e33542db0fa262c63c482fc8a762a55be7cd088a34093c28b601bfca66ea2cf01a58ceaca61eb6c070655c6e89434d856ab8a3be540710aadb40c48fd7653926bcb7f58a618dbba9b4b65975a69ef47e547980e1b3445a5407ba7ef0a4bc87cc156f966aae9da33ccd94477d421e86cfa41917c865cc57bebbd93d3ad524be066bb2351d7712a5f0dab40cb4580d6b9c74126ca5c0a9a7ffd72447c5824ace827bf880977dfda5d1967e0ca4ee5ff5846ba42322f18f158e92ab807d665f737e6a5be87976a23af01fc009d63954762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-bp151.4.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(x86-64) @@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgreplibattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.2.5)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-bp151.4.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shlamb15 1585642682  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-bp151.4.6.11.4.55-bp151.4.6.11.4.55-bp151.4.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protectionobs://build.opensuse.org/openSUSE:Maintenance:12219/openSUSE_Backports_SLE-15-SP1_Update/ce75ac59626a8db83bbf99ea019e86c1-lighttpd.openSUSE_Backports_SLE-15-SP1_Updatedrpmxz5x86_64-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ed72a8cf7930cb1cf2994631d210a012f9958685, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=185e032c8efdce8458679e3a450f860dfe6a53b7, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=46488d7cf75b5394f7ff0bc398fbe2f6829cd42c, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=985f743a2030582e026c0d8a2f785da0e6cc5577, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=69d29a9a2767c9cf3460bc171bccd9ba8603d177, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5fb7f579a6efc2b86c5f0beeb67c8cda21be8cc0, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=167b0c85a9aab935b1d66a3c15d5535706315903, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=00a7818abc3769593f3829d9cda9b951f6295b6f, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1f913eb085f729a75f5004975035134fbbe01c41, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e91c6e326cf8aca0dd60fefda784fae699d1427f, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b4ceb530cd15dcde5dace95f9486970adab33848, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c5a0e4bcd45c24a8b4459315ba75d4159815cc80, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d69c7d6cc5d434403c9abd6993e8584998af460c, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=93b702efa101c7026406c766ad6d2e623ea47fd0, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5a8cb8c1db6c1ab4538cb0b2b687822633db155b, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=852c48a82922d50dcb774e6c2fce88eb2f1bd851, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12df63b53d8fea15a67570c994e8e005435adddc, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2d4e1e0cbb23395f7c2073c5f45cf39d1853e7a9, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=66d19ffb04982b2cf360d2a5f0714e8329dc96a2, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e9bb3bfd18440748ef991f75920011cc7aa6158f, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ed9d3e4c7828e1dae54aa085555ad223221ef102, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9555349dbda3655a58cbc8b5565d6a2b47a02a74, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4ddcfd2fc522dfa7d593174f43f8798f5685ad27, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=bcf1df6b45e816040aa1fd504202ad0fb3280340, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a741bd8a6f655b71fdc3375e700b1fc9a2862ca0, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=67dcb2c1a9f09d1fdabe73dc2570448d5391a356, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7767dc76dcb2d2cc201ceafc96ccb3fc34b67457, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=99ccbd3ad895ea44dcad21a86ea495ede1f4db34, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=14d1516a5d13d8cd0bcad25d585e5243e8b0c90f, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c816b59ac1042892b0d834dcf39544554719cc6e, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=30bbe4d8755e577859b7bc6934e26e25c944cb9d, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a7fee121ca13afe2b22f58fdf39cdc7823b42f60, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=62443b1c16b425c6e327ec9b54ea1be23408ebdf, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=4acacb32765fe198a917b06170d3db24dbe68294, for GNU/Linux 3.2.0, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=b0b19fcf441593201ea8208d4912cf2ef24bcf31, for GNU/Linux 3.2.0, not strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) "&(*,0468@CEGJOQSUZ\`bdgioRR RRR RR RRRRR RRRRRRRR RRRR RRR#R R RRR#R R RRR R RR RR RR RRRR RRRR RR RR RRRRR"R!RR RRR RR RR RRR RRRRR RR RR RR RRRRR RR RRRR RR RR RRR RR RRRRRR R RRRRR RRRRRRRR RR RRRR RRR _$Vd<~P`lighttpd-mod_openssllogrotate1.4.55utf-887d58de074fd573fad86457a17ed9050e248dcfb8de3da0cd6add03584b431e5?p7zXZ !t/O]"k%{U}g桙Ⲹ9+ځm#:I|F,[[A+/taYe.De)`V 7wdqWM$ jmk<͞ ~rqB7); _Ѐ4u 6},)=;N u F? ]JLFP%? # !{:SHݷ݋SݸK}}t3 Ό ,?k 2No"}7OsL2TU7*!ߌN¢Nyđ~h6:=I({v]i.d3S,)"xMQ0Cxb3 N Z(@7>2M у82Xn(dɅi ͧND!,z8jQڦ`o$ )C\>)c̊RJ zml\fvQ) g$V(fMZئ7ܰuʄ5.gHD9ZCɺi'GX+߹j/.I0Sàr.;?d@f(l| 1.5C6[D|9њ M F y>kN5Xa 2PN ^/cԈi[ssOy+@3GF#dY<~irsqff'y&+K+$+WOfH ֏10kY \H tRyR6 {4G#!pQ6;V#=aU3H ix6Kћl6!޲a ͈bbo)RZ?yjPF=tƮCk>5a4Ŷ*\S -#jQU T*ONs$B=]kWZI+J'&j/?j'!fb虥yr Q>\3jCw&n? eS鼹  ċveIb>M&w_P!QUq =>ozUϞM-t /ń1k{4HW̺iՄEn0/Cmc7`P,qJkݰT=u\ 0|qr[ @4⨸W879\wkwdڙF@t W| \* ^qTI0h |F.]܀ú~Ųt@6YP|m rDϪ&.u"Qڟ|Ĺh`9.~8{P*Q@o|sv =sÙ9b]Dž<#3 4uϒ umw:N!\ڮf:#*7&f"Y&qg03+!yKDƕn%&bQc~=6,+{9SeDŽ&1[6#ʍ𔙑=Ew ˒?'WD;_x>rh/IQs纎f.:XO-zܤ$ӆ@{fs 9b WɎWVo0oi yqdCl=I4)j ~-˯/, äf{'Pb^=PT d&S4GBUyӆN(  C/brz^ na/LZ(Z1T x`LSONMI&|j?w*#[Tt@F(:rr&P?5 6#F09qԡ]AٺQkD-%n}rW@/-ډ-̜M]N X|OkԹQ$,ߒ "-!#) zcH0leC4̟X[~` %˭&镶)b8ЫzY9=UI̗G:M݈K\Lͮm$p`^"\M}Vg'jdpچ (DtPU6Wv* qk[!pJԑC*.r.t yf`,6wRt)ygC*J@uMn<>™ư@B*8 srDď a=czFU$37G}eq}V:ᛄI8M"#D>ItMW&l=o>6sSi;b{cQeni+4cfqN6I(}XHKFoj~z4~yyFfr*ZgtJBo(q(j1h@鄺/#a]:Q4(:= 94I&ax8X?5p@}pW/ r*]-lUϽ0秮B[Y VݪKhݜx*Vq#$c9s$NA&PںHğJS څ{T}nJ4yE۔Q捶 5qrɒw(b Kr3廅Eu@۲o ?7,;1ntnc9G#Xx:4a&{}FG?8WtchWaAugS@o%;L^\LK 3c5 _ UP,)kG.'4 >%oaOFAҿ KE RM7۰-W*ÊX#+ )/޸x Ƶ06wC0@{p'Up Cjzp` g K4vkP;MEe6w9wIl7:jPm"q{kgO[!6:;H% @Z+:'lt,j- e%^ 5Pۑn|́|(dv,Kz `@w|uRFs2sKjɰu š*Iz/Ǯ%C-Vd'3LR'@Ho y3Wb8oTupCV=`p7Ej ,9p;z"jR`P _Xk?st~/tXط>=@ ]/S0 54Z,,̟)&([;.-U*_r`daB@OW"2gr3CFNq'OH蔊WA3y,8w=\աXLyt n15weY18 HEm kٺ5UWi<ί:Lтk)GgNw*t>7XJـDž[ܹRW̿o>%I%CʎYf}LeaO_Mhn=kG[^RPr{Ki.SCNDeZe{)qcvv{s7|\OU\iˆDc  jGt-` G)Yr=3boYbŞFjCU uV[ml9ϸI81' 95Z8adP⾏@QLi밫)6b2g 2^ri4)%`B <%r79/ ȍ1ǡo3cVq9)߁u ݚA,'ߧ7m҆\3!#2W'`~E|϶krYҸc o$g@kVW-/g_i-U4SR[IXLuG*Vl?(40wY2!6#Q*o*dx({\wԐ_UctG#yW(9uu>At.M ^nGFMӝ-e[5& 4 nTn6 x-bO3LtSLnIlGdEڔ&*\tw;TsB*Ft ̈\1#XM<Wd8`RNwNkk>ɥ1{?l#Q;4ZA/rE|)‰A_ _/T{5PCQ> K:?Vm.Ñ7!* E M_./SfƔ |wH!^ZneT\*v{TH]ւ^5n;,7 DdٻXg35uYށ^W䐮^(' cAa_#O|:weh}tpN-Jǻ5 O%($2U,v5 IO!=ΤMSޒ J7:P4b4J/oCLqu\+0 g #"v h^iH0בp_i ʡ iHvDEC^{K׭IS0Gp|Dc^<{ʽ=[{"08c eA搷8y6̶_#`XZ,Nǝp vLd_%9lO b Ẅ́| h*vYH橯  mY< ]"Լ)Ut~eYT#/$`Fi2biAީ7 [a'Bd'MA^c!k&(ːAN|+GZDpW֯ܒ[q$9黧#91\l1pC?G6H>^!skAmzun/NF Q'x Iy1.#T45O^”yxB-M2~"{>0t%UQD0}ts]Rj7˻=$eDz)*ibN' %$ cª)oJ:bʧ-!Id>^:NTZ +?UwJ֜&K1%3n$t};ymjQ{*7?>b!E`:0sӛ&uk0u!Ȼzed~67/*peytɀEF:nR oɹvkg^K| fVzSG Kݢ[''>j@*Ue/`m.cGe$b2R.ݾ>5n Ty3zY|ÉuۤU;^6ޛ*;w'{ >xQ>8B)7K )$X 뽎&ϲ_m0_}RAO;Y1r oe%ʬg'aZ8sLWc[%zP%wQo)۫ȱHuDW̪-irO3bX'ӹ7xJTvhPQOjj~M4= :,}Evǝ _Gkp^J=}~O7, YOG1EqνxjPov$kkbc)KEer+&sIAPG4dGO ) T#mop΁O)FP`=8pfaeo3a2 4Lw!+rȝ64*|*@W0RF@ca  =Zr=TɆHJB>Y'%Vuò؝?9PNbr_?X}Z&rf6h%1Qc}}` u-Qjq}@6.c2 STS k86AY D7ml'w,dWʑ[ȶ^VC+LR_S )/z>S=%NE@پcxCM+`{&yY+*%B d>CAkYΎc/WkToN>n3r8l[ 9SQoeQ,B0]{qf-<_s5ҹÆ5LV}Q%5E \HT'ڊfCϡmi*z0}$RUP 7fZU*Ѥ׽N1ZaNG6,3\7AbJ{Cp3jYWtB ?( ıF9l짥y-/t}FO5u< X.[31mA? ]^?FN!VrޥEѥWb,B-4 !՜#;ipo}c?GN,C'5qzAht>3haQW-#!x`-3 W \i/Zs!o{O/>6I-;/YcT)~\,64+61WRn~)4N%l zS${y3jDWb_Ҵi`wǃ?{0k'o8y|T.&+wK,'ַB֝\O;В1n)AȠSTs+$2긇3 hW"nJ9N#=#X݋TmS0V"f G(Vrԧ3`ӵ[\cȍ/Jc8V8Y\Zhp)06tHD?|ٺ ⮺K^ӅC)V5"q~Rd Qw({`Ĵ% a6 yM.@Ub;{~lFA`5ό,w-h Wе`HrOCKWrbu<鎸CPfӦU0/ v ?39<;{9owG24fֲK0#3YHň7K mmAm>riqbtT+M= 2A)$ڄq.&47'g}+Ȿlnx(F>綨,IW`h柋CFw߫@ha49V! \^|N [WTфV5΃ys->w@PaTMxʃg4ĘSPs^cUAS~%j*[oF/%h`O|TB=A$[skGm-Z`j,s^D ßY/|X*LZ?IjUGv2OFAߩYMAbQ,{9#؝|A c-A Sz?¢AsYܧ n!+9} ($XuY|f2QRpH̑QJK ˾`rQ  <*t(c!.mYZ§@iDo^ ˸ [{M >*@B\*yHCT]>)OdqyNBC*^YA38 'BH̶CI+=tD] 9Ql"c&[Km 9\?o!Ӥ#']:f/z]%tGE8N2uR{ܤ])mth3BK?Q>?3EU[tC wr'GO~Mc ~<4$z؏Qs,)LFx$0,ܗse? "3.*^qe y n%cC`M8yf(X[R"hpci\Dbv fm_:L0~" i|w%5@[5qTI#5bqb@@ɽ q ^ȣwI>ae:t\WszqR}wx'~?,BDICnlv4bt@𑺽1YԔhϋ^l\g$hVs()كVj*NmTU D=axKT't bd:8C,`qY5T_xF-xTures k `뱓[!0J bNgCElP6AGId=wθ>}>^t0'lڢ8_?Fa~K~oH"$'!h2rSDh׎@.bG iT>'t ^ N# '`_# un-}O!+89D0~gxV^tWڋ@Nj#| |0tAVQ_΂Wk`",c2`~kE!$CO@>g+# |٣m``0-޽[$߹Tfe+GNirOwj\H5Vw|"@?[Wl]4'GuBJM@^߆g QubagiE2l;tτNҼr<5>jgx%u'"2ro}?UMɝ<,[' &Qf \yZ&@ʏYQ߱O4j_@3v%چ.݂ Qψ`=Dֿ$7Dr=`]\}T`ZG_d)A.MHVbSg!~DPʊcit8]|LxWոi>UZwq"P>x#ɗ.-[251Q+va6Vqȃ~<+lZZC7%o7(bɣeK߮y~a6o9_hLǒ_ ˴yIo=3s-ێ\W3듿]tt3R5(:I7dԓG2>f7އ;X-AŎztAZ_ei2^E $,j&LEsB䗠QsPٕf%xӐ߭_j !U6X&vaeXn-ƑjV!bjz^L> 3W*LK+3֒o'j2sL,.&J焽f#\A>t!$7h)'/\f$0{HC8uv)}hQ¤Zx乞}A|:DY8[ 1iEDٿ=Ҕk .Hܬ BQ(x^}VC$ h֬+ٻX+NEI)Gpi&9Sa}'!TURLIC:R (@T׀<))KH$ M`ZZà,51 (jx-Q_93=YNDžH׾QA!H ,&bvFNH@%qo3|pø`4X3"7}m!QfQcs/wwIǀsd7,d\߈g=cY[?9 pK\dh@DLðYdyjhiBK.=a&nZAΤ'E^)$|.n}t)M.(Jv!@V_u8H p>c"pC*`ӢMb[BfKC_Lxz1Şۺ XO?C ߞ'#??3wZʶ0ܒ "&Ya =v1I. q-xy)O8 K!cK`!C-V#]`%r%/Xp#ntfIc e[ 7oiW(ꓭ 07)> !y.,MUx,`\֤]\ !Y̚ )AvKC0oO v2.P9) H{G S9]N@7ken6࢜]VXW_5,17=/ FM!1+m7mil(z0H,Jv"%YM.҉"1:kć.w@wp(|așH ь:@&JUSuuQ[5dx ̅Q@ x#6ɻ F'?ޟMԖz99*YS9H#4t (7^8FY`:BcKFL> PAHd{6xPJ\x{R_EfMx8qj;q\#wh,6N7  XoGVTu) ٛ uE@M5 | ѱ^{Evzdj\h7md o.;"Q4g;.= Y]8Ur qM$H^ hv~Oe3oV܋!UJ=`yGMd1(|B [8ϛloV} Hit3d+?:J׵@f=u*K)e"G7vRz>i}I=nXe &SWU=0f+9,9zg` 3~s8{k\i>+wb/)98ys&?$|3%Y lkMy^8D]zpwl%0%^/BIb}.Mexq]jLCD@~0fr/xQS>Kys9XT +,Z#a~潜c/!"@b֢C~ݾL÷F4qxcZO`x<Y<ǘrDAajf<_ѐ*`Tcq #n{aF=Ϟ9>`zaP %j郂*lZ?Ą\IgzJ Y Dȅ uZeO2̬KƉGV\:aW]2_2Lg-+nv:y" f}L /%[ uuqۻ Vt(ʨreG!&5MUŸ0խ~>ICKxk/?~T| mKrb&ߗFu{knLFjU<3"nNR%MBF¢YwS G~;&0*4kgI,T4_EՄ9K_儯Jyl%v2[K䨈dN%1dHX\YG D$\AZRx_x0fPWI=/Ϝ"hb+}9,QyaXa!pW8"">[#wFNS//e)rSHs˴X&?-- WJ~Xeaä6$| k_RCgO\5Wb8PxVѼ}=3Jw`RL `lo M"}n_5hKO+:v}H#sw>lQ5zq @upWPtCY2i-{Fcz䑣(|>[T86kIgM ,Ky?_#t;r<& rc0/&={ya!x?.n=LG /VVGFw&sWW˶Wp`ؤ-[0ᓅdP. 5ۚ(h"N1HB9Ȣ)> ӧRJVtL~DfeJ]!<:CM2_OQ,XZގ)<{ U'aйwEaƆO\KueN>tW1(yC5¤ #&Տ YlaH<$^g_+ey|xY].:BXd rPџkkۿ8F9s4:^\yh1 A|e25n"%c֎R׮yWe"B蝹v4]!L5Dw֊5:Pk#)Sh-i Kd4ɭ'J 6#v(@uU2er,&(Qf&~Rr5~0*_OPG־݄";m`&1 Y{bM^=8ڤW=$F/vU{(=Gi4uxl{\A}rQ,Hz~o#"Mz qWGaF(iOy3Hq,g/5q:ĝ^ĥܖޒs/to?T|- v1FhŝH/\AT;MLmIO9 ^}%XAs!ura/W,N,?E*3TN2\eNe^bA!p,0+Ȃ {f%Pv<"})d[ɸKaʧ2ts8ãkk`x{$M3qȦԓ+UD = Gk캲?sҢp.PJHvXTɚ.&y{-Yj> p)kwiPdg!x7OnVWȶ$կjָY1̅ 뼝{ tm漉V:,G`'XƴE~_&\uo0NG{M&̌ \)^-$&JHfnWۼޱSquM91^+V(M񣄕k`N_0\#vۂKm;wրD3bٙ-)Wlbqʭmy:z  qU1us(b_/WLPl֍-=S,_BL#> "kACHG4kpcO?Zqib_9:(ySڇS8x ɲ`a4- %hUɮR 7_U=%Y_>~Qdg;$xD@eéϒ_?B,ٙBF܎Hl!Hf_̾ )k Kˎ:ώųY:0l3ݠ |Ops??оI  cB$1JɬX>`/O4aB)FZ3.m3 |BIH57+[xhTw8[#PSpO<$.Wӓw%@&?3fA@"]󴋞?JM!U3 2g )*M B<@ kcBj폽~ %̻1HnYX :.Q„ǟPx F o+S܎U k) ͦOqd:^M|]8G1^@HrY*;cI#R@Ru򊩨1N4a.V J/W64rOAѬ(Zb*0pB화smR 2Zq<\/OOZ ՛j;h[{YuՔ:W9hib?vy$^ݿ՟YZ#I. ]WI{!zlO É[vl qzn(Y3|ҺNٽ00EA;4=cc$St;';0LooRc7R49_1Ʋ{Do)K1Sl'L%xjAIۻ2} m=`IN"Lty+C ųj$ᾼv_]>u{N+S(r&x%}RgCR6՞e/c,v#|Bp%:znbX)bPJ%ɡ.OC•?|،ֻ$E (`Kn,v;&<@5Sc{kEnU8@^Ё$W ^g (mVqNDqX>^ ;V@{ME2vmrr-~^K]p^O\M?;08.ar>*" !hGt{NXN+xcn/HK6h{u Me@qPxT+,Sjb\jQw*N6cЯ`0H,S\Il*{X-`~q=we=xzR$%WR|)SAW=GCb~VU׬} j|{ME|c9i{:9m_>Q!0У8+^g ΜK%b {3dv^[k]%!\E+0OH{4,EcS4FI{%FԜT 霭nt+A+8wi/ k}s:LkD`o! 5Yk\`ԍ_aJZ@smjqe] [8Wpt/[A]z1 Lt{|ew)Nu"xi$k\=P9RNF,3i`~BC5. Q Z.;ਤ^|/fvW[>VN4C&\8epIcTٌ+d$!8QTEAdŞ,  `~r_\zWJ jk5+Z pq YgGuYҨ'ېt;k <ӼV0V´˟5r~vfәx?0vk]N BXS;S1 Vfz_);DIt$*&\!ftakB$ᘡ}*7oKKZV  O7kw^Q>%%1Rٔ Ar4m8tKC%0v:ESB߰!r TQ9$+[SfE7S-)NB38Xu>Mkz+<>DU-p=8 Fy|$ƅE 8j땇Z肤ŭǣ %߯F9lޯ:{^ 6=Wl83 <~GhB#@:`s+ۃtP$qu\HH)bbB84͖59P?ºM+q `?,Y.2^']>yȯ@ G;s(d{Oa:M9kFr>^;kYLE:10q~d~\B_bgsظTG x j)DE};!Y* T;O^MN/n|wN`Z?᫨⣕^fHZE}D>qV5bqqJ-{2wIu-xcLaR{91md^( @l݆sp g'l3}= 1MpU=nrf_#C̨q|]TB߁\mJ:hxj@b-q#eowV+^qmY.XTІ" H7t2 h V1F^E]5b@g[DܧTG|Vo5nذo4icsa~YC*An4GaWm_FTђ7)8H\G(b yD ,=]!C[+ 8&K֎AY@tžouDXOxaԚAN adpɡ?Hdv@dnnĮzɡIș?fJm/]mH`TA̠I+y%n:E,ؔփiI 'b&]f@xE[0EqҲW铟d39UwXz55f luZхk.Z^jʗe>DSqnU=ҡ*:qDR=rf ]M6Uvg$pBLAާL{8KQ#|}|a}V2Z=c\$̌a;Z;{xu ۣoN=ѓAy='݀\YNv13dV|zJǼy3b%V qYX=%)9 )~0uܸV- Ӗ/TE;?WdG/l+$Iya|qq~G;mFWlvZ;cňvߣ^nz8g6MrÄ3y_L-]W g* ٷ9&WH7L~A˼m:^ZYvoR[Z0{Bn1v-\%#}OU*y}4)R5qĈ{ Klj*LXR"─^$2re/ >ڋ#ݛ|]Bٮmg x.v`}!1H]pdI&gNv\1n4~lb2I˵}2eP&c؆,uĜ[zassB (rdpKNz<h]2 xYc. 7,n%x??qUz_ B R'vԅfb]5T'F*OoFcg5q/f̣+wγTyie4ə[Pi%Pw6 'vWEZxoh6 w~!Xh;pd n3mgfMu\FHT!Χ.Ȼ-do\moaFxR?@гFaN ߎY/K}TUڼLjBẫٻ^,JI|5 1>hD'F"@}iz3&C=(#D]:2 9*lQCCvYe%%s@d.c8 iG<ԟq,:osE( `믗VԯN*v{=-/cP%s0| f*=-XA'_|ƀvosu3r ML%}f)m>;0C ՓxjGZKy_tx"SE'܄ItOqׅxdE/C,O7xU^þ@#WXg ;6W |R> M^@2jx~\-yH?]jL3 ~ OtZ7DZaS,+ێj 1;b8HHNq㼽IC 3O5crN!yX[˜ 640W ,y_Tu y)cbNܓe@i.l¡4;Gcfɦˎύs2 BzcѷH v>]56E<󁂃%K!|cx-7 ziGQqniY֕l+1 |'m"e% O19:Ci[2h9^ ٮQؤ-5CDmQʋ=hcJfAzcj{7~ Yhl+#w\< m84Onl?>٩+BSOy0kp޽ nSr2BlQ'2~šRX#gLK"һҩ3]8#Q܉9 lG;ѕ; xX+D<8zΘ5, _SצS:q3ir4E0cUC I 8"-`_n$k9HR;b `E*it=֘NlUƜ:EMg]/ԛ}1F eQRLKBãSaDU!2+2!yj 𝝄؄P3.: C:'MU5d;/2@QKeB)ջcmckQ 穦cÏm@ W#ˬힼhP}ګԛߎBR#CETUETm C}EVBC{jON1RE2FU,pe,tAW`f%O /(KֺKUST7/k:>Sh sg_ WnY@%a8l2xF1noQR"DW_搁P0/𬒊%\ucVu?T;+8C%9-BuXUB3 Ԫ[c{82E\ˁV/|R[6lhcuϵ QݕB' \$XZ @;# ?-׀}M(0KOn%TAT\ 0ATgsx^€ Prq3=* rlKoA>BDWjٽ/ZaOM<Y{g24}ph_cd_R++CBg"?A>@R47D]h`9E$VVkqu),60A7DkNub R#>3eNLU::=V3JD #dU Hjԉ ,}du\=p@:ͯ3t^ }Gt:gIbɴ=@`,R)9{yz e^ C%;xQ~~ ܾA"XT 'K-Պ@8SYTb-*4ܙ8ɉuhg3FZ!|QV8%|< HK0)@y.o@kV^^cʛ-8t)xƍa]~{zvc9@;& (; -n>:oT޶AKX5HC^fFĩIlGlT`M"vy.x1)Xm?UA>Zf:׿'mI \OY&!73K#ɠOB.O (wrX 8&vq e=_Wv5'`Tl@(J(zq> Io!zxh/0^Hy=T/[jzpFCS4%O>Qގ4a\2c'"iw8uZ:8 i]kѐVU e;`"s]d-Y igܧ޾;߭K,B"- m?3R~a&q+m`+$:%卿 儜;aVVM?_PD y+:}.78YJ&9B.\}:.T8 eR[Ix\ G tبv_I>%W]I~%j;`! VSstZQ60VH{ 0 d-3~̨03|xK'zf. M|B/]ѹ #a1"_E!#tlʫ ӭJaqD 9ybVj 񀖓dcJhE"GΡ q􌖽:{g:s}]Q >n-XOVv8[V =;tL&(/vKc5Dw;6' *V˘kL) 7RÉQM&Ϣfwʥjv:s)ڠw/11o%Y's0;RhSf 8쪱nTlkC Ef2xQ7[HNY=ʈ;oPm&Ir[bZ!,?^A OArZX*55 IQnw>/'3=_ !4^â K<{??8DՅ9kދ "8.A}.?Dg>L-X|ٸ>aAS@'v꿭vIdgy`Hhd- %灪θ _ 7 у mj3i$ᰃOX^(8Wzу_-A;z`2f_ d9zoUR#ЍDmbh-<'5|,/{`lXN~ILV>9 Ct]܊4iGF܄H U`v21DoIJ äٔ0~K~&tݨbďu?(?ah06`&JDF^ԟMV;gEDOqB88&+Fgd,ԋC-c[OiD\ӷsiz4/` 3QG7s&u!pv@M4.~/;2ܜ *~MGw&ttr2?mhdVGY!IDaĽI/)aKٌ|xt?8|() Ceshm_5Ž e{ky%o7C!%\h' X[~X.,]ȏ؀;ry*k ,tfZE}|Íô٧GjMs)m}+؄rhu=$6"z䧆qMߦ%=]#਴_U&&4&FXdփexP~_},H r{ӆ4:4i&`meEeYs1;eKX'jYd/w«C/h +=ܥ<ʌF/L=e5 <uX)|Ʃ}mt/VdӀ(Wq* .r90QCJ)ӨyҮ4f4e-i+yB9HEU7U}|i12hR3UZ\ngj X(HM :~6SefNx?܉:%᛼[C%L8՘jcX DeN6: g]4|ooBR#.F}S~lAs+8wI2 ~^p-iрAN3AR_f(sSq82o\Ѫv.P|;%i5w?~pF\]O~)}(7x6Z zЎBY x~ 5OwQ0WGsf^<՞9ċ^#,/Wyq @δWOh1s M"B7STjP-o1'r5qBWԄ0.a zklASki49z*y6S-˳ Qo..*NyNaXD>*ID*mX<{q^P(?l*݉NR o9B9 ހs'Zc2֊B5!+b:E&Sр>o"\TB>f@֪0armnX؟8WC5@x/OG,GIm'$"Ҥ&$@djxYŷ}\TPwNa~Ée}/ǵZI/;Q .#gpFȩfy;ӂF'=\+mI1#S>rNO|׺g;Dn{}d8H]#;|-R}5}@lXk= z>xM{l΀ysk'[eNP1Gzc%%˃ 6lf1Q0dֵyfz])ƃ4a{QQ甂qE =N䩄w}]$"9Ba gCrcCiŬJHg6t=PpLVqIض :LﮠBƩ&yPe}{v}s10.n~dfbVKɒ: aO}|![Aah7֫2HZ[-Xg|UV'n +$<i{`xr86UZm?gKA5 )$KL~e5Tgr|ĄT孾_j^ SvtvTDU_6$6W>G ׳t\C}5-SFªMH"\}te:)3=^I\rd>B?HN$[JN !PN [[(58}ywAppo̵e7&BR@Iz3HjQZWTj&)+`Z(~! Gϭ ˄m] k:*oPl.E΁%|1vJe+asK@dy| s<Ȁp.om7z0!.Rzi̽01o\vp'WPt>x@%qs-=/+."ZBOC?8A:.Ǡ,!5w֤ڄT؛:d "z@e׭R9)6'C8IÖWaRM(Z]R7/LCv 7F2R3`ոNڮ˾ g4D7ۃset! bq?9\a]Vhd\܁oo,<GBi^ϔw}hZ?P k̦4#};X|(`G,Dkjp̶U%ow(!-׿|6iQJԄj}<|cs9"]DMbL M@ k58tpӕЦ(^RJM! hDn׫ϰ+B2V4NAOX:lxˆ>x<ԚIQB%ɕ8$lozoS63S ?)NM76JvW YBNq?ޝA( f1 l57gV:|VT- fob|pV02ڎafvU$hGc1Y< ==%IWTg'wrO WOފLZMN2Wp@56)ـ&A(6 vZ l{w{u)<γ1<ʹ׿K|誑8ؖ1ڨFzJtZ!BRXRMT>jg0KhQ,CRh:{"ن"T~AwH69ݞq{[01a]&:ņ/D13g̷Ji413Pp V(p Y9< jsXn`0s}k\od:<`*6$nQoqK<^ \_+aJ!쓶NaH= C>E {+ĸ%-`l*QaxM퀇{gHt^HaH&|Vcӑ0*K`9h<Jrڒ]j:-,(R85( ô=hmsKx,ctǁ 4G@J9vn$3eCgE{?Oٓ"/"2-Sʌdʙq~X9>d2{n Ǫy@7W Z VW&"HG)yyU^A՟%4i|!5m?tJ`)tvMJc" P!^͛qzxyw q֧[+"K9qNת&bwGôe=iMn b0nz#_WMLHK7>Θ"ڌvRd"H?'QM1y8rbX'l0<x|b`HU <*:`0AklM̬-V3Fh K< 4eƪW:} xH7imSCPDwNmPQ@\I..LEːZt=WbLt^cmjBoe]pCi*]t+P^bX*N#iJ?l_z pDn{LgGFP7j9 tÆP$~!rջB @U0y4PC;Tb!7NWFsS͵kIj`w3>=X$A10(7'ZX-LYFȺHJ{%#*>9B" 1m sKt +`^I0wL.)/`rO#!7 IFĭCkGy<~3F߀4Q(÷?Rmo;4LCдG@4=: SSngגаHg栺pH+DEi~iMy^>w5 ҁqE`30#ӌ0ZdıCb Ur8haB|Z19$Ezr6Q`3JP-+x` ~$Gv#M2[.ϼ&"{Z!Miv颉=04W H9QՅս~r8sOg|Kh@,IЭȱuOSe8|KL.R'I]~aF7RUK<ȫi|0$\x<35eMv.!m~2&P"mNd2Ex_@/y s׬֩IT1mM *Z5~H_eͩz#fb8vs)ȂUtni_7 v:bo\˧]ȓAhpD%jn8??;̊_pt2f>@ =Օ%ʡ`Ae']\H/2P*u1`2<by) 9uƼw FU3W+*oc`6ogia5]Lq!7ALπh˻-> Z?@VngM@\av)N Z**[*̙!*oN܆[ş4/ B:0W]>ݟմdz(8ewz)Bjhk X؁''gvWr.@[v 6o\f ڤ%GBw1b^hG^iǺNq]ꇂ <&}R%T./$0Nހ[9M6红DPrcOK Ur䵄P 15&wqօq1GI2Z28l},lU^HjʾV"eT~ꢏb{7)=EI @R,Xs 5 %?@)g;8o[f0O Mx{UDS;+ ]8DˉPX "(\} ZlH {u'?"ZiaK v9@.@\m^m65 OuFkopΞL2,W $:,+rŜ4tETaAi4>Ń Iͩ]U+ޅU=R Y1锧H6"B:TvDn0l?"4;Z0YټM^9vn6Fu3^HP̲.ϝ(=2` ɚhȆ8"ڲ˨JYKTүYHrapXLD؜t~+dpwv,J$b6n/<=xە@I5ّ)@eBM/*i{e|jz}s_~Uo1j{k`fpIje[RϜh=VmkJ0diCMruPi>j (#kLD.G̉9GX2+jjf(z_` HyLʹ=-p#ُ^ M>\J[?";P.ќV@ \|LCz h1~;:h~O5g1|"b׼)eCt*>|"~ jy;.~6}R;ЛnfX(_snЅ`}1dF[hZÒ \GN8kѴ+%c{BTH?LG4ϯ3DEUnt5tbtzn;wHǪd oJFVb7C;qX lC5.TQ2jI K0OyKÂs<믂nJ$&sRrJ-x?7%3Pdf"^o(E,\ET4vTƅH?%E$ma&Aqnj ]Jߥ/.!PlW ~5-:ADe`eM]/%]),pRpxꢀL+cANbֺ{(Cr7u:8#GpD␥hڔ>Kع2*W$޷SZ{ZH|wJݕ67ƄK TA%}Y:be;uy0FyE:8?``iG#Fez+}άSBG*?7o8+<J~?HkN|b ^>f"[kb &|K0Z羣 h0 | dW]'vU{fv!'pDLyDJ^.38^}H;~ȝv Jad6W*{'55˅tﬥŋh9MP͂i>)@;W%@U mT{! GQ*' Z>{Uy{}XNc%&+ěЯBb%`Q,ph,k PY& Esv{DȪ}U3RI#ͻpBFGlNCƙiD 2rcf@mlvGh'C*->#fNo 49'<+1dL7Y7 (' $SZ#XӔZDsdgżLŪoE=QdO yqCD ΰIs8\%re#95+E~8:F1,4'NU=`Qb{fr#a|hu| %6^eRVElPڲ&oPћtfB= A@ Vx۵]CV `dsVsT4i1:&.9U[O{'|kgV߿S2baD̓w >Ӿ~zIrZ-`a- i%̾'Xć5cUUcuƴ4 ̪ ־'kՎ5$y_$wHGf5y?)',< P֋jq9 (V+#ƺŚʨ bL`!K  1|a!oJf$9gP?D~p/ƀnB$Q[2FiӡuiP>W7C֖G$#p!G,hcL)`J{b"F7ćr>&yn |,G$.F: :8PM^豋k7*"ܭy='AIލHuIM YJɷE6w M$`W̊$Bu_ F%iiX\'3T9`xyP(_[vK?c9nI:t dI p@7SBH_敀{Y0%qP^ U9fxL^Id(ҥjY3q$;ndoaSe]B8G%y3_ýV.ե佴zaRY|+׊Rg:Uf;! 9V&!Sr54 .RY`;jq TLr`I]eq)f* s2 lO3ݙM]K9Y'TG3~)с.=mi,XB2귚^H^x]uC=v|MzOiFtR1wA c=d4HRH  –XY__`;6 $6p9ր96r#7OMk~2[ڈ8Ja·0EFp%8'#sq/֒dmr~8pN k'a~{òwX3#m-Z=C#N(m; |$ˬqӁL=t15ԣ0>:7ʼ_ێ,oN 3.}<&~߀+H%!@\&+;#3murD 84a ]{]i:}?+O y|7zqri{7|"ֽq+H+yȻ#m*Vi|?t$|ˎ$\ju/,d=@b`^N0d{\ K6gf$%sv 6yPQ؜+Ui~pF5=*O_Md,7ӏH֖\l=pa:juiu:;4˷A8CvxU+y64D>otRhxd㳲vOonߠlVd.7*K" o$^ć8{_SCeF:STqPE|.הnc]?0[)Bd潝P[U5)ϋl|@m͡sX7 {-o>WT${p59m"~^;uQ9Kĉ]9<% !tKP{ɪQvG7A5r$ϵKl@U0h ]b?e)fҀI Z>iפ˚f.WbFE~z60g4J 'jʒAh6hK} yFt%Cߗ#:U&Ch4^( 15آuFCXA<.GX-afxM۹eiodOe~i9Tt%((\oyfjZ~1u:֚Ve,Q 锇 kc}\@s׻T7NHQs# 3 \nV7eH E@Bfma!ړQH ]r93&oW@[=:|sa".vY}lN5-E tZ8 2XoeC=a-Gp BSJڗ9@ GnM/sU@hK~e-q ~e!qC^b_A>x@DXo^GyLy$yJ) EMyXM12z_ޖ*_:ok&G >Ep͍W\md&jDep!,VmކJnVD@ϹUz6٘` ɯʾ@-LD*c&3Ò"nwqH-u-Mvbb h7Id{JTµ@Dԙ'p(J *ahܝ}̜*/#t3cYV3HAG"FOTO 2kS,JLx_?93tտ)~Dg}iȂ5yA½+<ƕ3~i4A9z_ 9*̐MY8~*MOX423=-ɲp y.ݬ Ð(bap]J')YhFdG]+'=9oj@y/?ıcA;j(iwF+BDrZv\̹؛0M)R0VO) $@R^U78Ai]T-Lc!\{aqu@>Rph0c7ܻdJxU4Z.2E"ӝ W9Eo=+G\!?$s֬&rDܼ,:lƟ>}AAE9a02b{iBTϐ"8λ$| oNMLyӄB!i~$ŠŒVj<ԞjBh43&5ne"1+x! 5o!׮>nCmFIHU[ՔCo EAR\5U?{[{U7$}rql1r;جʂ=qg.ig#A0דiz3Q[L*X.*C֑zQ5ʘ)kpט7|J5=2p{ v"릖M.i=SxA^S1Ҩ&#_"4\o vFIR71/\9 cCgS]DDޱ[r>kJnZ!(Gi󊬖uwvk H 7i#Ka'2Qd뻽$Gr& aj( 4b#eR3|Y4uXz\ w X=Ս@^tL%U܁sz|0ߑ Dz ۿ:2ű"ϛKoR;/6!7ֿ{ ՇY~X`$,^ ?Qﺟ@㫓 o[T|Xӯ?G׈;Λwiiz-q6]Pl nq o&W7n)3yMi|xpEtQ˔=7~/ n{WqSo*ӡtk+$; ɍ7{#u!< A!Qp#P@~5I஼(lv&7n(Vr`(uOiʏ2t,uRl@i 'ר@lBߒ^!Gg#0\QhBM b`q+?:oj6Ƞ&x~ܺx`bWѲVSU\iԆ͢OK Q>Ipͺvbm%|"oē{'Q.5 kgi:.H*xo}Vy i' 5JU 9pz8K}-ݺR jiSBI_g?aqXha={=ֲ L maˀBlCPF89=Rhn$X!2f?Lczb;|}X(Oj5&dg+D5ͫTkƐs"|/( ;XtW2yYu>X^.)}|Ju_ݠߛ {A^2kyrSqQ. 9D5\n( 2k&%4gdb̐cކx\ʇ+>!} <%VRP;$N;ҕO)tȺ0޺i7Z>hQDT+pJ];~(w{|ӈ6k`z W-ϵϷ2%g-ޣ5ςhAp讝V#DMR&H *U&8}\9bQ3zc/ g2`zMt7:)2mP2NU u&߂t;m\r12%1Kv8|3LΥZuiV0(sKr9g 3%iSDϪxqLc]k~PMARkC,)ҍ<.p˸J5@gXݣ#,$> .کP7L#Fk<*/h X1,>C[Աiɟ$HGmqRі60kэ&e;hM_hmX8{ݽz?wn^ ba &-!w=4ʞTKRcWKT6?"Uҷ|rF310Hc}w ~TT/ˀk#{ )O1Lv6$ '8V%?nӖ@Ga}ډɚ>*Vi8"rGј c@/iҨ p&}#/Ksȧpgz HKlL 'Vz rψmHBwoO3- bg5LE_f`dE0!mAjIޔ6,820J|k|ڍ^ɇOA7I;ەZvռBj#K4K`'M87f~(H9noiʌ [ 1Pqƚrѯ{Ƭ-ϻC<ֿW,?~;~V> @چv96 [xqB=n M\$0pQp]+~!.PNB7h系]B a"jα LF'9G[nT4lOM |+R_i[.'?bLf(Lup5%!h]og9t-`dx e ݮ271D[ɁhJp7u.o'Vòjkwbz)P:1/Ō LqؿDkO}LKH#\?BelamUÎeѺ]C)I @$sS8]=5sLq<1cz.Кb~skG^br?Ww]Mg^+VӆZíQpՊH1J "upJhSXy/DmsY}[=Ouv7$' "@IUHϽqX#ݰXN2DUC 2~oJw؝DT,v(e.&燒%1@=P!?ͻVNaWK()TO Zt=+lHY~n  b˛\4pb(U9$\&hBݽCB]$:bz8zo>S*@ҌXTQ "3ϋ `JBHΖ&0"KG tVujU0c AUhR ك%Q@Ĥ0[ ֝zTXf)VIM#|?us3Og[!m``oU"E^NEjb^hXw !1KnabzNnш~GD>on= !ʓݾP? @RRFeEݭ4}s!҈6:.jڈ2lڱ˱mE%B]%ɭgourGuZڻ8h( 2JDfΏ[g{BQui Upg<'g5X StEs eJS ';vB~s/[7PwYf)P2^TUTR1QP~4/R'Q#$k׈,bbz)ֲEJp < d#wyB4>#UG,)~nC.9X g'ra6>ѓ^[Se $yY S]01<;H1d+f]vƙ#@GU|&<_E$&&E7ڼr聹iX/,5z{Ww=A#·d̻V8 iY6sQr>h0fz?D$ 0t,JFqw%/x:]V+۝B5zdl8:a萞!x݇ho?)55|IFE UV /fKɽU}އVTc JWY⋋~(xJW&eTU܈\gѰ, }0>wv<6!`좺6џ): Be8aQKGZ6qz`$Kd9?!~wې\A:]Vz b$l\e4i=K6wnl +FLW$+Iyyv̗3RY; med/߲3b_HFҪD]JF !0R2ȇ.Ro&ÔfKvN_SQxs1-߳qXBn,u6ʪ#tEPGbe6~jZ^BzJ2;,zNSiA OzBI\Q[Cm %Th9d=T J}h4&廩9}[VR=_ @yVmHtWqͫ3t/B@c“I;]_ކz<3EQ^U0C8LQK'N?,FT&=d"ooaׁ9gu?BݗHg{Yl)|yГ9')^jv|kHc5p 7KC[">uRDΈy}F̛x/iB<mk/|? Jr $7UWO EmTaAK=h " +*r咹 ہGp$1s# W5YSsD T~rR 0@gD{tZ,A-8 qBqҍS mR6-?1аb4tW#q[GFjl/0PVcŴWtoqͣ'Z:Cgi ǯe6zj:5LW"n%w΁ѯX*t^訹&tg<GL%ۻf}jA06BFE}`O(9N>0hB&4&Lb C̍=UeX~nn端6%ʺ׌)wH}Oエ>Dy盧Ųň<}AU>x6nſym^&_=zG>H)FCnQ9E*y@ 7]{[ ^8 \WKi)QWI<) I8G!YZ}E]:АȼhqǍ>xǝz,0&( 0kBCǘp;1x@~/SpTb׽)zsE|sŋ_~FYS/>֦1_bMc#B݀_";.}d(-&|yRT`o@m(L];T>eM,X3݇JbWOTe@Ҝ4N[z:G+ykӀ72XO d(# JEQ5]RJJ8[+cT7W.@A"OojSb,{FFm/U~>a5>KB !3I#c2No!r }hf'wFR;w];_d9ennAzv*fE^ o(& ?c}mO@ ^@{C&XDɂJ#>Cn,``~qXS ʉxv ģ<̟.{gt燜-\-Y}*zѵe'J+hz]΂͑ CNM}ZݡP6cC}G4){)/i*-:xWZ21WĕxLtSMyBjUFE¦L?1kGJuU_X~qf}%\N`,cu! ]e<OZ /J!ch\k^a Vc$|u`OYn9zU2f^ uZlr֨Leԇq"xLLb3B!)ϸ?P[ɧOӢ([ &vQS(3rz3ghuF➆GE cnor[HLwt;tT\p)~֩m].\>%5O f[@<\#Ơ o"͓<&FD&v$*if)ՖeMfR/~ =jPyR5-z=/<B&@$`%9uC3†v_Jk㈐H=u6*wxQ^ŠՕ$UWP*UV_%4*lu5ވԃ`uM<gy3PZ\QfCL4-㶲Wvt&j0MҖ̑@0$"wۙ[JgE 8 ʈm2ܠx,tVXPh+D .oAզG&ĕ!~ ea,C@E.4" /_hETLә0z&eFK}Z2I|SJM7MKYϣ{_W.ˬYxls5"h<7~TqAF35wBJ4G J鳘#7o))픖a73#[>֕Ւy/.3@*[ ?z2w~ܝGr8Qkɑj-Ð7hkƃO-KBWQaQ1?TTzl(_U| 7c]΂#'B DkS&ۥ!81&=+ /G/8?kSEݚ։$Y"uR+ ~Nm<ߓ@#sr/ {?KR8llUZCt za>M*]e"$}B B{pR8hƥXr6BY;X& `T1Gf͆5c(JñǦ_W;@zڈ 2Nԉ4sN=ѩ5ټ(LLyٱҷ2܍c$RX'?*>&/Lblncݽ*sh4aj_tSOArZxБ%npkv\A/ ؉ۮ-po%3k4޺F`*ewКK0 H)e-+Ġ-F{̑c*>x¾4YLy$b Έ_R4bEޅ֯ J TPhrR.S%aJWl˂6vy3X-#ϩM6ɇ*l 2!:&ĥvmY97{v+v:nCH,fp<9ز+ұ ̾o pr=m>E kc]0=}TḽVV*h-tg%`zF6>NP > -)aӵZ LwJ`OWTܜ `"H-@6R#жf$ԞM>!_X:Je(ߐXp)XvQ^0^Z\Vd_R쐮yGݜٔRHwG B>Ez?SeU9Tm8pƶ`c)(;CߑWz`a.ݞC߅'ұSS0F/Q0>0,_f~c!G VlDN}Pjv׍ԙg܈t,=<%`!T`q|?c)#-Eo~{Ɨ)vCą&nh,3uDd[@lddm=f -O$/JW]Z"F H ~}Xdݵ6%5o+?!vfU3YoƋfY!Kc񵸵ъ<^v+(Dw88ǀ ssI*#O2ztE@ .jRCmlEӻb/ ?j~63cu.5R7k -BD,x[,A uݽyd?,ڃ*jolefU8P-P5LB>1t\3YTiϤ9m O`-&P6儕Ψ)Gee]2QlWTLXJe5{jfSju-G(ӫZ6<ȏe#A/+b~&˻DOkvGz^uB؃oV"JB(;@+#]Sd%Yy[8sōo"5 8W9qjƐi4h]ra2v޳X/-+ì-_ 1C%J E½祭Uo(p^-#wJCm0u%Ws 5`QvEUiܗ,Iu1"hlG?=" UZvO‡z(Mym-:n&Y5L=ۗ2V-32 R ha"&HLeA0~^דф(0YgMGXT&r O?@7[pƫE)]^I^R s=~91/ 'S<_L c[V"0)kVܬ!BbD6n:Mu`E2\w4բ@ߏHU$R ‰oٝo2"Gݡ5J… Zu0s~!ΦM<)+VގeT h>i9[eG΃{tr^Js׋y$' WjV61*9`*`XGz9L@_tQz;Ї뎌΃~-\Pvs86Tw3-K93WtKLlzwo?BR)_)DA?(TvF6ڳT̏ȕB-!YRиwqL;@X4IB=~>ddniGI6b5Cl^R9TS_c/߃~>)P}|N +eS"> KXBGUzlX0~"_;oǩg.=&סh)wU*4K΁)eI~MKkV#ʶŭp^aUJWX\)7QI $1>_B)*PD{xrdꆸ;3 0L}ҋ;@α6odH$H~IƯA آNDL#Q)g^ȩ#x6LE3/D9""Q}  V`]HIwf ;dU弡ȯqp2w hb)j-E|'Zb|)$H%5ws-)᩷pΒ3oki)cxzG(+lTmTu Ϙ?9܃%hz̯5 S[࿥ǫC,,>SBٕT=Tɦa'IC@4MN4R$e{RI'F|ķǽOr(jLjGk!.?>ܯOw1G 9rd {]*~پ5Z@9^~ 6y@p.+cHbگ%g)Ytp\MTvm)?0a0G(,}ok'6TdQ|'A >s؜h[3YvۏdޟPy!_$nʦCy[}vyPl?>/s+_}R# l5.4`㧑 jۘ76H{P萖)XK$.K?H%O d:yфZS= ߒBXׂת۱7 +2 O}lbTv_\jâaW$ROÚal7}ND 'wVL_c05bv ho+p-}3)+q9v?[^Vsi9竇lZhH-]HȟrrGˉ,΅.HRD-af \P6,%BN`2yZ1NWjܘMxzG=xCĖL:$ 2S$$' f5ZX;nfx198hɠ{uHpKqY Jͻk1;Av[WӢk <[@  tHD:}'Zt;mղ9(jG#܋"gB4Hzm&fzfⵔ~ <[*qUǥPA^Goqe^W-]}B+'x@,W X+qN  { ΨcoJ?i?Qbf pskt?qb~rq<||=L3n3>vTn>2K_e+nXQWyn\Ӆۮt^"NFQb*m5NFQY<>]+xW,Qu\=y_v:g'9'Xr9^,z|+Z觺]o;*h"ʅss;2b M2UvYgLHjBbw욕?`a~s,z ԧ J,%VjkpU ]=H7WE(z( сh}a7N)V ęտ++ M[8gح𽕄 rd>wvD\ H:7%T`_<9]j38Y;(s'7!D G=b!^0$42_LsMJ?b6n<_%:]Lh_Ij=*tr;At'(o("b 붼~Q[y-QY Gʶ| yK0aͤבx -4ĿľцU'7y!%CzlcXˢ4-RaK]S:p;0te"Q3')HxBvVhFr]*2{.؄  @a9E9oqb7H=(Yyl^Z"'`a<_zڇI{@t&1|Rk[ 2\\ڋ{蠨mę(-~O,-4jޯ_;uXO, |sBnGsj9{, x)@\۱QogQ evH~Ar].BdUaL|6UIwï"C{F;1&jJ}C~789P*B D>U Z2ՔnG/x{NW~kk6žBz؞qjP\2In\Ou:R14䲤)AC;-mq.CZc YѰeTtp0rX5|@Dk6/'%Kzˆ o>z0e頿n<++<$Y%8\W` 2YԛZhQ Toб8@crԶXյ6k NI`DW2ij/jbv/M8^Ղ/v@r$C2ڳLLROq| CќU3+ngģu?o^oS=<<X6z[czPgq_8Vbj۪Tہ*}ګD7̭s JxJ8kKݥ<as pU/\'X8o2CFʰTVoe8͟?3HtoLwul/kuC,#Dʣˠ@ <3^g] "I[cK$~|ҡbm,Iqv}䐜ݦ%sOvGgWCЌ, ߞg/Io"sOS%Uύ\wC,NW-;ەʟr8jjM9nRTL(dtcj4mk([Bpب}ؾm8Bwd b%A{ӠkU?c.uoW 1nJþ0wz216(c !g;*.pkݧ^C{HDaÕmy;0=} 7P4_?ʗyݙ8U@Pأ#]U`z_+@<aיYgHWcZUPeP$H?*|S;`D_  !l}-(=xiQ`[+ Bc("݇ɽ뵚C5P&φa﷍kb/SC!--ˉ<;$=gIvUL$I_4lM~AnY7x)Av'ztGR{A!;!tS6oݥI Z잯I![2+"2v.tSA`550S͞"Ӯ9v3^ fU-SjMbh@;Q0!W3JdSX0O?U]n1n* :Uhс9X\Vܲtb:k%E%cI:){pE4m?>U 9f&>Nb&fwx *u`j%MXu%TŬCC!s%G7Gڬ E +rDu0f뀽Si]ID0b{یDI@LGudq_0)bV Z\w4gVt!r77Kieb14ͻ~*@t ̐sd.'TclrTY9zJP±BB's>J0IOےHlޔx[r4B"}"̠ylvߺ0~al:7pB?K I&тknЄ WpZa2ʶ;V!NЀ* ;֨w_Kr6`ӕZ(H3&leP%G.l/CDH⎌ұE WIIxH1bPUL@FE3ԼU 'A4HݦZe`r`g.å1jX~nY,܎/ƏaܢnhwK x~WҬ 7&S\o}t٪|[~jEckDPcƿӭo ͂QDH2ӍO3U8Tya#lܛeS{TrnCE<)#d>bcDQn1HF]o$3uL+"G8/I*8$ >i2οҬUf⩔vd͟b0u2\{92Um_ðq G閯Npgk3ҭI8.=>Z+݉9Ä6UV+b}zk|k ~{BCt.W+389<뭞Y灵HcacDR% ĭLF\0mfwЪ+<5LI0_RHܬ:c|(// 2I wU6$x?xՐ7#:k_&-| vpN1Oɞp_U}l@f+9cEKAS%Ĥ 93]6`h9@r78`6fΩKG_dґ?gU}L =ɫ٣Ojnq t;˺c}Ex j}D|; a+Q9Ȉ4CCrB5ܞלrD~O<KR#c4NO/A_$M X[$w/#s(8p%0.zn-@bnbVToҮ}O`:IT0p_wE[*4~fM[̋)sV܎'xe2d~\qsEAY;|k.lǧh|S ߎ4 #HTpWI٤B.&#[DrC^i֛0l7M 4ļc.4\C-`F$i%;(}7㯕]0ȵr}-kۣVL8VVNEX16㲏`Xnļ=Vth/PR2<3<'Nюhx 59^)C Ҙ+?1 "YPڋg_k4Taܶm茗E@^=y$kΞO4뎟|!X)=K5FםMr{kً S}N(ϸin75՛߮OEqpD ^m"} E_K n`GiAPM405A4h!}[q,p%Ϙ׮ppD4#1^A7oa@WsW/E`eSX8DD'Z|W] w]` db^4ubhM_m\1;­N!bB9|%L*7{!0Tr]k$W''ZrQ$dGf(0_ZG#'`h}{?}\lt/?zjK ؆dZ) `(샏0>on'#` x{a6[nwKrp^JS=Sdw} (fXR$C(S^DcLw t:sxzb:-B&ʉ>ttG$׼E$,t('iy9 -H>Jۺ4wfnSԹsڗtm=.׽|^HV#3fynC9c+1׏˧D۝ N_Ɓ:+s _pR8G=0JO. N'y yN$N ӹh`O<.ZxDsF?GЁ;.4X,ƿ:h2IcցX, 29\,dzrÝ0>ʎ;L$9M==PvH*D:riIɸI@PphT=9IHfI><]a'ˋN_zØ+X,.B3l}u9Р?Teq>Q聉n"/0yOid"m^2>{z.L&Yhֶ7  (]iKSe*PV_1񺌟oW006 "cN6"90u *\O$ qPn.-Շ}*bM_{q82]0z+%P_)}a'd[I͢0#wnw6 nZ3Pօ;g\cW9m:*@@W1*~cZa/~<"i%KO%py4nm7eö׷gi^PZ@ݑ8 VV RA# /gߐ!g$7RVù%%N.PxY(Gْ@1~a. 9j 棱 ܠ#Rwō)"Ixj X!{ꞕ]3+c8Mŋ`-Q #g fMJ=`TX[a+jJ#wj$ ) ,mI/c.Cq.L>rz_~G7LZxa6q|׆Ck t yv-A%ގ->+:uf3ɦ6-yHK4Ԗ8O4"&B&:#{Qϔ6mtfq@g=C52>W!puU F~A nkUW9"N`BzG<(9(wbZc&.pK#^4^$tc7޲>M~uֿrs^A)_!UWb8-qS!v{oFSj1|fDczc8k筹 A܃oM.jq}htfm:Fi"ĒG(A0NiY0fv?zB0%dme1e]˴T\U Q;(%"T>6@KlM+ޥd.#4~ުITU܄j:ߢI͓% }B[x]|^Dg:mVn oy?з0=~ Q:WL 9ߖ[IHpZudםs# U W޲_>~F:zH!hRsXx74ֶ 6r$*S|<#d%{NMB6DC.SNEa{l4 ia_^JU5y60ӛ) :T[#r3G`t;< P _ɍ}l lg? ֘v_z;;TXUs˝L0s>|ڌdA%7vs-aWJ_Kˋ{WQEse 톺Տ=n9B_B|5ƝPFrn ݴ_K.D li[7/5.Bn\hmߢ-HhGR3,@PK:8_'Py8OcGUi@s"7VΛ'Q\Rd J5?`9hj,-8ν6sKD%XB"s[`½n)i*[:<5ʇ xs{{% Uь45 =nx)SZ3Tb65DLM<͏2>ĈHژ~9V~-|%N;u+,E*8>eBixt1 [T/ǰץ&6PN W071qy/sC֣GZ-0\vKJ>NΟ%*) F8Sk!sF{mb_g\&dޙѵaPv' w3xfM夙vi_GK1dbpA*VdD|qƯNR_tg!2M㖐r3؁VL҂E7q' `#O w8dB쟔bφ&4k'퇬‰X5ῸpC^Է-2* )@ݥ6'ޜP7>O&Gtg*4Z$myKLIr`5(aL&%:Vɮ8BOŻh2w,A+)5?)T )Sr,C1OV_BLQo=L2RĪ=am8Lt1 Y&ۄr8]AJPDN`.A0ߗjC@w'70/7pY\xZ0R ?8Y?zdGqV~kBBY=I`)l,YUZ)ɘ&$Ţd5c7}3X6覞k}1ʬ;;>,uзjAIn )/gv|l0JLNEy"K% A7ތo^~~Gw T\emlw,XO7222I~} _ h~jCMVwKZѢܛ2)cs={n$c/x4)-L4 YXUѷf$Ly 4bzV=ɥL j BJFw[E6 Gb:Br2bt/2bn[k.飋mznYh #dy=#GЈlP};YNR9 kQPs+~,ծS#PN3{BU"9raD5w=V?JiaAx20;"rZR~5цuZD??gxI{@)zpq2( Scњmf9[M#]/+mTeoAei(CW5-K/rQf~v@!(= 1|HEB& b%6M%G,b %^0٘J|?#rsIb2=_2#FTNSnoPe~7XU?*7QKK2sn[2}⫪\P Pv7ksp3>DeNOԩD`\eNn8nz.FȞICQeRO냚Q Le]bDZ0R&0rнiMi_&ЙcXNd>33CrU rvYH r SU3/QW0"/3aD!J4`;SSTwI,^C;H`0Hej YC!#[oG|[ )ك)Vm|Pĸ q Xt2sXkà/TF!&1=)1DݗURbww;z|uE6509F{X[]''= r-pH_A?R|S4p87! @$-0,U+ {9[P3?֍ӳ3}E,]V/ }}Z+^Or)mͩ?M ϼ*7Dĺ/jX A.ZP]=pa@kcZ:&<H@F՝SH @'Qw/ ǜDwdĸE|'d5R wܹ y#2Wi>I om\ h AL[#qO!f*&1|-Oz%9o~ˀ4İgfTꕏT!CH̓#8P&F{CAV < BcCA2AI4r\ EAHTO]dcF$ rˑl;|QLO25Q"&aH̞JkHy |4t&ȃ|jtQ L7a8CV%:,{*cijl~{\)T>4G0uBs?Qt;~};tTkCfoh iǟEَkЖ!~EQ}}13Rتp+6AiHSgshlTVFu{JC{/`%맖.k秾+е< "-Ń4uI|@u5Ci6E _r3f%pεfQ֊ =SVm{Tx[P~*e 7%kxc @4G$  ! LMo{앫'l4lѥW=6gi5vmb}O5ub[^$@yƢ37s M&:ɴǦ~ql+Rhۓi>=0`лFllS0 \ fʃ6%<> QOv]@\_8bX9_^f-ݛכ$ GlE &=:]n#zIU!NJ9f(Zp^ 5U;vh}]ʽ\n,w )Rxt<N̈́e'"2q/dg:܀FAs s/$B؜]z+EgRlU)$(?=ǯ}1BҼCǨGȾ!l(e=;* {BkJPLkm`_ܷy4ݕIMfo7}'?N!"wjڬ8E}"R09U 6C<~1 "9v.R ^8ּ`M  p%_*z ; :C*8yP7ðQŌWGY^UZC$"mƼe'd$A>HBnwXi3B{¨t=2!f.2NKBV iΎ@hoXP:H6uWڞ5w;s%I̥|>v)eHId9[rqtG;w(A]MeA*~<߀ UNGk{"ELM>W#F+^>C_6[GB=K#rͬ SiZ.~Ô\21 VVuR$ʑӞ')abAr0J- >4~pzz/?pWvs0yocFPT>9-tJ2` YݖFħ,>}w0ҐC ?~;EDtɏ7. Z&\0 VWŌ@>_2"d$r! "{йЋ}fi\W^jpNtR4΃ RxX E4rT'ԯ} Y#V2 xK3؂Ql=`?l ,S#O?G\E O^QIBmybXr0kD_R"]Ug$H )Fu)X%ʲ7Ts|tRj%~a:=aQv%7 ECOvF,рj!F_IfC&wJcCPm*v"/ڐ7GdY }^{vnhHύHࡡu`~ {K7(|[6;ޥG!O[b<<#C+ Vu3rF8@*V Y*?#I-OT G֖\D+Ӈ|k*'mjB vPy8Sph~(TWA=ΩvAqrSxdebam@Lug]'A}"6ӈ[a Y'|m_6myF}-jG囮! v$-Ɓf;x"Gy%۬FCSڂ@oO.IQ_L~Ϛ2fk럙#o_a{Q v7 ZvպSu+}WlFlF͙IL^AuH=myT.AHXh3&*9Q7ECdHa  o%"Dlhn^RQY4w C.\j7>x 1~M+#i7)i8q'TN}[#:SE{b5gR=,|CX?W"^41 L`C{{yifTo8Qf8E*=x'f=SgҞsK>jRr)QhEKYX10Y6gѨnDNǦh#u1vG a.5zhlњ9$>B#PiCxjW ds^ۈm@})M'POU@+Mվ8{^Ko]6Е4(Koʛ}yfd9S2I+sh<)~7Q.\%N?+,mEXSIdp"@[eǡe +z[-.m[ 7OA'H,UfׅB'.vU::~tXyk^Ǘc_nqR~a=fڌ_l}Hn%wje3 <zO)k0Ep%^@y#)7QΪZl)#0"~qd(M*6WǸm{Bw֏aAepWĠc ,PW;b`ZPټp(ogm.ҋ:Fp]a O}D-#prF- 2ONAƾW+ <. 'OOv$BU\`=^DːJۤHA׃=).q@G:jqa%Y<$?Wh g_nltifԴ3c!#t vBoya_\`ސ*u)؈t\`!s( mQf7lm`)O ƶ@$uaofe9%nY#x6~`o\2-Sw]~8 DnE^?NOSaÙf*Rr9$N~B oK7[A ._r`~j#Pו-fRxE }gTv]SR38Ej؛N;\SU;"5 zmż;] Ն"!WUޱT`':,/zs=wֳRMkXmK?]UY?TFS}an| @^pq< JQ]J}&8+8㸖dSgvl \z?bE6E%}(9?gP |Ai涧VouGsHyJ7yyzk$)Y3& 62wS/`ETZ2gq?n7)V4L=Vb4u>]ay6O]VA%lX[uGmi"""rX؂[rnAc^jN BVBNJ"rL+sCXt;DPRutͷϝ9Vmm{aAKڙ0Z!}P<@FvT03㗠$N6f۳E-<kF$\O ҲH_( 1m =D](ٳ9E]'&W}!^| =djf-5񳠛FsI,"".gL68GHO8_B6jڂz fW) )fMH?w4P" JF9 U\Gh[r$ I쟵v?ty mrV>< k̈1PCDb7)XX$2Rs- Y=|9}TwGftÖ8_*}|hj/-7: ŀsO)v+LדЌAҽ^~?d {Lme<í ?Fc2݉ꦈDgg@u6!r?HZܻMB36ř{Zg3!Lz(kiؓ$ ]j a8kE/|m-<(0\̬x$cnynDtZNW#n)$Ēs݇ӃP4}%P%== }D֚A~ 5kze'U&u۸FFE 3(ʱSk3ZO`;4M bnҴh#b9QΝQi/(jbLN"X|DI?j2*t.Q^#gaxt_W/ց![Fy`T$Sy8#ˌz&q"ZHHCvJŔۘ*kکߕ,풛[776XטU6@ 3!c΢G>s.pԸ$è} ~ɘ;!)FhNFK#K"0}B=\[^+ALJ$OI^\hJ8S>{7c{pӎ^_=t[>=rl%fMg׏A <w.#CFsjьvWY8 hJ[h_wx71 IyȐ oSjZ+`yjU97E^'VRS@2Pc4X\rx#D+?̗0 <{it]U0* uw<{&n\0! ]¯Q6Ac? b$<vB!0 W]]y R yV>Dxٔ10^9qH˥y4A_P $gK&]PG 7;mAgU*t3CrQ o͗HDuPiRUZXu(l{܏*2UVP$u_@ .+ zm):1>^ӏ\i mD~Ych?u<ǧ5`b28 (1?[ܔ΂d,J/,]g0EpCˡ2[;DX-* #}w L\Ԅӱ8d<;a])CGzzju%nV9"]Tq;|\ps;J:M$}Y% 7`bN[1D$^b%H&$rn3{zeafq\~·KTq`V2Xf&dRt \&U<:G +cCmU\M{4Yr3j^<:^FRggWb:)Ǯ? }kp39Jsd KD3Ӆ8"IJ09P:Zxy.:s_щN9r<\DΈ ‹Z $|+ j\Аa˥z䮗`L ꓐ.$@ٻ*4ɮf_])rz>z)rP9\mr/NЫgX"/{A QpgٶiEU54o_[:]]H ea' ,JqU"]$]0()zº/d7N^إJN-pW`CBw]TBpKEvvbDt*fy\/7ט!rSR26OAr(MY 6ŹMQaޏ*fOM1IVܶg؛!,ƞ϶NsB9׈WXdpB)Q&/]θbS;i6p]?%8Ћk=wܹyǵ"]@ha`rm>@xG.f$aOۼ!j$pןEA uXt_SlMR$kh"U0yK d48N6@٫rzI!BYSφ!*-_ Sgh .+,b?SE9k*Oqi{o:I+SP.dbPQW5<8&Y)AQ,bIvJqiBuf"`1B/z$]%Ep v[ˈ]H(XR6"=x:5.cm&D3Q77^]df<$K#EIZ*ʶHl{LYxaa^˞g!TQCExUIp6wη+z (`5Zί%\"ڦ~W5$>3c҉Uҹz"iU[ Ϲ _^P,48%|Ϊc`Q|x5%4144~+].2Ӏ~@|v ԛ K,}٤|wu"B%4RPUJ!fԭ8)n==TDY7keJC'钄QWMȓ{[}vB- @pۉ5@u1^O^_O-֐l4g>*՝;ra ƺ dAi;7 _X/o:~SZ/VQL> o|//A!H5]@)`H4\sCrMR+;`>G$io*(ӻ i2P<+0|Wf{+4E M$8'$Ġ zո-T:]`A@ˠo4{͂S DwL{SmPM܋7&igO߱'O! 6OiWaXL~@=AD=Eݔ3ϾLub+b~JCsF#$.E4e>|RآCHX[7s)ҠK&S9Bmĥl]EG' 'f~iz ήZCxsFzO|dH D mŢX6fh/0Y,Erx5 u $!b3?eQ1\ nݒs j n/RsKDu9TKmyG l营P6x=7ODNy bS]t_' l[~sQX^j BZJ4{zJE sQҲP5Kѽjjx .|!eNaZ jvD&JDM`Vܠ-xs$ee,L k s|xM&tj39~d@0N`o9:j{fLd\#|q6H;sW\/KqΑSGtۘ7cVp`rn=arM *f\UMH8s\?΋`97jR |'u)z>pz|ǀ8%΢Ky/jr3j]@- zzֈ܎rVdҷ~hqXx滾hr%\n\f^- 0ku:($֋}@pӄ!7J,>F]cwhPnBCk1xsfH/u%R~8zZ`#Ayɲy AzDt)5ݫGīVL@JfRUOr}ukL$LES0⟽M \L"x<sk4IQ簕`˸_ K պ)DLr@'ݞ=2Mx)Pq\jovi]_^7wdN-#7ht Ӻ4̲#J>u'ƐowV?ho"T%,ҝO2Ebў[bӪթKiOܠ@k+v6V|b_t_/MSճi\uxKs3 '?y:5H?ph`H+nNUk [ ?S)9͹'juHQq/.Ճ[%Ň}rs 2!jzȡ$w%D5b[f݋6tB<+w,%7f0ՎȲyops,:ؾl; yh(fۣ\M3tv?G(F85{><\(.\7溫Ug25 R9Q'nZn|bSX3>J{ #58b5ilp/R>~*CEl4D7ItT$=qQ(kEA~J6fŠ~]虸: ^i@X,TUv)J! (1, FMk6tnjS5{ۢaw.=6Zp#KzaL=Do ttj)dq):ƻϠЙVR5x / FBö|; P]1`QkdIӵ.؉0e<ngmjՒQiժX:4FƮp|>.]YtPMuD$u;¾t+Sn0!w'# B9Zrmc( ,/y4b%piD$_ hl8Ok%(W=8CEwR!L.'X ٌdT鵰(Um9H"ؗHsyGHd&sAh`|URuIa׷ m`V$, Bz8 ѳc5gnLlL a3-COAԶ3rSHoqI,ѯ{!yAb./m?K8-WEatS,m ݂ϿV?ƍC'm0Y CN?RU4Y)N\iOv,>r9Gm )6VHLQ֎jdXf^ x!v@9ܤ>u2OyfW 6i$Y=N 5=(};!^{ 00`Mz$>Z-@󓩸Pn^el'/L y"t4F"q1̹sñaף_|ָsw:`s4=z> G05l]X.g̀ekZ#GuͮV*)G%&ycljr>onv9%.%})s".NlN;jROO2%GwX\U=I8EmQ}kבQ|J:וqܕ>N|R2A L@P&L.y4ɞC! \57̑=pk N&16]rHfEX9=zlDZSoDFA^WDч{spfQI`BqO՗B[q=7r& 91xKh49KliQEsw2PP"Sظ};  )\˴ ! Q{) WY}aiqmC5X.q,l پ-2y k?ȁYj8AQOw3X%f;2.NRlC&$"AYNl>+\#̴ "G0xq3j3vҟ"-^2V}8Irb~ىZ O\El*#e<!jـr*K D7OE0P[=(){˭'M`2].N>!u'E.0W!Ą ,']ɕO{\R'ęX ϹUc;c3Qć k2Eʞu]l2ݰsBC+ǖNgM f 2X$Ed5RjPͻsT:vF%{ձ(wBd5z:>gT"U/ ]( QiZ"1VȳvF_d=i&Xv(.' R;$UrT^j;JG;Y.#V1/ehyC1lq )&YL%265u+Hι~M1jEXyfB$0>b.<¢)8_IQdsUON%⡡5I![q=Qԟ7~gډe$rK@T^u]D:GPPtZFxM0.)^>EQ k\|;cj̵蓕*GERܡ@ :ӕjKe Cjܪ4Ov8 \59H$` $bk0D#@#UkMݎ,/iV0[^o3BI wtipu܄eY3bH?vNF6v;Z<Sd% <~ zU` @aXb%փ(;yѴB)b.(Z6UofkZ˯O$K3vEh@ڰkjhp0]?{u\Tbx!|5Q^8Q9k7&GPan:^25I3>ώ:;PW+nN)T($'R` W&ٮ.ELq\-/K_ rx3P.2%qH,PmۋAB7 .dV`X䞘<''!yɑo/zY0"b[{qe%HR /jȾmew!K}o&kHJ$D>dm9W{:V@V"(wU&7~p!=/#̭I )ŪƞQhBP2>ւ$Eb୒WXK0F}D{+} g*֊eJTejK \c()>]`CK\E*>AR~Eov!;7ts*G "7lD<؅l\.:N>.8`а?'4$ٱIhm'h3T5`)b%6gz߃2#=RD7 Č)3D{UyO QF1?_xh$'!bChux&m_U}|\gğ/S˒i,lOIݖu@lj&D8X*^gt[KŽZvr85Fq ~Z/Bak /NOBю!\3_+h7(/fV%}2,wE%W{q{HQO$fChքD2;IR!2׊;8ٛ_Ąl;M!F:sb7ݳey'o2!O JBA`32ňy}7((fj{$שJj*nI .0y;=l$inke3MBnW[<:!tjMț(Rx'D]-z]`f,Fݬ|]8$ڬ$Hަ//[GBPrkTy>.EZ^UrDXFĐU@q7 (\U԰t{IUyK+翔p˷vI׎gRQkV`I6j_M"mJMIo./XE|'w_U/lSzTIKx*;!TUH5GMw"Ɖd5Dk ^p4^}emk3z]G `.Ɲǽ-nMtwHHgbuBZDe7`q7QƱfz/M}]DD -Y@ <-e'Q =aD'F[& Ng {U#lq}ȖR Bњ#&q}^97 (o?22>sf~(o&#}\inŠHi\6hGK0+/d5R5Ȧu+@[\ЧXzM{"bXE{q/%羑^oa]rƇO}? OeQ_Y .VB(1Yͅ3- y5ҙfY&V)FPAeZby8vKQ4BU#1&(<.BpUu-u JS7XwF>VT{$4^JG"mbqrĢ b%u"m-BLq'Z[@]/t&x=5nqG:R|>G?JRmHqTgM<1O %D lew.1y̾y4n9oѾYr3z~Eq9x7:Y-(S5 %Aү-0Hmoo|9MܓF3q4S,PYpsVoٚa*lK15U^PcH$ٯ6[`Svo6[5y;Ö9J;#KX8iuM\@<؅OR*sN1EOj Zuc-Xդ/r`@0qR|aEs_6{dOQ6L_8Ia&oq3HN\utoS}u`4X02;_93RP2 Ȓ U?Y:!"IGL yҼljL%Gf%i^/DLA`J֮[{rA}-.95<ω@OE1^^wH?!OIZK烱;ۤn)#X$p~ 8F[F.qo8KzJTm|b Ňo=˻߀gQ)_SfZ'N$XjH N7lv4sgNtxCU ƭh'~*RN&av#, \LS~ib cIӣq<&gy~LJvPGRMI-x>q6t`{(ʛM:RUaՀL +v#wg*Z[|Qo ,Mȉŝ9 {AcM XG|oޠn:5Ci]u>,O{LV,l1_WKήX1}<1“U@@7⪅E/JD53TOQ4 -?[L؄FҌM0 Zn+_-M1(apx a0W|lG͋-N:7Y {|^p'ZtVTtѦhe-W N,D4!APw૚3IZ/&G|~^3olbwzXcX7.NAWXx?hqň C;=lˏz z0IIxDwt@.IQg JEfWFu+%EyFQCIO''1*H*.|7F܂GRvx31oqQĠ,*9m< ybTd *C$E4$z{0"7z~[M\YT2"(ʍ3# nߨj 9}?ZSìm}&1~߶D>z|Kĸ_zYemCzmaW[gnB>hu&d%ܞn5jؔIiY@a[?< a>rv^+?Q#M*9MAHv=){{LQ/=O+MEb[MV`䧂+|۬aӑrɽ_$:BB,nf{W؃~&n/ҵ%}$,B^ѬY"5N(okD, ޗPCwx7n`&.8hf (#9u N䍿q ` bkhp3iK?' ^y66p$ L˴dI_FϷFa:FRsBEn*_hѪ+7I@-yN'U `vjd 4O*!z9\'1(eEJKZpM؀ N+qt=PF3ҫ4蝞זsrurjrSGh0(cFn5l/ϡ0iooOu?I5ıge*ŭndb3x %>LZ94đLS9 +8P!MPt6-7px9szߢSI3'#.Ke%=U! 걨(rW]ʥ?7v HuiB+<^Ѥ~(D7n-~d5Βkd\ں#.l>`f %F) ;Gjnc>'EJ-dNat;RvsASveZh|b<;UTFmu݁Ρcfxs*'Mz m0avWGzJtR‚P_OS3ѡrrƿpfuMZ OU_'.0.(Λ4S qer|G? 2X]m!;163WI|2})T򯥖jG㊵ !Cpe_v CUwjt3*pX˶ xܼ+ )爅z66#!rhr I׋V8a'o)ZD5z| `~OUDV\5GKq"R"M*OqQY )I;7mdEs)e9%s?ܧc(OiʗydT6Ul* \l9i1=;e?Dy)ժ*0hUoW)gUw4qcE ;;)2d!L<ϋNxR*f?$F|S>G݅ETu_ta~oObe^}ޮLe~{El$RRbO+A?Ks&1YS+:$a`K,=OPov?V]>[ IkKlxM<] M7&ͦ)0̞ql֖fP#gZ+opٙ-#Tb31B&garsK.\>)ʅb| J-#؍E՘ a~:Zǰn@i' EGP|H8i:.l"PK KlR*YAVv?Z[; WeSnܚJHNLE|XM~/G,r9 x>gk(;ArwlB\Tۖɕ̳04N32\" #G~?9tva.6IW0|yy~#17E?l_.mG].2/ϤvN?pXQHx.MIiT6}?]w)͚Cj2$l]= PN 'xƝX8r`ʐݶ E/uY +ElQ-?<~ț&[qͿ 83CIX20_`(:=;tRk/Pp!6_)Zb $m~,d9^u|KQ`)aZ>DO21ڸSEdU:m5=I ӾӼ5ʅBUኛ-*1ZqN&^Zmۓk Q8ŊP9 OsH̶k]qE2S@[]UWy?\X\`Wƹ$]`()$;lg9f nubobܹs]t6= V&"SzVk4~6IUF,3{M̸k:Ke;6\r@ ٴU#S{ɎR+:(ڗ&C9V$[.c[hUa `1r>U6ŋCD6>gyq7J<̟;wK!U]U(G4MAb xҀi17>o՚jUd(qo҄3_51gb>mSYBwt[(Гw!哘y0ש6#4(|.,VgmKicc97V>=s_ %W*pli޶·Z5p("C\t4 칬$v/;NЁNOg$9g]mK4WˬѿMS#Xeob_i:sy9XyxL嵏5]k9-1&`nr9ZADZzK%:|Vpc{tJ3 O\{p:f( Bj2b(~ϓ#.hкArq;d3ktl헃VV1)_{91iRN놬|Dz2/k#)ˢ^_«![coWm6c⩟v|`ev17}6vaf"N7uVq˕j,IjڧŔ@Nu=#9Dq5k~>6B o{.f]DnB|~FBBSyS^q%q֘0f|w,ދ p4(z)* }n`: lO`Z$ů  MJ:7kA*EUȝ ˋpl!OK͎_ BsЋ1@HY~ I|xm^ahtE7=Inc5 A}X'蘀q/˸uV]3Rz]yz %t;$udnߨW}fFRAC*jD.8*@qa@WӨ7) spQRj:ŶhQOJ? E\7;4k:ԏ"z3Pw)/Ixwyɗ-Bv]?Mr;G[5TﰅEPQq[ڹ"JJ^1 A܅XT5s h]fLI86vYf $򣄻2Q|5\}qvӃ: Қ 8m.\>Ȏ(9Q7f~ܽyJMuvU ᮙ%s&%t< PR0lj*|Ζ>eg(י/`bӢ:M1oq)Z7Zu˧&YTgU}5b4=Aʱ%1Pop&_ɸ;!(#;M8LͣG/ ZOUU{ڀcգD>GN"! xב4Hfo3xvȱy6bF\sYFX-{ZC#B٨@b֞L 崡9UMš%R(pW뀠#yą暕UWmADȧWqpNqY?c en9'wu)PAȂ:U4 ' kI`J7)tPւr1k~VM83|JorG tnX!K6aCʣD٥ 쳥Y.<}VN e:!4'%~ Q!h@Hҵ3 oV"8,¹I& j}9hr_@!2w0cPo&O2CS<<m @d w~Ж@X'j+!Ҥ̡șKcJ~ibkSap%|smTDco^z2FPXNb%6omEr dEOa&:H1֙b2(ڕ ?GNo/Z eԚMWTU,tĦVIF d92bɕЍʴLQӾ/pch-..8(dmwfTnlHP}1}31 ̑fZh/Ax UR&ZB0UT۶-/eJګ'XJ.\{iheĽ85Cg!FҶX~yS25EvX):@u7m cKWhxvDW^r[PU\hDzگGG~F*ԇhp=1`Hy q%MTY3TEqg"4cLbVnxD$h!qZR .ݚXNF1N}6$CFGd`2>-н%]݅w5A7궶eX}W;3Zjū-03˅#%4ʥ.#Na!vxG `bOoH;!}切Lq'"Mwc2F^8,Y KJ]!/(~gxjJ~k".y8T,w '=%8(uQnpOC%YN.63/} ^C|uu-PyU,-{z:/P{}<$>sWc)hNMü{K4p/|nywTW5_KağL7VRO@kP,®8A,IJ_Pt-@Ydn a\Aϙ|o{/^ 8 YұZ^Ò}b±-B T<2t}ȕR$cX%c@H<N,7Oq.qʀ\y=/phdiCpDa 9.7.rT lӘv\j@qyc[] c(xQܿfWl A,R?%02"J=:7|t/%FN))}IFqݣeP;Fbe?(1b*MQ%Ȯ6Db7^UAPБxx`TI hg%\^’Ը Pi$=sZnZL0 4C@/sv熹4Mpvڸw;?i #8% [Kpޔ/:[MlNIE=r-w ]e / zfW:!%8H^ EE/G2DH8z4 MR,>lL@\{D֗7G@UX$:4>ꤖQ^pgn;wU 腋{,L ACI㻥t+O>χo)*sQk?ZI:DlYt*@ _(i|2(~%BhIUrPz=R#y%D36^i:WC#gR|{t? !>QXsH"N9.wBdB@,f p/G \T9aW-c~AcL݂-_ J )luZe4wx_o.a }d8 ;664i,MH˄;Һ-:>m~Űkar-rdu_>Gr8@1Ia,˻K__l[KxQ~Վzp;O +."3X*C( :zVʔ0Vx\04m%(ĴN/$`aw,)9Fv[@2I8}󉀽9l4̊BB-Ʊc7b{#)^ gJ ^V*HpL6=Dv1ZHVS=+F͉2"m@nbh0֒ik=i3̯A3sׯԳMaR!>UF2Ծ.v3wJU*z@I#Ŝ釵 \pMJ,h\1*Qy;~=x_V ?kQnVržx[4LvD~6 T!1j>'dhܬ r-=.sp$\P^Q({* K<~U#6[r; %hJlښV1A%g>rAh 2ۦS3/utr٦iT_6 .DaCbsnTJ(˞=x>G3Pg|Dӗ9_&@ =3H֤zd3i#wəC8/WO)iGJ*.ꕄL zD]xtfyJw?NݼJ;q \5 "jz4U e^O<!ִOF%>lvYx/`g\;˱ +:XfH sXϳ)Z\Hڷ I+ؒ'gp D;☦-Naq4phllƺ9)$\v h.ñK!Q v.XH%Hq^n]J |y||%.ijA"A_nEեS(؏0&!͗h#rJs&_&W=ISL>.9&vH/\3n1(ji&Tr^cȈ1\t~HxGKDW1II ;?^?56T>鴇?p#4$+f"zAv? ?)zRwԲYOwE80`x2m MWx."G$dsNY 6l{yME-MX7)*X)cF,U.wAݿKHE+|`OYXj|wbX8!T$(GW2?4GholGv1)y>ljv;e>*e}wTq, "G<I1}fC&P{ Z"USq7jLעC BJ2>YzɁ "Xke6]teakI $(`Rr/P X}VʌllanN~ȝiNSM0ZI vlGý.:Jg JV؛be"3^$vsBC]CY2gjxK'Zdo:WTJL/4k)/@ ״^=2dgDѦl.KlV*.1iWRvpD2 zFx`e>kkDgtYbBK]7y(_DaN].[ёj彫"Os(ɐG"(M! K$S{nf t,H:BYEf傡e;nS>̔vݷZi):x7 A(d{t\G, '?zQ*]!s[F`:~Wy4[\al>Ӯ6Țmҡ9PR+m$_2br^V(23K^^$U1U#: S +^fD@lx:m5L-k8HϠca@I=n/Q!a='#ޤ)ٖ+\cvbL^~TBLI쑑,a+2˛[ *]ɴϑcȼfnu`Ҥ I9?ʼȭM^\f?)ϥ}*dD-^$`19.-~[ &=vﬠY/,HT+֊\&~ZAHglJqRًq/Ltꎳ= zGջjo mP}-X?@z0\8Ucq|*v^XBǟ&Kӌ5P_ΐͤuf;^Wׇ"j`=ԁuh K̕jaD ;- JGCjؗNv Zui:ΔbN3VScp}Zd)on@]}RR^WL\?ƀ/`c `S>>|jKKܳ(7Yg)CJ(7dI=e_n/Jr8@Pa{= Oշ.]-OɵVCjWBpl>+'GiN!`Oo\2V/*оdY*E) ˨v;7{hq|r{5u)h=gY/Mߞ\;0H.Eخ{ ?yo6ْ̊Eg\ߑZ μ[_u(SO.vDx-UWUEo. 7 &o#MC}G@|4}(0&\7V:w4Vձ?S}'gf~op}nKفHd-\O,]gQWw2 's[[RDz==tuKH#=慡dI+ATscҩ'@32,]\qLV{ضa%)ke?1 qAuSjͥYm|"cM=;ӑd:`J/F7w\BxF');6T97u=nXV!MڌۺvJNP,zym.G@m4 8θ\2/?CA ,QC$Cx0R,B~(,![B|Q猛N_ ƤbW,7W: өYYVUv7vcpj=}JB%q$=YXK@{ZN$ "\`_iW^*ePyPRf֮Z25s椊խm90eT;: xƛ>MYyİOxvb;:#cŶV۹oǷ:p2ˏ!ء/ngFF#vQ& \|I"M/ivD|Si_ Dv@P<@ v3xkjSZnty`R7gsp)"{2PzWGw/IH3a9>OB|\M=mE'>JMq!uDX?wz ۺwȶ<-c,¿ %:e"2鸨l? u<3rю= @\cBލZiB-Z]R߱2;a)ύUG.'f CT] 8f_LiTİYri*}:i7hqy‚q)…"f_Z1s\+) n4|p{^ #iO!oPEGEcaEфT]A~@ޕL]gB!xAj*X Sz-V;wn"Q[LhU..d@<.hy:/cV۹OΓG"kpV#ۦ'jB2tDLω} J﹟YL>G(kW$cWdQ4phu s<7Pe"XUL ەۀճIkPܾKK"&A|2u!(ZSc=VU8LZ31]_6ק}QmNBv*de[r> T<];b~;]uS<~(>͖ XU7&'E?U)0"-M5s*x'ԿGviwt^`etJMxwm+?u_ziZOHU7O"= LJa)ZWpVw+,ͣh Eá o 뛕^XYW㎑--hg SJv<,W_CSwT/5Ŋd[W &̭?@^K E}i"k#+gl$b@>'\iCm-c(W`-a3pHiaaWd"@DzXO.Mn,` ܾ) aCd6[[*exqQ1/p+6xotm2> ,osbT_9rR>aHζlP`"S4%&}3wxQ‡9 |8-#nmcfgL5ԿY^ ;{IY,v7ɜ)He'd[p'ũMGIe=!XlosB)UN\vV-,pe^ha_{#{:wvd *eiZH݇/\;DHWH ^[ ' $VT~u/lnvA㽘A(³,ι"vu CfB8 ̼"At s^ 9 {ްõyR ÓG8pglC@& `F'8~Wv]LkDPM>J.?*g"\pa F[޽@τ^yh|)H΂23@Mt}(.>=l Nr O:ܳ_$ r(vq?8bT\:%4TF>]GT]G-+|:p^P\h(kq`5EXf&G8.GSpp d)U YM824W7jZDJu+,KG"-sQī7iBLH.OE)T 44tSͿ0FjTM"3X;m^o~I @ҁO=+݁U2dH? OflSBh4vu tm.׉SPj_GBt_?g 5Ӥ]Y)sH| ([badsIU,0|g˃*!B( C=2;4MT8%,μycRC0%X5"9.R =CM]v|Ru}$ST͹Rt'$Ll9g-`]$p1;5`ª}Z6=8k ~0s``Hwht} UӄO~9l-lDxڸfGO$h;tR(vzeX bu7Wp &Beh=A;< MJF}{H" u$L-Z1p"4TH^ MPptsbR1n\{Z,X@k SY|''{^mKN1+W !Pu7Зw0% "d{[ 㸼6 w5Z&N;xY!ּ/2$Mv)fL{+^ ,}|0&kz֝CB_M.*49: eMRAL;ʴ tF~|`MI$=D@c]1'xXD7o: 0EsP&TΧ<'rwC6u^:}S5@>2OZ.@jKH[9`?k>n1h Uk\J oJiqgiע0~FS1BC,GᏄ/=Ι&%A>$B,pF:jm1. ~r_oaBx`Ygdz\2j|4 ^s +tub?OPb0\iJ3 , 9;Gۋ7]uKxKݦbq[pC Aںj[Lje3ȩLUP;SJ@ O̐“k,5T*>ۨJ.FXpoF(N  /v>!<{nĎpJۚ +Wi~ ƖR~¥}')vhYjLW dه%(Ҿ\͠rh;Oݎ~2`#M{*V~?CN?*d%yñ՞v A&(*+nX-[>ϼ%կ:$ـL>Ц굷!oǾ ^Zz~ VTM>{ 4-[YiI s"²(Ԑb +*Lauy./(p42st5џ3O1:.e`&<د||a}pG?MaгS)5VV+.0ϼU9⊵)(Vtf;(sd;><;_DQ:,\Ji}Z\O}Iot e⒂YIFauk y_EmS\Y4yvbyoYH7e{R/j i75-n.oB2*Qot $BQ̝j`Ix6Y+]˳9Zw]?ծchqVQ>1 -eGƹ2'ڊ m>]juX#t $~ċ* vH$\!Lu^1}r-~oGtњNnItj ˌk^Xuæ۳Y!6IIAαZg;QTQyz.`lD7HGf_yiGЉ-v."pYQa$@"&uċ|6 nB蝃r.rj4|=N?XnVHB^ . $u #$c_Ge\K,kIccj JkI i?d ]D?+kK]KBҍKOn-|,ѪWjլuN] s ܦA(s&ӽ"b:PY*j`W"7%|~^;. +@ze%EK<1k9zI ^5J~ EʎTܜvƤ%#q ;Ƀx S!s*[7'_)8Olg rkE^J<j׮ p1ڂ5ipS~иt̲4קH)|}hճ11Qjp$߸Ȍ&^@#}si V+'c~u3U |*`J %3Ä N[5F<']<O@ي>cf4\8 JR+IV"Ez}*`٨եAlnNɌǕ1Wvj 1hZn3F:/u2o׻2 _nK&~KBԂ;H~>x, r_)\d.QuJP3/=CY39rJ][w&YH6Y%9F :@UЁ/}EE|%hOxy|a] i jXk1  ?V#FDal7zpPSw~._O?mYT5ҽoVl6_Y藐ІGGC uޓon?IXѨ5祥)v!&+pK/:2OULm̶YLPAe⅝!rOaר&C%\$>x1ehNZmM}&KͥߑI9:8s6FC͍ I ; YZ