,PP @ @ @ھ 08h4Xn @   4XQzh$PP @3= /mntn<n>@`dT 08h4XQ @   4XQzh$PP @Y@`dT U4Xn @3= U(hnhA 4XR4Xnk 4Xnk p З(A4XR4X]G4X]Gi`IqA4Xj$s4Xj4s4Xj4s ;&VcA4XR.}4Xk 4Xk kdA4XR6=4XR8C4XR98pl[ 1A4XR98p4XR;34XSmr~A4XS4X_'c4X_'cnWynA4XS4Xn#*4Xn#*og,tA4XSw4XSu*4XSpqR\A4XS h4X`#F4X`#FrJ"A4XS X4XSN4XSIs 3DA4XSI4X`98p4X`98ptZA4XSz94XSp4XSpul ZA4XSu*4Xk4Xkvڟ s%`4XTI 4XZ054X_'cx ,4X_/q4X_/q4X_/qw^4X_54X_6=4X_6= 0)4X`1-4X`1-4X`1- 1t34X`X;4X`X;4X`X; 2A4X`沀4X`沀4X`沀 3ZSI[4X` 4X` 4X` 44X`84X`84X`8 5I4X`#F4X`#F4X`#F 6^ 4X`*T4X`*T4X`*T 7R4X`2b4X`2b4X`2b 8=g4X`98p4X`98p4X`98p 9h@m04Xb4Xb h4Xb h @ H P :mD!4Xc4Xc4Xcx!4Xc4Xc4Xc Wv!4Xc 4Xc 4Xc#*B72!4Xc$s4Xc$s4Xc-L>!4Xc/q4Xc/q4Xc1xˀs!4Xc3B4Xc3B4Xc5 [!4Xc7n4Xc7n4Xd U}!4Xd4Xd4XdX;F5!4Xd !4Xd !4Xd?!4XdC4XdC4XdWwkq!4Xdp4Xdp4Xd9"H!4Xd84Xd84Xde~ !4Xd /4Xd /4Xd"ܬ!4Xd$[܀4Xd$[܀4Xd$[܀ {t!4Xd&%4Xd&%4Xd&% G$S!4Xd(4Xd(4Xd*QO!4Xd,4Xd,4Xd.} /Z&!4Xd0G4Xd0G4Xd2R !4Xd94Xd94Xe沀ww!4Xe4Xe4Xe沀wVBV!4XebZ4XebZ4Xe沀w!4Xe,4Xe,4Xe沀wڣ!4Xe4Xe4Xe沀w>.a4Xe64Xe64Xfe}hra4Xf4Xf4Xfe31Da4XfĴ4XfĴ4XfeX!4Xf h4Xf h4Xfe6-!4Xf沀4Xf沀4Xfe60r!4Xff4Xff4Xfe6?9a4Xf*Q4Xf*Q4Xh$sU !4Xf,4Xf,4Xh$sna4Xf054Xf054Xh$sI!4Xf24Xf24Xh$s^a4Xf7n4Xf7n4Xh$s!4Xf98p4Xf98p4Xh$sA`a4XgbZ4XgbZ4Xh$s@;!4XgĴ4XgĴ4Xh$s(a4Xgр4Xgр4Xh$s !4Xg S+4Xg S+4Xh$sa4XgI4XgI4Xh$s0!4Xg4Xg4Xh$sԕ)+a4Xg 4Xg 4Xh$sS=!4Xgp4Xgp4Xh$sqa4Xg84Xg84Xh$s!4Xge4Xge4Xh$sTa4Xg#*4Xg#*4Xh$sk!4Xg$s4Xg$s4Xh$s*a4Xg)'4Xg)'4Xh$s d!4Xg+4Xg+4Xh$s 6a4Xg/4Xg/4Xh$s `!4Xg2b4Xg2b4Xh%  :Ila4Xg6=4Xg6=4Xh$s <!4Xg8ـ4Xg8ـ4Xh%  t$ a4Xh1-4Xh1-4Xh$s k=!4Xh4Xh4Xh%  꾪a4Xh4Xh4Xh$s ut!4Xh !4Xh !4Xh%  Ea4XhN4XhN4Xh$sM!4Xhv4Xhv4Xh% 'Da4Xhܓ4Xhܓ4Xh$sY!4Xh>4Xh>4Xh% @Ja4Xh2b4Xh2b4Xj+o9v!4Xh4s4Xh4s4Xj,a4Xh8ـ4Xh8ـ4Xj+Y>q!4Xh;34Xh;34Xj,a4Xi4Xi4Xj,(n/!4Xi4Xi4Xj,|_a4Xi !4Xi !4Xj, U!4Xi X4Xi X4Xj,6a4Xiv4Xiv4Xj,h!4Xiz94Xiz94Xj,owa4Xi>4Xi>4Xj,5!4Xi4Xi4Xj,qzAa4Xi4΀4Xi4΀4Xj,K!4Xi(4Xi(4Xj,9&a4Xi#F4Xi#F4Xj,t!4Xi&%4Xi&%4Xj,*Ra4Xi*Q4Xi*Q4Xj,(!4Xi,4Xi,4Xj,+a4Xi054Xi054Xj,!4Xi24Xi24Xj,a4Xi7n4Xi7n4Xj,1{!4Xi98p4Xi98p4Xj,Q]Da4XjÀ4XjÀ4Xj,&!4Xj,4Xj,4Xj,Wa4XjX;4XjX;4Xj,Ķ!4Xj 4Xj 4Xj,6a4Xj沀4Xj沀4Xj,+J!4XjI 4XjI 4Xj,x[Ca4Xju*4Xju*4Xj,I!4Xjׄ4Xjׄ4Xj,ݻLa4Xj4Xj4Xj,s!4Xje4Xje4Xj, h4Xj54Xj8C4Xj8Cj4Xk4Xk4Xk X'WB4Xk S+4Xk 4Xk ` h H-4Xkf4Xk>4Xk> p$ 4Xk4Xn'4Xn' x4߁4Xn 4Xn沀4Xn沀 /  04Xnܓ4Xn 4Xn O V4Xnk 4Xn4΀4Xn( >Unh4Xn#*4Xn$[܀4Xn$[܀ ÒECNp)md&#ozmZڃ8 $BqmFan@]pöGb#bpV2F^<oBf~|Oϋp:@L.rrDoePJUJcNr(6ϼ6u-BHqzZQ%q 6fgv6S M e,`-7sWfcC|Ȥ3=  . .. catchmod cp dd df edexpr ln lsmkdir mv pwd rm shsttysync tartest[Lwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: nobody:*:32767:  . ..zgroup0{ protocols,|services', ... ... . .. disklabelfsckfsck_ffshaltifconfiginitmknodmount mount_cd9660uӀ mount_ffs mount_nfs mount_kernfsuӀnewfspingrebootrouteumount . .. .hdprofile, . .. bin dev etckern mntsbin tmp usrinstbin} .commonutilsz.profile', .upgrutils,0upgrade . .. bin mdecqj sbinqjsharej . ..chgrp ftplessrgetoptgziprmorer sedtsetr . .. . ..chownHchroot installboot . ..miscj . ..~termcap/bin/cat `8  @D, @'-$+#@  / @j / "%8 %8 @<@s@R`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h!\#p`$   ǖ ? $      \ cx       ?@ ?# @!  ?\؀! ?@ ?# @  \؀       \p?"  #\#`?@?# @!  09@ ! 4? ?c @ ̀@ 0'@@@ ̀@ ? ?c @! @ 0@@@! @ #d#h0   #d#h0  #d#h  Ŕ  ' \? "cp  (    \#p#pܘ@#\#`?@?# @؀! ?@ ?# @  ?Q@؀ K?@ ?# @! 2 9@ ! 3? ?c @ ̀@2 %@@@ ̀@? ?c @! @"  @@@! @# #?B ?@ ?# @!  6 @ ! /? ?c @ ̀@ # @@@ ̀@? ?c @! @  @@@! @    #d#h  Ŕ  c ?   (]  Z 䀢 "\cpcp#\#`  #d#h  Ŕ  ?`?2 \  (9  6 \cp$ -#$  $   8$ cp ` ?\  @ ! ` ? \  h   \ "c\c"#@`㿘\#€ 㿘\# "? @㿘\#  € 㿘\#  ?Service unavailable㿐\#     ?1 !  @' *`:`J "J %s: %s not compiled in instbin-krb㿘@'@ J 2@@K@@[j /  @  @ @ "@C "    € Z# b@ X@C@ 㿘 ?@?`Usage: %s ..., where is one of: %s㿘Z# cx @X  @ @  'Z+ ) @M@  O4@c㠒#@@`@ Z# @c@` gzipumounttset[testsyncsttysedroutermhaltrebootpwdping-shshpdkshtarpaxnewfsmvmount_kernfsmount_nfsmount_ffsmount_cd9660mountmknodmkdirlslnmorelessinstallbootinitifconfiggetoptftpfsckfsck_ffsexpreddisklabeldfddcpchgrpchownchmodcat㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@-\  @ b` #%\ +\#\)\'\ @6h?:? 81Z* /l///x/////////////////$%$c%c$%#$c$Z#H@  $cZ #@bp@ K"* @\# \#Ā \# \#  \# \# @Z@Z@ː#H "\  @Yb@V#stdin-r%s㿘Z"\  "c/ - + )\'Z%\Z" @਀ @2 `@ %#  $ @"@ 2%6d 㿘   'ZZ#H ^ ? & @Ő`& @?` 9 )\\#  2 H?` " "* `@ ? Ң\# \#   #   a@`` @2  \#Ā H?`"@&  $ " $* $@ ?" H +\\# H?`"@& ^`"*@ ^@b ?H?`"@& I " I* I# c ,H?`"@&  M " M* M@7 ?jH?`"@&  - " -* -@" ?U [!  0H?`"@& ^`"*@ ^@ ?:  ? @H?` "@ *:  "  "   H?` "@ , :  "  "* ` @?"  @ \  @c\ "c ?6 Z#T @  @X6b㿘ZR"\  "c+ ) '\Z"%\ @J`  @ 6  @ $ T`$ @T`"@ 2buffer8ZR#V\#  %\@ "\\  `@W؀d#$"!\\@# $#  @WגcH%\+\) @c @ @ 6 @W’"@ \  @Hc\ "c㿘@$HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_read㿐@{  @ `    /!!K@䚔ࠔ^ 0W* :L::::X::::d::p::::::::::::::::::::x::::::::::::::::::         "*?J@ -KJ`  KJ` $"@K"*`& @@  ` @,`2 "@ ? @ @?А !%.$@ . "$.  `@VJ   `@+  @'  `@+`@%O   @VĒ  p'@&2H. 4? -* <==<=<<<==<=<<<< @'T  @p @~   @g @~Ͳ   <@m`* .2 @0/ `@~    @Voa@usage: chmod [-R [-H | -L | -P]] mode file ... 㿘Z#@ךa@ 㿘@,$Id: chown.c,v 1.10 1997/09/20 12:44:29 deraadt Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_read㿘@  @ bH\  8J  o`?"cȢ  /#<+\ )\@,P?E? )>* @ @ @ @ @ @ @ @ @ ?@ @ @ ?@ @ @ ?@ @@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @@ @ Ȣ  Š    %c%# @K"*`& @@ \#̀    @*ŒbX2 `\? \\?"c"\#Ȁ @@ : 2 *@@ . *@y @@`@s@`@$    @U !)3\%\@$N. 4? 0* AB8B8AB8B8BB8B8BB8B,B,\#̀ @&  0 @) "@|Ԓ  @  "@|˒͠  c @.lԀ  \0 @.Ԁ \#؀ "@|    @U"b@̐%s: invalid group name㿐N !@! \ "cԐ@  b@TJ \ b@* "#ԁ%s: invalid user name㿐N !@F \ "cА@Ԕ  b@TҔJ \ cx@)ߔ"#Ёusage: %s [-R [-H | -L | -P]] [-f] %s file ... [owner][:group]group㿘  8\#Ȁ " X hZ#`(@@L 㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@Y "#  9"5 %Z"-+@v ?O? *H* FG G G FG G G FG FG G G G G G G G G G G G G G G G G G G FG G GG G G G G G GG G  ƨ   ¦    &$@U$%%c@^K"&*  @@S#  #  @)a   " @(a8# 2  @- !"` @,F * 2 $ @,A`?. @@C##! a@(Ҕ`H@!!@5`H`H $ @$ @ .,`H*! @`  @ !! I@J /"@*@ @! @ @$ . &@ @W .  a@S <  3  @@ * # 2 @#  @@(8@@@;8@<  2  #  #  @?@%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8@!覒  @R )!! H+!! I/<-@"f.4   ` `!@"8"@@zZ L HV2 2`"$@S  / " @b` "$"! DL / L? / /, $#,"hH @%`@,`@! I`@J /%`@*`@ `@ H@N?2<- @2<@2<" H@y<  y @# 0s      " H@yܰ 0c <  @" @[@Oa@I(@[@]`?Y #  #  "@y@"ݔ 4 <  H@a 6 a@R H  . "  a@R  H#  <@ 2    H<@+`0# <@p`? # <@@`? @2    @Qؒc4   @4     ?`?%soverwrite %s? 8  @~ ` X D <# :Z#``!@۔HZ"`? "`@ Z"""  Z#Z" y`? &`@b`$b @`  y Y!@z ! H$ ! H& @+?   X!@x`H@ʐa \#+-!@@@j@2`X`X@xǒH `  X@x   @@8 # @̒ 2# ,  @@ђ @ o @**@  X!@x`H @s@q  X!`H@x readlink: %sunlink: %ssymlink: %s㻘 @$#  ` *<3!@`H # `H!@)J`H #@xK 0 #  @ <mkfifo: %s㿘` 3!@`H  #3!`H@)   @x&`H  #  @8 mknod: %s㿘` 3!@`H  #3!`H @)  ! @w`H  #  @ utimes: %schown: %schflags: %s㿘   -6 c "c @^#$  $  $@X#$ #!`H@( !@wȒ`H `  @)   .`! H @)  . !!@w`H   36 ` @)   .! H@)  !!@w`H .` " @) D  .0! H@) D . - D !!@wt`H lchown: %s㿘!! H @)   . #@w] H  %s %s usage: cp [-R [-H | -L | -P]] [-fip] src target cp [-R [-H | -L | -P]] [-fip] src1 ... srcN directory㿘Z#` (@X@J 㿘@Y_HY_lYbDY_Y_@@Y_Y`Y` Y`< Y`H@@Y`hskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈""a"8  G"`#'%@~ ` $` @#a`@ =2, @#` L ` b @#`'`  @ܖ#0 @# @" b@@# $@  "``@"@ "!` @@v"p! @` @#b  @#b!! ##,"@`#`!` @"#"aa "a#"a @#hb   @#_b""a 8  ! ! @#Mb H ?#@c  H 4  !` 8 ! ?#@jc ! 4    `   ?@#c@㿘@)@㿘@"a"8㿘@"` 㿘@ "``@ 㿘@""a㿘! @ܐ"`8 @㿘! @͐"a 㿘@: 㿘@(: a paa qa raaaa ma na oaaaaaxunblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 .'D#!1D@Pb'   @# ! b@";@! b @"2 &! `D"!D ڐD㿘@2@%s%s: illegal numeric value%s: %s㿐@ ? c(@L c0@!J k m b".  w . . .  'J x   *2  @f!@ " cP@!  c0@!㿐@|Z  #   c(@L c0@!J k6` m b 6`. w6`(.  .` .  .` 6` .  .`.  .` 4,!@&! 'J x % ' *2!   @v 4!@!@ " cP@!5  c0@!0㿘! ,` ," *@`2 @!#`,`,$ $  @ @  $`, $0 㿘  %? (`   (  2   ("` ("`?@="@ " `("` ?"` , ,`" `!)/+ 0 ( h! 0@8ᔀ ` `   +   ` `  +  `  `0*?" ` $?$  ᔀ`" `   @" %`0 " `0 %`0  `0  ? $`0 2 "`?$  $@ $@ @ !0   ( ( "㿘#`0"`0`h` "`!!@"@ !`0@!`" ` !  0 @" a`  "`㿘!  4 4 @ ,@?? ( (` @ <'!!+ ( @? " :  " ᤒ@Cᤐ$% $`$ *@@ ` @h ` @  " %  ϔ 0 0@"@  ( ( "%s: short input record㿘! 0 1 0 @r` 0@? ( 2? :  ( $  #aa@a$a$a` "``"` *    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx㿘@@73"  @ߒb  @ےb4 @ la@ya??&a@@q stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘`@ `@ 8"`@"#`@`@ @g $   6 `@@H`@@ ("!   < 2 @`Ha a " x/"a!!@"&@6!a "``!@"&@&!a"`` "`!! 6 `@@HE@!! @`8!`8 @? $? @H,``("! 8` *#` @   "`(!!` @@ $? @H ` ( ("!!"` $ @!! ` @!  2!! @$   @:!!"@K`!&b  V! d*  * (!3 U! D*  * (!"!"  Vd*@ `* (d UD*@ `* (D "a@  @A` h `@@Gy <     a@Ȕ     @a ?  .   & 㿘' h#53 , D1- @ ( 8) `h a@  @`,  @  D@ik%+a$ @  @@G@@n@@a a `  @   @`"a@n@a $  @ $  8 a& &h $h"$  $  @$  $  $a  0"a@ % 0a@@  0`, $`,@ے   $ !y㿘!"@!#@t !#@!@!!   @ ? " a  a " @! " ! @ %s: end of device%s: short write on character device%s: short write on tape device㿘! !`!3! h-!)a@h4 . a@I   `@@F)> `@ B  <`!2,` ` $``  $`       % !@m` "$ a@`a`""``   $` !!@W"@ !! "%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @ "@`' 'h #\ dh @ @ @          d@@ @꧒ x x        d  @@ @ꍒ%< @Ȭ#\#` d 8@@ϐ @v㿘!. $ 㿘@ %sskip reached end of input㿘 < < ? @n     @ ?JH  bH@E  8 8`9  D D@Q  * D?%  "a ?"a  @ bP!$   "H@lx`@3    bH@D@ `ƒ D㿐!! ? @     @ ?  bH@D !!  7 '  a@ v  bH@D   !! 4  g` c!!@ 4L    bH@D7 '!! a@ה?  bH@Du!`D ! 4  4` 0!!@   bH@DV!`D ! 4 ` 0`D !!4`㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@%!#Ġ #-+)'!@ ?L? $E* Xdlx$$a%$a$%a%!$"# .! @b@ !@!K"&* @!  ! !@k"@@ 2@ !@Cb耢 @Z@b. '@ S #!@@5  @m@ , >c< @@2 @, @@U 20`- , @ܒ $c!耢 ",  @, !# @j@`@T < 2   !#@@@j<`@j@`@  @ .  @閐 4 &. ` $ ! @0@#@髐 㿐@w  6 , @ @  @ L,  㿘"#  " !؀`?# @&    !؀@ empty type list㿘  N  n #@Ȓ`8 N  o  "a"!آ  @ ,``!"`@儑* $# 2$ @B   @ ,,`*@`$`$㿘!耢 2"# 2!쀢 @  /- ( +)'a耢 ,` ,`x < 쀢 ,@ݔ! ,`, L@Ւ `@a"( "5 0 9 ")("8 9 "0"@ 9 "8"H 9 " @"P " H : 0B %5.0f%cBKMGTPE %5.1f%c㿐?"X B#@Ր#H0"`?##`#P  #`##h@H 㿐   B?'  B?   B?%-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s 㿐$  @   "@ @! C ` @6  @ޒ@ޏ   @ފ@'  ` @6  @@|   @w@ ` @6  @k@h  @c@ $ @5 "'' ch Bch$?@! ! $  ` "@'' "ch B"ch$  ?@$@ $ @ L Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐!  $# @V'$#(!  $'$#`@H'@Β$#p$P@! "$$@#$@#  ,  , 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*ld %10ld %11ld %5d%% %s 㿈! $% "% @% $P@Z @d%!-` "@,* * @l@h 2`@͐` @6 @Y@V @Q@ ` @6 @F@C #\@>@ڐ#\` @6 @2@/#`@*@#`#dL#h@`@-`㿘@Β !#@g?@Y @  @`  df: %qd: %s 㿘@Ж @@. `4 @Z#%@c  usage: df [-iklnP] [-t type] [file | file_system ...] 㿘Z#&@`h@L ffs㿘  #DF!T@"6;?6""&?&?&  @0  @& d " @'?@܆ d?"@" &?@ ?& && &$gL& ȐL@̔ Z@Ȕ Z<&`@r .K lfs㿘 g !!b@"6O?6!!&!&"@2 & "@ $2 & d T" @@ۈ d& $@ " &!  "@: `&&""&@ڵ`<&& &$L&"L@f Z@b Z<&b@  .K ext2fs㿘 $$  " " ;#S@2L? "6F?6$*@&*@&`@)4 $?`@! ?4 @@]@$& &" &&&& &$L&#L@ Z@ Z<&c@ .K 㿘@`vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBENRWb:ers:wnv%srioctl DIOCWLABEL㿐@ '# !#  )'#'@3?? 8* (Lp!t  @ _ $!t!t "'@ V'$!t!t  @ M $!t!t "'@ D'$!t!t "$!t@ ;$!t" %"!t  @ / $!t⬐ ~$b z$b@ "w'K"&* @#at   "at@ @"b#at` ` ` !@"# 'b@=e"!t?`(!ԓ*`@,l8t @ @2@ @t @ @ 2@ @d @ @2Z@Ր #H@@ LQ? @ "b@q`'@b ' b@= `@' 4.b" , `m@S % '@<b?  @   ``!@"3b"@;"@l!@  b@y@}unknown disk type: %s㿘@r )`@Ӕ@K! @K `@є DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %d (0x%x) lseekwriteioctl DIOCWDINFO㿐  "  )@c֐ !) @c")!@c")@cʐ!8~ !W&&6@ 6" b"  e`f@ቔ  .  )[!h"  `&a@:` )!@: " 2&'@ 6 )!' `m@W 6'@lԐ"@ )!@lɰ 0$'" 2  `m@:  '@l" " 2  e`g@)  )!@H %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘.    " *' "*'@b (0@b p0 *@b 0*@b 0@b"reading label from block %d (0x%x) disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCGDINFO㿘" k  "   *!@: @  b@Xc  'b@; "" !W@*  *  @ ڐ*  C0@bw"b "b*"0"!  !W%*! @2  2   @ *   (@bN  "e`e@   *@:bP*b"@@b9& Bootstrap doesn't leave room for disk label㿘`( "&`(&` @ @.!!Ԁ+!J  @`x *JUD*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %20.20s # (Cyl. %4d- %dp. @ .UbD:  * : ` +"8*`@h$L' ?#xB?`(' #xBD? ' ?#xB?`(' #xB荡D?' ?#xB?`8' #xB? ' ?#xB?u`8' ?#xB?$@B`(' #xB? ' ?#xB?M$' ?#xB?@`(' #xB? ' ?#xB?'' ?#xB?@`(' #xB? ' ?#xB?@`(' #xB荡?#? #? #\+aPa@ .: #\#`#d#h#l+a`a@  #*+ax +a @n  "  @ +a '@["`8@ +a @P `8+a'@I`8`"b @n +@>a @f`8  ?`&  @& * & **?`&  @&  & *@iX  `8 @>?+a@ @5`8  ?`&  @ * & **@i5 ?`&  @ ) & )*@i$ ? &  & * @i# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐-`@G`  #*-` -a`@6-a @0`-a( @*`-@&a8`X -@a@`X -@aP`X -@aX ? &  & * @hA-ah@`(-a@`,-a@`0-a@`8-a@`4-a@`<-a@`H-b@`J-b@`L-b(@`N-b@@`P-bh@`T-@Òb ,  \  ?,  &  @%-,`@\`@,`-b@`ؒ #\-##`-bȔ-#@   `@Ow # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) re-edit the label? [y]: #@!X"'.@ԒbH'@&'"#@^7aXv '"@^1m#@#@!Xi .@ԒbP.@Вb`@#!X`Z#H#ZZ"@l L'@zb֐ @ !@  @!b  @{/@P (@l?? %?@?b`$b @  n? n? $@ b`$b @ ? n N#@F!X sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀/"'/"'''/@٬"/"@܄#@܀!X@ /@]"J /bȔ#@fX' @  @  @ 1.@8 # /@_i 0/"@5@ @]a"@ '@ߐ@#  ` @ :`  @ڽ  @ں  @ڷ 䀠`? 㿘0@%`N` 㿘0@>`L 2,   0@ `L` # line %d: syntax errortypeline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐  &`&`/050-0# #@ G 0@~a(2,@@ǒ :2 ,0"!0 $: 6` 0@ؒaH 2(#'!#  4#  " @Ò # *@ '0!P@\ 6`0@ax 2*' +ܐ@က  '@ 0 '@a 0 '!@[۔ 2L@{&`X0@va  `"qL@ "m 4j@, @"`\ 0a@Δ    0!@[ 6`J H6`'"0@>a  `0@6b `@' 00@*b  @j '!&`(0@b0  @Y '&`,0@ b@  @K '&`80@bX  @= r'&`00@bh  @/ d'&`40@bx  @! V'&`<0@Ӓb  @ H'6`H0@Œb  @ :'6`J0@b  @~ ,'6`L0@b  @~ '6`N0@b  @~ې '&`P0@bЀ 2 @@~͐  '@Zۖ }&`T 0L` 0*`: `@ `0"`6`*` @@~  '0# @Z $0#@Z }@~  '0#@@Z $3, g#  H#! " @~" $ *L@[!@ `  @~S' : ' 0#h@Z\',  *@~2 $#@~('@$, @~ $  @~'@ , 0#@Z° @~4#@Z @`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  3!8 , 2 03!H 2 43!`@YH   2 H3!x@Y?  H 2 83!@Y6  8 2 < ,@_ 0& 8 < 2  8@W 4& < 2 3!@Y  @ ( 3@Y! 3!@Y   @ ( " 3@Y" `3"@@X I ,`     3*`"x@X:`@ 8 3,"@X:` @ 8 3,"@Xד:`  <@3,#@XΓ:`   < 3,#@@X“:` 2 `  3,#x@X:`` @&`a`4%3,`    `a@X ``,` usage: disklabel [-nv] [-r] disk%s (read) disklabel [-nv] [-r] -e disk%s (edit) disklabel [-nv] [-r] -E disk%s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] -[NW] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x#'b4ؐc@ @@*!Z#4@c #4c(@#4c`@#4c@#4c@#5`@#5`H@}#5`@x c#5`5@r#5@na#5aH5@h@А  (    *`2 vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsYou need to specify a disk type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. m [part] - modify existing partition. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. ? - this message.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder./usr/bin/lesswIn no change mode, not writing label.No changes.Save changes?Save changes you have made to the label?nFilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.unable to write labelUnknown option: %c ('?' for help) Ƞ0@Ô!6@`0@"b" ', 00"*  `` "`"   ," ', *0,@    6@`` 䀢 266@@  8$  7$ l$, 4 , $ 6@0 6@-!h`0@j!/ZZ#H6!Ȥ`0576 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    (!@^Ӓ@ِ@6.0$@y 0? "H %H * @^2  q/0/10@s6 @m @?* : `nē*`8 @`p8pt,6@v!6@s!6@p!6@m"06@j"X6@g"6@d"6@a"6@^"6@[#(6@X#H6@U#p6@R#6@O#6@L#7@I *6@҄!@Ҁ!,@@v!@r!@@j!@f!,@ @\!@X!,@ ܐ@N!@J!,@ ΐ,  L@67!7@ca "6!#@"" @Q@ϐ6" 7 !(0@! '77!P@ %7#V`p@ w cdL*  R  y n2 VL#d*`@R` y2 0@!b   7a7@ H L x67@x@a 27!@S˒k6-0@Me60`@b! 27@x!Y6@Ѵ!@Ѱ!@Ѭ!7@h"I6" 7@_!(@60@=! 7@S!P46b0 "7@S|" (60@р!@|!@ Ғ,@! 26@n!67"8@wL@6No space left, you need to shrink a partition Partition must be between 'a' and '%c'. Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. offsetStarting sector for this partition.Command aborted Invalid entry The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. sizeSize of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Please re-enter an offset and size for partition %c. FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.㻐@ 9#Z@[;c0 NZ#:` @j p0, ` "G ` BZ#:`P@ZN0ӑ, 2 , a//+:):!Z%:#:` @N, `  ` #@)##` @! p 6 ,  6  @a   e$, $$ ,  4@$@)$: : !Z    #\@:! @Z#"@ :# a0"@ :#a@ɖ$ , @    ", ,      "  ,  2   2, :"x:"!Z @   #\@X2@:! @ZI#@ :#@}b@" :#@qb`$@ :#p@ua$i$ /#D+ :c:@   :!Z#"D, @t/@ ",   (,  &:#@t  , :Z!@Yc$+;);5:!Z #\`  8@C 뀤 @Yޒ# ,  2y@+;);5:!Z#\` @& ΀ @Y#`$;@  :5Z!;#; @]#\ a@ :! @}@ @x!;@В!@@ ; !@  ;!@Y !;@, 2@5;+;):!Z#\b@ǘ o! @Yb#4@" &@@"@@ϔ? @partition to modifyThe letter of the partition to modify, a - p.Partition '%c' is not in use. Warning, need %u sectors but there are only %u free. Setting size to %u. The OpenBSD portion of the disk starts at sector %u, you tried to start at %u. You can use the 'b' command to change the size of the OpenBSD portion. 'c' partition may not be larger than the disk Size may not be larger than %u sectors Please re-enter an offset and sizeError: block size must be a multiple of the fragment size.Error: block size must be at least as big as fragment size.㿀 =b8=P@ 2N:!Z@Xc0,   ' ' ' '   Z#:` @Ĕ`0 Z ` 2 ` @ 2 ` Z#=b@a0| (#D+ :c:@_  :!Z#"D, @r@ ",`   (,  :#@s: ,` +;);5:'Z ` #\`  8@ ?? @X9 ` ,` `     @ `    2:@@  Z#=b@N `,` &@@@" &@: : 'Z` `    #\@T?l?:! @W` , "@ =㠒b@`$`'Z::@@ #\x@.†@-?C?: ! 2 ` ` < =#@W: `  "$@@@@ =@c:@"@ &@$@ $@@ =@ސ#$`$@:Z!@Wc$@:Z!@Wc$@$`$`$` `  2m@+;);5:'Z`#\` @ƚ$?ހ? @Wa` $`;@ ` "2 ` ';!; ` @`#\!@ ?? :Z! @W=c`@` >  @˜` 2 ,` > H@s` !; ` 2@5;+;):'Z`#\b@s ??! @W`4`@`@"@@? @partition to deleteThe letter of the partition to delete, a - p.You may not delete the 'c' partition. The OpenBSD portion of the disk ends at sector %u. You can't remove a partition outside the OpenBSD part of the disk. You can use the 'b' command to change the size of the OpenBSD portion. 㿘 ?cx?@ 2J:(!,    Z#:` @ʔ`0C Z* `  `  Z#=b@a00*?#Z@Vsc0( b" *Z#?c@0 `   *`` @ &@*  @ڔ device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] 㿐@"8@pb #b *@"H@p @"X @pϔ @"h @pʔ @"x@p (@"@p ,@"@p 0@"@p 8@"@p 4@"@p <@#@p@@#@p H@#(@p .->: #\@#@:x@p  @#Z,cH>A` @cH㿐@k " ? "*@" @   *@*  * @* @ ߑ*  @*  @( *`#@    "&@*`"@@  * *   *&@@4partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Only %u sectors free, you asked for %u 㿐 AbA@Ŗ 2J:w!,    Z#:` @`0} Z.  .Z#=b@a0nA#(a @o@ @@   #\AhAx@ ::!2.:5!  F "  " @ Z#Ac@ 03. " @" &@. " @ &@.  < =#Z@TRc0."  b @Ô? @㿐@]  ""* : * ?`@ " *@' @ %s: [%s] 㿘*"B#'ZZ#HZ"! "6 (@n@@+S"$@o ," ? "H`$H*@ @ST % @O?J@ L"*@L" ?@ L" L"  ?@vה#.#L" ?1"%s: [%u] Rounding to nearest cylinder: %u 㻐  /-ZZ#HZ" C @n}@@*$@n / ? "H`%H*@ @R Ұ?@ @J; O?@*<O ?O@O ?CO * O O| y w\.VJ;cd*   ?* : ` "*`C"l@ `8`( $@`(*;O`+`-2'  '!.$ @ "4?J . "`,? #' B '@# '  7#@' …B' +-"'\4?2 '#荡B`8' #艡B#D# #D' …B' @ @Z`8C @m Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? [%c %c] 㿐 @   @Ć @Ă z+ZZ#H-ZZ"@ 6l, @,` @[,?l"2 ,`?l"2 D Вa@m2`aD@    ۘ D!0a@m`a ? % @`% @?  cH?2 cH? "cH %cH * @Q 2  , * @ @&@`@, &@Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ST506, or floppy (use ST506 for IDE)."%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.`@Ť!D#@kb#" %Z+E)EDD *cE , @k&@    (,  (E @kݒE @@PH , `X@k@  `@PH  (, H? "H $H * @PL D6 E`hEx  :!Z:Z!@Pc0@ &@E@":Z!@Pc`@4!0@s . ')E'E%:#Z ,#\   ?䀤? @Pc ,& ,)E'E%:#Z 0#\  ߘ ?̀? @Pzc 0& 0)E'E%:#Z 8#\ !(@Ș ?? @Pcc 8& 8)E'E%:#Z 4#\ ! ?? @PLc 4& 4E!E!%Z# <  4@ 4 4@ 4#\ ?|?2 <:! @P' < b f$ <b"@ E@MbP < <"@@" &@b8"b& <)E'E%:#Z H#\ "U ?C? @Oc H6 Hout of memoryfailed to sort partition table㿘    * `  "` 2  *,  6@5 @2   F@ǒc  `  " `  *`2`$@  *, 2 `  B@ۖ "6@ F@c6@Possible values are:Disk type㿘 ` `|@ G@!0'E#" #E!Z.`X@jU@` ``@Of#H`` (.`ZH? "H "H  *cH $cH R* @Nƒ #" #Z GD5aH58"G .`@i^@ 2 `6 cH? " @N 0,` (.`E @j E @@OcH %E!E.`X@j@`  `@OcH`` (.`cH? "cH`$cH*@ @N{ GStarting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).㿐)G'G!#:%Z" <#\ #h!x2 <a@N0'@" -G+G)#%:'Z"b <#\ cȘ##@2 <@N0 "@" """"㿐 """"& & E&   @  """@ "`  +" **@  @  @+ "`" @ @ <+ "@@ <"`  &ܐ1"+ @" "@@Q   < ┝㿘@cannot seek temp fileout of memorycannot read temp file㿘"  "`|   @2 @ : @%p 6  @M֐ 2H"{b  1# b 2 `" 1 b#" @:1@M 2H" "* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? "`2! 2@"o 2! = @" 9 "#1"#2`? "`2! 2@"V 2! 1@" 1# @&L  @M\ 2H"b@    >  @ B ; 1c*cline too longcannot write temp file㿘@H  @M4 2H" "N 2 &#@#2I! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * D  | &  @$   !@L 2H"b  @ : < " | @ "$??:@LՐ 2I"a @ 0 ! <@ <` @ B <  㿘!@3 &"`"& ` "`  $ invalid address㿘"@   "@@@    "@2J"`@@ ?㿘2 `" 1# + @: 41@H211"c "c<2""c1 2"c1 "c?"c(21#:`@11 "c?"c21b"#1  "#11"c "c2`? "`2! 2@!  2! 1@!I 1#/tmp/ed.XXXXXXw+cannot open temp file㿘" h"``@ ?* 2 1cJbPbP;c "  2 @x* ?"1J@~3b` "`?1@1@K#2J"bh@ @w?@s cannot close temp file㿘 @  1@K#2J"c`@n  ?" 1@#" |  :` 㿘 @~1@ؐ#@n㿘Z"`T@   """"` !P*@``$*@ 1##P*@"#*  ?P(? 㿘22" $"` " @ @Zސ @  @2 ,  㿘2!2$ @"$"@7$ 2  2`$"`$" ?㿘32`$  2"@ 2"` &`$2  2`$"`$"* `?㿘!2 $  2" @2"` $ $2  2"`$@  ?Enter key: 㿐K@*"N  @ @ @: @  㿘22.@d 2@dB"?Ѐ6K(0000000111011111111D1X1l111111111111111111111111111111D1X1l111K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?bad hex digit in keybad binary digit in key㾘N@ 0N` x X26N@`N@  %L 4 N@Q , @?"=Ƞ N@   4  ,    "? ,  ? `*` ? @.  , B 0BN` b B<`N@  %L  ?N@ , @?" N@   ?4  ,    ?"?  , *  *`@  .    "`@l des_setkey㿘  2    @ 2``$ @   ?.  @G M des_cipher㿘`-  "@  .``$  ?@ M * *` *` *` *` *` *` !*` `@".  "@  .``$  ?@Ͽ MY   @decryption failed (block corrupted)decryption failed (incomplete block)cannot read file㿐  @! I / / / / / / / / @{? M  "  . $ **`*`*`*`*`*`*`@2 N  M" @ M"H ?M"pݰ?invalid pattern delimiter㿘 J   2N"`@I B?@%J, : @"@ !   4* +)`` `    @   2@ Ť @  p unexpected end-of-file& no previous commandout of memory㿐    N@w~ap @ ?2N"a N"a @ϰ?0N!x@& )'%22 d@l "̰ g %   @ Z"@G 'x@J?  ?4   À  Nx@w/ap  xN@w%a 2`2pd@  2 h _ 2` "` "&"@@:2@G 2N! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? g"`2! 2@m 2! A?@ =?" h$d2`? "`2! 2@U 2! "@ d@d" L@ L!@ & @     @ѐ   J 02㿘 \ `x [#2` $`b X@, 9@G, 2N! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * `? $`2! 2@ 2! &?@$ "?" x" X2`? "`2! 2@̐ 2! @  \`"\ X*`"  㿘)\3X 6`.@ `'@  !4 !\` \X* `\XĄ  ą(\6   X* 㿘#2` $`" "`"\"x!@ X$ X`? $`2! 2@D 2! @ rcannot open input filecannot close input file%lu 㿘N ! P@a`@P@aVa`  @F/2P"ah @;6N)? !@v 20@yR  2@F2P"a @?0! PP!!Z#@c &newline inserted newline appended 㿘b h`` @`?"h"``2  q" 32%2@N` &` ܀  `? C&`  @  {?@ߐ w?$   @"h `? %&`  @  ]?@ Y?`? &`  @n  "@  B? `P" h    `  `  `P"Z@Ec `  h  "   "`h `h`h"`h"``@"``2   "@out of memorycannot read input file㿘 3+2/522"Q!-22 " Ӑ? % @w`% @`  @d` b `p T ` %` bܒ" @N 24&`p@D Q !. , , , , , , , , , , , , , `? %`  @  ?@ ?%`? %`  @  @ې *,`   "``  p b 2 `"  b ܒ" @:@D 2Q! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? <"`2! 2@E 2! I?@ E?" p" 2`? "`2! 2@, 2! ` @k ` 2  *  @ @D3 2Q"a@ ?  ܐ *@  "`h * `  h  2?wcannot open output filecannot close output file㿘N ! R@ڒbp@A@_` @C2R"bx @36N,? !@4 20@w  2@CА2R"b @|?0! PP!!Z#@!&  㿘(2  C`&2-+) @2@ ```  h *@ @ ?`@2 k  "@cannot write file㿘"" !2#2%S  N@`2  0`@  @CU b@ ?  unexpected end-of-file㿘 J@ ` Ȥ"@@n ?'k '2 b 2 `" 2 " @n:2@C 2Q! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? R"`2! 2@ʐ 2!   @   " 2" 2`? "`2! 2@ 2! !2@ !2 `@r  *?35212-2+22"Q!/2@& bx@J?  Sa@O ڰ  T  % b`" @ 24& @B Q !. -  -  -  -  -  -  -  -  - - - - - ? %  @C   @  %`? %  @/  `@o `bx@``@t  ` *?2 b 2 `" 2 b " @p:2@B 2Q! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? T"`2! 2@̐ 2! " @   " 2" 2`? "`2! 2@ 2! 2@ 2`*'`stdincannot read stdin㿘  9ZZ"7-2+;22"Q!325 ? % @t."`'" @j ऀ U   % bbx" @ߒ 24&@A Q !/b , , , , , , , , , , , , , ? B%a  @@ a H?@ D?%bx? %a  @, a bx@l bx*,`   "``` 2 ` "` @T@A*#Tbc@ؔ  ?5 &? ?5 r bxbx*bx&ȁ%ld \  \abfnrtv\㿘 U@\"x U5Z" 2 "PU"@AH "N ^*`:  \H?`}"@~ 2x{ H?`"@ \ " \*@@_ N`  @cߐ "UbJ 2  0H?`"@  `"*@ @@;  82  0H?`"@  `"*@ @@#   0H?`"@  `"*@ @@   H?`"@  `"*@ @? \ ZH? "H "H * @?  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'D@ 'H2! H@`H@J? r`?$)V'%.#2 DH@"@? s"$a x p" ZZ0$d2"`2H#b@"@ K"* H 'HD"@`'D J -2 `"!#"H 'HD?'D@ 2 "a @y   <     @  2` "!Z@#H@ @ "  k@c k@a @  k@a@J"PV"HZ@?c2V"P "P* `* `* `* `* `* `* `* `* ` D* 2 "! D  HJ@ D@ H H2! $HJ@ !!2@X!#2D V"`Z@?>cHJ  22V"bh@ 2! #2X #2!Z32Z#H5/VZ#-2+V%V)Z"  ` V#b@Mb d @? @'?*̀ "2! `@>Vbb@|  2 ` b @!b  ?4 &ð? "x@J?  Vbb@Y  ?4 ?@a" P?@.  @? ???0`.`Ԑ &̐`@>#Vbb@(   ` &b$  ` b# @Ŗb0 "V"#@b `@>{# ^ ` b# @b Q 㿘"" "`"#'!1%@<b $b $$  J , ;  Ȓ & J ;"$0"" 4  "@ `" @??number out of rangeinvalid address㿘  J[!@ `  !J@  `"J`   #X#)[#%2'X+ `J? U* eghghghghghghghghghghghghghghghghghghghghghgheghghghftgghfghghghegeftfffffffffffghgghghghfghghghghghghghghghghghghghghghghghghghghghghghghghghghghghghe`Ȑ`$`J`!@ ` `J@  `$`J`  ``J!   `@\)  @@ -. " -Xbw  ^2w u& !  d - ^2_ h?^`Ȓ`@[  2P . "K XbM G`Ȑ  .6$`G >@ / @ ;`?9`J@, `)$`Ȁ*`Ȑ`$`@J` *?`Ȑ $`b "b ; "` &@``Ȁ ?` Д @v? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘   J[!@ `  J@  `"J`   Ȓ" J`pKZ!*`@hdn8qtsPzH{(qt,kllmn p(qtrt<uuvwtxy{({}(xqt,|4 `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 P 2@@    @  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 P @q @` @  ? @ } `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J Y2 P @6 @d` P ` @$   EC"  ̀ 2! 8?" 2Y"c+  J[a  2Y"c @ `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 @` &?@  &? 6L?  !2!@T>L 2J! 2L2Z"`͔  2!n &ư?@" 33?"`L"H" 2Y"c  J[a  2Y"c @"?L ! 2Z"`( `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J o2L 2!@SΒ2@!@0h P 2Z"`@\  @]` W`g `G  L`G `V   `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2`P "`P͒ " 2Y"c  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 24"" 2Y"c  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 22  "@ `" 2"J" Z#V@b0  2X"b `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 P 2@d @ ?g   @~` x `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J T2 P @1 ` M@ / `Ȑ"` J2X"b7  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 22w @   @   `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 `L  @   " 2Z"``Δ  ` 2X"b `" @ "`  2Z"`x  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 P @k@ p  @  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J ^2 `”  @] W `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 32 ` " 2Y"c'  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 d d   .  2"@2""@" 2Y"c  `J n" ` p l`2`Ȑ "`Ȁ``Ȑ"`J 2 ̀ ϰ?2! ʀ`q0 J[a  2Y"c " `" @* `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 P 2@e2!J! L ! @PܒL 2 L2J! 2L2Z"`k  2! `&c?a ] Z"`##%2`J g"  p ". ) 9( 0%  ` r"   `Ȑ $`Ȓ`@U 2""0 @@2 . " , ?$, 2 `J `Ȁ  2"(  2Z"`   2""0 J@  2J` 22Z"` "(2`  "` %2@ f%22`? "`2! 2@  2! װ?@  Ӱ?(@ "2@@(2""(2 "b 2`? "`2! 2@  2!  @    2",2@ b0  P 2b, b, ? "b,2b, "b, 2b,  ?"b,2`J n", p l ,2 ,   ",`Ȑ "`Ȁ` @o i `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J E2 P 2@"222"(b,@0"  @: 4  -" 2Z"``!  ` 2X"b `" "` `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 P @@΀ " 2Y"c۔  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2@  JqQ?`Ȑ "` J[a  2Y"c @"    " "` @` &? `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J `22!J! L ! @NL 2 L2J! 2L2Z"`J  2!`WZZ В  "7 2"  ̀ .2! *q"(?0&" 2Y"c  `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 22"` "`  @`   ?ϐ  @S 2""$ @#@2 . "  2X"b@h 2""$ `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 2 2 b$ @ 4 @  0 `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J s2"   Z@Oh 0l" 2Y"c` @] `J n"   p l" 2 `Ȑ "`Ȁ``Ȑ"`J 292  V"@O2` @ 2! /Z@O' 0+ "`  @&`   @ ?2Z"` 2X"b@ 2""0Y"c @?㿘" " "  ` 4 2  @  2X"b@} ?no match㿘D '+)`  ?, "屢+`` `    @  ڀ`2b# #* `* `* `* `* `* `* `* `*?filename too longout of memory㿐 J` N[!@  J@  `"J`   J  2V"bh@    "`J@ !`@"Ȁ '  V"@N=` ?  2c"`@є  2"8`4]'!2  $ 2b"4@e92@3  2c * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` *  ? H$ 2! 2@ 2! = @ 9 ""82""42`? "`2! 2@ 2! "'@ ' J 2'b4 Ȑ`# @*  J 12"4*@@"4 "4 shell access restrictedno previous command㿐'2!  2d"`H ? "`? 2"@ b 2 `" 2"< "&"@@:2@2` 2c * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? "`2! 2@ 2! u?@W q?""@2""<2`? "`2! 2@ 2! 2@> 2"< !*@ J Ϥ32)2/2522"7cc +2-2"<`J !k %Eb@ S   %  b<" @< 23&b@@1 . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,`  ? E% a  @ a ?@ސ ?%< ? % a  @ a <@ʐ < *@Ȑ%J \U<% *NȀ_b@ S  %  " "@ђ 23&b@@1u . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,`  ? % a  @3 a ?@s ?%< ? % a  @ a <@_ <Ȑ`% @* dJ  d9`` tb@ S  %  " "@e 23&b@@1  . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,`  ? n% a  @ǐ a %?@ !?%< ? % a  @ a @  ` t@ {< *@t  o2J! 2@!@J'b@ Z  %  " "@ 23&b@@0 . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,`  ? % a  @P a ?@ ?%< ? % a  @< a  @| < *@??'Ȑ`%Ȧ `J C`Ȕ j 2 `"  b " @~B@0" 2c * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? "`2! 2@ڐ 2! 7?@ 3?2Z"` @?0*" " 2`? "`2! 2@ 2! !@ !2 b<@z" t *L ! % 㿘 " -Z")!2'2+ P  ?x@J? x ?5 u` N  Ȓ % J   Ȓ "J  Ȓ"`  N .  N   T   $ 4 ? $   @F  =?@ 9?``$ @   ? $   @'  ?@g ? "` ? $   @  {@O w 㿘 ` @  ←@r25-23292"c /2 H` V  %`"bD" @B 24&H@. c /" , , , , , , , , , , , , , ? %  @  ذ?@ ԰?&bD? %  @  bD@ϐ bD@R``@@  H b 2 `" 2 b"D" @ݒ:@. 2c * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? 8"`2! 2@9 2! m?@x i?" H2""D2`? "`2! 2@  2! 2@_ 2"Dg"8 "8*@@ *`@Q !A?$ 2` "`2"D   @ Ӕ 2`? "`2! 2@ 2! ?@( ? "`2`? "`2! 2@ѐ 2!  @  㿘      ?  2 2`  "`<9`Z"  @ v   @   @ j 2`? "`2! 2@ 2! U?@ Q?  $" `"`$$$`  6 "  `" " P 戒 "`2`? "`2! 2@0 2!  @o  㿘!    " ` @" `& `"`N12)2?-  & @+ ^$  @ ђ   ? & !  @ ! '?@) #? % ? & !  @Ԑ ! "@ @¢  W ` 㿘!2  $  @  ` ? $ 2! 2@ 2! =?@ 9? @  (%? P "$ђ$$`?&@" "?"` "`2`? "`2! 2@n 2!  @  㿘  `2X"b@( $? @ @" #j `$` W &?@@ invalid mark character㿘[!@   2j"ax@ ?#d.`@ `Ԑ "`#d.`"@ 㿘[!  #d. w@ 2j"ax@ǔ ?Ԁ `*`  Ԅ"Ԁ`㿘@  >  %& @+ 2c * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` *  㿘"  N \2 `?㿘2"L`\ %2 $2b"H@92@+ 2c * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * ? $2! 2@\ 2! . @ * ""L2""H2`? "`2! 2@C 2! 2@ 2H`N \  * 2"H㿘2  2? *  "@㿘2  2? *  "@Oed.hupHOME㿘2! 2k 2? * *@" 0k"0Z`  (k@"8#@  @ @DfJ /" /.*`k@Dvb0Z`ؔ / 㿘2! 2% 2? * *@""P@?㿐. 2? **@" `h@0   2?"b$ 2?"bP." ..㿘2! " N ! l@Yߒ`0 @M /   2d"`H@8  invalid pattern delimiterno previous patternout of memory㿘 J 2"l  ;"::[2*:    Ȓ" J  *2#  22l  :; # 2<#@J: "7 2#` 2" !2@b 2!2@5  $#@*! 2l  :#  3 2"" !2#@! 2!2 ##2@!'@;#$# unbalanced brackets ([])trailing backslash (\)㿘 @* : )2)2"'ll"*`:   [ \`L@@``=" < < , L@ i`L@ @ Ȥ$@2# L 2 `" 2 b#" @$2@) 2l  :#  3 2`? "`2! 2r 2! B  > "#2"#2`? "`2! 2Y 2! 12 12!# @#*$  ` 2#2"l"";":"2 *# ʖ J^" J]"  ]&(8 ![2 J `.`:`=2  J ]   J]2J 2J J] J]@?number out of range㿘&@& J " G @V B? J 9 J, : @"  ?ϐ  @G  @&@#@2 . " 2m"bx@y &@? J g2   Ȓ`" Ȑ & no previous substitutionout of memory㿘 Ȑ"J % J-: @"  2m"c@=  $ J-: @23)2+72"n -2'5 `Ѐ N   %  b`" @ 2.&`@(] n . `, `, `, `, `, `, `, `, ` , ` , ` , ` , ` ,  ? %    %` ? %      `L `Ȑ`$ @*  J@ "?\%`Ȑ`$ @*   P Z"G"   x@J? ` ?6 u J-: @w   Ѐ b 2 `"  b " @):@'͐ 2n  * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? "`2! 2 2! # Đ  " " 2`? "`2! 2l 2!  " `*`no match㿘` "`  s +'2)2` %`@&?Y` | y آ@ $? j$!    ! m?` i?`ڧ`$ @ ? K$!   ! N?A J?? $!   ! ", ` `" `" ``2o * `* `* `* `* `* `* `* `* ?`  S ? infinite substitution loop 㽨'    ؿ ` ` , `'  @ 5)2-2"n +2`"@t$l V   %  bؒ" @Ւ 25&l@&y n `2+b`,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,`  ? 9% a  5 a O?u K?% ? % a  ! a a  ` $ ڮ ؐ@۔@( n$!?l W  %  " "`@@c 25&l@& n `2+b`,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,`  ? % a  Ð a ݰ? ٰ?% ? % a   a   `  < ؐ@i$ L  ` 2`   @  ` #@  l b 2 `"  ؐ "&"@@ے:@% 2n  * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? <"`2! 27 2! P?v L?" l" 2`? "`2! 2 2!  ]   $ 2` 2o"c@Ҕ  ? `  ٕ ! ؐ@ ؒ@o# #*@@ *`  㿐'  A3+2-2"7nn /2N &c \  "`l O ` %` "ؐ" @( 2.&`l@$̐ 2+" , , , , , , , , , , , , , `? F%` >  9%`? %`  {  @ @6Դ@*@`@ ˴r N 0m 9l`l? h *   "`l P` %`  " @ 2.&`l@$Z 2+" , , , , , , , , , , , , , `? %` ̀  %`? %`     @I @6b@*@`@ Y`l P` %` " " @X 2.&`l@# 2+" , , , , , , , , , , , , , `? v%` n  i%`? %`     *@  &  @&N  l b 2 `"  b ؒ" @:@# 2n  * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * 2`? "`2! 2R 2!  ? ?" l" 2`? "`2! 29 2! x  *out of memory㿘3 <33 D@  `d"@* @ @*`!3$ <#3`D*` * "֞`D <*@ *` "֕`D <*@ *` & ,$`D@# 2s! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` @* !3@% <$ <3" @ nothing to undo㿈  3 H?3 L? 32s"c@ ? D  "`= 2` "`3 D@X3 <+` *  +`  +`@ =  +` *  ` @" @  ,"`@ *` `"`"`"`@" @ *`@ `"`"` "` "``"``" +`@ *`  " 3 D `2  : *3 <3 D2  :  +` * ' ''` * @*` "" "" P ۳3`H""`H3`L""`L2`? "`2! 2 2!  :  㿘'3D??!$D)3`D <* @*` 2 ``@ @@&@D??$D3" D3 "`H3 "`L㿘@Ҕ㿘@ݐ  2" @ " 㿘@А  @  &  @ْ  &㿘 @ @2  '"@& J-`?    [*8 ((J J 2 "@ 㿐 ̒  @ & & %d㿘 @j  @x  u(@^  && 㿘 2  `?J   Ɛ "   |&=<>+-*/%:()㿘" 3 b "bL`&L   =u!@D= "L  L <  > ! 00   3"b "bsyntax error㿘 u@b㿘" !"" @" %sh" ROM`@ " @!u c@֔  @ Ȁ ̀ ؀   *@ @"@  2u #@ˣ" non-numeric argumentdivision by zero㿘.(ؐ vӐ  v @{a 2` @`&   v @ma8 @h`& @|d`& y" ? 㿘 v  v @?a  ` `" & L"  㿐Ԣ A ?< :?` xv#\*`@۔         ۬@4a  0^@6[  0X@&U  0R@$O  0L G`?A DB?` ;w P*`@܈         ܨ @y6 4"  0 @y.84` @y(2  @y# $  0  @y`? @y@ " m k? h? e㿘[" #Q   b }b 㿘" #ΐ b^b %d %s 㿘@q` u@c""" "@@ 2ww""@9`@㿘@ lost+found㿘! * aH  @@ `" `  " `@  $  $ " `@*@@   @ *@  @J 2    "  @wrong type to dirscan %d 㽘N 0`" $x@8 X   a 2 ` aB  "@p2`* @ *` > " @B`4 @   =   b> 8 & @<& "`@& ( @ @   "@, -2@2`  4   2     DIRECTORY CORRUPTED㿘" @`4 @b !8  4  3  (.  6* `@@ 2#  fx@+^b  @=`  "4 " , , ,  ,` "&  ~B?\>  4  2W   (S  6O  `@ &     b>  !=`:@  25  (1@1 2, ` a >"@""@ & <  b>   x@*b  @ג`@ 4  ,`  " @h:; `. 45 22 @2 `,   ? `  `   ` ` ` H  /   &HH`?㿘 @%s NAME=%s %s=%s DIRFILE㻐y"@ @ y@8("@)Ӕ`!h@y@ϐ@%d <  yy"("0y" @0y"@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘@ T .`>`  @ Eyc@F 0?! @ <  2yy"("03 y@#@ T ,`: y# @7"!  6 yy@7"y@#0y@7#H! 2  y@%,#X  "@4 㾐 (@ ,/    ` `  " 6  " 74   $4 "H   @, , ,    ,@ 㿘 (   ,@Y "  $"H   @, ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u ` @ 8@@<  `?"yy"("0z@"@!  ` `  ! 2 zz@$C" ! @6"!! M@X 3`' /a'Ē '@ z1$!@"0! !z@$"H $!3  @$!3 @ ! z "P!!@s $!! y"@6c! 2zZ"`@ !<  7z@7"z@#ސ" !!3  @ $!z,"3 `@| z "@# /!''ad,`*`<:`ad2@!"@!J@ z"@ 0R@#!@a  z# @ z@5"0>!d.  ?72 #!z#H@4a 2 !a@@#H!@!` @B4`!!!d*`  2 z#P@ǒ z#h@5Β!d.`  2 !  y@5" ` @] 8 /z!'''''@a@ X G!hC`A@? @? 8 /z '?''@D "@qk` 2```aB  "@pJ2`* @ *` @>`@Ӓ  @'@@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘" @nPP 4ڰ , ( "԰    "@&\ 8ř,  (# ,# (b 0 : @ B > b 0:  h & h b`P* :  8   "  0 "e< eD`L  ,@5 ` s,`@"'@&`0` d,`@"`"`0  )3 @w "` 0@  ,`, " P*@:`    "  0 "e< eD`L  ,@ ` ,3``@> |!@! ||@4! @"!  @,` , ," (" ," 0 :  b> " 0:`  h" & h"@&`8 㿘@Β "H 33  &@&` @ " (@`4 4@ b" 4@@  '3%@۔ b 4@@  . @4   !d 2`@ ' "@ ? @ @@ @*@@J  !d.  2@ ,`@  2@ @  @`4 㿘@ @S2 @㿘!h`   @_ 2 ?,$?@tR  0,@M  #,㿘  ?"@"0"`DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ &@&`$ >`< @@@(@+x"%(:  8ܰ  "%( x h x˰ @&` @b< ~@3j P@"!P @ " 0?: @ B  @n"; Ѐ] +pbbe<@ :e@@ B `L ;  @ @jI`T&`b 8&` 2+&`N`0 26 2`@$ג ~ @ ~@  @`2% @`% `: b@`0: < ~@3 P@n"!P N`0 `@ ] R Ѐ b 8&`b 0+  * :  b ; Ъ p " N`0&`@; "+ 22`"`@$v ~ @~@ Q @ J" t: @m  d``$ PARTIALLY TRUNCATED INODE I=%u㷐M 0  x @ 2 0 t @   !" @ `0" 0 : #b t: @lȠ  b" t: @l8 " t@  b: ~@2S P@"!P ?%z F@B@m   D@+. " t6&*  .  9    `@1 @$w " $- *!L@ . @:99~ `% @^  ?#%M 0 2  @#  @˒~@r @`f * ?% blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘 ؀ T Q'@`@g``,@b`` `@<"T 6#@1@L  ,@G @ #ؒ!@ '@;`@"T @2``,@-``#@1b  @1[  bad inode number %d to ginode 㿘 !h!@ߒ"Ā` " x@ 1"@ @  ,@@  @q @ x `* "D`!` ?"`"@`0"bD#"@ x@ x$b"D"@q~`x*  bad inode number %d to nextinode 㿘! "!!h+#@a\ = " "@T @  ,@@  @qF @D x `*  d,@qbL    Đ %a\ \`̐ "\!"P!@ ݔ!"b" ""Cannot allocate space for inode buffer 㿘"""!"!\" "e<8`H "`4 " )`@%"L%`@q$*  " %"L "` "`!! 2 @X $!@ ! !^!! 㿘! "@f"!cannot increase directory list㿘" 0?:  @ B  @j;  8 , $ (@7!@pap* ! $@" $` $``$`$`$`$`$` $`,$` `$@ (! Ѐ@2`d"!!H@5*` $!H@" `" !H*`" cannot find inode %d 㿘@pQapa* @     2 #@^㿘! ! * ?aH #@?aH#@a!@!H$!H$aD (%s %sDIRFILECLEAR (CLEARED) 㿘@ <  2   @m@h ! 2@ ! @/g `?"`ax@ "@  * 㿘 ( @2   ,@ 㿘 (  @Cu , 2 ` !h@8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐"X@/  7!h3@/"`@$ p"h@"p p@."x@.! " @@."  @.ߐ" '@*O"@.Ք%d %s I=%u BAD STATE %d TO BLKERR㿘#@@.#"@J "   "@4  0"@  *@"@ *@"@#@9J@㿐  "@J \  !h "@ahJ "  *J!h<@ @"(@ 9 @4 "@ "@ *@@  $ ("@ *@4@"$ $ $  4 :<  4: $ h` "`"H  ܑ6` *@` @Ҕ 8 /!''ِax@ ~"@ *@`?"`dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o %c option? 㿘@d @r- * #'%.+)3#!@ox +8s* l l %, bb@p " @-", cc@a "`bT %bT, mc@R p% @# #8@-g  a ,a,! !  ,! ,a@#XK"&* @ @f   @`cT!  @Xc  @@`  @  ? 䀢 2 @-%c flag requires a %s 㿐@0"J "`@ufsffsrwro㿘 @A9bЀ "   @A2b؀ 2  @A+b "   @A$b耢 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** (!  @<c!@!"T ! @ #@?l  ! f@#c ! "#@,`@ "@+#@+#@O! ! "@ΐ @+ (@! @+ې P@! @+Ґ p@ ! @+ɐ @ ! @+ @ #%``'!@{y`8 !@ . * * @| (. "* *  (2`@ :@| @l !@+"T  Ȑ ah"@" `$@+!0"T R'"``" @{7`,$`$`?`4@| $!@{$`8 ؒ"@$ `$@+V!H!! @+O!`!  #a@+G  2a@+@!! Ȁ @+9! Ȁ  #a@+1  2a@+*!" "!f""X!` ""@  ,  )"J" #  ,71L"@z``,@z```d, @" ,L@` @  @ "@@!d!` 5! 2@*Ր!!P @*ΐ!@f "!"@f 2W@'''"ؒ" @Ζ "  ! @*" @: 0 ` " ,>+ b@z[``,@zV``! "@zJ``,@zE`` : `   ?$- @ @*   b ,b"``?`4@{ 6   : `   $ +   *  @ 8 / D'Ģ "!"` "b 6'`@o  `b ,& PARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%u㿘@< 4`(a@K 0 `Xa@K @  ` ` "@ r@"  7ax@ "@ *@" " 0 :`@ B B?` 8`  "T "~`` @)Y"w! <2@ܐ" " 4 :<` !4@" 0?: `@B @c; @6"T "G#@)!?@@((w 쀢 B` ` :` 5 2`h` ;0`h + j ?#`"`( dbP@ + "@ # "T  ` ,#8`` @(ؔ`(@q` 2$`h"%(: `8``  "%( `h  ``B   @c|    )"@xh`t?   4,  (` T "@(`  , 􀤠  )"@y`t  ,  X` T "@(mx  , @ ` "`!d. `2 T` @P 2"@ 5#@ܐ#  #@ c`""``  ` "@ "@ *@"@ *@ ܑ4 *@ 쀢 "`?"ʐ`$`p?4``$`tp4`"""b&`c" 4: @w`$&`$`h 0#@ ! @' 0@|  `$" h @ ƒ!"@ *@@i"  "@ *ax@m .BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   $ cޔbȐ "b#@  ! @'  @#  #@ !c $/-357#+ Ò   u   :`J   ?$:@ 2 %  :    ?$ *@  N*  `b̐ "b @ - ! @Đc 2> @ ʒ@~' 2 "@  0@c . @ bX bX$bX%a"@""@abX@ X`"bX@@ 2`bX@2 $`2$bX $ & $~ ` @ 8 / <'!"bФ " ,* ) b @6' (`"`'"@J  " ` @ b ,ܢ DUP㿘  2 '-+  2 Ѐ bX  bX 8Ҕ $ " $bX"bX 2 bX @ բ`ROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'"@ ?* : `l"ȓ*`@./0t0\/</@ ! @!8  !H@ aP !퀢 "T@ !X@ Ր!x@|!    x!퀢 "?@ y!X@k! 27!H@ oaP@ !@]!    Y!퀢 " @ Z!X@L!Ѐ !H@ QaPf  / 2 "@!@ @J`"H  "@ *` ܐ *`#!aH!  @6dȐ @0 8 /!'! * aH  @S8+@@  F   ,a"$ !Ѐ!% @ " @ S"a @%Z"@ ! >$ a "P@     :  @ 7@  ?Hh $@~  ' '̐`@*@!H@J+'%@ `"?`  ";`  6?4 2$   ߔX@aЀ "(`  _h d* 2  ˔p@aЀ "` d*`  2  *` ?2  $  h) `@*@.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 ( 쀢  ` !h@ ,  $   '@8jc 2"     c $@!Ѐ "`"H "a $  \ ͒c P, ƒc '"H  // /#7  @8,bh #@Ԓ3 $6@ː * $,`@6 7@}y$7@}q $ & $!d*` ?2  @~g4@O!Ѐ "` $ 4  '"H  // /"h"h7 `/ $    @z"@74 $ & $!d*` ?2  @~)4 @7bh % "H "X  S &`H ,@!Ѐ "H`G @7c    "X `@5?   X@( ?%  %   X7@|Д@!Ѐ "` $ & $`!d*` ?2  " ` `8  $L . $ `2L  `$@!Ѐ "`` .2 $ `ؐ & $!h@  D"H $   2     2 ꡔ $ ,@[!Ѐ "`"@ @?* : ` (*`@<@>=D=D)+ `"3  "@J 2+"@ J $  ` "@J  ap@ ` !$ $ !d*` ?2 "@ *@!H:UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` @|O 8 /!'Ġ  Y' #%'@ ?* :  6@* A@A@A@Ax!d, R@``限2 "/ "`2% "`  ` ``  (J@@ "$`@xw    ('ȁ㿘  `M '+)   >  & $@xS  :``J   ?$:@ %   " 2  2  : `   $  * *@* !?%!` DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?bȝ" ?#H@?, "@ *` @{*``5  $eL`X !e$ ! @c#8! 2 %e$@ #X " `X%e$ "`" * `X $eLe$   #pe$`X@```#x`"eL`X e$ %e$`* @oeP*  ``,`: `@o`@qR`|`,`: e$ `0* `@o``|``@q@* `,`:  #@P%e$! 2@ # E! #@`* @oeP*  ``,`: `@o`@q`|`,`: e$ * `@o``|``@p* `,`: @ e@ B`L ;   %` "`" * eL?  n T?< ``"`: !@"U?, eP?4  V%eP% T`,  % X`@oReP* % \``,`:  \ % `e$  `@oA`@p`|`,`: ! `@o6`@p`| , :` `@ % he$ *  % l`@o#``|``@p* `,`:  l % d@"U%  ?<  \ T"@ d" #@eL@ @y  @ ,"*  * 0 쀢 2" , @yΔ `$`8@     : `  $ +  *  `,6weL@"U @n``.@n``  @ ` Ԁ#@Β@n```$4% % `,?2``@_`5 5 &% e$  @o`8% p% % $% `% ( @6% (% (, @6% ,% ,U 0@6% 0% 0 4 @yP   T T @yG@eL??, @n[` `F  @ ?* :  +*  MMM M M M  %  ?% :  " \b  ?$. @ *( @ J@@` # :  " \b  ?$. @* ?%   `85 ,`:`J ` ` ?"@: 2, :  c `    " .  *`8Ғ`8]  % @m`|@o ` ,`T T @ "@@m`|@^`@n`@m`@^`@m`@@^`@meP@n`*  ,   X@mveP*  4e$ <@n`8 & :  l@n`8&` ?"@. @&,$ $% $:  " `@ @ ?$: `8" :@   4@ `8De$ 4  h l   p@ @ ` ` e$@4*`  #   *   p瀋@ ` e$@4*`  #  $ '  '  '  '`p> *`@`l.* bؠ @?Y  @@f`0  $ $  $  $$ "*  耢 b` " \\ @?. x@;`X \ " \ @vs(?<@?   T TTT @> !@`x ?<@vHTT  T T @v8( `,eL??4%eP`@>ǔ  @@Ԓ`0  =`=`-`-`" * 3 |3 3|3㿘'H'L'P'T'XZ#@RH@w %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  3# 3!@9c|@^z 3#  @,! 3#  3 !c|@8@vِ 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘.@ "ޒ㿘'H'L'P'T'X H@v 8@6 /@F <  L  r @4 /r㿘@ /1,"@$ /,"@:cА"@7 "ذ /Can't stat root Can't stat %s %s is not a character device x 3"#! @@Fk 6 @@ H0M@F_8  @ `@~@<  "@L@3c "c@FA؀  f `@`"<   p<   `g @ ` malloc failed㿘@r1  @?brealloc failed㿘@rh  @.bPstrdup failed㿘@L  @bvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead *!T?"aLJ Ԑ@D& 6 .@-  @C <    @Ɛ @ " @D   "bP.@   P@# !  h@J!  @C  "aL?"aL! " p@ ! 2@ "!`"!!", ?$ $ #b ,`$`$`@o$ @o$`  `2t  @bP  (""`"l@ܐ  Q 2 ! 2 bP@/0 " @A } \@%@hjL,@@heH8,$@ \`@\@!#\ ` @!h@aN  !j`"T "!@mJ`" р ! "("0M")?! 2D"8" $"`# ,@h  $ah 0 :`*` * ?:  !" t:   @R @ E "!" " "`@" 2!""  ,`!" <`c""@" " " < ,`" `! @$""`" "`! @"! 2 @v"  " * " * "  @* @%!!""`"`"`! @"! 2 @J"  !" * " * !"`0 `H@!# "`0 "`H! @"! 2 @##H  !" * " * !"`4 `L@!q#P"`4 "`L! @s"! 2 @#H  " * " * "e, e0!e4%""e4e0@#x":%0! @D"! 2 @͐#H  !" * " * !"%(`< #" <"e(! @ "! 2 @#H  " * " * "`H8: e8 !e< ("e<e8#"H8: :8! @"! 2 @v#H  " * " * "`L8: e@ !eD ("eDe@#"L8: :@! @"! 2 @C#H  " * " *  "bHH8: :8L8: :@""H 5"%, 1! 2 @ @ P p ` "` "e,:%0 <"e(H8: :8L8: :@ + " *  i"%L?e! 2 @ݐ  8 `` "` "eL "eP#\"eT%`"eX* @eP*  `,`: @" @e @gD |`,`: @"e$ * `@e``|``@g1* `,`:  ""%@ B L ;   $ +`" * "!l: @J @iƖ #x @i\ #ߒ@i  #xӒ  @j:@#> -9@h /<@ E  ;  B  @i !l#@_3@`@`c@c  !@`!l#@Y Ȳ@@P!WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 `>!l: @I @i7 #x] @hY ="a`!N@i 6#xB@!ؠ %#)@h6alal <  D  ;  B  @h @`al#@ al@@ݐ!㿘w8@s  1 8 i ; b8 V ,8H >2?  6 ,8N >@ 6 !@,8@ *@ .@!@"! b8 b8؄ b `?/?..`@ 42 ! ! ؀  "@ ? ! !. `K. 4 "`ؐ @hԔ 8 / '#@-.#'!'!'ѐy "4''a''l 4@h$ @g? /,  4Ȁ2'4" ؠ? ?,<@g& 㿘 쀢 Y @h returning to single-user after filesystem check 㿘@ ͐# "` @fݒ 㿘@`  @fՒ  @fҒ  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 &   $ "' "N 0 S  ! @     (   & &  0㿘 84(. . @..`44  &@>/`  8@/`@2 / &/./  8. ` 8@۰ffs_isblock㿘 8 "  $  @ `?*  *@>*  *@>@   `? * >@  `?"ffs_clrblock㿘 8 >  > .@>*` *`  * @ *@.@ "ffs_setblock㿘 8 >  >  .@>*  *   *@@  .@ #㿘@//LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!`@A@ 4##  #!3aؒ @A  ` @ea*€  4!`@AP;"!## "`@ q "  2` 2  !a@Ax`?"a J !(@  !8@~   Ð"P@ q "`x"<internal error: unknown type %d.㿘€ !, !<;"耢 4`#"!,4## " @`"@`@ 2`@  "@d0̔"J" !(@0` !8@*` "!<"!,type㿘4c "`: 㿘4c "`0 㿘4c x"`& We only support %s mode, sorry. 㿘!`@@Ӕ?"aWe only support %s format, sorry. 㿘!a@@?"aWe only support %s structure, sorry. 㿘!ah@@H?"alocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘'D'H   'D`&` D  DH@8Ȁ D  DDH@8؀ D  HH!a@@\   @9ڐ  H?G"a`H`""`HJ a ! """  " H@ H"`  # H@S H"`H   `@MH @@alocal-filesusage: %s local-files Continue withmput%s: not found`'D 'HDH@7( H!`8@??d"aH"bɐ "`| @cbp'@|N "x !%['V#H @7Ք B N  |$ | H@8ؒ H 1J`@   J   "J  /J@  d*`@ `* *" @  # @ ! ""  c耢    @ | H#䀢 Hc $c P@8l``  | $ ||$c D %+)#Ǧ# K| H, @@8N@ b H@ H, @# @F ! ""H, @  c耢  @: | 2y #䀢 sc $c P@8`` | $|e$c @d7 ,H, @, @# HȀ  H,  h@ 0J H`D| >H@7 9b "@ B# @  ! ""@  c耢  @ې | 2 #䀢 c $c P@7`` | $|$c谆 2@2Ƞ DM̐ @b@" |r+w㿘 @*hw㿘9 X X  "h"@ usage: %s remote-file [ local-file ] local: %sRETR8'D'H   'D`&` D  DH@5ϔ؀ D  DDH@5ĔȀ D  HH!b@>   @7  H?"a ?` : `J`[!@  2 JJ   "J  H  /[VJa@  #d*`@ `* *H"`  " H@ L H"`  # H@  H"`#H @38  9H#@`+@:XHH @7  H H   # `@ 9  : X@"@_L㿘@;` !? " " * @졒 @W,! | #䀢 #c!" $c$" P@6rb $c$"Ȑ @yڒ "#""" |Ȑ @yђ remote-filesusage: %s remote-files mget㻐'D 'HDH@4h H!cx@=?"aH"bɐ "`| @`͒bp'@y 3%[#V# !Hbx@5 g N `|&`| H@6 " N     cd*   +@J+" @ I # @   #耢   @Ӛ `| #䀢 H# $# P@5c `| &`|$#@`T" |onoff  Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %d. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Macros: %s 㿘!܀`À!"` 0bH@;("p@a"x @% !܀  !b@;(0"@{a@$ à!)  J "b@;"'!0@;bc̔ÖPØ!@;`H!,###c8@;v!"pcp@;i h@;ac #c@;T"  c”@;H @a#  !``@;4x% (@a%"# l`8@;b"Д@;`x#c̀  @ؠ c̀)'ä", *!ؒ@: c̀&, "!usage: %s [ on | off ] %s %s. 㿘  `? & `@ǒb   & `@b  &!`x@:@? !9!`@:Bell mode㿘̔p"aPacket tracing㿘Ôt"ausage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿘  b-`? !a@:g@>?`@Jb "`@Cb ""@G `4 !b@:I` ?""̐ "b1!"!@:9b8" !bP@:0"h@a""aVerbose mode㿘”,."aUse of PORT cmds㿘̔"aProgress bar㿘Ȕl @"aInteractive mode㿘ǔ"ausage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. Disabling gate-ftp mode - no gate-ftp server defined. 㿐 !`5@  `?`? `@b 4  `@b  ," !`@   ?#@J  !``@9?:"a2"!"``@ U "`, " ɐ "`  "J  !@9]a" !  J "b@9H"`"!Globbing㿘̔M@"aPreserve modification times㿘Ȕh9"ausage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐  !c@8@L?2+`@ݒb 2`$ @Ԓb 2`""@Z J  !c@8`$?""b耠`?"b"耢 a  a ?"a #!4"a`@8""耢 4  "aremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'D  'HDH@0  D  H!a@8w?$"aH!@```!!`!, Ð!@ aH"@q``̐ "busage: %s local-directory Local directory now %s getcwd: %s㻘   4#&`  !c@8-@`@1` ?("a@`  #@g`?"a@A$  !c0@8 #H@R`"!`@Yusage: %s remote-file DELE %s㿘'D  'HDH@/؀ D  H!``@7?"aH x@`mdelete㿐'D 'HDH@/`h H!cx@7?I"aH"bɐ "`| @[obp'@t( 3!H @/ - N `|&`| H@0 H x@`| H#䀢 H# $# P@0a `| &`|$#@[5" |from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'D  'HDH@. D  DH@. D  HH!b@77? "a"@I` H"@B`-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:㿘   &`   #&`  !c@6@@@ڒc ##`@Βc " `@0f` 2`?2"a@c `J |@0Q` #@/` ? "a``␘ @ @P!`@X@X~usage: %s remote-files local-file mlsx'D  'HDH@./h D HDH@.#Ȁ  DH!a@6}!H*  ?''"?@Wc HJ |H@/ #@/ H?\"a@<a'H"bɐ "`| @Z bp'@rƐ  | 7 !#D?0  a w/䀠##H.   @N  | 2 #䀢 c $cH P@/;@  | $ |$c | ϰ  @Y" |܀@WSHELL/bin/shsh-c%sTry again later㻐 @Y  @Y @S @Z   @Y  @Y @X0 X `@˒ /" -/ @#/@`h  +/"耢  !Ð@r!ؐ @B!@Ou!؀  ̐p @A @;  x@?"a@Z  @4 @YK @YH?@̐ "!"!usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'D'H  DH@,hD?  H!bx@5@?V"aH"@Q` 8 D 4 H@"H"`D 'DH"@=` $ D 4H!"@!@N!ؠ OZ@@ZJ@*H" D 'DH"@` ` "@a0` D  ?H"@` Ð?"a܁PWDPWD command not recognized, trying XPWD. XPWD㿘!, "!,@ !!2  @a@ؐ "!,Local directory %s getcwd㻘@ܒ$  !ؒa`@4@!x"!directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'D  'HDH@,؀ D  H!a@4i?"aH"@z` !!!, Ð"@aH"@@f`RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'D  'HDH@+̔؀ D  H!a@4#?"aH# @4` !!!, Ð#(@aH#X@ `command line to sendusage: %s line-to-send 㿘'D 'HDH@+8 H!`P@3?"a 0D@.Harguments to SITE commandSITE 㿘'D 'HDH@+`耢 H!`P@3?"a!D@H㻘@#`#/@X#@}"@X٠  $#*< , @ @j$@XƐ? @ @% modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'D  'HDH@*h D  DH@*p D  HH!b@3B?"a"@SSITE UMASKSITE UMASK %s㿘a,  "a,#p#@:`"!,SITE IDLESITE IDLE %s㿘a,  "a,##@ `"!,HELPHELP %s㿘a,  "a, @ H@ `"!,㿘!܀  @ @+ !܀  @  @XC QUIT㿘!܀ @ # "@"#"!9?"`L"x "#́usage: %s [password] Account:㿘  !ap@2@? "a2`@|s!@"؁㿘@0~ "x @Ӑ !܀  "a$"!$@ǐ ǐ#@o commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'D 'HDH@)h  HH!bp@2GNH@"H ? '!"@!@L!g"!2 J !"@!@K!0€  !"@!@K!$@n# 2 @U֒a@X J !܀ 3!"p@!@K!@F  @U?)"a3ːa@:Tbذ !ˠ!@W'a"a@XDH ?€`!܀  "a$"!$@  @UCase mapping㿘ɔ֖"aCarriage Return stripping㿘ǔÖX"aNtrans off. 㿘  !$"!@]a""ab "b"a! `@j  Ѐ ,  *"!̐"`@^ ", `HԀ  ̆Ԁ 4J K J(š̂Ԕ K` `JJ@ 2 `@   @*J@ `2  * J *#`Nmap off. mapoutusage: %s [mapin mapout] 㿘'D  'H!$##X@a#F"aD  DH@(h D  H!cp@1 ?,"a "#"!# @ "x ", L " "# @ ,ʐ!`c @Ĕ# L " Ȑ x@#nmap: unbalanced brackets. ʖ!`   *` ``"?Z UJ P $ \23JJ*/: J 0$*JJ  94%JKJ@"#J?ϓ+`@ ""ؘ   J*`: +` K  +`"?K@2 K 2 J 2K   K +` "?#`*#`Ȗ xJ x "+[ J [ [ \ $"J 2 J ߖ J $20 Ja  ") J 0?N  @+`J@  f +` _@ @+`@ Q * C: :  ]D \2J9 $20JJa  ")JJ 0?N & @+`J@   +` @ @+`@  +  J  ,*`J   *`:  ] \2J 2J  J @ @b!0EJ ,\ ]"5Xa  "* J 02JN # @+`J@  ϑ+` @ @+`@ + J  [+#`J#` 2 Passive mode㿘!, " Z0"aStore unique㿘ÔJH"aReceive unique㿘Ôp:"aCDUPCDUP command not recognized, trying XCUP. XCUP㿘@ &#Ȓ``!!`!, #@޾a@  `̐ "brestart: offset not specified. Restarting at %qd. Execute get, put or append to initiate transfer 㿘 Ð @ޑa0 !9@;` :< X!@.`SYST㿘@ Ґ!PLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘'D'H#̀ 2D̐!p  DDH@& D  H!a@.Z#耢 !@a!#̑*` * ðbH`@# #̑*` * * #̀ Ð#*& Ð"@a"!$ "̐`"̑*` *  ?" "!#̓*@ *`@ * *    "` #̑*` * Òb  ǐ#耦/Z#Z"%è"Ǧ#`? &`@b`$b @?, :  .̑*` *  `N? . 2`3ZZ" ? & @b`&b @ ?2 ? ?  & @ܐ   b &b 2 Ð"0@ga?"afilenameusage: %s filename %s %qd 㿘'D  'HDH@%$Ѐ D  H!a@-{?"aH @'  ?À" H!a@-c"!%s %s㿐'D  'HDH@$Ѐ D  H!a@-E?H @'< ?'!H@5@!b@-/`"aSTAT %sSTAT㿘 ##@ 6`Local file "%s" is newer than remote file "%s". 㿘?␀ !c`@,`PAGERmoreCan't allocate memory for $PAGER|%s㿘'D  'HDH@$}Ѐ D  HH!a@,  @&R  ?<"a@O# ` h@Q@Nf 2 @`p`@)9 X '%,$,$  = XH# h @Ě @Nl< = X$$,H @@N`?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitdisconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'D'H   DH@#NЀ   H!`% #̀@ð"!H,`@*` @@P #̢`@H#̀@0H!`@+?"a@a,`* Òb   )[7˫,%5­,`"N!   Ḱ N  2  X*`:  $ \"F EN !  * * :    , @*`*: @а N  D?"?H,  @5`H N  i2 D H@$@H@PJ@.@`N 2 N @8.@!@? !@ڵL&2L  !(  !܀  !@@ڣؐ?9&!, @ڙؐ @8! ᠟€@# L  ?`"@  " *@ @0@!'D!'H- 2 ,`*  21ND,`Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. Invalid IP address: %s%s: %s%s: not an Internet address?Invalid port: %sCan't create socketCan't connect to %sRequesting %s Requesting %s (via %s) GET %s%s HTTP/1.0 /Writing HTTP request200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sX-?Ĭ%?'?#ܒ"@ @כ/?㼮%-?/? @}{b㼮b8@  /?-?㼮b@@    -?  bH/?㼮@}S@@ / L@ 2 ,@ "h` L@  ? "#ؐ@] / "@ "@?#ؒ"@?#ؒ@  J  ` "ɒI@ ?cܔ "  @}b?#ܠb8@.  ? #ܒ@b@@!  #?#ܒ@ L  /#,@ƒ /-?L@ 2,@-?@ :, "耢  ?!c(@(@ @N/  /L[a   @쀢  S#P@ 2 .@ #h@0G @#p@@M L ?#Ԥ@  ?#@J  #"H7  @n '䀢?@Ր#0@Ҕ ??#@ɒ0#ܒ@  !c@(o ?!c@(g?#@?#@ "   @W?#@M@L0@Α (0!?#@ @M耦?@L0  N   ?#*@@ `@@M)   H!?#@ @MY耦 @K  N   2 ? ?#*@J@ N#V!cd*  R  c2  h@ٔ  "NN cdN *@ ?cД E" *!¢! @0 : 0> @b /@cp"B N@ / @ @2 .@ܓ*`#x@ 0 `@ @@icpJ@ /` J@  :ހ *@`ڪL ֠ @# : ,@ : L ꀦ.N  @C /`*@ "耢  #\#`aؒc@%-#@c` 7c`@7!܀  K   8'''耤  L `'' `%Đ @%!܀   @ 2 #@60 ' '' ]"  #   N @’c耠@  L @c耢 2 N `''' +" M"L?L F?!, ` Äc@$` ؐ$@  ''䀤`'耤 !#$# ' P $#耠 '`' !@@= d ܰ @F6ܐ '܀ ~!܀ ?  %s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈 !Ð#В @Io @JcԀ #В * ! `@R2.@_ #@D?"a# *  @@HD ! `@Д  `, ``"!( #ђ @Ɣ 6 @.#?"a#2 ò#).-ª?@   71  + `'@q% @ #`$``@H !#`'@^@#c0@G` @ 6ѐ@#s%@#@l% 'Òb8@  @ِ#HD'  @j  6@ʐ#X@Vcx!$"@Pc"#"쀢 `@ɨ#!, !’c@#Z(@ "쀢 "@%# @?"a '?c!@#   "耢 @#!(@Gd 㿘@! !? " " * @T @<!9`P "`P9 T Ð"@_ ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘'H'L'P'T'X9" P"耢 83Đ 8@қaؠHĐ @@G  Đ H@ҎaÐ X@Gٔ   Đ `@Ҁa@/!? " " * @ @! F 9 X X l` Il@` l@a >\!<  ?9`\@ʔ   `  `9R `\`X@DD `19Ɛ @d9  : XT=" l XƐ!` 9  > X  : XƐ!'t\`Ɛ! l{\ ' @C | @CT" lƐ kl  @C| @C T" lx`"@C ` @0@5t '@? @B 'x!< %  . " 7#ä #R @C$Q>`ᨒ@ B >ᨰR @B$̲&@`"  l "! a?`"@ #`"*@@ " :@ B ?ᨀ   2a@@8a" O` l ! F`˒!! 4 ̀ =`` 9`": ˒!!4 À`!?`"@ # " #*@ƒ !? " " * @Ͷ @8A!؀`Ɛ @ļd.05ˢ!@+r` V1, # 44  !`@+!?`"@ #`"*@@z @8!" :@ B ?"   l  ` @2 ?`"@  " *@N `B >?` "@ .`:  `"*@@4 `B >" B l ! ;˖!!@  @!?`"@ # " #*@ !? " " * @ @7x! @Ɛ @d @ . @!(ː??:@\ T" l`@@],  @AF| @ACx`;@A= 7ː @A8| @A5T" lx`@A, " 19?,"a L &@A?& L @' ?"a` "˟@˒!! ` @  receive aborted waiting for remote to finish abort. 㿘@ " |9" P!ɐ#@!@6!Ð!x@Y receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s'T'H'L'D'<'|'x'p" :?ʐ "c˘  :!'??: l'4 h',T@``?'  !,  H <`2J -!ƒ`@HL !ƒ`@L"x " 't TH@L0.'t'l'h#  @ '@X!x (" ! " !9 L l@@?$ Ll`"p@@ p`@@ 4" l," h @@ c'l @@`'p<` H@ ` fHJ |bH@  TH@+ /.  Ɛ @mHk  2,H  ʐ (@   /,`Ɛ @OHM "p . H@ta! Ɛ @:H8 "p . @H  'H) "p @H 'H  !<  } 0!<`x  t L@h :@  Ð @?vl @?sp?X"a@X*!x   9 X X 29`  L9Ɛ!`\ >L  Ɛ! TL  , Ɛ T @z#x 'x<`<H@X`  <Z#H'|" l1" h  HJ |H @?  'hH @[ђc  '|HƐ @`" l" h( @D '|Ɛ @Hɐ#'t|R @7  $'!`@!d !@<@< $!d@e 0z"!`"a`<  " l" h@ϐ?!< "9  9 X X |`  |9R `\`X@? . " 715ø #xR d@>`L|R d@>@D< !@ B >!" x l "! x!?`"@ #`"*@@ " :@ B ?!!   2@@4\x" O  l ! F ˒!! 4 ̀ = ` 9 ": ˒!!4 À`!?`"@ # " #*@Ɏ !? " " * @~ @4 !؀ @. @ 8ː??:@9`4ʐ @@hH01 X X |` 07| @H 9 \   @'o|? "  | @2  7Ɛ @IH4" l," ht`@|01˴!3@'Hx? g  'a ! 44!  a@+!a?`"@ #`"*@@ @3a" :@ B ?"  ! l  !`B >!@'x |  |` @5 ?`"@  " *@ ? "ˠ #|?` "@ , :  `"*@@ȣ !`B x>!쀢 !!ʒ`P@Uʐ @!" B l ! ;x˖!!@  @!?`"@ # " #*@] !? " " * @M @2!x @ . @O 8ː??:| @Ɛ @CH@ 4" l," ht` @| @<l @<ph`@< @x~ !  {˒!!  ` @K  h itɐ#@dL@ ?_'\@ΐ '`\'dH@Ux`?T!@ݣ\@U!ʒ`@H0H4" l," hh` @ ց!(sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 !!? " " * @Ԓ !+%Z˦!Z")#䀢 " a@I!@*O!ؐa$@i  ݐ @5r J@ dƀ`j *@֐!@@*!`? $`@`$ @` R2`O @! "!@M? !`2N  !x  !܀  ֐!@!""! !€@# " N  !?`"@  " *@J  ؐ @{Ð @3ƒ`$ @3’`H /   7\`$\J J@ `JJJ@`J2  "  "  ` ?㿘ː!"a@ɐ "c"!4!" "!%#@@ a $a!$ @J@! $% 4J@4 4@ @J@!wu4 4@ J@   H`4  J@4 44 4 J@ ", "& % @\2 @` `*J@*` J@ "2 @ڒ`*` * € @4   4 44 4  %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 2:?@Ò!"x  Pؔ X@@ђ` 7"\8#* 3187"\  bx L @  #* *@ @ 0"  %+)'ز`@? ``ؒ @?ࠔ @ ? `usage: %s [-adeginptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘 Z#ؒb(8  @X @3 macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8 @00#8ؠ#@@3  # @Y ?ؐ#X@ ؒcH@@rch  "`H. ؐ#p@{ @Ӓ! &/@c .-خ#x L#%)æ"@f C   0  ?;[@X @h 4a(@c /a(@8 ."@Y a( @l$ a($J @  .@A à$@U L ;[@    "%@   0> W@ @  @2c@.ΐ &@@40@L 2-0Ӏ @c  HR @)  ?@  @2:L@. &HR @)s  ?@  @2!L@. &@L0"x @8H   2#o 0 #̑*` * *  @H a  ,`` i  ,@H _#̀ #Ð#$ `%#̑*` * ?." *` **` *   " #̓* @*`@` ǐ#耤Ǣ#@H2ّ*:  ,L? #, ǐ#耤ِ @& @L0 @##@  H   PÐ @a @y#ؐ#@u@ H?㿘 H @X !@ H  ` `,4`" L!@o H$`""`\2.@e H. . !@\ H `  `, `\2.@M H. .J L 9 !P!P " !@꿒 L "    stringlist: %m㿘@-o 2&  @|a & @-d P & @qa㿘   2 & @-*` & @\a  & * "@㿘  `  .`@-Z ` @*@-S@-Q㿘  , @\   * Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number '%s'. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿐'D'H!܀ !ےb<(D  ?DH@uD? H(! ""LD $H @9  ?#@J !H!ےc@ H!ےb@ ?"a  " J 2ɐ @^ec *` H*` h2`  Hې#P` !, !ےc`@ qØ "!ÔPے# #*P `* `* `* `* `*" x"!<Ôے# #* `* `* `* `* `* `* `* `* ` * "!̔ے# #* `* `* `* `* `* `*"!ȔHے# #*H `* `* `* `*" p̖ے# #* `*ǐ "c#Ā H  @ "耢 a,?"a,# 2"€`1² !|@ܷ !|@ܲ  L? ."? ,!ےc@ ޔ| 2,!xےc@.  *"x  "ap "a8" xÖPے# #*P `* `* `* `* `* ``"*!ܒ`@  "x "!p"!8`!xܒ`(@. ܐ 8@Va"!,anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'H'L  `'HL H?"a H L ,` & @.!  @.!@S  'H@a/@{  2ݐ"'H@\!! ݔ @+H'Lݐ"'H`ݐ"('HH 25ò@S @a@z 2  ؒb0@ Zؒb@@Z O@@.3@*O 2'H'HH ݐ"PH L 2@R"X'Lݐ"hL   @R"p'ݐ" ݀`Ր" @"`2C  [ `"x 5 ˔ݒ" "* `* `* `* `* `*!@ ?"aܠ #̀ 5ò"1Ó, @*`@a@ Ԡ #̀&,  sorry, arguments too long. (%s) 㿘@-!$ސ"@aQ!ޒb@Rː! , $Ȑ"@Z@1 2;˴!@-{ L ", n!@&!&@4  TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘 | # !9>" !̀  @$!# 9` ""``"` ""0!̀ !9@*#ް#@,J? /  $0 d @; ?@# @гJ{ /" /*| ޔc c*< *< *< *< *< *< *< *< *< *< *< *< *< *< @ ސ#@p @+a,a,?"a,""`"""x`?ߖ `@ 1!ߐ (@ p `@  0!@# d !x&`""xx`?"!,""@`8!9$!@!̀ 2!9 ߐ @@a  ho& $@!̀ @!c$!̐ @ƒ 2.1 %s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘#耢 S" 2P !!``@˖@ !ؐ$Z@Ѯ O= Vcd*  R  n"5  p a"! y"* !"# h@ga  "b!`@ !@`!``@$Z@r %s: not foundh# Ȑ @+ǔ ,, @J Ȁ  "@@@N @C&@N Ȱ SIZE %s㿐°??"耢 ,?",`"耢  !x@ $ @  J`[!@  °??"!,"耢  !!x@!ؐ @N!"!,MDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H,!"耢 ?",# =`#\#`!xcĖ@`AȐ @+3 ,''''?'Đ8'ܐ?'@?2쀦`"耢  !`@x"耢  !!x@p!ؐ @!€?"!,"!㿐19!Ѐ?2 @]&!а  `w@)?9!В@ `?㿘 @J  KMGTP %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETAh?! @֒ –`  "`"9 X:@Ȓ  l ’!! 4 ˀ ` 9!`X B5- -@B2`* @ *`B2*@ *@@& d4 d!X@#Ȥ?․@V@  d@*@@*!"@##\`"p@Ӛ$  a" ,4  <   2a" @)@)!"@"PM`  B#\#\@”  "@'"@`''А"@@'’  4 €`”`"`":  ”``Ȑ "` "'”  Ȗ"@'"@`''А"@@'荠셠9؅čB?˒!! 4 9 ` 9؁’!! `(@)e@)b!"@@#(aÀ @)U@)R!"@@8Q9!X@ b @?@!؁ Ё؁Ɓ@'@Ȓ.@)-@)*!"@H@@)@)!"@@ݔP@.@)@) !$@ <@ <X@Ö!R @(@'?  @'rb(@ @ !? " " * @Ԓ @_!؁%qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d !,  @ ”  Ȗ"@'"@`''А"@@'荠셠9腠čB?x@!9xB3? ?@D   ˠ ˦!!   #"8##\x  @;` 99 € ;h"@"H#p d@  _˒!!  9 W ` S xL! H9!`X B’!!> `69!X@ b @d?p@`!x pxƁ@'@.@.@'@' d$@ <@ <P@齃  !R @'ې@&㿘   ,@'@4 *  ?#@U"  @@ N-ò   @6E@ݒ* @ @&ؐ@ђ  ? "`"%*@ @ !@'6`  ??`"@ `"*@@o 뀤@ 㿐!R `h@&6? P"cȁ㿈'''' @Y 㿘@ -%c %s -%c -- %s 㿘@ K "b'.%!@ ``? @̍@@̉ H@̄ PK"%!K"*`X@x@ " $"@p `@'*㿘@f-link2link2-link1link1-link0link0EtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetipdstbroadcastmetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupisoipxnsinet-a-A'%s' requires argumentencapsulation routingSIOCDIFADDRSIOCAIFADDRH@  @?`@@.b 2@ @&b  ͠   " @?` H@@ ? `: h"`@ h @ @ ͤ   @9͒`h *` "  $ @ @#@&o !͐ h͒`H@ޔ  2͐ h@ @&a @Ր h  @&Z 9?#9#c  c@@ "  2@ 2  < 2   "? 2 ` 2  b@T@`?`@€ ? Ͳ`9"     2.@"*# %!̠#(А@$  # !̠#(@$۔  @$ה #  @j " 6@ʐ"# `H@R #@$ 9. 1 9@"9" `H@4 #@$h @"@% 㿘:!?@$u# @ ̀ "c:?"a:"!socketSIOCGIFFLAGSSIOCGIFMETRIC㿘9"# ̐ @~Ӓc#0a@$( @X#?V "c#0a@$ @H#" 8 "`8 mallocSIOCGIFCONF%s: no such interface p !  9"# / @~c%#0-'@!' @~a$@#ܔ  @~| , /Ф |-͢ h/ `  @$  d͐ H@y   2$%h $` $` $`  $` $` $` $`''''''''\Ѐ >@B  8 @$  23`2`-%h $` $` $`  $` $` $` $`@ : @   h h "   ,` @   2   @!   Z#`@/H@$ 㿘`< "`< ̐ "c @ 8  €2`㿘 @ € 㿘 @ € 㿘@ c "c"#9""㿘 <  ̀`6"  @`` @#, ̀`" ̒ "#9"""#Note: trailers are no longer sent, but always received 㿘@l!㿘 @ € SIOCSIFFLAGS㿘#0a@"h ͐ @}]c h͒`H@y R x`" "c@"c͔h#2# @"a  @}:aSIOCSIFMETRIC㿘!͐ h͒`H@N @ș h$ # a@"} @"`%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d㿘"@ߒ`H"c@` 8`@ѐ#`ZH? "H "H * @Q  @ : @ 0 h h  ͠ h ,  @   2  inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿐 #  !. + @|c h#͒`H@Ц  |'@q@l p h`H@Й #0a%@!̔ h . 1@ ͐ x @" `|" ,# (#0a"@!h . 12 ͐ x @"۔ @Ґ ͐ h͒`H@]  |'@(@#  @`,# +#0a#@!}h . 1 ͐ x @" @ ͐ h͒`H@-  |  Z'@@ ZH? "H "H * @p SIOCGIFADDR ns %s 㿈 #  !. + @{ؒc h @"i  h͒`H@ #0a!@!# h 61. 1 /2 逦 h͐ x @"M 1@D#1͐ h͒`H@ϔ ͠ x 7 7 7 7 7 7@&ސ@NJ## 1#0a"@  h . 12 @" @ ͐ h͒`H@ϛ ͠ x 7 7 7 7 7 7@&@V ZH? "H "H * @֒ 9 ipx %s SNAPframe %s XA #  !. +ϐ @{7c h @!Ȕ  h͒`H@O #0a!@  h 61. 1 /2 逦 ͐ x @! 1@#1͐ h͒`H@. ͠ x / / / / / / / / / / / /@)@ݐ"# =#0a"@ = h . 12 @!l @c ͐ h͒`H@ ͠ x / / / / / / / / / / / /@)@Ɲ  '!' '!'Đ '!'̐ '"' !7'!'''   @ "``` 2@``@m"ZH? "H "H * @ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOhM #  . + @zCc @ Ԕ 0͒`H@[ #0 a!@ 6. 1 /2 뀦 iؒ @  @!Ȑ͒`H@; @(ݒ@!#0 a%@g . 1 @   @! @( @!# "#0 a"@EȀ . 12ؒ @ t @k!͒`H@ @(wݒ@ ZH? "H "H * @@ %s: bad value㿘:! .`@ `, ,  @ @Z-@@/ 0@,b "  @*d $ `H@N%s=%o%s=%x㿘  N . .`!. !@g2tZ#H?`"@ < " <*@ N`K. 2 %Z ,>@ : H?`"@ ,`"*@@Ò * :  % Z#H:` ?`&  @  `&*@ @* :` :`NN 4N`Z#H?`"@ > " >*@ Attempt to set XNS netmask will be ineffectual 㿈:!.`@ ,  ,#@@$ 4 4 4 4 4 `4 @Đ#@Attempt to set IPX netmask will be ineffectual 㿈:!,.`@ ,  ,#@@' , , , , , , , , , , , , 9"`4 @ć#㿘:!<.`@@&ސ @ `  ,, , , 㿘@"`$Negative NSEL length is absurdSetting NSEL length valid only for iso㿘@ϐ9 "b @Moah @ " R   @Mca 9* 㿘:!<!<  usage: ifconfig interface %s [ af [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ metric n ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A] [ af ] 㿘Z#b`@.@ 㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess arguments`@@P  @€ Z#@c@O @ " Z#@ےc@C # @̔ @P1 6@Ɛ#@U  +@ +):!%: !@`0`f`s%!$@ 8K""@ P  @M  #\ #`#d Ԓ    @@     @9 #l @4 ?' #\#`#d #h #l #p #t#x    @;  @@ ''' @P  @L @ @ @ :@! x'H'L'P'T'XH'?' ``䀢`''' @' `#####Ȓ.  ` *# ("#㿘'H'L'P'T'X @H@G@W 㿘'H'L'P'T'X @H@7㿘'H'L'P'T'X @H@)㿘:!"!@ fatal signal: %s㿘@_ݐ @  @ܐcannot get kernel security level: %s㿈 ' ' '  @L ? .@E !?cannot change kernel security level from %d to %d: %skernel security level changed from %d to %d㿐'DD ' '   D@ ? .@  !zD0!ؒgD㿘㿘  @ b@ can't open %s: %mcan't get %s for controlling terminal: %m㿘@N@ @ɒ ?"@< @?#@2 Enter root password, or ^D to go multi-user /bin/sh-sh/dev/consoleconsolePassword:single-user login failed Enter pathname of shell or RETURN for sh: PATH/usr/bin:/bin:/usr/sbin:/sbincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restarting#?#'  @xtW#@> @g  . *(J # c@g ,'1@@TL@ @| @1y @ @O \ 0@@"@ip `8@@ * @S ? " ,L :, ,Op p@Q@u< /2` -/@F'l l@ '' h`p@O @t#`##''!#@t`#@[ @ 2: ? @b  ?D1"!).+1'%:?h@b ?@?  ߐ`0!h   Ԑ @ ? ې?:! h   !H@ @ʐ !h1!: "!1"sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@wC1?'' 'ؠؐ @Q  @M #!x'!':! 2 !'' @ !#@s4!#&@E '.!c9? @aΔ  ?@u `1)#%?@a ?@?  !ؒc G1Ԑ   "c@ ?ڐ?Ԑ    :!#0@2Ԑ?'@M0Ԁ  "8cՔ1ԑ:  21:"!"xb@*1"!session database close: %ssession database open: %s㿘 "  @ .@< !0    @׫ ̀ "`  .@) !P insert %d: %s㿈'D ' 'D?    D.@ "w delete %d: %s㿐 ' '    .@ "\ 㿀'DD' '      @/ `/ `/ `/ 㿘@o 2  @ב* @Mcp$    # @Mcp. $  㿘@   " @@   @@ @Ԑ%s%s/dev/㿘 & ,  (@ , @: , & &@@ & `PX@ @&    & (" & $$ (& $%s %scan't parse getty for port %scan't parse window for port %s㿘  @~@| @`@@@K & a8`@@f   & !@ @c &  ` "   @V@f`L&   & !`q @I &   㿘    " ( (M " 1!@; `V20@= 1 pcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@t? #8! 0 '@ @Jo 6 #h @p@ #@ @  can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@  `?  @K?x?@t` P l? "h@@  @[?@O 1   & O") @  @#!?.   2 `x@k @@ `@c @@@   $ 4   c @   "'@@ ' @3  @pI@  @; @Z 㿘 61  @@ Ӑ$   $`" ("`( ("` (` $"`$0L?2$ :!"a@5 $  :  : : :  0 㿘:."! ^  #:!  2 ( ?2&  $a@ & N ( 2 :! :1:? @^h ?"!w! ?:!port %s changed utmp index from %d to %d㿘    ?&  ( 2  @9@   @z   ( 2  (  & !` v& "    ?&  !@b   &  @s 0’g0@; "1 2 ( &  @^  ( 2 1 p   (2  p̈́   shutdownsome processes would not die; ps axl advised㿘 ` `  "` `(`2` "xc@j #|#.1%͓, ?@@?2$` ""!$@GX ? @] ?" ` ?` " !  ݓ, ֐#1!㿘@q_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘Z#@a8@  a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@/#+#.)ՠ '%Ր@5Ȁ?5? .* pۼۼۼۨۼۼ|ۼۼۼۼۼۄۼۼۼۼ۔ۼۼی`%a %!$$$@W`:"b0@R`:"b4xɐK"& nK"* @"Ր " "a,! *Ր ' ' d' Ք @ ? @na؀  Ր a@  !!"a  Ր!@`"@~a"@ya,"(@ta ! @Ψa ! @Ρa耢  ! @Κb@  Ր "a$@C}bH!@袒!@  !, @* Ր bh@nR!, @ @ @ 3"@!Ր @CPbx!, @  bh@n.!, "@&  b@n!b@F@E耢  @nb@ nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8:@3b #:" " :" " :" " # @ 0@\ "h@ @ A #8@ 0kȒaB  "@2`* @ *`  @ #H@0U@̖: Ȁ̀#`@0B@ː !$  `  a`a >@?@`?# @@! ?@@ ?# @  ?Q@@ 2K@@?@ `?# @! 2 @9@@ ! 3@? ?c @ ̀@2 @%@@@@ ̀@@? ?c @! @"  @@@@! @# #?B ?@ `?# @! 2 @6 @@ ! 0 @? ?c @ ̀@2 @" @@@@ ̀@ @? ?c @! @   @@@@! @ @?@ ?# @!@ ?@!@? `?c @! @ ?+" @@@@! @? " ? `?c @! @  @@@@! @##? "@? ?c @! @ "@@@@! @"":"" "a  "a "`#p !#  #@@%@6 !"a( #@`!$    @ 0@ݒ: Pa(@@!&  & &@!$ `  %s: devread: lseek%s: devread: read㿘. >@   "c@k@ `@kstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block8@/  bh@kW@g : `@kM"0 J ""@:"4"0"  * "a(Ր `@@G ! @ !-:+)'%0* a, "@ @ 0 @ 0Ԑ`@R   `@K   `@@@   a @j@  c8@jڔ@R!͒  !0 @  0 @?ܒa@@1 @u  ,@p @ @@# @! x `* @ d,@  0!`@ x*   0"@ 0?: `@ B  @R;  !(Ր `@?!" !h@q`(`(  53/ d*@,"@` @Z   뀤 @I C !@?`X 0! t" /-+ d*@,"@ `@  t ꀤ @   `@?+ 㿘@2more-E-m-GMORELESS--help-?--version-VVISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t option㿘@@"``  8@c : "bH@9@@1@ W@.:"H  @*B# @*?#(@*<#0#8#@@ N@*3 2*?@@ΒcH 2@@*&#P@@ĒcX 2?#hJ - +@J  2@@,  @`@*? 4@@, "@,@ې @ #p݀`" J@ 2@ #x݀`" J@ 2#"`@ #܀`" LJ@ 2?#"`L?  @@a`?@@ ݀ "`@=  @ @0@  @@  @ @'8@ @8@7` ;! ,@ $ ;#@/ @n ;@7! 2@d @@ @\ @8T܀?"`@T `|" @ @ @6 @? @@@9 㿘@.㿘@C @  @Cannot allocate memory㿘@  P@/' @ JJ "  " 㿘 !0"!0ݐ "`@Ր  :"D @@^@.d@ @)h:"\р Ȑ @7Ւ8"8"`"`"` "`"`"`"`"` "`$"`(@[bX"f-#`n"W-`2"O-`I-o݀`KH-j݀`"I-`C-a݀`Ba,C-Z !@"I-g">-d8-K݀i`7"@6-B%"@"5-#@--58!@*p"@)-*'2 $ "     -     -       -  2`"`"`l"aԐ >'̐  ?''̐ //Ւ!8!8'`'`'` '`'`'`'`'` '`$'`('  @AÔ:""\WARNING: terminal cannot %s㿐 X  :"H ' @. LINESliCOLUMNSco㿐 `h@ ה  `" @ ! "@@! "``   "` `h@   `" 8@ !( "@@֐!0"`8`8  P"`8krklkukdkPkNkh@7kDh  '"X@ǒ̦!ՠ"@n@ ` ,` ,`@a`@  ,'"`@馒̦!ՠ"@M@ t , ,@@@ g ,'"h@酒̦!ՠ"@,@ S ,!ՠ!d@  @ G - '"p@e̦!ՠ"@ @ 3 ,!ՠ!d@ @ ' - '"x@E̦ !ՠ!d@ @  - '"@1̦ !ՠ!d@ؒ @  - '"@̦ !ՠ"@Ē@  ,'"@ ̦ !ՠ"@@ א ,'"@̦2Ր //Ҧբ"@@  , ,@@  ,/ //ҠА@z@  ,ݒ!!  `//ѐ@h@ ,Ր!d@KՐ"@_TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@ /#8#@@v 4 #H#H? /@#X@,@#`"`@#h"`@ #p"`@#x"`t@#܀ "`"` "4" "" "" `"" \֐ '#@׀" - *a#@ݒ׀ "`#"`#@Ғ׀ "`#"`:"H 2נ#@"`#@绒"``Ԁ 2#"``؀ #"`#@祒׀ " `J@ 2 V##"`#@玒"  t  `J@  :##"`#@r׀ " `J@ 2 #  "` @[׀ " `"J@  c" "  "` @B׀" `#"` (@2׀" `#"` 0@"׀" ``"  8@׀" ``"  @@׀" `2  "`  H@׀" `#"` P@ߒ׀" `2  "`  H@̒׀" `#"` X@漒׀" Ā`2#"`@棐 `  p@榒׀`" J@  h"` x@敒􀤠`# J #  @䶔 @+@ R  '@t"` @i􀤠`# J 2# ` @䈔@@ $  '@F"` @;􀤠`# @/􀤠 # 耢  " @"` J " ܄ ܝ㿘!$ ݐ`@㿔 ܁㿘N  N@ 2N "N@  ݐ6㿘 ̀   `+@㒔4: "bX㿘 ̀  !:"X   `+@}4$"X㿘  +@s4㿘 `+@i4㿘  +@`4㿘  @ϔ +@T4㿘 @@( 㿘 J ݐ `+@:4㿘 `+@04㿘  +@'4㿘 t    +@4㿘  +@ 4㿘  +@4㿘  +@4㿘  +@4㿘  +@4㿘  +@ߔ4㿘  +@֔4㿘  +@͔4㿘#`Ȓ !+@Ĕ#4@([ `Ȓ @⾔#4㿘 Ȓ +@ⵔ4Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘@)@??@  "=";"(!@M ?."X@` "@  ?@ ?@"x@([ seek errorread errorWaiting for data㿘   `  2 `  @3  2   @`? H     !    @ " H   & &   *  @ ?@6? `@!:`  ? <`   @h ? ׀  #@'ޒ k? " :"`?2    $  @&P"   :` *` ?"`?〤  :#@' s :"L  $ ` @W `"`  & "`$  #@'֒ @   ܀ 2?  "` "@&& " "   @nא ch_ungetchar overrun㿘? :"`?#x@'] :""`Finishing logfile㿘:"L !:bd !:  $? "bd#@' !@? ܀ !:@0"L?$"L:""TWarning: log file is incomplete㿘   c`g:  ')2  @'    :"L@   2  2 㿘@ ?4=  #: #`` '`#Ԑ ` "   6 #!@q?`܀      "  # <&"`  㿘1 ` @`  "`$@:? @B?  ܀  㿘   2    @&  2 "`"`  ?$* 㿘 @   @  ?? ` #4א "`  ` "`"` 㿘 ` ?     ` 2 `? ? `?"`#"`  @   @  Cannot allocate %d buffers㿐  !#@N   &'a@%ђ        seek error to 0㿘 ` א?$"`$ @?"`@@2"`! @  "`$"`"`"` `   @ ?"0@% 㿘 @C$ ` "`?""`"`""`  㿘 @ !  " @" @   " 㿘  @Ֆ ?  㿘!:@ "<  $  @ ($ " "?" " " " " " " " $" ِ : ` "`:"<@` ` ?""` d㿘    נ  ` 2   @`  ?"`  !@ $ :"<@ 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘  נ  8ר!'*`:  9   06,` ."  b c"    * ?N? "@$ } *,@$ u ,`  N א!א!, *,invalid charset name㿘 "" N :   "h"h @   2#`@$L 4 㿘 @C` [ה   @J  *@ @  "*@ *@ ``*s<%X> J*J*":J k:sd  : u :: ✄  :  ✄   : LESSBINFMTLESSCHARSETLESSCHARDEF㿘@ !X@!ht @!x J@  0 ׄ   ׄ  %cESC^%c㿘   א b0 א @b81: @ܐ :א b@א b@1װ ׄ""l( hׁ p㿘@!㿘"lא!@#Q bl$bl!"hJ@n"h"@$"hbl,@`L@ 2 `"h !?"h"l @ *`: @"@H`L@  @"h :!g?"h:"   "lא@J`?㿘!"lJ a"l $"l@"!@"h $"h 㿘"lא!@J 1נ!"lJ? y"lJ?גa"l 1נ!"lJ? d"l8J? 㿘"lJ  1"lJ 0"lJ 1"lJ  "lJ "l 㿘גa"l #!פ!bl$blJ@"h"@$"hN  "lbl 㿘J!   "lE*:"`?㿘!"lJ "l $"l@" !@r"h $"h 㿘"lא!@bl"blJ@]!"h"@$"hN   : 㿘:" ۰ 0; :"` "`"`:"    גa""l #%bl*bl`J@h $h@! bl $blN "l* 㿘!:" .@! )" #:% @ b2 #:b2:  !$ b$`$ `""`:""`㿘:"@? :":"@"@ Ȓ ` "X*`@,x,**+`*,h,,,$,,,,----,:!"":3"":"""lJ 1"lJ   "lJ "l"lJ | 1"lJ r :""א!bl@1נ!"lJ?  "l8J?גa"l )1נ!"lJ? "N "l8J?F :""A:"""lJ  1"lJ 0 :"", :""':""":"":"":?""א "bp:""Ɛ  @  :"" 㿘@! uN!"h?@"h $"h`8 &!@"h"@:$"h@!!ג"l* ! , ?bl: !"l`$"l*@"l?J? '1' L@Ǣ 8?@$h!"h3G 0@ E L "h$  !Τ"h 㿘 *`:  #L   㿘"lJ   1"lJ "lJ "l"lא!@ J "lא!@ "l?א! ג!N? ? 8N?㿘!"t @$"t""|"x #@!"l"  $bx"l@ǔ""l *@ "bt"l*?㿘    1 @t"@" ؁㿘:"  !"t : :bt"" "bא"@9bt͒ "b"$""lb| 1!R"l"|@" 2:"""x"( :""Q 㿘bp "bp@;  Ր    㿘@!㿘@&!@"h $"hׁ!㿘@㿘<""%􀠠 @ @*!/?㿘"   "b"! #"  #" @ #" "  ##:"!done|done㿘"?`*  *`@56666X566665666666666666d66666666(6<66666666666א@b0UL@ +"` "`:"8 "L@@nL@ :B""8:="b8!L#@5,#L@L` L`L@ 0(@N0%L@ ! :"쀢 @B@ :"b:"쀢 2:  "@  J#@q  @ 㿐"`/ #(*`@8(99999X7999999999X9999998(99999999999999999999999980?Ѐ x@T  dt "b@""  e laJ#  + -Z + - א "c "c*## @  א `@Q J# + -/*#@ / -/// / 8 r  * * @ !"  @"! b"b     "?݀   C  [Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘:"耢`א"@T@  ?ܐ @ ݒ  @`  !  @$ $    ,  :@ "< ] 8! (  D@"8H$ (@!L @ :03@ @"X1less version %s㿐<# ' @?㿘:"耢 ":א"@"J:""耢 @= "   g   0 @&?ungetcc overflow㿘:b耢 :א""b:"א"@  @  :"""*㿘@L?Pattern not found㿘:"<"! @ @ 0 b >"b#b@#Y$b  @  @  ` `!@  @ 퇐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈א "b  2  : "`/%-ݦ +)װ"A%$*#܀  @$& ?܀ ܀  "/   "/_  '/'@7쀢 ` `i`c!*`@CCDF4CIDKhGpIECC@DFEE8J0G,HEPK4HFE(IIEDD(FGC,CxKKJHG$KhKhKhF`FTFFI$KhKhDLEKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKhKh@ b  \`"  @k$ @  0*`"  @X$ @  0 $$; $$> $$+  $$- @ " " ,܀  !ݐ  @ j  ܀  "  4%```` @ Y 0 4%```` @  0 J@@  $$zX &$ d d$o@ 0j @ t@ 0_ &$@ *`|0T@'"L 밐 %" $$fP %" $$^0" %" $$U. 0d"  ? " ? &"  ? " ? &" %" $$1  @%"@ ?@"@ J 0,: b0?:@ "<@b 2;Y" R# L@͒ @:@0"< 0 0 $$@)   ,   $ #H '#P $$@  #H  '#`@0 $$@ #x@ 0 /b "# c   l `@ 0 ci 0:  cb0 c\   l  @0| cD ~ p ll j h@0d %c, f X lT   .@ J*#: % c0[c  0U R c 0H (" (㿘:"@)!L; @@= C@O㿘  @   @"`"`"@& ?Warning: some commands disabled㿘; ߔ  @0 Warning: some edit commands disabled㿘; ǔ  x@ @ 4J@K)` @ g `"$ ?""2J@ 2 J@J`g2J@ fJ@`J@?`J@2`?`@ И  d㿘  d   d 2㿘; 㿘; "H"H* @㿘@J J ?i 㿐@N E27?N n23?N d2/? ' J `e'`e`x`c0 0Ð? O@'@?  㿘@ȳ B @[@    @ɖ ?  @ڐ@=%?@@5"L@@ː? L` M L` +L` Go}.lessCannot use lesskey file "%s"㿐@$ Р  ' @@x @E  l@ ?  *?*? ܰ  ` ` 6 d` "  d ` ` d`  d ܀ ?@J?耤 ?0 㿘舐@& @ & N@ ".@` @*N@㿘`@@ @*N@  N@ "` @` `@ J"?8J?  ?J?㿐#:b< @?b<@@1!;  :@"< @@ $ :""<㿘:@b<0 @-%s"%s" may be a binary file. See it anyway? 㿈:"<" :"<   " @'@{  L @` ; 'A@ ' @@}쀤`@@u@$n @' '@'  @  @k ' @쀢 y Y @π` !::""@$"<;" "c@b"<@Y`ܐ "`PO:"T` :@ :"8 !:"D@`? $"D " @;@ (@S   ' @k 㿈:"<  ':ǒ`@  耤`@<@ؐ!: @"<"<     㿘:""<@  㿘:""<@ 㿘:"<@p? " ` 㿘:"<@k? " ` 㿘 @K"  @ɐMissing filename ("less -\?" for help)㿘;@X " !@˒ 泐  㿘{?@?@!Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 w@ @ :"P "' O"P@?`0T#d*`@\@\\\\\\\\\\\\\\(\\\\\\\\\\\\\\\\\\@\\\\\\\\\\\\\\(\\@'!:"bL@ō !:$"L  @ ?:"L@)"L?$"L " :"L '"@%s/%s㿘% L@ !@ @  @ϼ  `ؔ@@J @ @HOME㿘@!В  LESSHELP/usr/share/misc/more.help㿘@! !㿘  @ #':%:*`:  # %2 < 0 @ g5@R`@`L@  @ i  @ 1:':*`:  # %2 @"<@@1`@Z@, `L@  @,%s*㿘@q ; ch@`@@ @ @X !  @͖ ?   @ @  @m ?  @ 㿘  @  㿘 d d ? $@`$ @` $@&,,,Ԓ @ڒ@@,۠ ,SHELL%s -c "%s"r㿘@`@" @ 䫒 @Ж@!`N "@͐@ʐ 䓒 ah@@T@ax@Lecho %s㿘"p {@WN @00@-LESSOPEN-㿐 !?@" @+c ". L |    `T @.  @ O&&@# 1@ N` LESSCLOSE㿘"@@d P@8@~ @, ( <  @!  @;`<   @ ْ @ߒ;`@8@? ǐ㿘 邞㿘  ܀ @R??{`, "`,㿘`0 @"`0...skipping... 㿘    ?4  Ā   ?   2C?7  ?<@ ; ; 0I@?@@ "?@7 @    ?; 2?@"0?,@);7'܀ ?" 0@  @ ?)@ِ  `   ;!  ;!   $0 @?ɀ  " ,  ܀ `, "`,)` ;";@;" @1?㿘/ @ 4   ?ܢ ܰ? " ,@@` HO@? `ڞ@@?㿘  ,    ;♐ 07@&??2-`   @ # @  @     @?? `, "`, 㿘@ ?2 `@? wi   #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘W#@ 0@#@`  ``@@@q  @ @훐;Ȁ ; @" 2 㿘`2@; @&& @" &@` &  ;` "`㿘 "` "@ђ?;`?"`㿘 ᔒ & ?& & ˒㿘 !:"<@'$"<Ԑ@B @@ 2;;Ȁ  2 ; ;Ȁ 㿘 ܐ  ;㿘;  Ȁ "  Ȑ@   㿘   @" `"  "@ "` "   " 㿘?c \ ; * @@H G T@@,>?H  !ݤ !# ܀ < ??@. `$  ?  ? ٰ@  !   ? ܀ @'?0㿘?f d \  ; * @  & @Ғѐ? R  &#ec鈠  ##~  ?`܀ 02#0/@ C`܀ &d ?2`.蕐  0+ @j@w艐)+"? ܀  @?0` ?@  `$ 2  @K .0ۀ@@CCannot seek to end of file㿘  @4 0h    @Cannot seek to beginning of fileCannot seek to line number %d㿐@? $  ܐ@y`|04' 2 '@l`|   В@㿐@@@YDetermining length of fileDon't know length of file㿘u?!@ (k?!@ 0 @@N d6?@`|㿘ǐ  ? UL@Cannot seek to that file position㿘@А@|$ $ @?D@ g玐 "@j 0_@ @ސ?2 ? @|" ," 0"  ?  &@01 "?  x 0' " ?#? ` ?@J" @ ?     $ ( ؁(,%6d㿘 B@G#!ܠ c@aHc@c  "cך##`## *@ `Ѐ !ؐ "`ܨ  פ##1#*#`$#*@c $c@S Ѐ #c"#                   4㿘 %?  #`  א#J@` `#`א#J@㿘#"#!ܐ גcJJ #"@$#㿘@- 2  x c@ @ 8@4K ##!D #``ܐ J@ ״#J@  \ # *@#`א#J@   ؀`] ز c?"cܐ *@א#*@c@"c 㿘J#,  @c0  *#,   *#,"#0 @㿘c$ ."c$#ܐ . :`J@ _  f  #ܐ J@ #ܐ J@ _ Ȑ Dܐ   "    r 0n ͒ # h ؐ b"c$`Ѐ !ؐ "`%#ݐ   K# $#@`Ѐ  G 膐 5 x  臐:"!@7# `8 4%   !ؑ*`:  # $# N   Ҕ  c "c 㿘J#,  2؀ J#,?c0#`8   Ԁ  x ܐ  *א#*@ "ܐ *@א#*@~ ( "@p   HׄJ"@܄ ؄  (㿘?"+? 2&?X? ݰ ` A ,A 6?`,ܐ &@㿘? $!?䏐? !?  ,ܰ F  ??,  `2&@؆P ِ  ؄P  Lل 8؄8  8   ؄8   " 㿘ؒ#8#8    A 2 L @"L#8"#8"@"`"`"`$ $@ʐ ȐƐ#8 ؒ#8#8  ْ#8 4##8  2 #8 " "@Calculating line numbers㿘!!@  ; "`㿘!#<   d$#<@ c$#<c@` ?$#<㿘 li`q #8#8     ` @ @ 5"c@ؐ#8"    $@  "@)   G "#<  ;%ݐ’ ܀ 27 ?"4  ;" 64'?0%o  ! "#<  ;%ݐ̒ ܀ 2 ?  w?;" 㿘`Z #8#8     I @ {ؐ#8"    $@  "@ !  24? - %ݐQ ܀ 2'??   2?  %ݐg ܀ 2 ????㿘@ Dq? ?% ? @ 4? ?""?! /dev/ttySHELL%s -c "%s"sh㿘N -  Y"@ *"@ ("@ %":"<k @ڌ @J @ @w ""@ɒ  @ "@搐" L@  N @^@[ $ "b@H  N 2""@l@א@: @^@6@ @ ߀ܐ "`  @ 㿘@?@  ?" @ ? .@ @Cannot seek to start positionwCannot create pipe㿘 # !@#@"a`#!h@ڒ t?ߝ"@n"@l"@i"+?@1Ԑ @  @M "y?E  ?` $  @ . :  "  $* `@r?*ݲ`$ $P? ?` $  @ . :  "  $* `@r? ހ?@. @ @; y ޹ ܐ "`@   ْT?(( 3 ڄ? Invalid mark letter㿘? . * 1"Ȑ? ##@>  . * 1ٰ!Cannot seek to end of fileMark not set㿘 '", . $0' ^$:ٰ#H& & b<*"#Ht $  `!Ự#H&  ?& !Ჰ#H& & :"<$#H!  ?$ @  㿘`?㿐 @ & & :"<&㿐@? ڒ"`"`:"<"ā㿐!ڐĀ@ `?2 ':"<""` |"``'`':@"<@ Mark not in current file㿘h :"<@$"@ ?Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 &:  :0.0+*""Td $#8  :"L $#P &:"bT<"L :$#p "T'$#@1㿘: "bP’Line number is required after -l㿐 ' l@b 2%`;% @  0 "aCannot use lesskey file "%s"㿐   %'!(@㿘  0"; "!׾@4 `:"< @? ﰐ װ 0<`|Tags file "%s"㿐 <  ""#0׍<"c#'%"0@/㿘  ; "!騐%饐"%s㿐 (  "N@0+*N@ M" m = < ܰ @ ` D`#` <@' & ܐ <*`@'%"@]㿘   !n!$!㿘   @ 㿘     Use "h" for help㿘    & h@ 0'  @4c: "bD 4There is no %s flag ("less -\?" for help)㿐'D!!؀ " D € $!"!ؒJ  &! J? `0Z'D*`X0000000000000000000000X000X000000000          DJ@ +`?`"iJ@`d'D; "!DJ@ +`L'D:"b8DD@P'DD?'D z@2  @b'&!(@t\    "`   `, # D&     `?"N  @  @*`? J aD@q'DD@  "@ D €DJ@ U There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@e@'' x ` @@א''   `! @̐'' @ޒ0    HJ "  ` @  "j``  "#   ^`: 1X`M"` O`"` K`@``?C"@9"` ;`"N@7`N@@@` @c`?` *"@4)`%'  Ѐ"` H`'` @ 2``  "` `"@!@] 05`   `€H`  @ $`  "`    ` *  '`@1` ܐ "``  @ ` -%s㿘]1ڐ!(@ `Ȱ!Ё㿘@p "   S@ 㿘@d" ` 2` ؀@ String is required after %s㿐͐'(!x@ߒ㿘!J㿘N 2Է   `$2 . N Number is required after %s㿐ԐL -    ?А ? $&'("@@Ԁ   ?А* *`:` ?Р  А (. $&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe less helpful in promptsBe helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screen;H  "    J2 ;HUDJ "  J( P J 㿀'''@! " @Ր ?@!ܐ $ @+$  ?㿘ڐ!@ْ 㿐@{8%s: %s㿘.@ @I@F  *c@3 * 8"㿘!<!p <@׽ d$!p<!p . * * @׮ d@ת㿐 ܀ ܐ j"`  ;L;    0 0      0 0׹  כ  `@9   0  0 חק׷㿘<!xڐ"@:"D   ڒb@8ܐ "`<ڐ""ax㿘<!xې"@ `T <5"`T<!x"!x*㿘  *` : N 㿈6 `2 @ 0, @ ` -, 耤 $?L?㿘  ,*`:  % `N d  s2N@` *` : `L  N@` @N 㿘` "`:"D  ֽ :"D <j 0%!Ġ  4@  q    ?P 8ܐ "`)㿘ք֔<P!֕ܐ "`T㿘:"D  ko@:"D  0  8ܐ "`??? << 2 8<*  ݆@ <അ*` `@  <ḅ( ` <*` `"<  ݐ <? ("@㿐 b!<! ?@S@۹!#<'# `6. *`@DttttttttttttttttttttttttttttthttttttttttDtttt\# ې" ?@ 188 ,:"<.@`X/@ ,  ' 0Y 4!  0 P q?i 4  0b8 @ :"<@  㿘?`6."*`@p                                    (  8  p   ?\0; 0X:P"<: "<< Jޞ ` A <А?0:˞?.`+!|ےb# ۖ" J  "  :o"<   J:" ?." \ J2 02 0?㿘N l"   p b" 0UT ?* : `2J/!*`@&@?&@? &@? &@ |&@&@?㿐ےb"# N 21/Z# ?#ۑ*`:  :# ? %" .". c  \" c  $c !* N q 2 H N ?] N " P# ې"@1 # ` *ې"@# &1۰"㿘<# 㿘 ܖ<+  8"@ 4"@  @' [V   (8acd(" @J@2 @( @*`J@ @* [(8   J  <@ 㿘ۀ c`. "c  # ?%?"  @  " [ ?"#No previous regular expression㿘 0#t 0c`?"c Invalid pattern㿘 2 @є  <@0#U  ?# "<@<"# 㿘<# "<@<"#㿈<# @Ѱ `?` &@&  㿘<# "<@׶<"#ې?"c"\<2 <"  "  @$ 2 㿘 ``  @ 2" ` & &``" ``` 4 &```@&@[0&@"㿐  +   &     2J@&  J@ `'J` `J` ݐ`'J` `׀ 㿈'L='P:'LP  H L""`P""`P(N  ݴL%P L 耢` 1<@'a#耢`2@㿘# `d"#㿐f? ?@Ho 㿘"# \ 㿘.  " ӹ?oӲ h "ܐ  x ? D |r K 㿈C+) ܀ r?` 0`  `Y`?݀`2'@T  , $c   c@  "h@ 2 @   "݀ݶ \  Z 쀧 2' Nothing to search㿐`N@  20Q# \   \  c "c3"#m d 8 Ԑ M?  "#  d "#`d"# \ c "# \ ? '`&2#p  !??   \  : 0 i`| \  .  㿘'H3c# pcH?  #?HH; *` 'H9HH??#H ; *` 'H#'H#; *` ;  *` &#&; @ ;#`"H?ېH   H H?H"#"#㿘 3@c`ܐ "`  㿘 3@ߒc`ܐ "`  㿘 4@͒``ܐ "`  㿘   3@ֹc 3@ֵcȐ 4 `@֯  @֬   @֨Line numbers turned off㿘 ܀U"" ܐ @֕ Цfl  @֊  @և @@ϒ  3@c ?ܐ "`! 8)  8    2  : "`ܐ "`j;` "` ܐ "`" 4  tagsrNo tags fileNo such tag in tags file㿐<#4@}'bP4y"X@סۢ#()+'ې @}D f@i L  %c% $_'J@ % J@J@  `'J`  * E''J ̐ $ *$`'J` ^J@`'%cJ "JJ``\ '`' @*J J $"*@ʐ0 @ǐ4"h' " Tag not found㿐#   ,5  &?b -+)܀ Y` Ӓ#@@Ȓ ܁/dev/tty㿘5!@4 ۀ "c "c㿐#۠?cW ? ?ODZ O "/ c㿘@ Ffs.%s8@#)5'ݠ %#ݐ@J"`? f"$ s F"$ 0"$a@K"*`@& ݒ!! >!X>#؀ "@   . 0" @. @@5bh@4 @֜`@/ @֗?@  5bp@/ޔ<    @@@ `@@v%s: is a directory%s/%s8! @ 5"pK! <  6 @W%= @b <  ݐ@/В / $68@Ȗ!  @ .  5!€ 5"p@V 0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘Z#6@a@ 㿘@㿘 @@e`@㿘`@@_ @㿘`< < ` 4 `< < ` &?`< $`$$`<   $`$ؒ?㿘`< < ` 4?`< < ` & `< $`$$`< ? $`$ 㿘`< < `4 `< < `&?`< `$`<   `?㿘`< < `4?`< < `& `< `$`< ? `u 㿘`< < (`(4 `< < (`(&?`< ,`,$`<   ,`,L?㿘`< < (`(4?`< < (`(& `< ,`,$`< ? ,`,/ 㿘`< <00@4 @2  <44@( < `<00@4?@ 44@?㿘`< <00@4?@2  <44@( <?`<00@4 @ 44@ ߒuappnd,uchgnodumpopaquesappndarchschg㿘*!  !7@xkb7"  `@xb!ݐ!7@x]c7"  `@xT!ݐ!7@xOc7"  `@xF!ݐ!7@xAc7" `@x7!ݐ!7@x2c7"@ `@x(!ݐ!7@x#c 7" `@x!ݐ!7@xc(7"`݀`! ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&')@'%8@0Ӓ`ࠒ"$ &L "8 n2 L  o2    ?* : `8!*`@H@7c @l  8```@` 2 `"8&`"8@&@`?8`@F  2ǰ `"8 &`"8@ &@7c@.  2 `"8 }&`"{8@ v&@7c@  2``8a@   2`"^8Y&`"W8@R&@7c(@  ``8a@  8a@ 2a `"48/&`"-8@(&@7b@Ȕ  2``8a @  2`"8  &`" 8@ &@7c@  ``8a(@  8a0@ 2 `"8 &`"8@ &@ COLUMNS1ACFLRSTWacdfgiklnoqrstu㿈@. @:  9@Ӑ" " @w="``h@с 2`=" ݐ "a"ݐ "a@L  ݐ "a9#l)ݠ '%31/-+=9@ (??π D* h|4$0DP\p%!$$$%!$$&a$&a%!$&!%%&!"! `%Т` "!"!%"!"!ݐ$"a~ {"!x"!u"!s%`p"!m"" j%`g"!@.d9K"&* !Ԁ ! !  ! = "`!  ! ! "`!쀢 2`! ! ݐ@-aݒ!! &!: "@!̀ (=   6D @<"X79"T! 72 !Ā "7*!,6'"   6 "@7!! 6 #!Ā 7 6"p"a!܀ =  ! =!> "a =`@@W %s: directory causes a cycle%s: %s %s: %s: fts_read㿘!耢  <#@2 @* @H @p ! b!Ѐ  `  @5@L.`4 " ;  "V`20 !;0 @Qߒ`@0!;`@@u+` @Q֒0  N`@ .!  ; @v/`  ; @v'` &@@!Ѐ  @ؔ 0  ;@*`؁%u-%lu%qu''`; 'L!Ԁ   ! 2'L! "'t'L't '|  'l'd'\'T  Ю 'D'<4   !;@@t @Q_ `2 L@4`! $ . ! ݚ $ ! @ @_&&8L` <`8   2``< (``<`| 8'|` t 8't`08 `02`<`4(`<`0`<! f!Ȁ  D;b@` < ;b@`D <` @ƒ `@ @T 4'T@\ 4'\!䀢 ;`DVb@մd@ 4'd    @5   @)C $@s $ @s`< @@@ݚ 'l!䀢  $ @sz$294J'''L`.l''̠ #;b@R@ω'd'\' b@F|@}' b@>t@u' ;@4@k'T'!@ݐ "a!  @㿘 4"2 @ 4 +   2$  2!?z@R 2 ! 2 ݀  ?!€@㿘 #Z   @ cH? "cH`$cH*@ @X   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd %sxR 2 "! 2 ! "  ?a@Ĵ =@t3!`-=+<)Z !Ԁ <=!p @t`!  !?: `8@ B  @o;  x@t `@= $`  , #\ #`!@s!䀢 =! @s ` @@2  =! `@s `݀    (=!"@ =@s`0ݐx (@s`0! `!Ā "` `(@=!@s@! "`@`` ( #H@5#H? "#H %#H * @X0 2s 㿘= D@$"D! !@ѓ*` $!@O( ` !` .`"```2` !Ԁ    ! ݨ  ! 2  =-  !=А0p @y @u@q@m 2R 2  ! 2 ! @ ?a@í =@s,!` @B95Z  )!,@ @8  Z#H`?`$``@ @`$@*@@W &!H? "H &H * @W| `@Ŧ 㿘 <!Ԁ  =!p@r`! !?: `8@ B  @);  =!x@rÒ=!@r @! @`㿘'D@n#D Z#HL@ ?`&  @  `&*@ @W'  $L@"  Z#HL@ ?`&  @  `&*@ @W  $L@VZD;!@fܐ  Z#HL@ ?`&  @  `&*@ @V  $L@1ZZ#H?`"@  " *@Vʒ  Z#HL@ ?`&  @  `&*@ @V  $L@Z#H?`"@  " *@V 㿘<(@"6Z @ @ Z] I0@88@FZT I#H?`"@\ / " /X*Z#H?`"@K | " |G*#H?`"@; @ " @7*Z#H?`"@* = " =&*#H?`"@ % " %*Z#H?`"@ * " **@V   %s/%s ls: %s: %s -> %s㷈V 2 2  $=@ǖ @ $@@ @@ʭ$ .@pA Z#@`@0 *7@!@qN[J  !H ? (usage: ls [-1ACFLRSTWacdfikloqrstu] [file ...] 㿘Z#@@vb(@ސ 㿘@m:pinvalid file mode: %s%s㿘@   @@ؓb@ 8 ! '@#.)@@+⨀? m p @O` " @`@ޒ!@K"* @@ @@ - , -`@@%  ? / *@@@8J@ 4 @@ 4` 6`  @@4  6`@"@LM@ `@ @a/%s: %s8A x@&@HL`?,@c . 2 @`2.`.2 @e @"@L?<    /!A@oP  @K? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘Z#A@a@ 㿘@&node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐@ "`@_`J c! !`J b A@*b` @  ` @ J@  A@b `@ `@ J@  A@b@,  2    A@b`. `@2`  Ab@#`@ʃ usage: mknod name [b | c] major minor 㿘Z#A@c@n 㿘@unionsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿈@    B!hB#05ݪ #./B@/p?k? 8d*                                         (         4   X  `     &`J@ "B@ =# B @ƒa@:``@% ?@BK"&* @ _   0=06@LB @a B @a B @a @  B @ђa @ ۀ   `?#\@/ 2Ϣ 0@Ւ   B@"PaȀ. @@ < " @;@ &. @=# @@@@u@ ' Ba@=@@Ґ L2&  Bb@2@) L@@2  @@2  Bb @ @B@0a B @*a  B @$a "  BbP@ @ #\  # 2#\@B@lbx B"@@r 2#\@` @@"`%@  B"B@mbBb@#  @ ? .  B@!b@@O,㿘N@ n N` o `@P 'D`? @PJ@ n J` o  `@l "  @l " @Ă/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %swaitpid%s: %s\@h `D!hD!  O@ B!D!@P:@ݒD@5aȀ  @'%@h ע@R Z @J  " ˒D! D@lӚa° D@bB@a@D@bh$D@ 'd'h 'dd@hd`'d*`">p`'d*"p*`@"~p" D"(@l dD1D, @"8@l~p d, D@l"@o @#?  >0-D@H"H@Õ_  hh9D7.3D$"P@@h b`@G  . D"`h@G@ @l`@5 `D@Gݐ"p,  `>  0#   " @ D"x@G0"  @h D!@G @h %s on %s type %.*s%s%s (, %sunknown flag%s %#xs) 㿘E"Ȓ  L @k  #"b'x't>c@@ X)> %.->K@C?ђ?΀`FK"*`@0$05555555555555555055551,551555354545555555555550T00155551551551534d4455585c "%#K @ݒ`# "%cK @Ւ`` =$`|@ir |J 2K`6$`8K `@`S ~%` z$`|@iU |J 2 `4$`@ K`@`6`(a$`|@i< |J 2 `4$`( Ka@`` @H$`|@i# |J 2 `4$`< Ka @p``@ .$`Jax@tt  %t  ` $`t t`($`t t` @$`t  c "%# K@<a8t@ # "%c K@0a8` =$`t @@` $`t >"#t!$`$`t$ c "%# K@aX`!$`t(t` $`t@>$`  "ct@ !>K@ax@dK 4#'t`$`c "%# K@aX`!$`|@h |J 2 `ݐ Ka@""|@hn |J 2 `4$`$ Ka@` }$`` y$`$` > t"c|@hO |J 2 `4$`, Ka@` ^$`|@h9 |J 2 `4$`  Ka@` H$`|@h# |J 2 `4$`0 Ka@p` 2$`>/"#@|,KK"&*  @@q@`@ K@ !x@@  . - Kb@C@+`%6># K@9  ? K@b(@ @@ @ @ K@ː"0K"8 @A? !'%.#K@   Q @@bH!@ no : or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRC%sMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp?'!ݐ"x@kД Z"x, Z@k @  @k : M@?"#0  *#@V b `$b @b  2>M #@ M#@? "@@ >#     ""  ` =&`  "ݐ "b(" 7ݨ"%>ݬ"(+ݐ -  o5 >#,`   ab@k, 2 5  bN@L {b ''># `  ab @HN  ''ܐab@l   TbN@L[ Ob@&$ ''`$  %%'' #\@ OO! # 2># pN@J`0Z#N@`( bN@J`8N@>L ( b `@  @%bb? "%b  ?@$  ?N @`H@S @E@ @ @ K@\"0 $@@% <b A "( ># .@4 "(@aY"`N P@> ݐ"2 &` &`ݐ"8&`?&`ݐ"x&`D 㿘'HH@rє$㿐 @p "J @ "`D    =  &` `@r  5@p͒` "0 ` ? ?*`@q` $@p   @p `@"` &`2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘Z#ObOOPO#O@ c@s ,-o %s: option not supported㿘@Dߐ @ P@u`0?L n L  o  @i = 2*@` "   >  @2   "*@ "#؀ 2Š P `8@ꆔ @㿘@OBBBBBBBBxBpBhB`BX unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfs㿐@%P'#.!P@0Ѐ? ? o`!@A@)K"&*  @@P"`@  @ @ usage: mount_kernfs [-o options] /kern mount_point 㿘Z#P@c@} ,-o %s: option not supported㿘@C @ Q@`5L n L  o  @h = 2*@_ "   "Q @2    &*@& `@隔Ƞ @㿘@if%s: destination pathname too long0@['Q%#ݠ @h? f i$ $c$$c$$ @K"&*  @@@G "c(. ?@  <   $@@@@d`@. @@^z@L / /,@`?# )Q@@V / @@ #!p@;@  @r@@4 "? ?`@overwrite %s? override %s%s%s/%s for %s? cannot resolve %s: %scannot rename a mount pointrename %s to %scan't remove %s%s # s@b m#$   Z#Qcx@0`#( )@bՒ  $@n 2  @}@ @ O Q#Q##\Z#Qc@ʘ` `/Z"`? "`@v Z"""  ` Z%Z"`y ? $ @v͐`$ @` `y`Y2h @B .`  !Q@Ē 2 Q#@:N @Ȓ @s[Ԁ  Q@:#= #@:7 @ <   @  R @# R  @Β R @: 0<  @(@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set times㿈  @ 6R &@! R @:H@0  @1 .  ?Ð@/* c #!@@"c $#@:) n #)+Rc@# c@"`R @:@ R#@:@@G @." , R#@9 3 6# R#@9@ R#@9ݒ' '''@ꤒ耢 R#@9Β@ R  @H R #@9 /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿀'@'䀢 2!S"SbS@ښ R @9"@< @Д ? S"S@9vbK  S"S@9mbB : S"S7b@ 2!S#SbS @ R @9P#@  @ ? S"S@9Dc  S"S@9;c :    S"Sc:@9+ usage: mv [-fi] source target mv [-fi] source ... directory 㿘!Z#T@’`#T@a@& 㿘@ (    *`2 ,-o %s: option not supported㿘@@{ @N T@a5L n L  o  @e@ = 2*@\_ "   "T @2    &*@& a@,Ƞ @'updateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%d@r    8T@c " "`@ T#@ Ѐ T#T#V" !./?@y?1? ;)* ^^^^^^^^^^^^^^^Z[^^^[[4^^^^^^^^^^^^[D[h[[[\^^\4^\X\|\\\]^]]^^D^^^h^]" " @Zx ߀ "`Tא# "a@Zk ? "cUʐ @Zb ?/"cpU 8@ZY ? "ctU P@ a "a@ZJ ? "cU h@ZA ߀ "aU @Z8 ? "clU @Z/ ߀ "a U @Z& ? "chU @Z ߀ "a U|!@Z ?`"#x`cy`Uo! @Z ? o"cUf!8 Ѐ   ?b?3a`U@na`  ?"#|V%U@nah U?"#|L%@!pI`@Y ? B"c`U9!@Y ߀ 9"aU0!@Y ߀ 0"aU'!@Y ߀ "`U"@m  U@nmb( 2 `@Y ߀ "`U "0@Y ?  "cdU"H@P `@J`͐K"&* ` @ А& @8 Ѐ 2@ @ *U@n/b( $$Up@|C%$#UbU@|9@ #$bU@|/@  Ub@  Ѐ 'U@nb !?` @e!"' @' ''$''.7 77'' / 7@  /!ސ Ub#Ub@Y  @o? ސ UbДb@Yަ  N?@d 6 .@Xc U"@@   .@XU U"@ U"Ȓ@˔  " &5U? r-U Ȓ@ ,@m @m  @tL!' Ѐ !! "@p U#@]!j @ 6 .@X U"@M@ 6 .@W U"@?<    Ѐ 2 @ U#(`8@X@@a  ?"UJ?`` `@M@[a  U#P@@@ƒM@[a   M@* : 2 U#@@M@ U#@@M@a "a!   Ѐ U#@@M@a 2  H "a."a`쀢 2  0 "`V @@` 2  , "`V 0@@`䀢 2 ? ( "`V P@@?ch?2 L "ch"cha 2 ? J "a  "a ?cl  cl "cl (c$ "!?#p #p @  $#p?#l* @ "?## 2 ߠ ?@@Ycp? $ $a ??#l* "a ?#x ?#?c| ?#?c`!Z#V@e`p#V`@`  $c|?c`?2 @ "c`"c`? c` "?cd?! B "cd"cd! @`?cd" $! 8  Z#V`VV@-!a 2?#p2 "a'P'T'X '\! 䀢a " @""$ ! @$ ! @ے$ !!@֒$!!!@ђ$!@%%$ 䀤b `&a<` ߐ""`!ߐ@[ $ !ߐ@V $ !ߐ@Q!$!!ߐ@L!$!@H$@ ab@"@9 $`&a@:` $  ߐP@y  @v @ߐ@ݐ Ѐ .@ΠV@V͒a0'p?'x?#  't't '!@`'?T#`@Dp  .@V  U"@V`@ܐ ioctl (GDINFO)㿘e`e@}0 613aa "a@Ð U#@4a0 Z@2"?#@,1ݰ#0ioctl (WDINFO)%s: can't rewrite disk label㿘! 66 e`g@C Z@2t#0Z#@@㿘'H'L'P'T'XH @x     8 @4  @3@4B@Jc@n usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder 㿘 Ѐ  Z#[`@Z#[`x@8!Z#[@ `#[@`#[@a#[@a(#[@a@#[@aP#[@ap#[@a#[@a#[@aȐ#[@b#[@b#[@ܒb0#[@ؒbP#[@Ԓbp#[@Вb#[@̒bȐ#[@Ȓc#[@Ēc #[@c8#[@cX#[@cp#[@c#[@c@ buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/''|'t!ߐ @  $!$!@ @ $ !@ z@ $!!@ t@ $ \@SI!@ @G Ѐ @@'l k@Oc\@ _2\@8!@ @ ? @ޑ: @ܐ @ C #!a@ a ?@@ $a!@`@ .߀ "`@ "!"! !$?"e,"e(!$ "e, <"e(!`4!\@R!@ !ߐ?`@ !$!$ "` 쀢"`\!@RӒ @ !$ `4\@RȐ!@ !$?#p"`0?#l"`4`0 "\@R"@q !$ 4 "\@R"0@f !$ 4`䀢 6\"`@R @Y !$ 0o4\"@R@N !$ 0 4@ 6\@R"@C !$0 "H4 "LH8: :8L8: :@"P0 !$`P <"`P!$" T 4 !$`T <"`T!$`0`T: "`8"```8 !$`` <"``!$`8  0&\#`40@R::@ !$?#$%P 02 $ t 02 $ x 4@N`$ |$ d | !$`d <"`d!$??#c?`4@6 ?`8@1@Β$``4 @(?`8@#@$` `8 $``?`|@ ?`8@@$`?$`` !$`* <"`!$ * "!$0* * ?: :00:  #a$ t:   @ %0@ C<%0!$!"|`*@"X 2ߑ: "X < !$cX: "cX <"cX!$cX`@P`6``x@@F`0* @ ?@@;4!$ x `@:   @, | 8@' ?  @?@|@$ $ ?#   "e$ +?#a$ * @%P*  @ `,`: @a$ @ @V |`,`: @a$%$  0*  @  | `@C* `,`: @8a$D @A a$`0! * "`0<a$#X* $#X.?@@$ a$`8* "`8`` "```8 a$a$ 4 0@ a$\@P#H\@Pߐ#h@ `8: "`8``?"```4* "`4`|* "`|ߐ@`@"ߐ@a ?!$`x@@}$`+a$`0,@֒ ?`x@ђ@nwu `8 qn!\#\@]"@#c@Pa$ 0: $ 0 8: $ 8 `?$ `>?@@C$ * @?%P*  @ `,`: @a$ @2 @ |`,`: @a$%$  0*  @!  | `@~* `,`: @a$ a$@a$`0* "`0a$`@"ߐ@aa ?`x@[@}$` (!$ 0* @N ? x@I@ @"@>\# `` \#@P a ] @P` !$] (@P`] @O ߀`!$!$? 0cp ] H]@O`h!$? 4cl ] ]@Oߒ`@ ?#t"`@  ! ] ]!] @Oɔ!$ ?@@$ ! ?"#t!$@v`"@a ?`x@Β@k$`'%$`0* @Ē ?`x@@\`@)߸ `"@$`@R"@ ?`x@@H$`+!$ * @@%P*  @ `,`: @!$ @3 @ |`,`: @!$%$  0*  @"  | `@* `,`: @8 ߀@ߺ !$`"@$`@"@fa ?`x@a@$`!$ @ @W |$  @  | `@O* "]@O$! @ސ !$ 6]!H@O@Ӑ !$? ct.! `]@O ! `` `@  ] !`]!]!@N!$]!@N`! @ !$* @P*  `,`: @!$ @ @ |`,`: @!$e$ * `@``|``@* `,`:  !$e@ B`L ;   $!`d: $`$@d`|@`$``$@]`|@Y`$` 't!$ 4]@N"@@ !$! "?#h" " "LD%hL "h "X!$%P@-#X* #X@)  | `@* %P  eh#X ߐ#\$%T%` $%X!$%`"eTe`"eX !!$|`* * @!$]"#\]"@]bX]`]"@N/`!$"#X!$DL "h X-'ߨ? $%P.#\a$eL?.  $eT@@eP* 2a$%P&a$!$#X&۶ !$@`8z+a$@|@ @@@@@@@P@`<L?..#\ a$eT@@eP* T? a$eL?2eX%` @ *eL?2a$%` eX@@a$eL?..#\  eT@@XeP*  ",@a$eL?..#\  eT@@DeP* 4a$ 8a$!$ @ $ , @ `$ ,!$ x ` @:   $  ,? 8 4 )!$@``,@`` $`&ߐ@h`8$@c`8]"@M9!$]#(`]@M2`@ !$ ,?@  $" Lt ,@@   B`% 8*`  @ |]@M#x@Ȑ $@  ,@@   @% 8@! 8]#@L$@`|]@L#$`,?$`,`@ `$$`@`@`|$`$`d* "'tt Ѐ !$! d: @ | ?@ $@ ^ 8@L"@!$`"``,* eD `L "``02  "`l "`p!$`p <"`p!!$ @` $!^@L p@T #a$F!T$%\?#$ @?#x$ <?#$ X!$ \!@ <$ D?#|$ $"$ $ $ $ , a$* a$ *`a$@p"`a$$  Ѐ . $@* | #\^ | ^ @L[ a$ $ 4 ($@ F ("F #`#\'^ ? ,@L>  Ѐ ^@L7!@  !$ ,6/ު)ߐ@Ѐ 2&%^!$@``.@```d@@K, ^@L !H ^!P@LZ@#H!$ ,Ӑ Ѐ 2^@K!H  Ѐ @ @#a$$ @`?c@ a$  !#!$T< @d*@"0@4a @ !$`0`&!$ !$ , %'?$@p``.@k```d,@v$ ,&$ ( $`4  `;( $ 0 Ѐ l@ @4@  @  @ ^@K!XPanic: cylinder group too big 㿘!$@.   $4!$@"``.@`` %` $`?`4@o ߓ. !@!#a$ ؒ @ $ @"U$ $ a$`,?`@T`4  !$ 2` !$`4 '$ e$  @?`8$ p ؐ $T!$`,  $X`@eP* $\```: \ $`!$%$  ؤ @ @ |`,`: 0` ؤ!$ @ @ |`,`: ` ?$`h h` "h!$%$ *  "l  @  | `@* `,`: l $`d  d"@!$ @$f@J! @i % !$ ` )"  @"U : `   \   $ +  *` ?"`  )+!$`x```@: * `02 #@n a, @ "`l a$ 02  !$@``.@```d,`0@$a!$ 8Ѥ ߲ @!$-+@"U$@_ 8``c```@@$%$ `؀``: ``l  l `` ?$@ *@  + `` $`$@ |@/ * `T``T@@ @ "@$@|@@@@@@@ @P@* ` @*  ``X@$@ |@ @%P*  4$ 8@@$!$`("`(!$ `" ( $ (@ 86 8"*  4`" 4 8&@6)@"U : `   `   $ +  *`$ "`$ߔ!$ 8@' @ )@"U+$@ 8 `c ``@@a$%$  ؀``:  `l  l `` ?$@ *@  +  ` $`a$@ |@[ * `T `T@@ @ "@a$@|@F@C@@=@@@7@P@3*   @+*   `X@a$@ |@ @%P*  4a$ 8@ @ '@'@ 62 ؒ"@*`@`4 "`4@"U '``: `  `  `` &@ +@  *`$ `@ "`$!$%$ ; `h@`l@ @   `p" !$ ؀@   $4*     *   p瀋@  !$%$4*   !$ ` $``$ $`` $``  $`'@'` '`$'` @``.@`` `d,`0@"㿘ߐa(" " "  Ѐ #!2a(ߠ!( 4   @"(@1 :  < @ @) ߔ(: :#a$ߠa( 4@`a($ (a$ @@ C L :` @ + 3`  3 $ hdޑ* 4@Ԑ@ 㿘 Ԣ @",`,   4 @ `@$,`@*` 2` ` @x"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘!$` `d!ޑ*`@C   @"U@i5#    i,#ޒ  $i%@"U'``$c``@$@`8@ $ 8` `i#@Gr 0a$ `>a$ @"U@ ``@@!$%$  ؀  :  `l  l   ?$ *@ * +  ?"!$Đ?"!`?"`@  " "@ "@!$@ |@B *  @"U@T  `T@@ @?"@!$@`|@'`@$`@`@`@`@@`@eP@`*   @"U@@ `*   `X@!$@ |@ @%P* @@@?6@!$ 0@J 4@ a 8"@ @ "  8"@ ̒@ $ ` 8"@$@ "$ 8"@*`@ `4"`4 8)@"U ߐ , :  `   `     " (  *a$ 8␆ !$` `dޑ*`@M؁fsinit: inode value out of range (%d). ?c@j!& l!$` `d*`@   @"U@"i@FR#@    ?" @"U@6`  `\@ ` *@  *!!$` `dޑ*`@!$`Ȑ?"`!?"`@`,@ )k!0@F@֐ !$@ @  ,@ @ @@ @ x `* @ d,@'? 0@!$@s`x* @ !$`0@”㿘@ getrlimitsetrlimit㿈#`Ȁ 2&@ @Yɠ?$`Ȑ * @" @C耢 6k@*#p? @v耢 k@*#""a Ȱ.!8a" "a@ 㿘   @0@㿘@L @&seek error: %ld rdfsread error: %ld 㿘 Ѐ  ߐ@*`  @0+>  @;  !  @[ 6 l!@EHl@*2!(@ !!@ l!0@E9l@*#!(@ "wtfswrite error: %ld 㿘 Ѐ  ߐ@``@@0/ +>  @d;  !  @ 6 l!@El@)"8@ #!@2 l"@@Dl@)ܐ"8@ $isblock bad fs_frag %d 㿘 8 "  $Z  Z@ !`?*  *@>*  *@>@  `? * >@  `?#lcX@z 8 clrblock bad fs_frag %d 㿘 8 >  >Z Z.@>*` *`  * @ *@.@ #m`H@y 8setblock bad fs_frag %d 㿘 8 >  >Z Z .@>*  *   *@@  .@ #ma@y 8COLUMNS㿐  `h@?2  m@!Ѐ  @C" P㿘@8Failed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`A t?A@iA?"`tA""0"a""A" x""xB"`rm#*`@d  A" tm"`-"bԒ @n!A &"`t. `mh@I[  A "`tm""bԒ&@ny!A "`t. `mA "`" .A@ t+A"   m@b A "`tm""bԒ @nM!A "`t. `m@IAm""bA t !?" "!A@  .`m@H"!A t@aЀ  . `m@H0!<   mc0@H!A@ t?$ tA" ΰ?!<  2A xA ta@y   "$!<  AA "`x t  @ ?A2 " x. AA "`x" xA x A" B" 2AA" x`|n#*`@Aq?B"  "A""e"a"` >#@a2"""bB" BA x ?AAAB" " ߕ< @{" 2 `A""0"a ?"b1!: @{" "`">$" b B "bB" AAb "!?"aA""b"A "` %s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿈A t  B""x"a"" ZZ#H#"Ѐ !A x #A"  ? $  $ * @&oa@w;@#A` A t@aЀ Aߔ!!<  A(  A, 2A@c"$`A@M t"Ѐ A x  Ao!@&̒""@АA?"`t! !Ā s"!"aB" A`| "`|"Ѐ b" B ? $  $ * @&""B"  oa@v0<o" @Ub #""؀ ` "" @x o@vb(0o"8@Ub B"A |"#\#`"#d#hob@b?@vbx@S""x?cA x A  %A#?t@q?tA" Unable to truncate archive file㿘A" A x  A t  @   A  @Xi t   . `p@F?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘A x ߐ p@FLcP?"0   pc@F?? Failed read on archive volume %dEnd of archive volume %d reached㿘A 3A x A@ tߔ "!b"! "b""0@ tߐ "aA  " .A `q8@F |0A q``@E|Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘A A t@U A " "!A" " A x I , C !A t  @  4>  bA  @W[ t * %A %. 倢 `E A .  . q@EWapA" F  ?  A"   A "`ߐ "aA   q&a A q``@E-|0 B.A `q@EL|0" ` @   qbqb8@ECannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐!Ȁ q?A lB"?  rb`! ߐ "aA x  4F߀ C"!a  7"a7 'A t a@ 0A/" " A x A"A t  @!  >   @xa@ dA t@   AA "`"!A  r@DyaP  ra @Dr?Foward positioning operation on archive failed㿘  > 2B `(? A 4A8 x 24 A t  @˖  ߖ@C""4 ߀2 >`(>@ b >A t  @   . `r@DI`A?"`?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐A 6A x O  4  A`} s@C`tA A rA`(p  t  @0   . `s@C̔ZAbAA |  s@Ca KA  A t  @  DA. `s@CH8A@u2 "" 1A`/ @w;<   `" s@CbapA7@u2< 'A t a@5 A. `s@CsA?"`? "` Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?cA  'A?#t@? @  . `t@C(? 7 'A t a@”   . `t@CHv?7 'A t a@  A. `t@Bpb??c t @? 'A. `t@B۔P??#t@r? 4t   . `t@BƔ(;?7 'A t a@s  A. `t@BH'? `#"`@~  s@Byap? 7@'A t a@M  . `t@B?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈 b@쀢 . `t@A @  . `t@A!Ȁ ?A o"8@P b Dt#@A$b1"m@Ob "A"m@Ob` "AA x z x  Au "@A|u  @Au hb@@|u @@B"? 8uu ߐ "aA?"` u@Ab? @@%#u!u @@u@@א!u@@Ԑ!@u@@ѐ!h@@, u@Oa Oߐ J"aȀ $aO  aO Y  s S"ua yai"Ԁ lu!@@"uu@@! %@@uAu"@@`|% !A#u"0@@u@@"X@@, u@O\a O"!A?"`u!@@r"" uu@@i"hu@OBb u@@_"u@,u@@V"u u @b$ @" U$b$ "@@>u could not pipecould not forkar_start_gzip: impossible-c-dccould not exec㿐@ɐ  v@͒c@ v @ŒcB"   2  @0 v@ǒc@)@'0/"    @͒ @ʒ v#@Ē @ v#А v@äc@@"@  v@~c؁?#p@D@ \#Bb D Ub  O"Ѐ  @  F@  A@. )Z  x@ 'B@+ &"B2@0Q 2@+ B@,^ &B2@R#H B@ B" ( b@6 @*Cannot chdir to %sCan't fchdir to starting directory?#p@Ϥ@ s!B" D l"  f@7 a# @5( X@.@   x?# 8?#0 @?#8-Z @  /B@+&*B4u@/ϐ 2p"Ȁ " *@d %"Ȁ " @@M" " @B@$>@*[ B@+&B@3Z." " *@dO &" "  @ " "@  B@"Ѐ  @c @@ "b "  "@  . `w@>  3 1? @4@5 B@y @2"Ѐ 6" 2? " % * @o !""@k B B@O@20"? < @"Ѐ " ? " % * @; "" 2 ?# B@   @<" . `w@>>0" ( b@ b@6@)1Unable to open %s to read㿈?'B"  @1  @ !B" , " 0# @3 @,  '#Z%  x@] ̀`@.[ ?'"Ȁ  @2&`@d @1   ?  @b  '.y `@=0@*?@@1` "|  @/  А@@1ܐ0Ѐ  @c @c $bx "bx@Ԓ_` Ѐ  c? "c`$c*@ @J $@0tB" @@Ѐ  c? "c $c * @% $ 耢 2 쀢 (@耢 ` = 9@ 4`B" 4@k b@ F"Ā @5@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. ?#p@#B@b   b  za@<0!B" D {"  u"Ȁ B@1r lB" @3 b"Ѐ  Z#za@lN "b  x@E -B@- 2"Ȁ @1 &B  B@W B0"@2  B B@F B" ( @0@ "Ѐ  !" z"Z@c$"5 "Ȁ @0 @4 B" D ?#p@ Cannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b?#?$?#?#c@=,M? / /- -,"%@a  . `{@;0S<   {a@;0G@/ C@ >@3 9# @1k 0@S;?#?#  8 @/%Z+@! ?$@, "Ȁ 2L`b 5L` /`?@"  {a@@;n`0`@ @>.@`̒ -"Ȁ  b @@ @b @@@@@/2 ʐ @'&Ő ?# @) " `" #`@` "  "  @@@ " @@@|Ѐ `@ %bbx "bx"䀢 @@ݐ`Ѐ ]b Z? d"`$ a*@ @ ! ? @u@v`@/+Ѐ 5b 2? 6";  @  @`   $. `y @:@ 0@@@/0 @@@ Ѐ b ? " $ * @ %b b@ @3?@PPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 ' B" ߒ"8?5|/B3|)߬"8 @Ւ "^?  @ ` Lp" > @: c`!B" $€ $"` ``8 ( `ɒ"8 "8   }@9``"8 @۔ @B"` "`8@ 0|c?0 |c@9ǰ?0bx "bx Cannot identify format. Searching...Sorry, unable to determine archive format.㿘" B!  B!A#P.  *` *   & .  . @  "k?B@*` * "@j_  ߰"8/5B3}B!@!4 H @ B" 8 > @9Zb   A#Pߨ"8. @* @*`@`€  .  6. 2 ?  @95b ?  8 @'""8"8  }@9 bH?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘b8""8b B" "b"?  ~`" ~` """ ~ a @8?0!A""b"J"Ԁ  1 ?  :""8b"<""@ Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘"8"b8B" "?  ~ b"~ bؖ"@8g?0"Ԁ   ?"8b "<"b@  :"ذ 8 8A? ""Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘"耢  `  Ab"!"b"! "<@" : @ FA!: @i@l 4A @A! :@ D  &W @d  1`/"8"@A!@@"<%)'@" 8@ $@<@*@'%@8" ݑ:  '8@$@A!@ "<A"8a"<""@A!"bؒ@b:  :"  B "b  `X@7?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘A! M B"  @7\cD?s ! 8?"8"b@"b< :"ؒ@ B ;"*   :"!)A'A%#"8!4    @7(P0@ "8    >? 8@ a@5p > Unable to obtain block size for file %sActual crc does not match expected crc %s( H  '" @ 2 .؀ 2  'N> `p@5d'  ;>"<b@" ; @?7;    @ "@#\ @"|  @ "@ ? b@"b@ :@ d  `  H`4 `   @: 4  ` "|  ?"|  2 `2    c@4  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(      '" H P2`*    *` 2  @ 2.؀ 2  ' `p@4')7A"8@%"8@ "8#\@L@<` D`. `H @4^ / H    bp@i  . `@4?  8@  b @4   H`4 `   @K㿘A!  0)"8"b@"b<> "ؒ@ B ;"ؐ "a !%A#"84 I A  1@mH!=Aad* @ !A`!\ $2 !\`27 `"4 $1!\  @ !\ $!\ @ (@ɐ   & $&  @N`2 1#2& $ @ @@4 . # & 㿘A!h ' >1@l Aah* @ !A`!` $2 !``27 `"4 $1!`  @ !` $!` @K (@i   & $&  @N`2 1#2& $ @ @@4b . # & 㿘@"R?N MA!l  D@*Ȕ!=Aal* @ #A  @@A  #A .?& $a\  @b a\ $a\  @ (  @ǐ?`@4 , #@Ѽ $`$ $&@  $?㿘@_"R?N MA!p  D@*p Aap* @ #A  @?  #A .?& $a`  @ a` $a`  @ (  @?`@3 , #@ $`$ $&@  $?㿘@$TRAILER!!!㿘 @?a0  ? H   ` 㿘   > &  & < @@"+$@")@".@")@&% (@0@"  '&  #&  &  &  &  &  /  6   & H> @$q: #?cp @ $ $? 4??ct!0!0$ $ $ 4  , B" 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘`l   c@07?  J   N    @0#c?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H     H` `! ,  HH `@/ ? H,     ` H &,*, N,   `@/ɰ?070707㿘`K b@   ?㿘 L w x  >` @ `& `  @ `& ` @ ` 6 ` @  `$& ` @ `(& `$ @ `"6 `* @ `,& `0 @ `8& @`0& & `A @N H> `; @ڔ `&&   < ( 2 &, H     &,., < &?Y?  W㿘@%File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@% Ұ? x  >  ?  ,&  ",   4  H A @   `h  A @  !ǒ @v     @l     @b  v   @X  l $  @N  b (  @D  X " $ @:  N , * @0  D 8 0 @&  : ; @  2 L    `       2 , , 6  `@.2  ? `@.*  070701㿘`m `@   ?070702㿘`m `@   ?㿘 @!"b|㿘"|  n ђ n  x  >` @ ` `& ` @ Y ` 6 ` @ R `$& ` @ K `(& `. @ D `8& @`0& & `6 @  H> `& @ 0 `"6 `> @ ) `F @ $ , @& `N @  `V @  ,, @& `f @  `& `^ @  `J&F C`n  " r 9 < ( 2 &, H    &,.,  x H   @ b  `> O  H   @ b  `; ?[  |㿘 @#"b|File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@#? 6%?  ?  ,&"| !’ @     ! @     f @     "(  (4& "`x H    @ b  `>   6 @    ɒ`` x  >, x  >  6 @ L     @ B     @ 8   $  @ .   (  @ $   8 . @    " & @   v   > @   k  F @   b ,  N @   W  V @   N ^ @   F n    n  "   '`    '   2" , ,   , "  6  `@+  ? `@+  `("? (8 (0ǀ2  (8 (0ǀ2 ?H   H㿘ْ   x  >"H ]`* ` & `* ` &  `*`` 6 $` * ` & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, \``* ` & `* ` &  `*`` 6 $`* `  & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, `@`0 8& H& ?& @  ɐ 9 < ( 2 &, H    &,.,  x H   @ b  `>   H   @ b  ` ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@!W \? ?  ,&  P؀   f4d ` x`H    @ b  `>   +   ; + +   ; + * 2 :+ + *    0(@( *      . q b x  >N,+V,+,: +, + *` @*` *  @,   q x  >++++ q+ +` : + + *   @` 2 + + *   @`  2 + + *   @`$ 2 + + *   @`( 2 +  + *   @`" 2 +  + *   @u`, : + + *   @f8N +V + : + + *` @*` *  @ M`< ++ *   Bϒ   ʒ  `    %c    %   2  , ,  ,  6  c8@)   ? c`@)  Unable to create %s㿘    @NH. 6,` @  "?, -.+ $ (&@N04 6b쀢  @  (@( ?Unable to close file descriptor on %s㿘@B @|  . ` @(Ж #  `$(  @) "̀ ``  36 "̀  ` @l B" B"  `80   @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @M  . ``@(v ?<  ,  @h  c@(9, ?㿘    `  @O  Unable to copy %s, file would overwrite itself8 @Mz #   @2  @2   `@'   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@M> >%.# 2P @@`@  aX@'??<   @ %. .@DJ %.* . `@'˖!? @'Ø?#@C b쀢  ` @}`   %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8    #  ( , $ (? 3* @P@t@|@@@@@@@, @L2``&$   *` 2`@, @2`  c(, @"   c`@'  ?` .  @$"쀢    @ 6 @' ?#    `$(  @  `$(  @]    x"̀ ``  36 "̀  ` @   MB#@5Wb D @$R  )@L . `@&*`@s2` c @ma"̀  6   "̀  B" B"     @B" B" "  `80   @  Unable to remove directory %sCould not unlink %s8@K !# 2&?<  @ 6 `.  ` @B .   `@&;?8L /?  /@( /1,@Kd (@KW! ,#?#  @x@#  6,@KH 2 , c@a$@^ ,͠ Unable to obtain file stats %sAccess/modification time set failed on: %s8A"""("`B" B"  @K 2.B" BA"bB"  A"b `@%A@rb . `@%paxUnable to set file uid/gid of %s㿘@ 6  #(@4b .  ."Ѐ   @ 2 ?. `0@%x?㿘@ 6  #(@3b .  ."Ѐ   @ 2 ?. `0@%P?Could not set permissions on %s㿘@No . `@%7File seek on %sFailed write to file %s㿘\J'.  '&"& $& N    L "  2'<`  @yP    @xr  @$?2&Failed seek on file %s㿘??@y$  . ` hAb@xE  . `@$㿘@ @x?&@"Ā   `80   File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &h  X 8+?@x :@ D @  `@  H   @"? chc@pX  . `" 8?c   c@# ?  @xs  . `@$  ? & Unable to allocate memory for file name buffer㿘 "bP"  bP "bP" bP "bP" bP @"bPA"X @u!, "bT @#a?@ "Ā  @* &?Invalid file name arguementUnable to allocate memory for filename㿘  N   b@t  b@#l?0@xp?`$$N /". $$ $ $ A"X Ab\" A""X"b\ 㿘A"`` "`"  "b\#    A"d`A"T@l WARNING! These file names were not selected:%s 㿘"Ā  @A"X )'Z%  4   2 `㠐 @# h 㠒@R 2 Can't fchdir to starting directoryCan't chdir to %s㿘1A"T %A@&"T!1A#.'X "`Z"T,@ ""T@%\ 20*/"T "X &"`.?&"`"`  @"  "` `@"ڔ@?@ X"` `h@"?"`$"T"TP@ A "bT File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐b\ #A~"b\ #A $     8A@M"T  $bdf Aհ?bd 4? E* U$TU$TU$TXTU$U$U U U$U$"Ā Abd <@`@1 &Abd d Abd b@"Abd bd `@"1Abd u8  > x>&,., bd <>< < <  < (< (0< 08< 8@< @H< HP< PX< X < @@"Q (@"K @E E!A@ @!A@"% 0 @ 5!A@0 0!A&"Ā )bd 0 @t  !A& H>&bd , @uW,6  .bd `P@!6A*, &,&!A"d `@ߔ,&*  "d`& %s %b %e %Y%b %e %H:%M%s%2u %-*s %-*s %4lu,%4lu %9qu %s %s == %s => %s 8"Ѐ cX@Q 0p `@Y" ` ;!@@#`#p"@`  @@b "/` ƒ ` `  #\#`c @P ?  c `@P `c@P`0c@PȖ  ?  c  2c@P, 0? & & * @@jo%s%s %s @" 2 8;!@ 4#`#p" 8@ @@ "/ @Y!Ȓ@ v   J@*  ` " *  **   J 0  *J0 0 Є *`(8*`(8 *`(8  0Є *`(Ѕ8  * @  #  8W0(2    0 0(2      0( :(`     J 0*JFF Є  3`+ +`*8І8 + +`*8 &3`+ +`*88 @@B* 0Є3`+ +`*8І8@B*   㿘 / 9  `8W0 (.W.* 2`@2  `  00.* 2`@2  ` `  0.:. ?`" %s: unknown option %c %s: %c argument missing 㿘." "` `N?`"b`J -K bd *bd "bJ"d @Z8``"`J@ "`-?. :  @!Ò  :2J . Z#cH :2. K" . Z#c`@@N:  ?.K* @ " ". > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@ƒ / "b @"b @-b @Β0!@-b @0! "b@Vab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  9-. !x5B@ZЀ??`8M#|*`@gpdhh(dhhdddhdddhdddhhddii(i<ddddddd`dhdddddddddddeee4df$f,fHf\fpffdgT``@3`'" b@#@R""`"#`"b`"#` "# `@""`""ab@ 60 7+)%B* :  "* eeeeeeeeeeeeeeee&%c%"&$  $  %c %" b@L@ L  HdFh@ ?@"":@""5@"" 0@@-@'!BAcP  H@Y" $"@ b0@"HZ@c +Z)A#P, *c"h@MG  (, "pZ@c0Q"""x"b@r:     b@Y@ "@S"  `" b@H"@w̢@""Ǣ@@"@+ A?"a@&A "a @(b0@ @""@"" @""@@@A @@  @""@""@""}@B@ @B""sې"/ @( BB "bqȐ % @  @@ BB  ` @ @ @ BB "b ! @ @ B "b" @@@@@ B" BBB "bB"`K"*`@jjkLkLkK";!Kb* @@ "@" $"0)K" @|b@?. @ "#K"A!Kb* @ "@" $"A"!b:cef:hmopruts:vwxzBC:HLOPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-CTAPE㿘  B ""$!(+%.'B#7 5/?א?Ѐ J* ppo`o`p$p4o`pDpTo`o`o`o`o`o`o`o`o`loo`o`o`o`oo`o`o`oo`o`ooo`o`o`o`o`o`o`oo`oo`o`o`o`o`o`o`nTno`nno`oo`o`o`o`no`noo`o@oLopo@oxooo`o@` %b b@@Sb* %b $A"!J@ -  J`  $b$bB"" @@# { @/w "#""B""Bn""  k$@ 6g@c`$bА ["bX"#V$&"xQ%M"bJ""H&BE""$B""&#=% 9$b 5$b 1$b 0-$b @)$b P%$bK"&* @B"?  B@pT B"?  B bB p"bB  "  @ ``@B"   '@  #!@@)` 2 @`@  $" ``@"  @@  0.""" " @U  6@@z@ A!@@)w 2 @`@  `` : 6@@_@ 2@A"!"Ԁ "J @lȐ `""J@  "bԁ/%s8"'@R@RL`?,@?ɒ .  @?ϒ!  @i?<    @ ?` /,`ΐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6rUnable to open file '%s' for readUnknown -H format: %scpio: Known -H formats are:H "# "#""B"" """#B?"b"" )B'B751%./+Z9A#P@U??ʀ D֑* a, xxhxhxhxhxhxhxhxhxhxhvwwxhw wxhwwxhxhxxxhxhwxhxhxhtxhxhxhxhxhxhxxhxhxhxhxhxhv@tvLv\xhvhxhxhvtxhtv|vxhvvxhvtvvvxhxhxhv""A#%"""""$""B""  $B (%" $"#$"# ""&"x& |$y&"@xu&"@`  `@t@@   *? @[ @,WJ@ -J` K%I%'AcP  H@U" <%" `8@B P@̒c , *c"h@I  (, "p@c@: ""&#&%"K"* @B"`G ؓ*`@xxy|y|y0@ ;`@ 6@@@ 2@0-@ 2  @b@@c"c `@@ A@A"!!Z"@{  *?@ V "@%s: Invalid combination of options: -%c㿘 Z#a@H'Z%A#'@ǐ 6㠒@HuL0Z? "㠒 "㠒 * @ 㿘@'E@AH   HThese format options are not supported %s = %s 㿘A#H  @rc!Z1##(@H10@ Invalid option nameUnable to allocate space for option listInvalid options format㿘  N   c@ c@5?09 c c@,@iǐ.?`"+ )A'AL@ $@ ,2,@ =@i , "@"`"` #H L%#H" `$L 㿐@>  # `  [`YVJ k6` m b 6`- w6`'.  .` .  .` 6` .  .`.  .` (@# 'J x  *  @La @   usage: pax [-cdnv] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘#!Z@Y##8@U#%X@Q##cx@M##@I##@E##@A##@=# @9#cx@6# H@2# X@.# @*# @&# @"#X@##`@#!(@#!8@#!`@#!@ #`@#!@#@k usage: tar -{txru}[cevfbmopswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] file1 file2... 㿘#X!Z@ޒ##@ڒ#@k~ usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘 !Z@|# H@x# @t# @p#!@l#@k Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N   a@&N \a@g 2, a@?0f` @c @a$ b0@u@gQ?, @N2 *@`@g *a$@ $` +%*`:  P"` g G" `0  p"`0` $` $`@ڐ`@fِ, `@6?J  $`B!h Bal" B"!h"al Empty pattern stringUnable to allocate memory for pattern string㿘  N   `@fu 2$ `@?0$ @i$ $ $ $ B!` Bad" B"!`"ad WARNING! These patterns were not matched:%s 㿘B!`  )'Z%  2 `㠐 @’! 㠒@D  2 Pattern select out of memoryPattern list inconsistant㿘B!`    "   $ \ 2Y # 6B  2 *  ,B  2*@+   $ @ubH ` /*@5$  ` /*@$ @im$ ?J / * $ $  &!` !`         "@@eߐ &@;bh?㿘 &B!`  B" ? ":@?!`   "   J  /2 @h   @&     2  "`? &"   P  & ?㿘&N ?  ? [  *"N;*`"/N@7*`N@  # 5?N@ /1&. N@ ܲ`(? N *`"   N@˔ `N@ ?``@2?: N@ `?J!`?   * 8]#2J" -2* J ] * 8 4 @$ * 8 "  *  ] ` Removing leading / from absolute path names in the archive㿘B"$ " N  /BN    . .  @hF@i5?&Bb$  B "b$ @-cB"$ *BN, /&B ? BN, ,  . ., , @h@i ,?&,Bb$  B "b$ @cB!h  @@ '  ?  , ,@1 # @i  ? , ,@ %, ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐!@Eb)'1#!@<" @:P@8"x@G, &@!b @+"0@g\,@#"0O  .@"!  O  @" ?#@@0,$* > 㿘 @ ? ? ,  ,@ : File name %s/%s, too long㿘@N /@ ?#l @`?@ &@ @+@ ?@ * . @+@ ?.  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s  B!h?#P@ PAP X@]$ 1\@@     @,`@  !X@f 6 V a@X d\"  @L@   ː  Đ ? L@ ,  `,L@  $ a@OP% OP OP  Z#b@A OP#b(@APOP  P,&@., 㿘I  L D  &\ \ А  *`: ?Ѐ- . @\2 ,@L \ &2,@  ,@` @ @ "@ @'4 D@?@* $@.Can't open current working directory.㿘@BD!@6   "b. `@0@r (@X "B"`"*`@n  ԣК"Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "b "А c c(@fȾ@ 0"Ā @@e LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @d1 2? @g @d% 2? @[ @d 2? @O @d  2? @C@b8#"b"bb@ "@b@ "@b@ "@b@ "@b@ "@b @ "@b@@ "@"''#D'ذȐ @c 6 Ȁ 2 Ȑ @c ZȐ @c 6 Ȁ 2 Ȑ @cw HȐ @cp 6 Ȁ 2 Ȑ @ce 6Ȑ @c^ 6 Ȁ 2 Ȑ @cS $Ȑ @cL   Ȁ    @cA  'ذؠȐ @c7  @c1   . `@?㿘B"p B@ 2 B"t B@! 2  B"h " @F   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "V?N $!B"p 2 N!=@>ג  $"p :`N # \N  #" @Z 2  `8@.?  @Hz @@I!=B"p, @ " 2@`U 2" `X@ٰ?0B"p,  ""  㿘 $@I!=Bbp* @`  $@2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "V?N $!B"t 2 N!=@>A  $"t :bPN # \N  #" @ 2  b@i.?  @G @C@IR!=B"t, @ " 2@_ 2" b@C?0B"t,  ""  㿘 (@I(!=Bbt* @`  (@2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N  `@ /"N,@`N $ А ,2 J2J* .  2` `@  J 2 @_ ` ` L@ 2$  *$  @ &*:  M"  c C"    m     $   $ aL@@ cS `L@  @@B $ $N @ 6  a@ $ "($ L #@  6   a`@ 6@^ѐ$   $  @  a@ $@^?$ Bbh 2BB"bh""l  bl" "bl a@ ?Bh J8@  " * )  @ 6 @ &/  /@  *@  " @ &  @  " @ &    @   2 `?㿘@~@@ ."$@, @a 2j?L?Г* @*`L @`=$@]?@a?`8W?"*`@|@N?Г* @*`N @ D$` d$` N?Г* @*`N @` $``?$` N?Г* @*`N @`$`  N?Г* @*`N @`$` N?Г* @*`N @`;$`@,&@8@?Cannot allocate memory for hard link table㿘B"  !B)@;  $"  @ `(?Hard link table out of memory㿘B" q  d " _ @F)ǤB",@ 7     2   @    2  !, @,&,*,    &   & ? $  $@@]d@]b' @]5  @k  $ $  $  "$ B", $ "   @]@ @ `?㿘B"`4 " /  *? ' @Fz)Ǒ* @     2   @    2   "@]@]㿘B"  'Bⴑ,@ ""@`@\@\`2ⴁCannot allocate memory for file time table/tmp/paxXXXXXXUnable to create temporary file: %s㿘B" ) !B1!G@:ݒ  $" @ `?@Ð @@'B "b@'@\  . `P@ +@\?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐B" 2  1@GB"-`@ ;%B'.)2%  ̒  @_:      @ Ӕ!0c?̒@^mJ @_|    2   8 @ G$ E @[ 6B"̒  @_  < B"̒ @^). 8$ $B"-` $ " #  `@ ` . `@  . `@ |H ? @ La ?@[?Cannot allocate memory for interactive rename table㿘B"  !B"@9  $"  @ $`?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘B"  @ `H @"B", @`@@ ````@` ", @[u`@煐 &` `@[A  @w &@@r  &`B",  &`" @[T@@[R `@ ?㿘!B" @@Д""* @ @N 2   &@. Cannot allocate memory for device mapping table㿘B"  !B!=@95  $"  @ ob?㿘 @ @?Device map table out of memory㿘B" +@DF!=B",`@  `   2 ` @Z  B&& ",` & "  @ +c Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘  B"   @ 2 "`*  ` 02% & V&Q s A#5B!@Z5 8 "" "$ 5B[ в@@%R   #B А  &#BbЀ  @Z   "b" "$  &  & `@  @` Cannot allocate space for directory access time table㿘B"Ā  !B!=@8#  $"  @]c(?㿘B"Ā  %Bđ,`@ " `  ⏖   2`a<āDirectory access time reset table ran out of memory㿘B"Ā 4@C!=,`  2     2  @Y  @弐  $$ $ $ $ B"ē,` $ " @Y @`(㿘B"Ā -@B!=B"đ*@ #B*"Ā @ 2      2  ? "@ & &@Yg@Ye ?Unable to create temporary file for directory times: %s㿘B"Ȁ? @Z @@$B  "bȐ b@@Y;?@$6@Y5 Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sxB"Ȁ .  @[  ? !bД`'7 '''3Bb@[ ؀  bȒ@[  bh "bhc@EUnable to set mode and times for created directoriespB"Ȁ W "h@E!B"Ȓ??@[  ="Ȓ@Z 7"Ȓ  @[ /"Ȓ@ZЀ ("Ȓ  @[  "̀ 쀢 B" B" 3 `"h@ "!B@Z"Ȑ?$""h@ @ْ`㿐`@  @6` `  *   @`' *  @@A 㿘 $y $ J$J` ?  "&  @   (  ((( (  0(2      0( :(` 㿘     .  ... .  `0.* 2`@2  `  0.:. ?`"  !   ustar㿘aL  aa @Zϔ    ? ` Β"` write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘!#% ") @[!  @Ua   a@  a! aB"?   b  @?0 $p㿘" °?` & `" 6 `& ϔ,&* `d ߔ ` /6 `l ה `$& `t Д `(& `| ɔ H > `  `8& @`0& &   x  > >N` 1"= 2 5)8.,   &, `䁔,&,*, `  (  & " 6, `n,&,*, `    A6   &`   6  " 6., 1&,., &,L /  &`   6  " 6  &`    6 `x H   "@ b  a>  > L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ?` 8#*`@˼X8 88X"p %ݰ  Ԓb@ Βbp Ȓb ’b, d b,   ``d b  〔 c/S x  >   / @Y+ d /* l   2 ?  1,  , W c,!  | n  q%,   @Y d H |    _c x H  "@ b  a>   d @ C $ l 6 9 ( t , / 8  "  %!    ! &?  b ? ` `     c8 @w 㿘 ?  ?㿘] ?Є  ?㿘aL  !a @X+    ? ⼔ *"` 㿘 ߒ" 2?  & " 6 &&NaY   aY+ /, `,t"@&* `d ⃔ ` /6 `| { H > ` r `8& @`0& & .aH (a)ђ 6.a(`t \ &.a( $a , 6., `l N &., &, x  > > ,&N``7"$*`@ԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨӌӌ(Ԩ  &`  |  &`   6  " 6 J  /2k &e* N` 4   &`     &`   6 aI Ĕ aQ ῔ `,, A& N` 2   &`  ( 6   &`    6  " 6, `ე,&,*,   &`x H   "@ b  a>  > `    6  Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠   6a(  ?   , d aP',  @'2 ap x     >,Y  /, aY @V  c,`c ?` b#*`@@``؄؄؄ 5,`` @V d:aI   4 3,`` @V d , aI ږ   aQ і     6,`` @Ve daI   1 2,``,  c,aaI @VR aQ @VN  `|   2a   0 7,`` @V8 daI @V4 aQ @V0 `x H   "@ b  a>  `|    kaaa T aaO  `d e  S $`l [  I (`t Q  ? 8` G  5a c  a)β  !` ,  4! &?  w ?        a @ `da  ?  /"J J J" `4 ` /dev/ttywrFatal error, cannot open %s㿘#@% @cB  "cT@cB  "cXB@#T@T@#   c@2?㿘'H'L'P'T'X1B#T H@0Z@I#T㿘` B#X@ƒ 2. ?@ 2* %s: 㿘'L'P'T'X L "b"Ѐ  !"  Z@<c$"!Z#a@/#@0 @<ڒ# <%s>㿘'P'T'X P "b"Ѐ  1"  Z@<c&"1Z#a@/#@/`  @#@/va Z@<c㿘@fB`"㿘`B#`@ @@Q+ @2@B#`&allocate bad sizecannot allocateallocated object too small㿘 2?@kc6  @. %B#`a@  :(&@ @@ 2@@2@Pa2@@k(2@""@""" c" " &@ @k}c84"@.  @"@"@ 2#" 㿘`@kdc2  ? "  ?@S* ` *$? $?@freeing with invalid areafreeing free object㿘 @@@2@k)ah 8:  * 2?@ka+`@2&` &?& 2?"* ?@2#  #?#LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀$J#$ #$!b@qp"? L"  P ?" " $"* $J#' "k"@L"ж@H"ش 2 @@"@qB#@2Z$R"耢 2 @ ɒc L$@[B#@C`<# 8%"J 2%0#("@ %%'#H"@R@R @R $cq`@Q@ @Q@@@@Q`#`@Jo $'$#`'S$' '@Ґ#x@%%'@s$@@s@䀢 ``#@Jn; .@ #@Jd1 @< %"J@ @OJ /  @t젒쀤  B@sА@9`@sɐ#쀦`` #@J̒ can't get current directory - %s㿘$J#$%$#@peb? L"  P ?"@ " $"*  @J#`/ %"J@  %@s " @͒  &  @rD  .@i @Iܐ# #@Jo Rnprsu,ne-p: %s-u: %s: %s㿀 J e.   ` L@ - L` ` @ `n2L@ e2L@ E2 L@ `L@  @L@   ؤ ! "\$b@o֔?n? 6$*                   8                  L        T \  뜤 !(  @K䦒$!0@I;  $"L@   @J䦒$!8@I" $## ?*  @ c  $? $?$b?"b$"*  '$#`' ' 'j?#@@i Q \2P+@L@ f/` f r a"D  b 0"*  \ "66 \"7+@2 \ c"2 , \ r t n"' # \ v"!  \     @А , *: @И  `+@ \+@`+@`L@ `   +@` 2 +@`%+@ @` "`@GT 6 #@$"   @  ).@O< 6@ @Ő 2 @ @$ " @ pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘   J w`? ##+$b@n$? p"  v ? V" "  $"*   2 ? 2Ԫ Ӏ`հ    !% L@@  !%"@ @x " @8   `#@H ?`"*`@Ly@G#u# B#Ȓ#@G #@G@n ZW@Gܐ# @G֐# @GА  2 @Gɐ  `@GÐ @G 074@"B X#& @ @G h   "B#Ȓ#@G p#  @G   @GBB@G#2/",㿘L#R#UZ#fi#lrtuxponly -t, -u and -x options may be used with -ffunction %s %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s[%d] %s exportreadonly%s[%d]=㿐     !J r r s e"    t"  !  $" `" ")$$b@l?l? 9] * TDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD$D,4DD@ @@@" b" @  d`@`$#  +,, - '@i " '@i " $## `*  `J - + `$*J` `J@" ?#瀊@@Eǐ! X $"*  !"*P @ , , ,$"*  A  `"$",` "` ,` @4@6q  $*#,`#h P @  `@7 7`,` Ӏ``1$# 1$-)@``-@"`- ##h P @ @EΒ  , !`@E) $#  " -)@ "0"`@" `\`Y@E!x"@E! @E!$@E! @E!@!@E|  @!@Et @@@Em!@@Ef!@@E_!@@EX!!ؒ @EP = #@EJ 7  `"!!@E=!" @E5 `-#@E0 `-B "B@@E#" "#@EB@kB@E#  2f ],U drtUx-taunaliasalias: -r flag can only be used with -t and without arguments %s=%s alias not found 㿘%"    /$-#%%#%@j?M? 98* xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx4 `  $"* % `?  @Dp" $"@j @" @=@ ``/-B 2 @(@DO @j @DK@ ` "x/$-%@_ =$@`@c@~ `!`@~p  #(@D @j B@D#F #0@D? @~  `$ " `2$ `  ?$ 8 %b @5  @"@c_8$   ?$ `$`  2adt㿐%"  -$+)%!%@ikc? d" 4 t ? a" " > $"*  )%@}t@}2    ?$ A#8 ?$  2@~=#%@~?"  ?$ &c8 ?$no arguments㿐   @BƐ!(0 @98  `?  lpnz㿘   )$'"@h᠀? n"  p ? l"  z"?  $"*  2 @Jt "   @Jl 2   2bgjob control not enabled%%㿘@?b`?$J# @BX") $bB@h ?$ "*   @H   0"@Hߒ  $J#%@? %*d %*s %s%*d %*d %s㿐`+ B#@`  #\`#`+ B##\#`@qG bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈 ``, L@ -)%$ `% h*@  `*: [a  #@~2` h  @`x $ "   %$#!$@gߔ`? l"  s ? @~m" ְ $"  $,@   $#@p`B@An# ,@ $B##!@ @d  ' *` `c @A,@  0$J#% B# B#'!B, @AȒ#B@A#z   ' '@?   ' B#,   @I@쀢@4', @I7 @4   , $#h ܖ@h A  h"@@ 0; 3 1 % @G ")& @d1  @@В ?6  @z  !@Gǒ 6 !.@C !(@@ ,@`2L@㿘#0   $J#%   !@fː#$#missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTINDOPTARG%s is readonly㿐$bB@f ?$ "*  O"` H"(L@  Ð@S J |"@$#  , 2 @@tb`  ?$#  ,  $#  , &  `*` 2`#  #  *@HB? @Ð"x@@ 0Q#$ @fF ?   +// /  ?/// ? ! $#0@$"@c$#0# @"@ 0@"@c@$Ð"@?ƒ $J#    @ @6 lm㿘   )$'Đ"@e᠀? l"  m ?"* " $"*     @@C ="*@`@ 2   2DD p 08D p `XPH@bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasH f`?%s: bad numbernothing to shift㿐$# $bB@eH ?"* $"*  @5k  6 Ő @>     *"  $  " $ @>א 0 Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 %$#Ő@da ? ? S" $"*  2;@x͐ * 2 @xɐ ,8 ņ!( = Ř!0 . .  *  #@< "` @ . ``  ,. .?Ő!8@?  Ő!@@? % h*@    А?Г*:`  А ,N "ő,!H@xx * 2 @xt8  53Ʈ  #`*`X@:` `N g  g o a" `I N u"`@N``N `" IN @ː!` w   I<<*`ah@:` "A ?* :  5 * HXXXXXXXXXXXXXX8XXXXXXX@XX XX0X(T    I"N N  @;&-:  -", = +"  N,`N",N ,Ţ  !`@ZN "NN ^N 8Ő!x@= ,@w2  %s: not found%s: %s㿘$bB@c” ?A$"*  %: b @0 $Ɛ"P@=d, "* @ $#  "@   `*`   2`    @Z)  .@ Ɛ"`@=9 㿐 $bB@cu ?$! "*    @B  @B   6 " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp      $ǐb@c2P?2 r"  s ?) p  $ u$$@>Ԩ$ǐ Xݲ "L ֨  @>Ԩ$ǐ `@< $"*  ǰ? p&@=Y $@g8@\ ? `,@:R ǐ x@= `  '$#`'F ' 'ئ  '$#`'8 ' ' ?#% h쀤` x"w  ?$ `$ @@jN`" `(`$  `@y` $ ؐ?$@\r,?$@\g``  $J#  @9ݐ `  @R % @S ` ` ,`\`  `  `* ` 쀤2 ``   2 ,   2,쀤 ? *  " ,? " , ?*` *`,@$ $@gǐ @;ϰ 02J#    @ @  N@g` %, @` "`@: 䀤 @=J 8`?㿘!$"B@a۔ ?$# @Pj`"*` " @Y  trap -- %s bad signal %s㿘$bB@a ?$C "*  B# %1 " @;h@b "x@;  ( @x4    "@;F? `"L@ -2L` "   @x "@yD 2 㿘 $bB@ah ?$; "*  #%@^m`X 2  $`XŒ` @:J r$#`@?* 2  ( ``2@ !%#@  @B  $#@ @Y@YW%s: bad value%s: cannot %s%s: can only %s %d level(s)㿐 $bB@a ?$"*   @^P N  '`$ɐ @:B #``@ * 2  2 ``` 2` ```@`" 2 ` ɒa@:k  ?4` ɒa @:_# J b  @X&&-set㿐$#   Ð"2 @\T*   *`?`@ZY&  &: ?$` * $`&   $J#%  %#Pfv㿘  #$!ɐb@`c#؀? f"  v ?"7 " $"* `"))ǀ@? " $ @9  @晴 [@ @ @* 2  `ހShell: %8s user %8s system Kids: %8s user 㿈@Z@W@:Z!@Q!@:T! @K@:N!0@E@:I!  %8s real %8s user %8s system x#%%%$`$`(@Y @$X@Y@$"!$#@ha" `(@ #@ha" `@  #@haؐ#B@hc㿘1#K.? s.? . ?.?@'  0.@7{   ` 㿘$# $!$ #$# . R@ $Lc(@@mLc( 2  $  # . R@ " @#Ӑ  #$#"   -Xh-P-H.-@%,-0+- %,-"-+,-#-,#,&,D,)D,",,,.,,@,,'*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]x'ϐ!d'ϐ" 'ϐ"H'ϐ"|'   `,` 2`@.b  ,`@%b @8C"` ^  'ܑ,``T'ࢄ O ؟€  `%`  €  @ ؀ 2-  ܐ?'܀`    @  `?`?؟€  "   '@ذ㿘`!`"(N "" N@ *`: N`2`@ 2 ` 2``?怢 (``N@ 2N` internal error: unknown opȀ  `#̐!*`@2223@3X3p334L4 4x1354453 5(5p433$6,6d666666668`78N@ N`?N !`? 2@XQ '4'4$#4J@ '4`?   @qf`?@e``?@Z`? @X S< D  @M H< 9 @B =< . @7 2< # @, '<  @ <  ( @ < 0 @   (@  @  $@  @  "@  @ Ȁ 4  ̀ ڰ  @ZL4  &'4 4@4c'44 @’ @q  @ @q@ `? @Z) @c`? @Z `?@T@ @N2 @I 4  00@,ڔ  ,@,Ԕ   o&`-͐#8*`@7P7h77770,\`?0,V@ 0,@6Q  0N0,0,@$G  0D0!, @ ;@8 6X@42  0/ @ )@8 $X@&   0 @| @w8 8@<  `?  ̟ 㿘@^㿘@溒unexpected operator/operand㿘@  2  €  2   Ο  `?㿘@2  2 €   2   㿘@"  2 €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2j  €   2\  €  2U  M €  2  ?:-  2   * €  2  ?8  2     @?ΔP =`=X=P=H=@)(!-a-o㿘  @ ``?  `2   ϒa(.`@ `?   $ 1   ` " 㿘ژ%s: %s%s㿘.` @  @  `&@4k"p0ϐ"x@4f @ht@Xf@@c@0d@ s@l?m?n?pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimited%-20s unlimited %ld bad limit: %s㿀    JcP cP H*cP S*@` a*@Ϥ""  ` *@ `*@ f-$%@ZP? S"  a ?" H" " Ϥ"" " L" 2L  $ В`@3Δ "* @ "`  @3}  @U` !#? `@)  @0: `7Ϥ"" r+#  `@:s耍  2`@32 2@3ڐ : @> А @3̒ 2C  #@:E耤 2?耍 2? @mx耢 .@ߟ @3 %  2 #2 2@3  : @ А @3 㿘%?"`"`"` "`" "`C#@ђaT@qR ! Bcc "c @"cd@?*ch  dCOLUMNSLINES㿐cd 4%"cd$ Db-C#`h@9 %`B` # "ѐ!h   @|m "@z  ѐ!p   @|^ @z㿘#d @v $#J# J` @b $J#, @9?@\ 㿐!.1% @Z  `"  @G @o @C  `?㿘$@^#㿘$#` 2$@`0 c`?"``"`*㿘 $#   ?*` : @`~ N$  `$ *@ N P#`Z#` O"#`%""' ' ' ' ' '$##'`'`'` '`'`'`'`'` '`$'`('#"$ $ $ $ $  'Ȕ w' #h/// /C#@vL @   @ C#$c@v;    K@K` 2 ` ++ 8(8 2 J     2J2J4   2 `? J `2"@ 㿘@V / 2  Ҥ"$!, @*`@8@  @@R 0  , "F J#     " J# * `J `? 񀠠"(   J "  &J  ?  # #J *  *  #*" 㿈n @h  @@;  .@@@2 .P`$  @@ J? /" `@   $c* 䀒`''.    '%$ $< , Ŕ', ''`'.@@"@ $$< c, 䩔', ''`'"@Q O @%$#ƒ`fileglob: substitute error(r @5!% @$# @E=`"" $ @@> ! $ @@0b[ %" @$# `'' '% $@$  $< $c, K', ''`'"@"@$ 9   .  2  $@ @ J $@: $#J` "&&㿘 @`@̒  `"@FPATH㿈 @!$@0 # `# ㊒`'' '%@>L%@9%@4l$#  " @*  , 2%@K@u @wB#@="@>   &$#ؒ` N  . $c* 9` @',`, ,`&@  $  ,`@7p ,`,`*  ,`* `@"  @Ȗ @ $,`,`@*` `@$$#㊒`-*@T ? %$?,`@@` ,`.@&@ @j``@,`.,`@&@ . @' $< $c, ', ''`'"@"@$ &;|&()㿘&'{  `& 'q  J?[a  J?  [!J?  " L[a    L   [!  L  "  * [!L   `g  0y7#-1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[%A"BCD㿐"#|"c"#"#"c". "#"# " $ " (1% H "c *c#B#$c!% B"c  "@ ","c c"@""# @A #`% @ " % H 0"@:  *@t"@?"c% ע!3 z@ $I  #đ*    * @*`@`  $c 6"$"#"#$* $$ *@ *`@@  `  00Ɠ* @*`@` ".c0#c|"@gy g @Hݐ 㿐 2/@ R 0 /1@B#??&# 㿘  (  @ = 0>  #ȕ**` @@ "(J ""( 㿘#c@ c !#" @ @3R#@3N#@$#c@$c @  ?㿘##@2Gِ #?@ "##1c#@`?"@##c 1?@tL#8? "c 㿘#c|@А 0c 4"c!##@)"@#@  㿘#c@ 0 c 4"c#@  㿘 i㼀#   ("c""c `@#"@"##??  N@@3`??@!##"   @2"#@.## c"@ @4?@a ??? @W ?? "c@ "##@ !@N@#@㿘@  㿘@ 㿘@R c@ 㿘@I { 㿘##| @ 07#??0###|[!쀢 $ #J@  `_2J##|J@  2`_`$#  #??##@E 㿘## @Ր 05#??0###[!쀢 $ #J@  `_2J##J@  2`_`$#  #??##㿘# #@ @R"#0# !#?$#@J?# ?0# # $#@UJ# 㿘@??@i ??㿘   *` @ : N       㿘@ # #%# *` @: N c  㿘  @W#0  2@ ^  ? @@㿘#c|@ 0 c 4"c#c^" 㿘#c@ 0 c 4"c#cG 㿘##@*!#?? $#'%`㈀ @ݒ   #|@݈#@ 0??$# 㿘@#㨐??" |@c 2J@ 0   㨐??" 㿘@ @ S c"c * 㿘%@5 0 㿘%@/ H 㿘#* c@%"@ 㿘#* c@  㿘# %  0%#*`H@% @ * "@@ 㿘% 0 % H@4 0 "#!#|#|@C#|"c%#@/f#| $c$@"#@{ 0@㿘% @% H"@:`"  ##|㿘#c| # {01 I-search: 㾐?/% @ @@F cĀ< @ )1  2??,ܰ?! #*,@ Ҁ   ,|@Q |$ O`^ B?  @ @v @? 㿘`#?% 0 %3%@$@x 8|@.L@ ^АD?0 ?`0:@d %`H"#?㿘J@ ^ `@.@.j` @A ?"㿘%*#c|۠$'c|$@0c|$"c" "c*"#@ 㿘# 㿘#| 㿘@? 㿘"#?  @ #c|!%   ,@@<  c "c#`" "@"#!###|@ #c# C#c #c" & %#c?@ @  c#c  #c|  >  *#c|8 <@? @ ??## 1?L#8? "c㿘#c|@x 0;#c$J# !#c|" !#J?#J?#9J?#6J?# ? ?*?#*?#J?#)J#&J?# ? *?#*#J#   ? $    $    $ 㿘#c|" #" # "# 4"#@ <#|r a  㿘#!@E4#x  #̓*`@ "! Q#x!  c̕* "  @Ē $  nothing to yank㿘      "`  `"  ` ?"` c̕*  c"# 0@ ? yank something first㿘 # 0   @!8?0(  #̓*`@,@#"   #` ?"` "` ` *  "`   #̓*`z@ |"#"c"" "#( 㿘@o  㿘G#|""###c "*@H?  㿘$#@Ds`   ^^2 N >  ?`  **@`?*@` N *@  p 2( ^(  @ ?*@(#p%s%s = %s '%s' 㿘  B#p@$#  B#t@$#ʐ@$##đ.    * @*`א!@  `#ȕ.`. @ @ @$zcannot bind, not a tty%s: no such function㿘#Ā  @#ː  װ !! *` *  `"    2 @$L   :   3 , cĐ     2cĠ   u ) # @ ,   ,    ` `2N@[V 2 *  ״! *` *   " @7 "   : `; *` * גa   !@#B' ې@COcx#đ,   #ȕ.,   tcx#đ,  *#ȕ.,  "  㿘#֥cx?"c!!ɒcx$#Ē  * ``Ę   + cĐ* ``$cĘ    ؚ#f+   J  ē*`@   E*@ !&֙cx$#Ș #Ȓ +  *```"   c *c  *c  (c (c  $*cĄ(  㿘# @ 0#c#c"ܒ "# 㿘`#"ې 0@t  㿘+c|)##c'%@8c" !Q#$$c%c|@*$%#F(@6%c|%#$c$$@*?8 @"  㿘 @a  㿘 @[  㿘 @U  㿘 @O  㿘 @I  㿘 @C  㿘 @=  㿀#c|##\#`  " # @ 0 #|]@"@K  ?%B. @ ꀦ6 ڐ   㿀  `9  +#c|##\#` " # l$!  c|@ @)͔" 2  $c@Aܔ耢  ` ` " #c|##\#` " # 1B`  `0<0$@)#| ">$@S 0#젒#|@"@ *F J? /B;#0@B 㿘c "c#2  : "@"#|@*""##B x㿘Bcx ?"cx (` `"(J` J@"( 4 㿘  "##cɐ   c  c?c "c#  #`#?@㿘# #c *` : N 㿘  #[a   , * ? `   "#"#p"#"# 㿐!&#|#c#|" '# " H#| $c* #|"c"[    d  㿘#?% 0@ % H@R 0# :@@(?@&N   " '?8N(N*  : "N? N   "`'N   " '  0b *`:    " ' N #/"#* : " N    "`' *`:    " '2 N `"* : "N N    "`'N.. 㿘@ U㿘@  L㿘@ C㿘## 0g??a [VUa쀢 $㈔  J@  `_2J㈀ L Ja@  cd *`a@  D*`@ `*㈀*Ja@   U`_`$ U Ja@  D *`a@  cd*`@ `*㈀2J??   㿘# ## %# N c "# "##substitute㿘!% @$# @3`$@$`$ @@-D ! @@`%" @$#I`% $@P㿈 G$# Ҩ`'' ' $< $c, ', '' '"@ 2  $< $c, Ԕ', ''`'"@"@$ ” 㿈$# _`'' '@U":  B#$#ڒ`㿈$# @`'' '@6" :   B#Ē$#ҳ`expand(NULL)%S%s: bad substitution%s: is read only%s: %sparameter null or not set(    @|b $@i $ J# 2$J# 2$J# 2@ '$#`'ؐ ' '  '(@  ''Ԩ?$@@>8 -@Dhp N Ӱ  ,@D N   ˶    $,@` (,@?$@@=,@ N `1 )@22@g       $,@` (,@`,@?$@@=ɒ,@ N ` ),@`,@}`"' '/j @ @2  @dL f?$@@= ,@ L `T@  ؒ@@a  ,  @@_,@ "2A   2  $c `" " %  5$@5 5 % 5       %" = #"   ?"  ""(  @`  ,@U U   %"U  = #" U B  ?"-U < @@dN @U' @$"U #@`@@$$c ~`@ג@d @d0 '؀    @ @’#0#(@n  'N}  'y | 'u ) 쀤@ ؐ`'J@f_  ؐ`'J@[W䀢 2 ܒ ' H'B# W䀢 X ?W䀢 = : `" `  ?"` `"` @J5ܦ ` "`@JJܦ  @GW䀢 @!%"cP 2A,` * %`h   * %`h n2,@ i,@` $@  `@$@  @@ ? `@7 @`` $`$< c, &`, &@&`@`&@"@` $`$< c, ͔&`, &@&`@Œ@&@" (@ ' '$c`'W ' '΀  * %`h  } ,߀`]"*`@0`00A[`@9` @@3{`@0` ,@*`(`$ '  " ('@2  @2 Ұ `'`@ 2,@` ,@`,@` %s: parameter not set㿈N@ J$N@ #d N` aN 2?`@e [' *L` * @! *L` ] * @h@` @2 %$ " 2$ @$#  @`@aB#@@ @"$J##  2 &2&!X@)&@:Z $c@:k`$$ N  N :  N  N %`h*   ? %`h*  @ N N" 2&N ?&N@ * @"  %? = #$#    $B#$ @  #  `$`$y @@ϴ [y L` * @s L` ]o  %? = #t$# ͜`'' '@gU@`"1$  $< #, ܔ', ''@a3'"2" :  B#$L` @  $#`9  $< $c, ͫ', ''`'"@`$@$L` @`?4   =%@ h*`@ F? A?@_@`$$  % h, @ @2 "J B#@ + = - ?" $$ $J## B#@ %`h*  @2逦  +!X@funny $() command: %s%R%s: cannot open $() input㿐$# @-`"" !%@R @$ @P 1V@ -` (` #`   "   @[lȒ@#D   @C7 02!6 #@@ @CZ  @  @ @@ 2 @ђ@< 6 &  㿘@v %3%# P>JG.@ &.@U:@2     2\  @  $  @ ! L / < @(@ @[8  ? @<    2. @ (*L /%< @(@2   @48  ? @ @<  2 /,@`,@ $$< c, ˬ&, && $# $@ @7&"@ / ,@?$@@7,@`N /"@' / , @@;3 2,@$ @" $@7@c@~@&@<Q @ H@F  @۾<L  .  L  .2OL O .N .@:  @D  @"@@7;@G@?&@@ @  â@ة2,*+?@!㿘@̢ *$@@% @ % (`2 @`L@ @̉ ` 2 @ @, , , `L@  @,@㿈 '$#`'f ' 'L@ 2 *@ ` /:"*@?"@$ `@6Đ `*@`L@ `L` / `*@ @   @. N "& @?$@6 2, , N  &HOMEPWDOLDPWD㿘N  +@\#@]2 NN  2 N@\|# @] - N  @\o#(@]@ B#" 㿘@P% 4@Q$ 2 @i 2   %@6c8$  $ 㿘  @˶ ,N {#    `N { }  2N? ,2 "N  # g$0d  $ $< c, ͔& , && Œ&K" 0A= "& 4N { }- 2N? `N ,2% 2"`&$#6`@@@@,f2㿘 @) %sPS4%s%scoprocess already exists%s is read only%s: %sX'D'H' D 2H H  DR DH@\?@3 %" @R DR L%"#PDD ` *`:`'$J#1 3 .@[C# @\t  $#@D&c $##(%B#B,  @` c@D ,  $@@# @= D  !$DR DR  # @v`#"`  @ @D %D  #% %'B@ݒ 6 ' x$`X  u%q%@\ D?* : `b"l*`@hXXDDD<,@PDH@DH  `09H 'HH ?'H @A !$#` 2@# R @&  @4 #` 2`DR !!$@b @ DH `@h @  @dH 'HD 'DDR !$#  @%R`# 2 HD`@@I H %H "'%DH Œ aD 'DDR HD a0Ґ %`@$# 2 @3G " $ @ @2@2U""쀢   @#0@  @ !$#` 2@ @ #` 2`@ @ @$"" "    @  @Ӑ$b"b @ $ $   $  @k $# 2@H ?'HDH$ b@j%DH  G`0`D B!'D   @ DR `?@DH , a0EH!'HC%D "!:`? 'D '"d'#'#' @'{0% 'D  $D L 0#   '$# 2@$# @2 $#  ?  @2 @1$'%'DR &! "%D@YP $D#P@``' @Z@DH  a' %@"ǐ 'D@Y) @$ D#P@`@ZԒDH  a'0$# 2@$# @2( $#  ?  @1@12$'%'D t!@ DR@` `? %DH e a'0D  {%D Z! D H D H L a0eD ߒ D 'DD \%DR W%D '0ʒ @6   ' D DH  a01DH  a0+D D@cDHاD @]'@PD@1zDD`@t . .D@ %@ #`@'%@1 " XH @{ H! $J# @0 @O _builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈'H'P'$J#(   "    2  X(  @[n @Y? H [ʬ#ʪ#, #$'H  P` H X@ 'HH 9 `@=H   2`P 'P$H & b@7 b@7 p?   $J#'  b*   @ 'HH ` "( H H!  0%"#P'H쀦`@VW`H H   H(  $J# 2`  D '$$##(.`@R $J#1 (`2 !@W/# @X`Ւ @@# .`@` B#B#@@ .`@` @<㘐  @Z ` .`@ Ƒ.`%K#PH $J#'  @k /  `@8 @'HH    0)׀ 0$H@ 'H J$H   H  "  H@  `@a ~`@[ H  @-O H.@  a@F  @JȐ@E @  H a8@0Ԑ 'H$c'H($"c$# "  ` !$# "`| $Jc1'H2  *c1H "'H@""@# 2 @/l 2 $HP ɒ a%"`X $"c$#* !HH = "H &$2H  H@ ?"@HH @T#`H"`! *`@,8,88HH8%^ X@.@.>@. aX@0RH $H  "  H@>  ah@= ~a@7  @`1 J#(   X(  @Yj H@W` P  @TP $J# "  C @NF C @NB  0 20" H` " " P@?'P %"`X@-ܐ EXECSHELL/bin/sh%s: %s: %s㿘@U"@VL %b @  L 2 " &  "@ " @@q.@ " @shcomexec: %s㿘@I%"l@I c@S@㿘$#     @I , 2 , @J&& &  ,  㿘 @IWԔ  2 " ,  ?$$ ?$ @S  `2`@J`?@R $ `$V` h$ 㿘 N = * !2N +  @I%"l@I " " " FPATH㿘@I $J#*@C / `  o%"l@I^ ` @2 .`Y   @T"@UB#@& &  @ &   ` @2  ` 2 % `0 ! % @I#`   @     ?& %fc8 ?&  `  Q M`K `  ` 2  % @I    L &  &` % %" @~   L %@-c8& &  &`@T"@UEB#@  @]  `L & "`L& 㿐%@I`%%?@I    J /  ?$ 8$8 @ $?@m`.  <  2?I ?<     2&㿈&@ / Ɣ@?X@ " kQ@  '$#`' ' '耦`;@ :@m@$@" @-a$@l@ /,@`@"@@-N@Zy N@ Ȳ`Ʋ S 㿘'$@$%$$  #$@7ݔch!% $"x$"@3  @@8ch$"x$$%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?       $J#   .' ' ' '''!'$J#1 @R# @T톒   @O @ ?`U"X*`@pހxH F" $J# A&  @>`@ <  2`/-"  @ʒ `&L -  L 2 #     @ `  @N c`@ $?`$J#'   `@ ?@䩔!`!$2x?   !!!.@  `@ ^?# *R@   @  #` *2@ "@?`@ <`@      @NX.@c  a @  +?@'?`@``` `` ʐ#,@ `  @ Z`@ y`   $@6 here document missingherein: yylexerror writing %s: %s㿐 ` @ xa{?r% @'  @5Ӗ 0' "m?@*O $# @*Ғ $ %@6%@*P"`@V?# @ @`" %"`@@ ! @ a@6'% $짒 !$#@ h #`@&@"`@`'  ` @ 6 .@ #`@ ` @9@6? @T'.@ "@ ` '@* @㚔 &?PH@REPLY-rreadPS3㿘  `,` 2`%` @Q5@@RfJ !@?!@Q) X@RZ@ f# PM ے`,  @Q@@RGJ@ ײ @ 4B* ?B#%*d) %s㿘.`x `@9 㿈   @       @ ] 4 '''$#@2 㿐   `?`? J@ "`J@`? `+  J@   : * `*`J@ *t``     =bD.`@  `?   $ 㿘`   "`1B #耢   y㿘ndbteste_error: %s (offset %d)㿘 & ` @ ?++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"''ܐؒ@&@p''L''' `p''"`p@(D $# @(ǒ 쀢 *@"@(H   "`pL 2 B@ #@'ǐ@t1  p` ( '@q"` p"`@Ð @{  p  (Ԑ @F "@Q @P @Q$ @("`p end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐 Y . @  p  '"  &   p ( )  p p   p@P@ # p  //  * @*` p@  p c  p `  p `   p  `P  p `h  p `@~@' missing )zero divisormissing :㿘 Z   p ߀ 怢 #@ @! 88& " `?0& /  *& @yѐ   p  $ Vb0@i  p`@) @`    p  >   p  J@ @K0D  p  ;) ! ,* `p  /@2@A @   뀢 v@.耢    p  $  b@ * x$dDHx @  @{  @v   @  "@  *@  :@  @&    @$    @4    @6     z`?   t@   p @  l@  h@  p`  "` א@   @  R p  p`  "` @v  2     7 p` ?3"`  @  p`  "`   p` ?"`  p  %  bP@5 p`  "`   p` ?"` "  $ @"@O@O,2&  p  ̑,missing ]㿘  p M[!   [! M  2   p"` ( % h*`@ <  % h M *  2 [ ! @T 2 `!  p  # @ p"`@@ "`p !$# % @&@Lͤ`p"`#Ӓ`  pe & %`h*  <_% h *  2M#! M_ !  p? $# % @&@ p" }"" " @O 2$ X#`  p' ' p" J p`  p2 , @*`@`@:   , * J`퀤`  p )"`  p" 㿘@@J  ` $ @" @Nƒ@N< "$ 㿘N` 2@@@@2 @. *`p  $ . *`p  㿘!$# `""" #`" " * 㿘N  @" @b%@N~ 2 @!    p"   &@M'  *@& p" e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        #+$$b@+uЀ C8$* ttttttttttT\dlb@Ʒb( `@  $#@$@b0$ "8@4b@"@ $"* `Q `  2 2"@"Xy `J@ `@F = $#@$`$@-@  2  @n"@P  @ @K `A@y<` @N"0 2 22  @8"@  " @ @   @     @@  @@  @  `? <""@ *)$5 3%/@$`H": #h@3 " @@   #h⸔$@3#hb@2"`@ހ@$@/#h !$#@ِ #`@%"`@   .@8 "@  @ @! "@2@"`@@@/?2 $.@ @"k J#(  %#@J @Kt % @@#@ % S" @   @- 2 #0@c E @Ӓ & ̔'   $'' '"@@0 " $" @#j @., @+$ @ @ $#P@! @. 㿘@) )!%) ' @ʒ  @, L " @@   ` "`@Ք @y2,!% @@ l$ @substitution failed㿈`$#@"`0T@ @   '$#`' ' '@g  $@"  @"@ @ @  @ ͐ "@@"Ē@ Д $ j%s: not in history%s: invalid range㿐@%ʒ 0􀢠 %   "* `H%*` H@% 0`.@X4% H`#@3)&% H""L ?   %% H`0" : ? @} '"p@( %*` 0@no history (yet)㿘%% H`0  2% @ # % H? H㿘%% H`0@# 㿘!%% H 0 %B# `  "%+c8 H?$ H` $ | %%H0"`: @&   %H |  *`0" |  㿘%% H`0"< `? @ ڐ %%.  0@@ !1%!%,` H@ @@  "  02 @@@fl "@ 0&@>  0@ H?㿘 %#<%% H`0"<`!%. @ " !% 0. %r8$ 0%"c<%,`@"H㿘    1 @$   %c8&  @q 㿘!% 0  % "c<"%c8$ 0%?"`H㿘% H %%#%c<* 0  @%bc80c< `@ 4*c<* ?0 %@!c8@ 6$ %J "*%" H㿘% H@ $@ !@J? "!% H`%8 H"@` , @,HISTFILEr㻐$J# N  "` " @F!0@H0 J@   ;" %@ Òc8 "`@\a@0   /    $@l*;@L   $` "` ^ $ ۨ`?@Ew%s%c㿘 `x  2"`x%% H`0"< %#<* "% 0  @b% H@ )'%, @ "@:  , @H , @㿘'H'L'P'T'X%""x% "`XN " $@ !$#@/H @.#$@+#@ 㿘'L'P'T'X@n!$#@/L @.r#@+ސ#%s: 㿘'H'L'P'T'X%""x% "`XN $@N $"􀢠!$$#@/``!$#@/eH @.H#$@+#$#@ $$J#% a$""@@ internal error: 㿘'L'P'T'X@ !$#@.aH#@/8L @.#@+# @ %s[%d]: 㿘$#J-$#`` @.ǔb % @``  $$#a@.% @" 㿘'H'L'P'T'X!$#@.H@+I#shl_stdout not valid㿘'H'L'P'T'X%"x $ b$#h@.ٔH8@Ē   <   `  㿘  $@)h  $@)  $@)8too many files open in shell㿘@a . #㿘  @ޔ  `.  ?̐#@,預㿘 `$@*ʐ#`Ŕ @can't create pipe - try again㿘@: 6  &  & 㿘@@ bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘N[!@  "*NN  2&NА @h `+(!`(  %` `  2!x! p N  @K!&?$"؄?  ""  㿘1$"؀` @@~"ؐ?&"؁㿘!$"܀  "` @l?$"܁㿘1$"` @]?&"no coprocess $$ `"@?㿘  $""܀ &1$ 1$1$"؀ &1$@/?&"1$"܀ &1$@&?&"1$" @?&"/tmp%s/sh%05u.%03x㿘%  @ ,` & & -+%' ).`D`$@-.@F!  @(=  &  `D  `&% D&  argument must be %job or process idambiguousno such job㿘  P"`%"` `@T %"``@ "@C"@`@; )   $#J#  *`  @'  "`$#J#  J $B#"$. *`@` "`*  @;ǔ ?<. $J# $@J# @B 㿘  1 +%)$$#%$ `D@2$  2  2 M# "L 2@2  @6Ւ  2 @6Β  2 `@D @X$%"`D $!B#`C@~# @7[#$Jc @.*cj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘$J#  @Ay   C#  %"@ "!   @7  "`.@#  `$   C"` @; #C! @c& ! Ā@ @ 0 .@  _ "  "$B#, *  @: ?, !  0 $ b + @6Ð  C.@  6a$ $#@b  B.@  %a8 "  `"# $b"   C aXC# 5$@@c01" $J#  "$B#, *  @: ?, $"$B#, *  ` "?2` `@:s ?, $J# @Afork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐}=` 慒6 %`@@ $$$$` $    `"#"`@` `2$$ $$ $$$ $% D$ ` "`$$($0 "  " @ N  0@  +.)%@`P` # `  \  @,` @ ]@` @5 . Ȣ`?`"$ @%"`D$ $J# `    $  @5   `C#@ @``g@]`b   @ @>$J# ` $ "$B#, *  @9 ?, $J# `$@") `$J# C  @9o C  @9j 2  @n   @@`` "  " $#* @?* @8咒`  `@@ `8 @ $""$0` "`"``#@x$J# !$#a@)( #$!c! @) c !$@)#@&r#  @ϔ( @^ 㿐 %`@U  `" ` "`@  @G waitlast: no last jobwaitlast: not startedjw:waitlast㿐 %`@/  ``  `   ;b  b @   }  @|Ȱ @  %s: %sjw:waitfor㿐  %`@ &@  % D  2   2  ( @s %  D@  @Ӕ #? @͔  ?ȗ* #  @& @   &@㿐  %`@@62  @ ȗ* # ;  2  ( 0' #. @ 6 @;`  2   2  ``2  @3_  @3\ 6  .@  #  @W job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐  %`@!@2` @ ȗ* #  ` @  6"XŰ  "p``(   "x) 'B  2$ $    " 2 B#$@$#h2$` @Ȓ `"` @>` 22`    ` C#`4@=   !C#@t` ` #$c@=p  @ !C.@_  "#`_ `  ?$` `@""`` =``@2  7`.' ` $`   ` C#$c@=;   !C# #@,`Ā   .@#   b#}`Đ @] @ "ؒ 0   ` ?$`  @ @@ You have %s%s%s jobs stopped and running㿘  ( % D$$#Jc$" ` "`"H 2 2  2 "2 " "؀  ""؀ " " "  jobs㿐  %`@ٔ􀦠   @d` @ɔ ȗ* # D   ``    # %$ !`   @ @.h ?   "$    2    #  "@6` 2  @}  notify㿐 %`@r  ,$%$#$L "    @ @c ? 8 "$  L  $%  "@@2 $@#J# @= 㿐 %`@5  ` ` "` @)   asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘  `"  ` !!2   @c     hc 0B"   , "`   `7# ! 1 `  "! " @6     !   c@1  &  @oc`   @`㿘  &  (@ 2@& , ` %"` D@ڒ j_waitj: tcsetpgrp(%d, %d) failed: %s㿐 ``& `& $J# "`  2" %@2F %"h  `   ?& @4" & `" @32N  `倎`ဢ`  `s&  & $J# &  #C  !C# #@ `Ā 6  .@   a(#[`  C  & C#@: 4C#`&) , 2C  2C $  $@:ޒc , ?& T C  ` c$c@:Ԕ  2 ,  ;&  , '$J# "% 2% `  *Bc   %@3, % $"`(% "``` $J#   !$@f#@!ߐ#  $J# `2@{p.    % D   2 2Y# 2@+?@Eo L.@"  ( "    2 2( ''''"@$@"$"@ @" ''''$   2       $ @ ?" check_job: job started (flags 0x%x)checkjob㿘 2 ( bP0`  `  4@`2`&  ,   "  , &  , : &    &  ? $b쀢b"b  0`$""䀢@2  ? "  @& $J# ;`:$ $@ $J#" .$   ($#` ` "`R  2``2` !   @  @] @     $  @ta$J#  `   `  !& ?&  ` "`@Tbx%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sH /`   ,"  @#’a(0  ?&   !0!@    + 2 ( -/ ( р /B      @`" " :`!H6?-:``"2/ :   !P!P' `%/  @X@#:`  2 `2 `2      2  / `*`B@@4``` ( ah @#L`ax@#F``a@#> `2 O "` !㐐a@#,   㐀`!㐐a@#   ; 7 B#!B#! *``   #\#\@"2  㐐@"  "  27  B@"Вc㿘 %`h*  "'L@  ̀` , "  2 ,  `    2 ` %` &@L`?"*`@CDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDCDDDDDCDCDDD$D$D$D$D$D$D$D$D$D$DDDDDDl    W` S`0U@3  J`  J 2 @`  7   ( " @Wے  `"`2.&@-    2 (`@     (`@ݔ 2`` 2 (`` &@ 㿘 `Ȁ "`Ȑ `%kc8  `"& ` `@`2``"& 㿘 `̀ "`̐ @%Hc8remove_job: job not found (%s)㿘    "@ " bH0)"@ ("    "@" ! %  D@  `?"`  &"  `""` `""`  `"` 0 "   2"2 ""㿘 (   "@  2 %T㿘R  (R 2 `  ".@4@#&@`. `.@4Ihno closing quote (    '' @'$#`'q H' ' "  `" Ԙ Q'`  ,@` 'H' ,@`b` ''%! @@N  \ Ѐ  "@N@  @ "@ #! `Ԑ "`'%! @@N  \ Ѐ  "@N@ r  @ `Ԑ?"`@ 9% @`  ?"` $J#% a`,+%3  7 `@@N  \`Ѐ  "@N@ A P   * % h D?$@@P `@ $,@LXNVShSUSUTW,WXU [< *``9 *,@@$@  >J  > % h*@ * : ?А >`?@2,@2,@ ;% > ($C  & %0=3 > | </$054% @J@  \   Ѐ `"J@@ | ; | &!,!!! & !$# `$% @J@  \   Ѐ `"J@@X <+ & >( &  >  $   26$ % @J@  \   Ѐ `"J@@1 -  $  > <  $ $    > $  |  @$ @$ $ %" $!@`= @0J#( % @J@  \   Ѐ `"J@@ (!@0` $@ %"`$ (t!@% $%"@ %#4J@ ` @* `%#5  @$ 2,?%"J" O` N!@'`% L@'~` %` !  } `%$c $ْ`1` `-%"%b@'c&!@ "% @!`8` "` !% @ @I`$` "@"`"`  @"`8$ @%$#$` @!㿘%"%" %#%@( b %%""bcannot create temporary file %s - %s here document `%s' unclosed error saving here document `%s': %s 㿈' { '$#   !$%7#8%b& "b#. #`@&"`@ #  '  .@ #`@ @ ̐ $# @ O  @ @\@ ^  %% `Ԑ "`# '  @J@  \`Ѐ `"J@@  @ L  L K I@ $ @y@J@  \`Ѐ `"J@@ @H   @@`?"``"`*   @``?"``"`*@B( @ $#@@ B@   `Ԑ?"`ԁ㿘'H'L'P'T'X%b "b% @ ?  %`@ 8"`@ ? (`@% @!B#"닐 $#@H㿘 <ܒ$ B#$$ $ $ $ $ $ 8? $ $!$ 0 $$ 4 0Ɛ $ , 0 $ ( ( @K 㿘% @@`$@J@  B#B#B#%%$@` r* deeffee<epf\$@| @|`@` `$` @$@$` V$``  2$@$@$`M$`$` I$`` " ` `8$@` ` @ " N J@  @f J?[!@ ` " `8`8$@`  9$` `8$@` ` @ " "@`  $` ,`,``$@$`@$`8"$@$@`` $#` ɒ``8$@@ 2` $`$@$` " @@!$@#@>#@`$@J@ "u$@㿘 ,$J#    `?  @  (<$ (@ w,&` & % B "c@# `$#,J#,  J耢 Jꀢ  $ & ,E% @ ?  & ?#'% ("@@  @`$  "@⤀ " (@'m  ("  J "   ,$ ("  (@ Ҡ? %@ %` " @%  B"#@#$  ,&&  , @$  ,   29&@G 5&3%"  , ` % h*`@ % h* " JJ  * *J %" 2  ,蛒  & d  @  PS1%dPS2㿈% "" S!%0W@/"p@0@'*   B@ J ""xJ@ !2 `'J` ! ``'J@@  ` @rJ@ 怢 !@ܐ'!$# '@  # @ %%b " !% @ 9$ @ @/`"@0$ 㿘!$@Ȓ#@#missing ] 㿐 )%'  % h @J@  \Ѐ `" @@`l.`llmHn<nTnX, :  # [  *  U  *   M *  H F  *  A`, :  [; @O 2.k 0 ?&@ .  L 2@$#` @J@  \Ѐ `" @@  *  ` `2@. , @^: 0 ?&@.q 㿈  '$#`'  (' ''%% @J@  \Ѐ `" @@[?$@x,,`:  [  ,`:  ]"? ,`:   @,  $ <%`?㿘 `Ѐ ?"`% @B#%` @@`"@!% @ `$* *  ""  @" 8$ @% @㿘  Ԁ  % @J@ `0 `Ѐ   "`% @J@ `"*J@&" % @@N  "@N \% @J@ `"J@ "%  "`ЁMAILCHECKMAILPATHMAIL0@-ߐ!@/ R@  `쀢 ""` " C"@-Ȑ!Ѐ "     @-!     ܀ )%<#   " $ @ 2$  2$ Ȁ 2 ̀     @$  2 8  䀢 " %c8  $  $ @   <   $  " 㿘! @= $ ؐ%@/c83)$' @͒ :,@`@ƒ %N? \ ?@6 @%   M#%  @ ?. @"`$؁㿘 #%  &c8#c8 8 %c8$$ $  @A 2 $ <  2$ $ _%s you have mail in $_㿘$J#( 2  !@- @.   !ǃ !@1i IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSIONyxypyhy`yXyxyPv`yxyHy@yxy8y(yyyxxxxxxxxxxhxPx@x0x xwxwwwwwwwwwwwwwwwxwpwhw`wXwhovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUnewgrp=exec newgrplogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliasTMOUT=0SECONDS=0RANDOMMAILCHECK=600OPTIND=1-iPPID-ri-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin/sh-shPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVyxyPy`z`yh0@!@ $B# @"c#%c8 @ D7$@*"#  @+5@@!% c8@۔ %"c8@֔ % 4c8@є @%"lc8@ʔ @# ʢ#, ւ` ,  , "  Ģ", p` ,  , %%!$  @3   %˒c8 @'$%% "b$# * * !$@1#?#@@Ւa #@ϒch #@ɒa -$# * -#   #`  @.   2`@!$%"`D$""8   @. "@Ŭ @*!@,0L /@0P !@*  P@2 T@ @*%"J@ %@ Ȑ %"J %B#"@,b@*ǐ!@@@,@*!@ @,@*"`Q@,ic"l"l F   @F.%"!!"@@*!Ƞ  $@+@ # $%@,5b$#@& 2  @Q@_", ,$# *  @% $@쁐 J# $# `,`@$$ `ؐ!Б,`@`S$"#P`@'$$J#) "$$# ֒`,`@$`  @@ 0  $ % "`X.@p !$("c# ,$# `!$~   @L $ @  @z    ,  $  @ "@$ @)  <  $@  $cJc ?*c@ L  "$$# ,`?@"`&"``$#"@ $#'J#'*#'%"J  J`  ea$#J# "(  @U L  $"8S   @I $J#& " "H@)"`@*A J@    @2 @@ 2  @)!h@*@ ` `"d$# * $J# $d@# * @  include: %d`'''''  @ b 0 '?Ԁ  $#` '` '%''% @'@ː $# @N ?@%" @ @T 쀢  $#"`"`?`!!0*`@PP\%C [̀ % X 9 @-  cԀ  3$$#`" `" c `'" c@`"`@/ %"`@@ @v쀢 c"`"` 㿘$# Y`"" @ shell: %dUse `exit' to leave ksh 㿈'D'HD ' '$J#  H@ '@* 쀢 %"#@$# @ ? DDB#"@?`/"!#*`@  쀢  2$B⭐#$J#  D  3% %D "`@@@  !bJ3%%" @| D 8 $J#+ D`  D` ?"` 쀢  FL DoD@?$V +  $J#  ?' !P"0 c@  e  &c@D" H &@*  $J# D h %"`X  V  쀢 c@ 2&c@@%@y% X㿘 B$J#    $B#̀ B #$J#   !$C#@ !$""#%B##R /*  # @$J# %@" `X?   .  @  @=@`X@#㿘#$c D`44  c`$ $ $ $ @$c㿘$#` 2 %@q X`@"` @&i`  ` , R@`"   $` ` R    $@ ה@:$#`"#5`㿘$#`#` "` ` , R@  @ $` ``2` $#" 㿘$# %@ @  %@"㿘!$#@ @#" @B 㿘  !%  D@2@i  2 㿘@B / 2 @J r @Erch@ alloc: %s㿘 #bXດBD#`% h* 0 %h0h  %h(  0  J 0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 a% h*@  z2@  A% h*@  Z2@ %`h` 2`## ##( ##8 ##@ ##H ##P @##X!0123456789ABCDEF㿘1 !.$ P?@ .@2?㿘   @ @㿘` `*@ϔ 㿘   *`@&  ` &   &&@ a ceiklXmxCpnhf`XPbHu80 prshvxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘$!  $!. @   .  . ?%-*s %sonoff㿘.` $#J@ % x% %p@( Current option settings set -o %sx "2%%i 'آ $!  $!ء. J@ " @ ,`" " ؀`'ذ .  . $#h%@4 0!:!$!  $#$!#%N  . J@ " %a .  2NB#p$!  $!$#*` J  J@ "`*`*` *`*$#s`㿘$#N  .`4 2ᕞ฀    &$#* * *  . ` @"@@@?@J@@F@ $#* o:Ao;s%s: bad optionparse_args: `%c'-A: missing array name%s: is not an identifier㿀   J R%# #* `,  `, @$$!  $!,  J` ` " * ,  2, * *& ** `,  `,  `,  `, @$!  $!,  J` ` " * ,  , *` $#J@ -   @? / ",` J  -2,`  ,`  !!*@ $#$!@͔d2 `A `A`o`?"ϰ?,` (`?  ސL䠒, LՐ  , R Ȑ& ~2 `s2  ,   , J`@2 R`@ ,  , ,   &`_x? %*  J - +* J` J@ - $#%J#% *` *` '   쀊 2  *  "& &  '* `2L@&ݐ 03? @' J  & HͰ?0# ,  2 *`$ *@x *@*=  '*  J- +2  %h(  %h* (Ѕ+ 8 +  2*J- "@J `  %s: bad number㿘Œ'"eX `+ @䌐@䉐@@$ 2$@$# `U@ `?@j*+?@!㿘   U  N  * ? [E  ]`2A       !"   24   ]"/ .  `(21 $ '#@  `  | )`02 `  2 *  ``?㿘 "    @ꀦ    ?"` [ *`̀ " 4 &_"˰ @ːİ I? @   @  "   ? 2 @ $  2  ~  y  @Ԑ@Ȕ "j   ?` 2] @ M  E 2B  @N@ E?B @ " 2 @ 2       @* `?     !`?2 `[     22 @?8  - 2  ]      2   4 @4   2 ]2   㿘% #'   ) |?? |2  2 `c@ ` 2  * 㿘.` @㿘&@:`2` : `[*`ƀ ?$$$@ƀ `@$@$2 `$@$$@ $$̤ݦ2?$:`&@: @``$$$㿘@ "" " " " * %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`` @* ? J 2D`@* ` @ -&`J` -`J`  `@ &@&``  &` ʰ?`-2`` "J`` "&`` 2 &`+2&`J`  `&`?@ &@-`   &` ` &`, : `??Ɛ  `, `#"N@2`N :2`.``R&` *!X` *!X*!`,  *7a@J@ : ;; ,@* ?`J ` @* XJ@ ;2NU&` :2`.``&`R : *!X` *!X*!`,  *ah; ` B#6 ?2 J@@* ?`' #2), @* ?`J   `%`h*   &`@* % `h*  &@ &`&`&`, > %s'\''㿘  % h* !2L L  L  +@!P00 (+!Y%+$#h`'`1$ 2 +`   2 L@  ?&  `&  *@ L  `+!`%-*s%*s㿘 $#&`B#@/" @@'` @$!B!B@շ#"@@$  .$5+/+-B   @ա@6 @ @Z 6 ⠔@Q  @&۠ $#``㿘@& @nj @`@L@ "` @y&"$@@ @.@&@㿘 @6@.㿘 %.@Ô   # @  $$ 㿘 @ ?    @z* ? 㿘d$#$T`@w  . "`$#ג`" @߹   $#  "."`  @޲ $#`㿘   `B#N@ / .'r 2N` .``*`:  / 2    L  J@ :" "@`J@  :"@J@  `&  L /"" "N "@L@"@C@OJ? /@ /,@`$@ '@"@'@3J? /@ /,@` @ @"@@ "&JV/`? 2   . /J/"J .@2@*@*@`<*@,@J"/"J.!@J/@ @ @"*@*@`*@`*@`  /"͔@ 8J@ǔ"J*@`JJ/*@㿘   Β B#@ޝ %`,@ !%"`,"%s8$"%"@ݜ B#$#`㿈@{ '$c`' '@'@ 2* /** " ;㻘?&dK`N /"N [@ƒ /$@@:``N .H`2 N .2 N . ;?N /6 8?3& /. `" @. @ܿ# .   *<O / " 2N㿘@1  4` @r @͐ ` 2@  shf_fdopen: missing read/write㿘`"`` @E   "`  " ``"````  .ՙbH   $#`&  d & $#0` 0& b$# & ,&  & & & & `& & & && $`& (Ґshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @ߔ   "`  " ``"````  .3c       (6&  .$c&  & & & & `& & &  &&`& $vshf_sopen: flags 0x%x㿘   /a0  $# 0q`$#  & ,B B2 ?`$ @^ ,?& & & & & & & & && $& (㿘   @b@۶ &?"$  ,㿘  @H@ۜ &?&  & & ?& 㿘     &  @  ?&  `& *@" ,㿘  @"$  ,shf_flush: no fd㿘!" 0` 6 /Xc(. $"`!?@ *@&   :   @۱ &  & @ @  shf_emptybuf: no fd㿘!   6 0`(. $"`y?@ `p *@&!%` $@$@2`?  *` ,  "@  &   "@  &   @ &  *&  @ &  *`& =& @5  "@ %%. @p 6@   (&& $&  @@ܢ & $ 4 `  & & *@&  &  &  &shf_fillbuf: no fd㿘!2J  6 0Ӊb@h. $ "`@ P ?2,? & & !.  X   &  2  "  4  (&. & $&  &  & 㿘 6. (. $"`Q?@  ?2E?@,2(& 6   " : `4& 2 8&   : 2 & ( &  "&  &  & *@& @f 6  . & $(&? shf_read: flags %xshf_read: bsize %d㿘 1ђaЀ`% 1aʔ` 2  /?@ @ 4@ٻ&@& "& `4 @$@ (` shf_getse: flags %x㿘 1ґb耦` 4 ` / 2 ?"&  ", @ " $@ 4@p& "& `&@`2 ,shf_getchar: flags %x㿘2  2H` 2  ?"? ???&  `&  @shf_ungetc: flags %x㿘@2@ 2"`@(2<??"9?``@2@` 20?@@ ?"&?``@2@`@&`@!"@` ?"@?*@&@`? &`*@&@`&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@? 2͒a?">?@ "*`/` 6@ 2ѽa@(.`$"`)?!.` @Q  ! 6`  @ "` @(&@ &`$ 2 `p ?" ?`?&```&`*@㿘 " ?@|@shf_write: flags %xshf_write: nbytes %d㿘 2jch`6 2cb 4@_&@&"&`;# ?25?@ %`@ː&@ &@#. @ה 6`   (&`&$&?$ 4 ` @!@&"&㿘'L'P'T'X@NLshf_snprintf: buf %lx, bsize %dh'P'T 'X` Ȑ 3aPȐ @*PCh'H'L'P'T'XȐ   BΖ@H/0123456789ABCDEF0123456789abcdef(null %s)P ` a @,W`3#D:``%   ? ϒC&  `& *@<  N@ `% h* :  Ln* ЈxаЀФАA?=":@9N@5 06/N@ +) ' *  &,: ?@, `% h-@*`,: @@, ` "N@ f` & ,  ۤ ۑ* : `S4!*`@pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp\DppppDpppppD@pp4pDppD Ϥ* : `k4#*`@         dԤ      Ԥ   @?  0,@@: 2,:  u: -5 +0. +  04  ,@#'L@ 0"'3"83"P  @4  ,@  X x,@ 0,@'?$@`3"h@ // @@c_%@ @"@? L@ + -  0  )?#L@3 0  ? 0 `&  `&  @*@`?  @` x 0  ?*`:  `&  `&  @*@`?@  0` %,  ?< ʒ`&  `& *@`,    `?  ?L@ `&  `&  @*@`?`$@,  ?< &  `& *@`4 @,``(?㿘! $!h%@"" "aX!h    $!hA  "al!l` ` ! !X ` @ $!X`@o 㿘 @/* 0  | "al@#  @X  @  @ $  ah  "ah!l |  "ah㿘ΐ $% # h $hal $al!!  !@   @g  "ah㿘բ L' % h $hl۽ $l ; &! 4 !\  &%@ @ + &! &  ` `@- $`@( ` @ °`@ $`  "ahtoo many <<'s 㿘 ah 2   "ahm !"al !l! - "!h#%`$   @?`?!@" b `$& %J" %  & %"%"@ %6᷐#p""""% $& 㿘 ah  "ah!l 0& "al@e 㿈@L @ @ too many redirections let%s: bad identifier forselectH !$# p`# @k`'' @'$# @b`''ؐ @' !\ 2  %@ @    ah  "ah !lǐ , "ala a 6xȀa! `{" !`( ! 0  s! !  3a !#  !!!   !̀!   "ah!$#`#`#`  "ah@5 + 3 #%)$T` @" :  2! $ah 2al %ahc&al!"! (`#f!7c7ː!8ې,% ئ%ahؐ" :  " :  2 %@&" "4" :  $J# @f`$  ܠ$< #, 'ܡ, 'ؠ'ؒ ' $< #, ', '' '`$" `" :  ؐ" :  " :  ؐ" :  "%ah@"  )   "!h  ( )ۤ { }֤ @  "!h $< $c, ', ''7$c!P@'`'"!r  $< $c, r', ''`'% $"@@C  "!h ''="l'> '>!'>!'h!7  @'!7 @% $@  2 $a 77!p!x7ѐ!X#%",`$Ȑ@@f@$0$@a   @!7s@$$@0E@ ! % $$Ȑ@̒@$@Œ@ܐ U@$$! @ɐ$!7  2 @S  @    @  !ɒ % $ @!7} ,d!8% ,$#~` $ %$#,~$ T  @!$ $< $c, ~', ''`'"@"@#$c ~$ ܠ$< c, ~'ܡ, 'ؠ'ؐ`'"@ܒ"@$ ~m $#~`#~`㿘 ah  "ah!l{  "al! {! }@ 7 㿘!1 @  & @ @& 㿘 ah  "ah!lJ , "al!!  0u@ @ l& &  "ah 㿘 ah  "ah!l#  "al! {!  }@\   '  % h  l$h  $l @`2$`& Ē 㿈$# @}m`'' @'@  ah  "ah!lܐ  "al (  "ah)$'%% # !  $< #, }', ''`'$"@h $halׯ $al |ݐ!  "ah $< $c, }v', ''`'"@"@$ }d&  )T &  ah 2   "ahz  "al0!l!< %S%s: invalid function name 㿈 '$#`'|ِ ' 'L@ 2 @쀤 : @  ?  :  @ {:#ݰ?$'L@ 2 @,  ? 8Ѣ` `, ̢`@Ր  $ |& `6  {ܒ   "ah!$#  ``2   & @ & # |y`& "# |s`& "`$#` ?2`㿈$# @|b`'' @' ah  "ah!lԐ  "al! ;?  <"ah# 1 '$%%ah $ah!lֽ &!l! $< , |', '' '$"  ;@ " :   $# |`   $< $c, |]', ''`'"@"@$ |K㿘@%" " " `XPH@8 0 p x (  {} newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘% L%c8@C ;##Ā '% T` "`@@L@`"" T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %R?%dsyntax error: `%s' %s 㿐  <" "!h !l" % &;"%";a\ a\ <"a\% @"`<"< "   : <@@ $ ##Ā " @R` "@`@ 2R`@  // <oH<"Pܔ \\"" "   \"%@" \ \ "` "`㿘$# z’`22 " " " " " " 㿘%"" a\  `?"a\""%%""b%" @ !Xaliasexportreadonlytypeset㿘$J#%   a)   =@`؀ "  e r=@`  r t=@`耢  t2 =@`   "  2   2 8  2  ||&&!() (08@]]<>㿘 ah  "ah` @ AԮ  "al !l  a%J"@ ``Ja`Fa `C %= $:bL`8`(4`) (`a% $  ` ="`="h$# @ `%F% $  % $=bX@`? / `,"!h2 `=D.`$# @ ``@`*``$< $c, z `"``, `"@`@"``""㿘 ah 2   "ah @ "al!l! % "!h @`*@`$< $c, y֔ "` , `"@ @"` @"@% $"1B# 㿘 `&  "ah !"al% .` "$  *`(8 J *`  * " *  *  㿘"" 2 `2 @㿘 V .`y# ,  $@6 .`@$ 6 6&  0, `"' @ "`V  * @@ ""@@2V * @@ @"@ ?6 2 yw ֑, yp㿘T  $?*    N N@@2   @ 2   2T *  2N  㿘T  ? T ?*    N N@@2   @ * @2T * @@ 2N T  T ٓ*`@ xz&& & & &  @ ?4 $@"R`"`"  `"` "@@"@ 㿘 @k`㿘T` $c* x>`` T` "@  2` T`&"@< ?!(, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘 B#S#*  2 * J@ 2"* !t"!t"` " !|"!|"`"`#A`"!|!B# T $ T t $ t! @$! 4"$ 4" $" @@Œ `@ !@  @ 㿘B#!Ԓ`"!Ԑ!@c@ )㿘#Bc @  $c%" \0@u㿐 @%`h*  k  * 1B#B#   "?@oޒ ?  㿘. B#@. % ""b @%" \""  2% ""h%" \`.@." 㿘% \ @="@B  "  @   B  " " H2 @"   timed out waiting for input㿘Bc 2 B"c Ajb(  "#%"" @%" \"%""hB#      "  2@ 㿘  & 2L " @%"`X༐ )%"`Xඐ  " !%  ! >& & !% X߲$ X  !%vrc8 &  & 㿘%""%" \%""hB# $   "  " J @  㿘B#  `02` `@l  㿘 "%v3c8%c8&  !` & N@ A     "@& `2 A    $J#   ?π`&   &   & @( 㿘C!`     @    @    @  㿘 C!` @ 㿈 < ";     ap@_耢  ``&  &     $J#  @!"&  A&    & '''@0  setexecsig: unset signal %d(%s)㿘   ?ϐ BcXp   ?ϲ`` & `` `"  0   2     & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %Ttime %Tcan't open %s - %s%s㻘 ?* : `C!*`@ L  0 D d d   T <       < |    h   #C @` 2 C@ߔ   I#C @є` 2> C6( `C'8C@CH@  V CC X `CP @  C@h C@p   #C, `x@   ,  , CC@v V 2  C@l   C@d   #C @Y` 2C@P`C@J CC@?  `"'CC ؐ@5 `   ) |@*  2C`@```C`C@ !C%C#C    @ `@  `" R@   @ `a@     C@`C@ CJ(V `C!8C!@C0@ C@ǔH`CP@ C,`CX@ C!`ChCpCx @  C@   C@ `P @`@`@ 2@ @ = @   1`  ".@ i   K "!C$Y[ !C .@kn ! 6 @H! @ 2@  8< <<- << >> >| > <> <&>&%s 㿘 ` ```  "     @`0`>E"H*`@ `   t  E,@ E%HE!PEX @E`EhE p ExE@`2  C !E!C @㿘 `2    ^ $앒   @ 2   ^ $쉒 ?솒㿘 F 4N  ,   d p   |      N N`   " ` $ \[N $S (P K*` : N A ) $> (; (8  *` : N  )(& ) # "   " $ {N  vN  N  }N  ( | )N㿘'P'T'X@P h'P'T'X   B賖 @P`N`F"`% Nŀ :*                         t 0                 H                 Hl h*` : L  ^NXN`d 2 `2  `? -, B*` : YL  8N81N! `;2(  ;C#  >`  8?  $N .?   NN N`H㿘  ^ pb4 4V  @S$ܬ$  2 $   $ ?pC$ @9$@` 2 $@  2 $   $ ?p'$ @$@` 2 $@ " @b$ $  $ $㿘@  "o@ GJ  (  P P      0 L X XJ J JJߐ J J`2ֆ0цϐ J?@  2JĆ㿘  & ?o % , o&$@$`$` $`  " $` "$` , ,,&㿘 7  " p  " o   o  " o   o " @  ϒ ̒oג㿘   "o̒oɒ  㿘@㿘 @;/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘!C#  @c?$#!% $"H"В @  .$"@g  H b` @А   @ː    Hc01 @ٔ C  "c.@g  Hc(!C#  .@g{  HגcP@#?$#C#$ncȀ@ 㿘!C# @?$# 㿘!$# 0n`nU#  2$$`I!8#` $`` $`$`$$`(` 6 `2 $#`$`,"`㿘$#`,"`T? @``@!"?@А`@ @Ő ?@i ?<@n$#nǒ` ' ' ' ' ' ' 'x 'h '` 'X 'P '@ '0 '( '  'TMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘 !%c8 I"  + I" ,a " " , ,%s: subscript out of range㿐&@@ 1L [-@T( &@!$# В #n-`#$M #(&J P$#n`bad substitution㿐$# 'L % h*`@ $  Jp!Xa$"a& $# & .  %`h*  "!L  *   % h*@ *`*: @  * `~*`@n 0x v"`@&J"Г*`@ +\ + + +L + + + + + + + + + + + + + + + + + + + + + + + + + + +|$"H&  C& ? =% X<& `9&  =ڲ&3& / =@N,# `  0`, "`  "@. &@  !&㿐'$ c % h*`@    a$"a&  ?& `& 2#,`  ` `,`` " @@&""& &  "@ &@ !&0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @ 2BV#"2 O@@K!K" !@  & `" ?.?@{ .@v2?`  #?.?@ ` .?@  .@ 0 0? -.0@@%s: bad number㿐@|?2K#Ёsetstr: %s=%s: assigning to self㿘"28  ? @ @0  @ L`  0 l=  ?&` & @@ђ @w   &  &P  !&@㿘"2&  """ $c`" ("  !&@㿘! @ R" "V?""  &@N  @ B#  L@ >`% h'[ - #2 + ? "' ' *     ?А  ?  ?ɠ?  6? @ ?L@ ɢ`2 &@㿐2 b  & ky &   "& "!&@\%0*s%.*s%*s%.*s%-*.*s㿐@D0@  "&  $#j`0@Z @2@ [!J  "8J" @ #@ @ @@ @%`h*  M M  #\ " B #,N@[!@ `  `N@  2`@@ N@N@ 0"`M  @ @"L@ /[UJ!@  D*`@ `*J 2J0@L@ [VJ!@  d*`@ `*J 2J㿘    @@  &@j & @ =,  $& @ j ENVSHELL%s: restricted%s: is read only㿘@5 " L [ =@@ @6 % h *  ޒ`@ &  L = $$#"@ϰ  $J#' I@w̒c M@wƒc M@wc hM#h6`ے `.@@@B$ M#$#i`@a _    @2 "2  "b ""        ?$"2 b"$  ?$@*b $ p$ p@2$ "  N`i   2 "" < 4& 5 b    `B  #ǐ㿘 " io @` `"&  ` i\ iY `2& `! @ a&!@ސ㿘 &%`h*    % h*` ` N ` N [@4 2J2% h(+%h J ` (2 `JJ [ J@ `[`]2J@2J@ 㿘Ȓ J`? 㿘 @  J@ J` =`? 㿈$#!h.`''!'$# NT E >  2:ʐ ,   3" ,@ ?"@ ,  "  =&3 $< $c, hE', '' ' "<,2T $< $c, h'', ''`'"@"@$ h㿘k !ג   㿘  " "0"0 >&@U  aܒ"  >@&?*  >&%c<!&8Ɛ ?`P!*`@ A A C B CH CX C Ch B B C B C$ B C B0!%$" 0' BL{"curԐ  6 0q!% %g֒c8$ L /c@d]  ^@ Y<  S%ӂc8%M"`  >&D7Ԑ I#X 9ɐ!B. /$# ,$#  >&@' >&# @UG $$a! &"%  & "@ 㿘 ?`7Q ,*`@ Dl D D D D D D D D D D D D D D D%%`""? 0P#Ҁ B "c1% %g8c8 & ˢ 0 0%" 㿘@ @`$@4$`      2       @` !fo` @^`@ >&`& `& `& & $&  J@`][["J "  㿘@h> [$#"@Ҡ㿘$`M#7A   . V  .  @(#)PD KSH v5.2.12 96/10/29 AAA  Q AA A QB㿘d$@ǐ@Ԑ !###%%%""``$" @``$" ` "@4b (@@2%@@   c "@b  !"4 "@x ?@* "  !?"4@@ !4` "`  . 4 /?㿘#"` R!ȓ*`@ I L Lx L M Q< Q< Q< K M N#" * # "b ^@{ "# ?#0& #@A#" #!"4`?"`"@@ #   ""  ?π "b?"b# "b b "b  !*@# "b@ 9!"4"  /" R!R! @  ߰?@ А #" p#@ !Q!"4" " @e##@ ʔ 0̐ Qc8  !"4  @ `@ܞ"4 "  * @  p#[!    *` * ?;" b "b  !M* ?π "b?"b# "b b "b  a*Jai Qc8 1#04[!    *` * ?" b !  ""b "@-b$" b "b  a*Ja: Qc8 #@o#"b "b  #""b "b  !*  %@ ""H  "#J"\ #@H#"""H a* #@\"\# "b" %""H`""H !@ @!b4 "@" "@ [#""@  #"2 %"""H!"4 "` "A""H  ![!N    ? 4N  !N[!@ ` " !?  "N   "?""H?  !#!@ b4 "@?" "=""H"H '"bH"bH !『 *$J#. !4 "   M*@ 4 "   -*@    !!4 "   ^*@ 4 "   @*@ "4 "  * !"4` "`@ ` k #" " #  ]#_ '#[ "" " @a "# ?  0KB H F @cT" """D#"@ -@ 8 "" "`#""X#"X#@ŒbT@ " #ۀ ?" @?" #J"T s c C# "X@  @)l@   ""@" 㿘#""%###!#? $"$b$# """"D"@"""<"D#@""@z Q8 ! Q8  Q8 .       Q8  㿘%" K%#" *!"4!"8` @"@ 0$bD ?"bD!"4"!"8 @! ?" "4  !"8  * "4  "bD ?"bD!"4`?"`` "` `` "@ @D"%!!"4 """D  @ @ݔ" "4` `" "` "`"-"1!"4  D@  "4    @ @" "4"@ " " ""D@" "D!"4 "@D" "D!"4" "<  """@ aU". @ X0 X X X X W W X X W W X X W X X X X X X X X X X W X X W w D" "b< #"b<"bD 2#""@"bD  a*bT# "bX#J"T s c C# "X?@O@ \ K !"4@  E $J#/ ! @ ’ ; !"4`?` @"1?bD"bD!"<*#" !!!"4  @ @" "4`  "` !4 "  * #"  D4`` "` D"  ^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘   @ Qc8 @" @ Qc8 @ !"4 @2!`2!"4" @ Qc8 2@#" 2@#!b8!!"4"@`@ b8"4` " `"#""X#"T@ @?* : `yeV"*`@ k k l l k l l \ l b l c l \ l l l l l l l l k l l l l l l l k l l l l l l l b l c l f l l l l l l l l l l l l l k l f \ ^D l ax a l l b l b l l l l f l ` l c ^| l fX l l e ^ l l k l l gx l ^ l ^ ^ l l a l b` b c l l f l `p l cH c l f< dL l e@ ^ l l l l j@ m #!D `, a%"͒N` ? #" @b  J  JN`@ ɰ?@  #"`""@"@  '%`u8 @`,@ #"` "@@`8,@ ,@ #""`"""`# "b##""b!"4` "#` "`# ""##""b @Y !"4`  Va@v !b4"`@K` #V!N@N`@2``c  Va@` !"4H Qc8 `@Q &L?N@ c(!N` w W"!!"4  J[a  !J    !"4 [!J   2!"4   !"4 N` %  N@ c@@ɒN@ y@!"4" N@ c### "b##""b!"4` #"` "`!#bL"L@ 2!!? bL!# "b##""b %"##LbL@p  ?   !"4` ?"` #?# ""##""b!"4`@` H#!!"4`@e` "4`@` "4` ?"` #"  # % @ "b"@#"@y? #""#?o"b# ""##""b#f""# ""##""b Va@l !b4"`#S""##b"@O #""#bD"b##b"@@"@ #""#b"5"b!"4 w# "b##""bN` !@ "#"4  `* # "b##""b# "b!"4 R# "b##""b!"4   @4" !"4  @ #!"4 6 !!#" !4  *@% @` "`4`˔  !% @##"b" ?"@!"4  V!V!`V !"4@ $ Ȱ !"4 # "b##""b!"4   @4" !!"4  @l "4  @ #!"4 # "b##""b&!!"4 @P"@"4 @j"@"4`"x"`!4!b8"4q"b8#" ##"@jb #""##"_"b##"@ ?" """HDN@"`D D  ?`?N@ N#`?#"b#@v\6 #E?@>@֐ 0?""#""#)""n? &5?c V [!*`: @  2` 2 J  7[a찆?2 * :     *`:  " J   *` *`: @  2` 2JJ  J  J  # L  [!J@  2  `  "  J 2J# "b##""b!"4`` "` * : [!  B!쀢`   J    ` B# @0 2 ?@)  ?  #!"4` ?"`# e"b!"4  @]#%!#[!# ##3U'V4  J a    $" J bD*  * Ka   4$" Kd*  +4` ?``"`@4##!!"4w *"4(" !"4@ #$J#/$J#0 "? @Ò#@I #"  !"4` @" 㿘 @?* : `t [ *`@ p r r r r r r r r r r r r r r r r r r r r r r r pP r r r q q r r r r r r o| r r r pH r r r r r r r r r r o| r r r r r r n r r o od r r r r r r r r r r r r r od r r p r r r r r r q r r r nt r r n od r p r r r pP r r r r r r r od r r p r r r r q!"4   ?@  !"4  ?@ڐ  !"4` ` ?@1  !"4` ` 6?@ !"4 &ڰ 0CN@"c#N`"bPC# C# f FC C# a4  N@ ,#`?"P @  2 0!"4  !"4    !"4` ` 6?!"4 `  4 0 !"4` ` ~?@ z !"4` ` p?@  l !"4 ?d!"4`[!` ?J  X  TJ !"4 4 2H?0F!"4 ` @!"4  6!!!"4 @gJ"4  "4!"4 % %! ` 4  4??,? @GJ`"`耤``4 0?㿘?%!#"!#"<bD @`? ? ?!"4` ?"`#"" 㿘#&@ ""L!"4 ""L@a  ["  { ( )?  { } ] ?  ?   㿘#!b4!#"@9 $b4 "bԠ"*㿘!"4"`$""` `#@&bԁ㿘 #%Zc8 Zc8$  $  @R  $  $ $㿘 `@\` ` & `& @&@㿘 !%[ #8[#8㿐!!" ""4"`"`!C"8" " "` " "`"#" ##!% u##"$b# " "B#?#$b""b"#"#""#"Ā`B#?@#'#B#$!#""#%Zc8$"Zc8$#"!#" @"` @"#B##b" ?"#""# *b# "b$""ԁ㿘`7!"4`@` 6/?!"4`@` 4"` !!"4` @` !!?"4@   @ @c" "4` @"` !!"4  @@W"4`@"` 㿘!"4 "!  @ @D"!"4&@ " " !4 &!4!4" ?  2?,?H 򀢠" ??!4 ]!4%h [!T`(%` `h 6.` ( "'` `H 2`(2``%hH 2`` 6 ` ( "H`H ` `쀢  ! J !4 !4 Q!4[%h??H? B`H  ? 4H 4 `( ?,* `( "# ?,  , `( 2 `%hH 2  ?,  ( "H  ?!4 T!4[%hK  6  J "   &J .!( "   6"? ( "?  6? H 2?  6 ?( "?!4 !4 7!4[a??0H  쀢 6  J@ H  쀢  ! J@ !4 ј?!4 1!b4[a*?  H  ??"`N ^    `  #"@e "? 0?א!!"4@Ґ$` "4 " !!"4@ "4" 㿘#"#"*`#@ @Ā qG qE @) ##""b# *b́㿘 #"""@ ##@6 bȐ$ #b* *  @{bȠ$$bȁ㿘!"4 @! "4  !!"4  @T "4 "4#"@6  㿘     !"4  /#-!$@⸕2`@ :` 4   @'4 $@$@#"2  : !)!!#"4  @$@"2  : "4!"4"㿘 `@g@ 㿘  !"4 #"Y!# #"4` Q!`2"4b"4  `  `,@ ⸀-` 2,@)"4$J#.   M,@ ⸀` -,@`  `⸀"4 `  2 ,@ ^,@ ⸀``@,@` "4  ⸀b⸀!"4 ##"#"6   ,@ b`  ,@#"#"%#L@N@@ @=pL@ $`` !"4    +!"4   <  >%#L̀@##"b  @o#b "b,#"@㿘!#"*# "@#oА @ #"`@-$"N@oŲ`"`@$"$#"""3#o b@&b##""@@`@ "!#N@o`"`@$"#""㿀  #D`  ! "` !"4$"$`c ! " "!$"!"4#\#`  sC!!@a?0H*?"4 "bD "`o"4 "`'B. @@#  㘒  ڀ "  "@ $#!"4`"`# ""##""b#""#""X 㿀  !D    "  @  $  ! #D` 2"! "`!S"4$"$` " `X$"`  !"4#\#`  r`@԰?0z:@@̰?ps?z 0i  .`sN @ @ @,`sA @ @bɒ "`@@0.`@@  @rD "``?!!"4 "b"4"`^ `?`D " @J? / B#K r# ""##""b#""#""X/ 㿀#\#`    r) or  @>?   $H.     M-㿘$J#.   cn="   n! ^ @n㿘%  #"# /b㿘@n  n㿘#""  % Tc8 @w 㿘@ɔicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom0@  ' / / c@5#ഒ  c@c @Y& "` d@`@+ @%.@'!&@9DD  d#-D7Dd@?? 3 *  X X <  $ |  @P[ & "`d `(@խ $$    @$ @   !d@K[  @՘ P $ Z#H@1L d@>Ā  @2` d`X@Հ @/ `/ `/ `/ "y$  @P ' Đ d`x@g  i$ f` "`c/@}  @K  d@Q`P @O 6Rd d`@F  H$   $ @ Ad  <$   8$   4$  @Oϔ % d`@"?#@#d d`@ $$  @ `d d`@ ($  @O / 2d d`@ !$  @O &Ȑ da(@@ dK"&*  @@ @!&  @R   ,  ,@>) &" @52 `  da@@Լ,`@@0` @@S /&" &  D d@ԤaX & "`D  @o'& d@|a  D @,`@@!f?c $! & "#< 8 !&f` "` Ȓ @  Ȑ , Ȑ *`"`& @W  & d@@a& @ & ?c @W^ &  & ?c @WR & (< 8 &f` "``$"`& $ $ & d@!a $#!& &   @W)  <* @*@@ $ ,`4`4`4`,` ,` $` $`&  < 8   d@a/Ȑ '/ɐ /&   @V ( 6fd@/"@o f &   @V  f d@b(f &   @VИ  f d@bHf &   @V    d@bh '& ?c@V̘ 6 d@{b@0& ?c@V  0 d@gb'& ?c@V   &!&'@ EDd" @J=  Dd"`@J5 k@Gc g@Cc h@?`?@?2?& 2&@[&  4`* @  d@a#%&&  @'' @2 *  *@  @ $    @V9 & ' @V5 . &d@.Ő"&@ & `&& &@@@ 㿘.@C  g@Вc& `D& &D   D !@ ؠ@"  D Ȑ k@c@I." 㿘!. @" $ ping: sendtoping: wrote %s %d chars, ret=%d 㿘-D -- 5 &`"`5 f!"5  , 4 'D@ത<#f`4 @ഐ  *@ * ,& ؀  @tI D  @5`& $ & ܢ 5 @z5 &  & @Uw & &h@. &h `@I#&   D`@S packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %x㿀  @s  -@& !'@h"@$F0&@ fa &` "`& ؀ "P / / / / / / / /"@'"@`''А"@@'*"@ *`" *  *  : D@ E:D  Ѐ4 DD`D: D  ؀4 D2`@D: D@r`: f`J :@` &`Đ "`&`?"` , 4 'D@Zത<#f`4 @Rഐ  *@  , & Z "  D`@T '@h"В@Hh"@H & ؀  #@`  #@P h"@G h@G#D   D Jh!D)h'h @ @ #@Gؒ  :!D ?$ X@Gǐ#PX@G @ `%` ڒ`& !  *  @@ @h#`@G@' )Z @ "h  " h< hh@G#x` @`` @* ` @@* ` @@* ` @@h@Gj#@r!h@Gc#}#H? "#H`%#H*@ @+ բ`` @` @a%#X% @%%c\@iy %& 2%h@G+# ?%@@"#X%#\@h@G#` @* ` @@* ` @@* ` @@h@G#@!h@F##H? "#H`%#H*@ @+} բ`@F##@F @L`& ZH? "H "H * @+\ Z@#H ` 3f` `: +ff:? :8 3f* 2 #--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %d.%03d/%d.%03d/%d.%03d ms 㿐Z#H?`"@&  " *@* Z@u#H k& `@FP`&k @FK`&k @FF`& Ā`k@F? & `& &k@F3 Z& "@ * *  @L* k@F# ZH? "H "H * @* & J& ؀ FD& Ĕ  :@}c` D А #@}Y  #@I  #@}I  #@9 D ؐ #@}7  #@'#\k!@Eƚ㿘 @֒ R & @u`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`m!P*`@ 8 H 0 @ l@DV (0 `]*`m!@  0 @ P x  l@D9 80l@D5 X0l@D1 x0l@D- 0 `l l@D# 0l@D!0l@D!0l@D!00l@D!@0l@D!X0|l@D !0xl@D!0tl@D!0pl@C!0ll@C" 0hl@C"@0dl"X_ l@C"0\  "l  " ll "ll@Cې" @Cא" l@CҐ"  @Cΐ" #@C  '@Ɛl.#(l@C#80Kl@C#Hl#h @C 0Bl@C#0>   "l ll@C#0@C#0#    2mm  P @C@ސ 0m@C x0m@C 0m@C 0m@C 0m@C} 0 m  m!@CsVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 , n@C@!@2`n!2`   @C6  8 ?n!2` @C-* n!  @C'  '@#!n@C! '@@C!А  !n @C!ؐ ZH? "H "H * @' %s (%s)㿐'&   @є '@%#!d@e4P1%'@ڐ%#!n @e'1%#TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘l `*`    *`  * n #Ѐ  o *`  *  @ @B patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ [oJ  D @ˈ J #\#`#d#h#l#p#t#x#|###o`@Ġ? #"?#" @6 @ .`@ ò`@. ( & o@B!  @ o#na@B`@&ao@B !0<2 2 ((  `f `?usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘Z#o@wcP@ 㿘@ Pgetcwd%s 㿘@x!p@ޔ ? P@K" @ @ 2p p@`(@A 0@J usage: pwd 㿘Z#p@vՒ`@= 㿘@Khaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc.shutdown/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): 㿘@x0  8J@ -"`       p@UVa( 5p  p"-@C0?N? 2G*  ì ô ü !     @@  @?  p@ܒa8`@ͺ p@a@,p@ @@ "p!Hp!( @ߔ "  p aPp app!@ @є " pa@p!pap@t,` @ @֒ ? p@~a@ #pa@C ??@? 2  p!paa@K @ @E ?@ ? . p@!# @ `@@ڐ  #.?@ ? `   0 p@ɑ.  @"@- @ ?pp"(!@? usage: %s [-dlnpq] 㿘 Z#qb@u[8@Ð 㿘@ dfiPRrW㿘@v  q@~cf"!,5qq#-f %f#f+f)f@?=? "6*  H ` P ` ` ` ` X ` ` ` ` ` ` ` ` ` ` ` ` ( ` 0 ` ` < ` ` ` ` ` ` ` ` P%4$<$a0$<$a0%a,Ʀ %!(@K"&*  @@@@ f@ f"a@@f@f@B!8%s: %s%sfts_read㿘f!<   f!0  f!@@   f!( 2`@ 2r @l !#f/r-f +.@א{. 4? >*  t 0 ʴ  $ @>!  @] "2 4a< "    @> @%8a<   @ < Đ@ٔ &   a< 2  4  @ <  4    f0 f0 @  @r  !,  @ @a   a< ` r @z %8  r@a%s: is a directory8`m 3f8!+f/.-r)f %<@i a( Ma< 7  !r@=  @;J%!8   a<f!4 a<r#@*9%!8  8 @  ", 8 @  f@e !, @@` "a<  "@%!8` ?c8`2 `@i= f`<   @i  ?#@ @`0   @ ?  ?c @Z<@ d `@s? |f  @ tf`r ?#@ @`0   @ ?  ?c @ P<@ d `@s Bf  @ۖ :f`8 ?#@ @g`0   @ ?  ?c @<@ d `@rː f@"  f "!8r @.remove %s? override %s%s%s/%s for %s? 㿀f!0  Z#t`@rƔ/Zf!@ "\ < ( T@@  "P @{K @ @ O q#t!#\Z#t`@rZ@a#Z"`? "`@T Z"""  ` Z5Z"`y ? & @T`& @` `y `Y "." and ".." may not be removed㿘 ; #f@R ? /2 *@@8J@@D /`J@ .2 J`  .2 J` 2    t@l" $a8   &  usage: rm [-dfiPRrW] file ... 㿘Z#t@r c@t 㿘@kroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘!ZZ#u@qҒ`H!Z#u@q͒`h#u@qɒ`@1 route: %s: %s 㿘. !Z#u@qa8 #ua@@q@;@Z#u@qaH@ nqdtv/dev/nullsocket㿘@sH /u /uu"X+h )h'g%h#h@}e?)? "*  ֤ ֬ ּ ִ%a4% $$$c ՐK"&* @@h"c@G!h$#h  u!@fՔ g  @H! g"c!h@#@ #g#܀ 6@uu!@ L@ ?`(Fu#*`@ h ظ h ظ h ظ ظ ظ ؤ ظ ظ ` ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ؘ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ ظ |h"#@m h"#@  @ 0 @L  @ must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done xh# . " vԐ g#@ i e`@J@ -`@ `?`&Zv"h*`@ T ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴  $ D 4 ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ D ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ ۴ d h ,"`dh ("`dh $"`dh  "`dh "`dh "`dh "`d#Zc!v!.@9 @p*v!@:Ԓ0J@ ' ''' ''  ܘ @ vQ @ܠ2vI! ܘ @ 6v<!ܦg#؀  v@:!@h d v@!h@:`P +g)vc؀ @ `,>h d`h `M 27@h# 22@ ,`$`g#ܒ@@@@h  c؀ @ ђ@` `L@D@@:Q! @:@:K!v@:H!@ c؁ fH  Q(H`D .f7 0*@` *@`*@? `` * *f!Hdefaultiso %s(%d) %s㿐Dc  "c#fc8@.!  fc8@B .c8@8e  f*#8  2 f8w" "*8 `* `* `* `* `* `* `y*?`jw#*`@ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (   '  w" h!4 ` @ϓ @A . f@Mڒc8 ",`!f'@!f"8@A "8$, @>"@@@2 f"8!w@[Δ1f 4f"8!w@[1f"8af %d: %s㿐 ?`m x!*`@ 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8  hw$"!4 !?  0  ??   2:@` 2``2 @`  2` '@!g 8@A=  8$, @"@$@&@ g 8!w@[J1g g 8!xh@[=1g 8㿐 `"Jx#*`@ P @ 0 ` p h l h p h t h x h |  h   h  @h  h`"`h!8 hh "h`h"`hh` 2"`@7$0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐y! 'h# (. " v @N gg#@ǒ ? y"'h%D /h `@J@ -h@ `? ,*  d 0 H   ( 0 < h p | \ 萐 $d $ $d $  $d *$ $d ,$  $d$㴐 % wdh" h"!8gcԐ "c`@ @@abh?2`@  ` ?2`@ ` ?2`@ `y ?2`@ `p ?2`@ ` @@Kf@?2`@ِ ` @@= h` V"`찆?2`@ɐ `@kK?@ F?!0  h@ @:!0  @0@6@ ?h y@@K^a  y!(ya0y@7H% %㴀 h 2%y@7 !`y@7 !%㴐 @ @? 4`g#Ԁ 2 h 쀢 2 ``h# "` !.'h%h$ N@ 3 2Nd 2NM 􀢠"N`  `"`@f ߲`N g.@z  h 0 y!y!y!@6M  y!@6` h d  h!'@ y@6!Ѐ  y@6!؀  " y 7 "y0 "y0 !!"@5Zy@6q" h0  0*  ?#( ?* ??* ??* ? ? ???"`h"`(*`J` ` H  *@Internal Error%s: bad value ph`d 2h "`dD "cha0"a0?`>{{"*`@ d p | h h  h h#h 8g#h g,{H"`D #,w@Jb 2h "*,  h> "!,: ` "`  1  d?`| p*`@ d d d d d d  d d d d d d H  d d d d 񐀦 #h` @* ,  ,`D##4 `4 ha0 "a0#@@k 44444 4  h  ߰  #h` @ ,  ,`D# #,  `,  `,  `, ha0 "a0#@@? ,,,,,, , , , , ,, &   @x@   2   ,@J@ ""@,@} @   @wsq ,,@hj "&@< /  @,@@'Q? ` @sٔ 2,@@'C? 2$h 쀢  $'@Ѐ  8 @ Ő? g#Ԁ @~   "  - @- '& ,@@)   Z#{bp@iӔ@; h0 0h h?(*(h ( *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7 7 7 7 7 77 7•D # 2D`21g1}=!p!8}ax@36!8D#@Ve  D}!#@V[  }!#\#`}@3a@}@3a1g/1g!8!2}@VJа!8*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx / / / / / / / / / / / /*   /////* /+D(`D 2D`21g1}N!p"j}c@@3+G"jD#’@U  D}'!#@Uה  }!#\#`!g#}@3cHL# 0 #g# :  K 0  @g#}@2ch1g*#1g"j!2}pg@Uc"jactual retrieval of interface tablex ' ''' ''  ܘ @( vҐ @7ܠ2vʐ! ܘ @ 6~!ܢ @ got message of size %d 㷘g "ch# 'g@Ð %~ܒ@S(@2@k܁uwriting to routing socketroute: read from routing socket: %s 㿘h!." ? @~"L a c  g   h `9  `9 *`9 *ha0 "a0ha<*`"` *`g ""`h!0"` h h h"`$"`("`, "`0"`4"`8"`<"`@ "`D$"`Hh "` @h!0 h ?`` h @"g#؀ ~@c(h!0 h ?`` h @g#؀ ~@qc(h!0 h ?`` h @g#؀ ~@Uc(h!0 h # ?`` h#@Δg#؀ ~@9c(h!0 h 8 ?`` h 8@g#؀ ~@c(h!0 g # ?`` g#@g#؀ ~@c(h!<$ 2!<g#؀  @Sh# 29 g#ha<@  ~@#0+?) %gh!<#g!hܒ@"L c @ #@܀` h.@0 Z#~@fcP !<@ h@ (J@@8h0Zh /(h"@(        \                 h, h4hh  h? *hh@ h? @ @ *@h  "(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘g#؀ B `@0 00: Dcȕ* ` @0{    2 p@0o Z#H E@  T @0c Z#H E@P @ 0   @0S Z#H E@ڔP@v route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘    hِ @/! Z#@e3`00#a@e*  "  @.Z#b0@e 0뀢 . L  & "  "      2  2 ?` @` ـ  ,  {@/"H !h!4 $!4o@/"`$!4     a@/q"x"" @/i@/f"Z#H E@P"@/[b $   L#@/R 4 $   L#@/I 8 $   L#@/@ < @!@# $ @  L@/3# D!@# $   L@/&# $   L#@/ , $   L#@/ ( 0 " $@#~  0"@& 0 $   L#@/ 0g#؀ " @&0?H@.# !Z#H E@|0#H? "#H $#H * @p  locks: inits: 㿘@.Ӑ##ZcH $!E@Z @.ʐ#cH @S  L@   sockaddrs: %s㿘`B@. !Z#HE@<0#H? "#H $#H * @0  #"@.`  ? @ ZH? "H "H * @  Z@}#H㿘`Y @>@ 6  , < ?`&  @  `&*@ @ !  ?`&  @  `&*@ @͒ 4  8  ?`&  @ > & >*@㿘E!h!h " @BG "    %s: link %s; %s: iso %s; %s: inet %s; %s: xns %s; %s: ipx %s; 㿀 ?`b*`#t@                      d@?"@x 9# '@1# 7 7 7 7 7 7@#( / / / / / / / / / / / /@m#8@-Z@|#H㿘@@    @ `!А *`: ? *`: ? *`: ?N 2    ,       (  *  ,`  * **".@$OpenBSD: show.c,v 1.4 1997/10/02 02:10:57 angelos Exp $UGHRD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x ' ''' ''  ܘ @՚ @א"@ @ܠ2@,"@  ܘ @ 6@"@ @,̐" @+ %-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐 (#\ 0#`    @, %-6.6s 㿘 MgcȀ L"c@  @W 2 @0+   $ @ʔ  @ @ ,@ @@  @  @F`ZH? "H "H * @ %-31s %-5s %-31s %-5s %-5s %-26s Source address/netmaskPortDestination address/netmaskProtoSA(Address/SPI/Proto)㿐"#\!a @,&bInternetXNSIPXISOX.25IPsec %s: Protocol Family %d: 㿘?`4"*`@ \    h                 t     "p" " """ `""@+link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s   Lx   "6 H F      2 `xc@+ Y `  ` @# `6Kx)'#@+@  ``;x@7 `1#W+'# z`@* @)'@`@*Ӓ @ @`@*˒@ xh @+90!4  @+00 (@+)p"rR"r Ж :*R@"` `*`R@ 􀢀 *@+ Ё/%-31s %-5u %-31s %-5u %-5u %s/%08x/%-lu pؐ@)  P'Ԥ@@3 @y'@3 ` x'@ߐ@3  "@* X@)t  T'@ϐ@2 @W@2 ` |'@@2 " Z@* \ d'@# h@* lxresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeadd㿘  @ה * .` *.@N p r h"  p p h r .`2 ` .` N p"N r"N hN ,2u  N T`` %`*`:  , . :2 B@)n6` .`?А 6:P ,  N N C ``* 6` `, @6` 6`N V` "6`N # V` ``   `, @N V`  `$6` J\2 Є(  *@  J  ЄЅ*(8  Є Ї**8Ѐ4*@ *@㿘@\$OpenBSD: compile.c,v 1.3 1997/04/28 20:23:19 millert Exp $㿘!m@"|""|@A @!mm"h*` @ * $"l!mm"p @ * $"unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 )[h#@=( ` @ +b00    !*`:     L  `*`  L #"h h@  &*  *@$ "P@0{L "`$ @  $@"L  2L!*`:   " L L  `*`L ,2<$ "  !*`:   "  L  `"*`@ j $@L `!L  "L L  `  $L 2  @ b` ,E"J"䀢  L@L  ` L@  L@ 2` bx@ rL`  bL@ i`` 0h#ȓ*`@ )@ ) ' ( ) $d , -8 , + - .ؠ "  !*`:   "  L  `*`2` `*` * $ "$  2$!*`:   " $ L  `*`$L h  `$ @ bȐ@" "L  2L!*`:   " L L  `*`L ;"l L h b@Lh "L  2L!*`:   " L L  `*`L \ c@L "L  2L!*`:   " L L  `*`L  c0@L@AZ$ "L  2L!*`:   " L L  `*`L  @nch@c$ m"d ?,$& @Q!?%$.@%  c@Rh "L  2L!*`:   " L L  `*`L  @.chh$c "L  2L!*`:   " L L  `*`L $ c@C$   !*`:     L  `"*`@$c$ @  @ݒc@h L  \ @Βc@ $@L`? @`?@@"L  2L!*`:   " L L  `*`L ;hh$  @"L  2L!*`:   " L L  `*`L ;2L O ?h @p`(9h\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D  j'D \   cDa D c@6DJ S, : J@ [DD@NDD @!c>DJ@ \2DJ` [&`DJ@ \2 DJ`2D`#'DJ@ \2 DJ` n D .@`D 'DJ@ \ DJ` \D`'D @.@`J".@D 'D .@`DJ@  [  *@`J^*@`J]*@` ; ]6*@J[%\J.:=\` *@`J]*@ "J!` ]*@ 2J 2Jn*@`J J]2 "` RE error: %s㷐, @q &@@$  &@@xԔ  m@?@ @\c@m@p @*"p123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   m ,@`$@@ e&`&`m"t&` @А  \, : @ <`\2&N #@,N "N,@`N`    @``&&` & \2,@ `" N 2 @ے`(,@` N $@$(j,@j#ɐ@͒( @ @`Xmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D &@&`&`?&`  #[D J `Da J@   D`'DJ` ` DJ g"  p 9 ; 1 s "|DqD"xDmD wDgD @UbX d&@ a&` @JbX DD@' U&@` 'DJ` `DaDJ@   `'DJ` `DDJ J@  `'D @*DJ@ * @b@&`m"d D& @NR!? &` .@"Q  c@ D b@JD Z'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ @a_2? 4ac?S  )b?  ?[!*`:    ? N `"*`?#@}x@@}u b0@p 0@%  +  (+?#@O   +J &@㷐 @ '[@P( 8@ O `& J  " J `  `\" *J  " J \2 *$(̐, @ȐƢ@Ғ unterminated regular expressionexpected context address㿐N 9 \ 06  $ /   j`2&@ @ޒa &@ &@ &@@aK &`@͒a@ whitespace after %s㿘L@  [!N     N  `. @b & @]@}undefined label '%s'㿘H#$!m# ?* :  :*  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?"h $"h & @N &  b@Z @x  2 duplicate label '%s'㿘    `,` `*`l#@ @' 2  @5` 2 @$  2 @֐ $$ $ $ $㿘 ` ,`  `,` `l#̓*`@ "   2  @5` 2$   2  unused label '%s'㿘 l#',` "`   @ @xc2 ``,`$OpenBSD: main.c,v 1.4 1997/01/15 23:43:12 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@X /#H+m )m%.'m@b*p?M? /8DZ*  D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D< D D< D< D< D D D< D< D< D< D< D< D< D4%bd%"   @$Z#@Ubx@{f K"* @m"  ` @`@ `I@  @@`@ 0@ @Xm"|@ Z@8#H  .@_  @b@{/ r%s: %s"%s" ..."㿘F `m  m0#!m! m ""tm!   !mFm!m! @ Oa@m  "a!.@  aH@ mm! "b`F "`!m!ؒ P@Bx m!X !X* `* `* `* `* `*mm!"b`mm! "aF "`@ ;аmbt _"btL@ #[L` nWmU""ma"am@8!F" .mbt "btD"t m!J@ # mJ` nFm "bmFmm  J  ". !@W!#!.bt #bt. Ԑ "bt #bt " .װ stdin㿐m! Am'm%mZ")m  =m $%"`%"`@a@  $!"`.@V  !H@`? "`@6ސ ?" ?m@7 $@mam"x  !m& i  "bxe m `"bx!@e! @m"`. " @ aH@@{mbt "bt%m'mZ")m `? "`@6 ?" ?%m@7/  $ $%"`%"`@a@ $!"`.@  !H@y@a 㿘@' " " "F"@"㿘@ " F"@" "$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%s㿘@u .@  @=`㿘  @u .@  @'`㿘m" "@u@p| #m$b@psbsed: %lu: %s: 㿘'L'P'T'XL!Z#@Sa 4 !Z  mm#a(t@S`!Z#@T#@Sa8 @y $OpenBSD: process.c,v 1.3 1997/09/11 11:21:07 deraadt Exp $%s%s: %s %lu 㿀m""t)mm"$1m9m5m-mm",  m$"|`m+m"3Z7m@ "@ `?Ƒ* : `C"*`@ U U U U U U U U U U P U U P Q U U U U U Q U R8 U U U U U U U U U U U U U U U U P S PL P U U P Q Q< U U QL U Q\ U R R R SX Sp U U S T4 T U S U U "L"h  *`l'"h*`@  *`&l"Ll*` * $ $$` m"P "-@" &`  )$, % @_r/"$?$ " $@y  lm"$b "$b b"$@ϖ @b"$@Ȗ @" ` @)"$@m"  ,  @#cH@"$Ē  2$@x @"$ 2@m"  , "$ @cH@w , 2@ @cH@, 2@ @_"$?$%"$ @cH 2$@m"  ,  @іcH@\@wÐ "L"h  *`'"h*`@lT*`&l"Ll*` *  $` $ @w~` $ "L t&"L@)T n&TT "k@&T`, 2d@`?"$` & @G!? $`.@  b(V` `"$@u G.@  b(F` >@b  "$bb0 @ "$''' ''b%"$$$ $ $%b$$$ $, 2@L` @,  @m"8bt@x@`am"  ,  Z@-H@B %,㿘m""P  2   2  b @"+  2 mb$b$  @  2 h   mm"t@"  \ "x X  *@$ m "bP 2 mb$b$  @  2 ?   mm"t@"  3 "x /  2  m"t@ m""P  $   2  mb$b$  @n @  mm"t` `?"x  @`?\%d not defined in the RE㿀m  "$m"X m @ m"bt  c9m  @/"( m ""<m"(    k#mW?!m-mm"8` "@ @"@Ζ  @A"@" @" $ "@  "` "8 8  @ "  $    @Ҙ `.m"8(#mb $  @ ?b#mb m"$$ !m"8 @s  "8@b "8 $ @g m"$"$''' ''m88""$`"`"` " `""8"`"`"` "`"8    Z@H `0m", 2- ` ?2  & @E! ? "`  .@  b(\  mb$ b$@s    . @  b(H  rstdout: %s?c m"L@@Z'm)Z? l,`* @  l)`l,`*  @Q#H`,`@*`  @`0"` @O @9#H@2`m"L@lZ#T @ . " @C `8mm""T"bLCOLUMNS\ \ \abfnrtv%03o㿐!F Ā?2N@q! " @$ `h@s  F`F" F <"`N m %Z \!F Ā@!  2$* : [!@J  `\ H?`"@  `"*@ @ 7 !ȔH?`"@ \`"*@@l @!N "JH?`"@  `"*@ @Q  !@  N FZ#H?`"@ $ " $*@2 ZH? "H "H * @" Z#T @ . " @l `8first RE may not be emptyRE error: %s㿘  m"X   a ""X J? "?m"  : :m"Xm"p  m@@jO    m  bX Ȓa 㿘  , q'm:` & \  ?N[!@  ?`℀ \2  N \ &2    & Y & &  , 7 ,` ? ℐ  ?"/ℓ,` `?2` ?"$ℑ,`@` `$ "? @ @& * & &  ℓ,`  @ @tH & , `   &   & &  ,㿘 ` @d&  & &"&  @@t & *@%s: %s㿘?'%.?N  w"!  { s" /"* + ?" @q    @R  " ?"& @q "&  @? & 2N 㿘@  gh g`  gX gP gH g@ g8 g0 g( g  g  g g  g f  f  f fwerasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard g g grprntflushbrk㿘@,@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %s㿀'a  %@Y2cp  @Yw2] `&` 2 N#@@ N u2 N@+c "  N <2  @+`  @4 ? @, `  @@ J  0@@  @* (N ^ @N  ? - `  *(@* ( &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 @Ab@@>b`gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘"  @ !! #  b@   2 @S@S"@ޒ:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@ے : 'H H  'H%H@)cL @Ò =2,@,@`c@OL c i@*Ғc 2Ls&  i2 L@*Œc 2Lf& i2L@*c 2 L@&U& $ l2 L@*c 2LH& o2 L@*cȀ 2L;&  o@*cЀ  @*& (!! " @@LJ@2` @*u 2` `? @ߔ`* @ 2@@ HH gttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@*$@illegal option -- -%soption requires an argument -- %s㿈L@ -2&` &``'Fa  @W#D2 # 2  ` #`@K@   "  &  &`#x@:@  @ 㿘  D @ז 㿘  " @0"@&   &  $$ >& $ & 㿘@ 6 F &  * + * - * 0 $߄C" $ "  " 㿘  D @ 㿐   '`` '``@n & 㿘 @ @RE &    ("  "  $@ ( "   "  $@" $ "   "  "  "  " 㿘 @ @R  & 㿘  @0 @R  ?` #&  & 㿘@n 6 D &  `"  ""  $ g" $ "  " %d %d 㿘# D@ F%d 㿘@Qސ @Đ#ЁTIOCSETD㿐' `@n"  @’cTIOCSTART㿘@n`n  @Ȳ`@TIOCSTOP㿘@n`o  @Ȣ` w( w  w w w w v v v v v v v# v3 v# v3 v2 v3 v3 v# v@ v@ vx@ vp@ vh v` vX vH v@ v8-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5 y y y y y y y y y y y y y@ y@ yx yp yh y` yX yP yH y@ y8 y0 y( y  y y y y x x x x -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk ~P ~H ~@ ~8 ~( ~ ~ ~ ~ } } } } } } } } } } } }@ }x@ }p@ }`@ }X }H }8 }( } } } } } | |@ |@ | | | | |C$ |C |C$ |C | | |x |h |` |X-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho           x p h@ `@ X P H @-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘   @% 2   ` *@&`   L&`  #,#,  @% 2   `*@&`  3&` !!  @% 2   `$*@&`$  &`$ "X"X "  @% 2   `*@&`  &`&`    tablet disc; slip disc; ppp disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ ```"" @! @! @!@!@M@M !@!@!@@`" @" @T"! 4  `"@]@  4  `" @R@$ 4 `"(@G@  4  `"0@<@  4  `"8@1@  4  `"@@&@  "H@@  4  `"P@@ @ 4  `"X@@  4  `"h@@" 4 `"x@@ 4 "@@4  `"@ڐ@4   `"@ΐ@4  `"@@4  `"@@(" 4 `"@@@"Ȁ  4  `"@@! 4  `"@@ @ 4  `"@@  4  `"@{@" 4 `"@p@$ 4 `"@e@( 4 `#@Z@4  4 `#@M@  #@C@  4  `# @8@  4  `#(@-@  4  `#0@"@ "  4  `#8@@ @#@  #H@ @  4  `#P@@ 2  4  `#X@@ @ې#`(2 #4 `#h@@ #!"" " 4  #"  4 #p#x##@4 `#@Ð@4  `#@@4  4  `#@@4   `#@@$ 4 `#@@4 @ `#@@4  `#@{@! @a#!! %@`@  d@0Ζ@a` @ 2@@F 0B@C !! 2  d#(#,``@"` %@0@`@a @0 2 `  @>@;` @ ڀ!#@0#@-(㿘!m" @#"$"m""%s: %s %s %s㿘!m"  m"b@ $"@h" H @""@   !m"@ " $"%d㿘 ?  1m" @06@&"m1 #H  M*` -*@`  ^*@` ? *@4*@ ^*@`@*@`*@1m"-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@D'H'K"" K": #K%.b* H@K` b* H@h @(H@N(?! e"  f a" K g" K@8A  ' `0@iK"bK"*`H 'H@_#  @j`8`@f  @I`H`h@f쀢 `@ϐ X`` `8'H 2'['''H IH 1 8H[ 2H2 ,HJ[!@ `  H@ l @I@I'`h@gG   HH`' p@f@@3H 'H     @  @˒`   `g@f쀢 @N @gh usage: stty [-a|-e|-g] [-f file] [options] 㿘Z#@A`X@gS 㿘@㿘@C@@gA 㿘@   x p h ` X P H @ 8 0 (               !    x" p# h$ `% X&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@B@@ c 2??. @@c .  @ߒc&@?`V*` D@ X ` t _ `JZ`?`J@ !A!mJ` >``JL@ `J@ !J` /!m@4`m" (!mR  %`m@"b2`?`J@ !!mJ` `@` m" !mR   `m`@"b@ !m`$"@`@(`?"@  `$"` @c%s: %s%s㿘 J  @`a a@[ 㿘@"!m"`$"@` $m "`$"@` 2  ` b?"b㿘@!m"`$"@` #m "`$"@` @ b?"b㿘 ""m@ """@`?argument expectedclosing paren expected㿘  % c %2m!m"`$"@i`"`$"@a` &P nc0K"3mR /mmb"b  Yc   m" 'm"m"@e#`?"@T@Z@"@" m" " mR  m@ "@d@ 㿘!m" $"@ m""`$"``2 c?* : `y!*`@ 8 P h | 4 \@h]`?@bW@ @\R2 @W 4L  0I@@A`?@ސ@ې8@ @Ր@Ґ60  0-@ː@Ȑ4&  0#@@$  0@@&  0@ݒ @@8`  @4 2n a(@4 e `U ,*`@ d  d d d d 8 H     @ 8`?+ )'%#!0&($$""Ȁ  ̀  @@`?  < `? @ 㿘 !m"" ""T @ m  m"" '%s: out of range%s: bad number㿐!.$ @    b@GJ[!@ `  `'J`   J  b(@) ؠ @3Ԓ  @3ϒ8 X@4  ؠ @3  @38 X@&  ؠ @3 @38  8@< `?㿘@malloc><@=!:illegal -m option format: %s㿘@@_  2$ @`mc 2oo"c" ` ""` $ $ @˒`  $ i$ @$  !,@?ߑ* :  9*    ; $  5 $     $ IJ`N@ : $  `@J : .@`@m$ N@ $ , 8 $    "$  `(@9㿘m#`I#%-` "` @< 2;@` 2*  8 x @ X & T` `?T`6   T`4   T`$   T`&  "@``2`㿘N B" @9write to stderr㻘 @2  @%@`$  @`ْ? @  @@a㿘Z#?` "@ . :  `"*@@  㿘 !n@YI##  " , n# `" * n# `" * n# `" * n# `" * n# `" * n# `" * n# `" * n# `" * n# `" * n# `" * n# `" * n?# @#@" ? "? @k" # @a"  @- kbbcbsos㻐'#@=J` #@=`J`  @@=#` m# m@=|# mn #  @=r# m c?"cmc  c, :  " "c"n # nm#  n#m##   `*o  nm#  n#m##   `*o  nm#  n#m##   `*UCLCEPOPNLHDpt㿘@=!0 n "  " @=!8  ncc*"c ?"ncc ?"c !& @<!@   * & @<ߐ!H  n  "!n# `& #!$#  & `& @<Ő!P "   ?& # >$#@<!X nc` ?"` @<!` nc` ?"`nc`  "` pcrsisrfif㻐'#0@< -*a@\o  ,`'#8@<  #@@<  @:8 '#H@! J@ ^  J`  ?  ` J%  J@ ^  J`  ?  ` J% J@ ^  J`  ?  ` Jm$@ "f fc a _ ] @kZK"&*  @@`@쀤=@9"1o & @9"!n#$# `h@\M  #耢       77 `g@\8e!n#mc@% ,   @#쀤 L :@b  ,@ސ2, @b("0@`Z#b8@7"P @R "X @M "` @H  "p@w@쀦 @Z "x"@\?@b 2""""@X@@T@] %s %s isset tokbbackspace. delete. control-%c (^%c). %c. 㻐n#@m#@:!Ȗ!1Z#@7ra'!@8ђ O O  #@7^a0  Z#@7Ua0 Z @#b@7K0#b@7E-e^H-i^C-k^U6@HPH-2(  "H-2  Heik2 H2 Hi" "ke"" ""  2Husage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘Z#@6`@@\Q termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@  : '@u * '  '%D@ʒZN D@ D@F#H?`"@ : " :*@’ %["!Z@aN   N "N倢 E*   0 D  l l X@Ð!@!HN@!CN@! >N@!(9N@!04N@!8/N#H?`"@  `"*@ @! N #H?`"@  `"*@ @  Nd #H?`"@ : " :9*@ 6㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@7G @5"L-o +o)o#.'o@Ah?V? 0O*   t t t t t t t t t t t t t t t t t t t t t t t t t t  t t t t t , t t t t t t t t t t t < t l  %0%`< `% 8G#  @a@`$4@yK"*` @   o@go 8  G#  @!   @ @\@ 2 `@ @Zk/㿐@5 2 @  %,` LP@Y Z "@f < " @, L 2 ,`%s%s: not currently mounted%s: not a directory or special device%s: unmount from %s Cannot MNT PRCBad MNT RPCx@> x!@*& h @Ք0 @Δ)"!<    @h!<    @h !!(@ګ @h ha@Ys   o@ @ ,@ @,@ :  ,@ :,@% o 4 !P@o 0 2h o@R`< h!@r 0Za@Y4  2T "Q o <@2K , @Y`  /7 @@Z5  ''?'d'X'\ab X@Id@!h( @A$ 'x'|'X'\ X#\@ Ȗ H @ߒax   `@   @getmntinfo㿐@}  @!(: 67 ``.  @ ` `<@W .  L2 .  L@{ 2  `<@Wה .  π` 㿘G#  G o (`?# @X    o (@ empty type list㿘  N  n @"b oN  oo o "`(" (  @ ,``!G`@Tޑ* $# 2$ @   @ ,,`*@`$`$㿘 o 8 o 8@ "/ @В . "  *o 8@ 2   " !o 8@ " @ . "  * 8@    8 㿘'HH@$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘Z#`@20@X 㿘@Ĕ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘}Z#a<@1! file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘!H! }Z#a<@0!!  %Z!@`@0!@ 2@㿘!G#}Z#a<@0s!#  %Z!@`@0i!@ 2@Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC 㿘}!Z#a<@0=!#b@05#@01b#@0-c#@0)c#@0%c .exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory㿘'D@1'HH@!a#}@U$`<  `<?@c D`<*?DH@!o~ "`GH"c!~ @S  @ $ P @Sxb @Su   @Sob @Sl   @Sfb!} <c@T    <c@T  !}G "cT < @pc  <@jc耢 #~GG "cP"T#~`c@T !~@T`$ " )J'G%G5G1G-G+G3G/GGDH@+@ π E*  < < < < < < < < < L L L L L X L L L L L L L L X L L L p L L L L L L  L L L  L L L L L L  4 < L D L X L L L ` x L L L L G"#L@4!`G"c|$P$TGcX "cX[$P$T&hu&#`&#`&#`%\&#`%\%cp&clG"#d!~@T!`$ ~ @!`x$P$Ts%xcl &cln%cp@  i}Z#` @.<0G\"c@  WGc` 6GG#T"c`Gc\ JG#T"c\JD!d"@G#L  G#p  ~}Z#`H@.<~ ~G#T "}~  }JZ#`x<@.~`@ Ɛ G#t  !}G#T 2 Hِ#"a!} @P @ $ L@ x !{@P  $#@ o !}@P@ $ (@ f !|@O@ $ $@ ] !}@O $ @@ T `J!dD@6G!J!d`$!dH*`@b !dD@`G@AG#h  G#p !G`?@?!G@ `##%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘G#X 5}G#h 1PZ"G#T "`X@HR` #} <G#T  H XG#T " h#!Z#`@-}#`p@-<@  }P *P `* `* `* `* `*|(!` !`*( `* `* `* `* `* `*|" G#h ZG#` 2|ZR"~@I`h @ |~`" |?@`"` G "cP~" `G#T  {@#G "cG@ #G#h {G#@@c0C+HZ")G'|%~#}aT €T f 6#T  T`D@ {@Y#G &"c}" ,G#l G#x Z#`G#T ~}~ ,`" X"@!Z@##c @--%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8@ ` !G#P$#P!~@} h ~ p<  0~G#d   h h???? ?(?0?8?@?H?P?X?@ @0G#p 2AG}Z#` p<  G#p 0G}Z#`@<}@,tP%G~ r`&G#P 2#|G#X 2|G#p 2G} <`  sZ#`x}@,PPGc B @"c|~ "` | G#` ~G#h ~  "@G#P G#h G#x |(!` !`*( `* `* `* `* `* `*@5 !} P @!!{?"c}Z#`@,<@ۚ PG "c@~" `G#T  G!{@#G  "cG#h  !{G#@c@P#0G#P ~ZRcV$" @ G#T ||  G#l `G#p `}Z#`<}P|@+ (|` GG#\`?"`G#l !}@P P  @Pې P   #Z#`}@+P-H!{+~)G'|%~1}#G#€` 2G#T { T D@ {@#耢 $c}" ,?"c{@O#G#P 2 G~@O G@G#? GG#P F|@ (0B#l 8G#x Z#@+@`GG#T  ~}~ X`"  ,~}~ ,`" X"@Z@G#x ZG#P  Z#`|@+(Z#@+c G#P ~@ h%s: %s: warning, name truncated 8*'{ 1|| (!~%G)Z+}@ G@O%I "#@ t!?$ @|@O$ @GX #`@*`<@l@O@O @$&  (@ G #T G#p  #`(`<@* (     $@N @y (@ (0㿘." G#P  G#X @ 10@ _z-z-gz.tgz.taz.zzpH!h~ @ `b@ "`@O %&В@z@ϐ@OШ@O@ $@J?׀ /%@ 8@ "`@  .Z㿘H!!} P@Q P ?G#T }. }  P!} P  } P@ٿ G ("c@O[ P~ @c "`} P%~)G @<@j `.@ @/@ٙ%#  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘!| (}@`PZ (G#T L .G#d  GG#h k G#x fG#l  GG#d 2] G#p 2X G#p DG}Z#`h<}@)P9G@@b( @b0 28, , `,  `,  `,  `+, "G#l  }G#d GG#p c}Z#`<}P@)oGc     "c|" | (~@`а %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐G#X G#P ~}T D@`"T} L @Ɛ /~}T D@ ` ~}T D@`"T} L @ /~}T D@`"T} L  @/G?"c~`` "``~" |" b@   b@{  G#~}T D@`"T} L @r $G#  }Z#b<}@(iP!GHѐ "a~}`T D "`T} L @P  }Z#c <}@(IPG "c?Z#cX<}@(:PG "cG#X ?}Z#c<}P@(& G "cG#X Ѱ?~}T D@`"T} L @  ~}T D@`"T} L @ * ~}T D@`"T} L @ * ~}T D@`"T} L @ܐ *  G#` ~|" ~}T D@`"T@Ɛ ~}T D@`"T@ .~}`T D "`T} L @ ~}T D@`"T} L @ * G#l  }Z#c<}P@'A~}`T D "`T} L @| ~}T D@`"T} L @m * G#l  }Z#c<}P@'b??!~#} T`D@`$ T@N ?? TQG#\ 2!~G#P G#h "!~~ ` !~1}#} T D@`$ T`L @( *   T1|@ (!~-}+}} (' TD@`$ T`L @  .*      T@  TGch  `2"ch@ ~~}T D@`"T} L }~ ` nG~~ T g"`#`H@ʔ  !~ T } L`H@  2$ THѐ "a@ r?E|`P@   Hߐ!H"aG 8"c`X@   Hڐ "aG "#|'" ``@   GHސ "aG "c#X G#P G#h  G"#Hא""a~" T| "`G# &~ ` G}Z#`h<}@&fPG"##p  G}Z#`<}@&VPGc ? "cdeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐Ha `G"a#l @#@G#p 3?@#`.?,?G#`G#G#l  #G#p  GG#c@GG~#`" "@Z@NH@#0}" ,#~| `1$`X|  -|??@Jy  ?#$`X $`X@I  @* * @*` }* * @*` ",|@빐  * G#l  Ha.`# @7!~#}# X@0`, X GG"#~" $`, $ X`~ X@"},2 GG"#~~" ", "`X`} ,@"}~~ X`" ,"@Z@ʔH#|@`(` @`?8@Jv @?`?`?`?` ?`(?`0?`8?`@?`H?`P?`X?* @ ʒ@ *?name too shortcan't recover suffix .internal error in shorten_name㿘  @J0G#T  @ ]*?d2,@ (,| "`?@` '"( "(,? `,? `,? `,? `;,'@ /  @-@?L 2 L 2``  `,@ `@ .2L`@ HL` ~@흒`Ё%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten ." 1|!. (@ے   ?2 W ( (G#T ~1| (  ~F ( (@  ~ h )} P|@`( }} <G#T  h#Z#’b(} PZ#’bP<}P| (@$ TGG#X >|"x7H}!Z#’b<|@#(~ P Z"@>V   #@#b@=#H O@͔OH[!@  `Y Z|OH y|Z#@#ΒbGc   @ ( } Z#`@#<|@R (G "c 㿐`'` '@`w !<`  G#p  G}Z#`@#<Gc G "cG#p |@" (%s: time stamp restored 㿘G#T | `!| G& #l  Z#Òb8|@#d(!| (  (@{ʒ o |G#p  G}Z#`@#M<Gc G "cG#p |@ڐ (| ( @{ G"#}@ P G#p  G}Z#`@#'<Gc G "cG#p }@Ҵ P%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@Ő}Z#Òc<@"G <"c+G@4@ђ`@ Đ@˒` @H@H #Z@  /*< @ݒ0}#`<@" %c@z㿘H!̀ H@H "a!~ Ȁ "!G@Dz$ !G# "!}@Dr$#!} L "!{@Dj$ L!{# "!}@Db$#!} ( "!|@DZ$ (!| $ "!}@DR$ $!} @ @DJ$ @@Gސ㿘G# ~@F |@9 ( 㿐77{"#~" {"G "c "{# *@@ @v{c"c{#?* c@{@g{c"c{# * c@|@X|  2 {c"c{#* c@{@E{c##c{#|` `* c#c#`2 #* {c"c{#| * c@{@{c"c{#| 2 * c@{@{c##c{#|*@ c#c#2 #*@ {c"c{#| * c@{@{c"c{#| 2 * c@2 @ @ o"`@@ G@<cG#@<{c"c{#* c@{@{c"c{# * c@|@|  }@ P3{#{!c&cc*@ c2N@N  ~1{#@"`##&#{#o`@ `* #&##`2 #* {c"c{#o C* c@{@f{c"c{#o B2 * c@{@U{c##c{#o@*@ c#c#@2 #*@ {c"c{#o @* c@{@0{c"c{#o @2 * c@{@{c##c{#~`X `* c#c#`2 #* {c"c{#~ [* c@{@{c"c{#~ Z2 * c@{@{c##c{#~X*@ c#c#X2 #*@ {c"c{#~ X* c@{@{c"c{#~ X2 * c@~@~` @"` 㿘{#@Dw?  @Go"`@~`X"`Xbad pack level㿘? @o"o" X} @@ @E o. HaԖ "T| "}"`H} "`0@  |@ 6@|" }" 4!o~| \`$€@ $ P?oo " Lo$" P" Lo P!o1o!o@ P! L o" H o| $#H*   "H㿘}0||${ ||$!{| @7`|$}H}@] X @S  `M ` ` @6'` @/'` @('` @!'` @'` @'` @ '` @@*ɲ`'!  >{  @ (@2㿘Ho!`P"| $@%|C??"@=| $!  @@C{c""c"$}`4""`4 } @@# * @ @2 2  * } @# *@ @3 3  * @o L ~|| $` o`P\ €oo "`L`P"`P㿘{ "co P  )o%|| /|#7}-@'o3} H*`$ @ @% H @* *`@ @22@# "@ Ӑ P8 6{#"@@?P"$Po T$?@$ H*  ` % H **  3 ?2 $ $ % H* @ ` % H$ @R P?$P $`4`$  `4" @Ȕ &`4P! o L P#o!o`P! L P w H} 4`| $  |} `4 " @ 㿘 o X  Fdo P |7o%| 5|#;}/@){'o-}H*`$ @ @&H `@* *`@ @2 2@%#{# o# T@# "@# P@8` #{#"@@8 #?@ = " @P #" $P%#$`@$H*  ` &H **  3  2#? %#   1$4`$  4" @ "%4`$@ @y  4`$  4" @ %4  $P?$PP! o L P!o1o& P! L P UH` | | $@ @? } 4`| $  |} `4 " @ 㿘|" }" 8zz"#@"c<r"ʀ Ė  v"8H"( u#5*" (6 H"( *@*   *u#4*  v"H" v 5*" (6 H" *@*   *":v"H" v!5**"@ @?(  H" * @ ?*@* r#ܑ*```2  q"H r#ܑ.  2  `  2` !q"H r#ܑ.  2  `  2`!!q"H r#ܑ.  2  ` !2`!q"H r#ܑ.  2  ` !2`q"H@#! r"Ȣ . 2 @   4@ o`(0 qT(0 r@(0o` 0zz 8 4zzz , ("#$z(0z (1㿘r.`.`u9rusru) . ./ *  ....*r.`  .`. .`uրr.` 㿐 '      r#ܑ.   2 u r#*@* <;2 r#7z5z,rc ,  *   , `2 . @ 2@ $* @, @6N4  &4 @6D@8 &8<Α,`Cr#r#ޗ-.   . r#ܰ?.  "?. @ ?2@ @  2@  ?`2 !r#r#%z.  "?, *  `&@6 4 $44`?. x  r#ڑ*  * 2 ,  "  *@ 2@ 6 , 㿘@``? u" u"= "`ur#u , @  ` "`* " , , @2   , u 4)&`ur# u zz` #`* "@ "  " * 4@ *#4?##4  8" "8u `&`u 2  :   1s? 1sr#/u-uu  %*`@&   %* "%*`"@,, *@@  4@  @  ,, @ *@2 2%`_  4 u " r#*` "@0㿘?       +? <0r@.  "- .0 .0`@ 0`@ 4`H`D0`D0`H         ˴㿘?        @Or#@-`   "A`  ,@@@1?2@&  ,@$`?r##@`?   rr##@`? ##@ `? @        `@㿘Ho `PcxHq!TKcH# H#r#@ *    z? 4 z4` * @"4㿘>@ɒ @ƒ @Ò  oH#r#@ *  @  & o `]?q!TYblock vanished㿘z#,v#$z c0*| ?#@2H@YHA#`H>#|z#4 2z#8 2zc@@ "c@ `  @p z<` ,  "<@ 0( @^ q"Hr@Ēbz< zc8@Q H#xHc `~`o `q@aTz< zc4 "< z@zc< "c<z#<6 㿘zc$"c$} L  * o `.``92?u#5@ao`*`@  2@ q !Tv 5> v!5 @*  v 5> v!5 @*`q!T@ 2z(`"(} (*`2 zz 0 c1 *0z #1* +#1z#$ Gzc,"c,v#$z 0**0 +#1G# &z#$/2#z* |} `4" q!TH". @@@39`  @zz#$2 c(@6`4@* z#$#@ z#( @ 㿘   z#$ J v#$u#5H"(v"8v 5v!5}   L ,`(` @*`d@md`"}@f$@} (-`@`` @4` *`@@@V`H"`v"$@@Kz#$ Ƨ4$@C$-l used on binary file   o`(  o`( @ |o`( |2``?0z Hz0Lz? P~ƄP \㿘z "cP@Iz. cL@3cL{##cL##{*@ ###cL2 #*@ {c"c{#z #M* c@{@ {c"c{#z#L2 * c@z@z. 2z P" :3#L@ "Pzz#P. L 2L@ ##P 0`* 2 㿘z#P 1{c##c{#zL *@ c#c#L2 0*@ {c"c{#z #M* c@{@{c"c{#z#L2 z#P {c"c{#z #M* c@z@z2#Lz"#P㿘b{# "{c* "c6`*@ {c"c{#* c@{@f{c"c{#6`* c@{@W{####{8* ###2`!* {c"c{#8* c@{@5{c"c{#82 * c@2@%5{#{!&c*@  @ %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘}~ LT {"#  *   * @`  "T} D} *   * @*` Ґ#P}Z#$`G ` "#`}Z#`~    "`H 2  "cH "c }Z#Вa(<}@kPG "c out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈  {"#~"  @ܒ H#Ѐ H#Ԁ G} L  * @  * @*`@  *   * @*` G# H@[  q"qm"#Ѐ gG# d} L  *   * @*`  *   * @*` ~ ̀ }@ } L ` `*  ` `* *Z#Вb@ @# #?%~-}+}3{)|' TD@`$T`L @z c`&c $* c@ ?@HА#@@{H#Ѐ (H !~'}%} TD@@`$ TL @L   .* @* @*`@ * +#Ԁ ,{ !~'}%} TD@@`$ TL @"   .* @* @*`@ * * @*` {#@ @@#`} ,@#H#Ѐ F~ T } D@?} L  *   * @*` Ґ#P2/HG#P G#p  G}Z#Вc<}@ЖPGc 2H "c}Z#Вc<}@PG "cHH"#"c HH"#"c԰ ''''\ @9 D*`@  " 2'@$  ,  ?   , * ,` ? ,`8$  *,  ?@   .`,`?@,`  ?@ "? ' "@`   ,  :`":*`@ "z`@ * '? 'h @  '|-`?@L  '%@.|"-`@`@"  *.@5*  {  @h c #c'@"-  "p"/ /'&4@l, "@ @ "`@ 4 %@/+`   c/    /" * @ /" * @7%@4@ ., "  " .@@4 @@.? @- @z  ?&+? @- @ z 2?a`@Z-``  @ 㿘?@5A ? p'''| | {#I!.@'ܓ/`@'-~1}/}I!9|5  D@`%TL @? *䀤 Tܐ *   $ cm? `$4T D@`%TL @ * ,  * `  `4 $ $ `*@ {@B"#è :`T D@`%TL @ * `,  @$4T D@`%TL @Ґ * Ԑ *   & c2 `p $?4T D@`%TL @ * ,  * ` ޢ `$4T D@`%TL @ * `%,  $@4$# @@&& % %@ $@@6@ @ $ @*@`? `{@"# `ݢ @ {"#|" |"  㿘| | {# & 4#~)}'}`T D@`$`TL @5 *  ?# ? 4 '~+})}T`D@`$T L @ *  ?#*@4 3 (?'~+})}`D@`$T L @ *  T| $* 24 {@,"# 4 ?{"#|" |"    .    ";  ! .    ";! ! .   !";!   .   !"; 'pp#\x! !I$I bt*  .    "; 'hh#\x  II l tt0 lph   t l  incomplete literal tree incomplete distance tree 㺐| | ` !~)}'} T D@`$ TL @N *`` `4!~)}'} T D@`$ TL @4 *`` `4!~)}'} T D@`$ TL @ *`` 4=: & )~-}+}D@`% T`L @ *`` TH#ؓ, @*`@ "{4    H#ؒ,  *    "; '#\    & 0I!*`@  )~3}/}`D@`% TL @ *`@  T *  ' 4$@  . ";w  * `  T`D@`% TL @ *``  4??V. ";?? M7``8  T`D@`% TL @Z *``  4|?"; ??. $ `D@`% TL @8 *`` T  4Y?"; ??.   v|" |" I!<'#\!I$I bb 4Z#@bh0I!@'.#\ II H Z#@bwu0z   jh  㿘| |   `%~)}'}T D@`$TL @ * @ `&? 4`%~)}'}T D@`$TL @ *  @ `4`?|" |`" .``< 㿐{"#|" |"  !{$# "#8 "$#|   |~"T?`"T{c@"c 㿘." } D }!}%}#} D@L`, D $`,L@3? $ D} D? ~. ~@{~}`," X I?`HIL (0  I H8{ }~ T D~} , X㿘}" D." ){'}!}% #L D#@ @2$ `  D@$ D} D 2~ ?@.~}X`D "X~ "`T} L 㿘!{# ~{ @%c},# ",$#㿘#{c`!| $G#x }~  $@ c}{, ","㿘@2?&@@J[J@ @*@`J@㿘@~ / 2 㿘@u . @"` _J@ ."*@@ out of memoryargc<=0㿘@ @0^ @3@ @^N ؠ"@~N @N .N 2@@/5 $@ @ 2@@1"@&@@)"@$` 3ؐ@Gb$ N $` 2@$ %s: %s: %s 㿘}Z#ْ`<}P@ q%s: %s: warning: %s%s 㿘G#p  }Z#ْ`<}@ ȖPGc  "c %s: %s: unexpected end of file 㿘}Z#ْaH@ <. }@C P0Z#ْaP}@ P.㿘}Z#ْaH@ <|@, (%2ld.%1ld%%㿘@1  @4 . "* * @)J#@)F ?`&@ - & -*@ ?`&@  & *@@) @ ْb@ @㿘@.J"output in compress .Z format not supported 㿘J!P  J "!PZ#@ cxG"#  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.p''G#|~}T D@`"T} L Ԑ $JG#| ```"XG#p  G}Z#ْc<}@ ÖPGc 2G "cGc| "c| , '}Z#ڒ`<}P@  G"#F } D'Ԩ !!'?  ~ T* J!X !!} @ @1! |`$*?`$;{<}D"  6 D}L *  L} D? }L@ @0i ?'}DԐ} D~`XԐ"`XԀ}D@|$, @ @1!!- ?@$? !!'D*  "$3}@- ?@$? G#|܄ (? (?'<}L@ @ * @ * @ :@ @  Xc*!J!X }}(?#)@Gx 2 Gc<`,&`,G#P Xڐ h,@ |$ ,@}@, @ |$ ,@?@}(" +5&4 c@/Gx 2  c`,&`, @?@}(" ܐ& c@/Ք܀@6 }@-`2 |$*`E@Ԁ<G#x 2  {c}`,"`, 㿘{at*2at{!|%{'{!{!x%~+})}#{a|&!x*@t 4tT`D@`$T L 5 %!x?"$!x $a| {{{a|""a|x2@t 2t㿘{at "@> 㿘{2!t{"!x{"!| Bad table  * 2?ؖ  @ *`@ ؐ  27  * ؐ#@ *@ 2    " * ?:@2?& + 2?.  *@ #@ +2.?:  * * 6 "  @*@ }%@@5(?? @ )(* 6"((?3@*   @ @+@2 23* *  @ +`3(2?*@㿘D ?  z#\, &, z#t,   2 0>,'{z#\t* 2 ` 2 @`t2  `` ,    ? , t z#\, &,zc\ zt㿘    {c*`ac } (,``o2@0R@Aa){z#t-}+@'{!t2 *   !t@ ,   2`z#\w          ? @*?`@?*@`@!ta {c*`ac{}!c (㿘1z#p zw  &#p-!  )   #?zcp?"cp{!t2 }`(* @! {!t} @@ .   !2`{# 㿘{!t2`z#t*`@  {!t} @@ .    2`z#\ ?" *@㿘$z"#p㿘{"!{"!㿘 {a? "az#X@.@X   9"Xa? "as! { +"a#{.@ $0?$a!z&??* $#Xa? $az#cX@.@cX   "cXa? $a0ρ㿘{"#~" {! #G1|!{ $cx  !  $!  invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘{"! -{!%~)}'}* T D@`$TL  @  %@{!~}T D@`"T} L x ${! !P {!@ {"'~/}-}+{TD@,``$TL X %,``a@T!c!{!{b*  "  @ ( {"{"{!+~-},`" $`)}`TD@`%`T L " ? ,`{!@,`{!{b*  " {` {`{{: *`  `{{ 4 {{ ȅ(c @{{*`#Ȇ (*2`{Ȁ@*`{*invalid compressed data--length error㿘{"#~" #{{"#{"#{ #ȩ*@?{!{"*`@?5{'{{#%~-}+}cȀ@!{̱* TD@`$T`L  %cВ`$c#Ȁ@cȒ"@ ̑2 {# `"+3@Ȳ`,  cЀc̱* TD@`$T`L \ %cА $ccВ"@̑2 {#`.`@@*ܲ`@{{!@"| ${".`@{!@ @+  @cpcА"$cj{}!`,6!   J   (8  J  {(Jd( {" *{c* J{d "c( {" *{({Jd ( " *POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘J"!`Jd #{{ "d"c"{"#N - +{ "c{"# @(!X {"#{ "c{#؀ "{J {#܀ /!J{{#c䀢  J!d@{ J{J#ad {"#J "dd * @J@ -dJ` d{Jad"#!J!d'* @@ah !J!d $!d{{#c䀢 @ { {{{#䀢@{J!d"{"#J"!dJd J{{#c䀢2"d?!d* @J@ -{J` {{#܀ J?Jd "d* @"` Q #J!d*  @ J  -`? @  " J!d* @J@ -!{J` -`"#{#ذ    @  `="`L@  @  ){# @*$@ 2#ؠ$@M2   J!h  J!d*Z#ap@@L@ !{+##ؐ $#؀vJ!d`"!dL@ 3 J`V"a`J!h J!d* ?J  - JZ#a@@ !{!d* ?Z#a@J@!{##ؐ $#  )!{Jd JJ"d*@"a`!h  J!d*Z#a@@!{##ؐ $#N :@? :!{##ؐ $#'`  "@ `!d* @J  - {#ؐJ@ /!{J!h J!d* @J  - J{Z#b@@{!d* @{Z#b8@J@#{"X"cJad "adi !{#ؐ`$# @uJ@#J Jad "ad :2JJ!h  . Z#b`@@p:J. : "alA :2=. J : {#J@  J/"!`#J@ J"!`Jad $"adJ!dJJ!h  . Z#b@@@:J. :`"!lN :@? :Jd "d* @"`{"#ر. > 㿘   㿘 /etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐#@δ`g  (-$@֔ Y@֫ #2,@]f@`@(  "  @]WL 0 ` @^"  ` a   @]> `  @ @@␒ @](H@% @]H@f/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@(@"@U .@[֓2`  .  b@>@[ =. 9 b0@($*;@ - bH@0!+@#@ʐ  @` @bh @%0@ڐvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@/ 6 `n! @ < @@ `0#@n$/@'Ȑ $(0@ @'@@v ;@'@ a ,{`;!8@T @ !. `@'@*{@ 6`! @5 ! @. e`e@&Y  `!P@@&o @&k. :  4  `!p@i . :  4J!*`@N` %sr%s%c/dev/%sr%s㿘&@5. 1 L@ /,@!~ a!!@!@{ .  !~@'!~`* !@g~!& . L@ /!~!!@Ę!@K!&$Id: logwtmp.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/log/wtmp! @, "@p А@q ؒ@m @i @@%l $ $@㛐@%$Id: logout.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/run/utmpp" @ ) А@%W $ $O؀ @&b  @ʗ @ʔ @`??@% @%! $ް @%m$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@X`a@%4 ??@ @ @  $ @%B 㿈 ' ' '  @& ?㿈 ' ' '  @&x ?㿘 o N[a  [!, * N ?а N  , , * N . * N[!@  [?Р N!@ ` " N N  2 N *2 @   *` ƀ: N  - * : `2  J#*`@* : 2 @: @I1-ƀN!ؠ? OOPS㿘~" 1"~*"@N` ~"@#8/-~"@`%Nۀ M *  < H   8 | p ``%`` `c@ d 0,@  d@  0,y@   0, "SQN@ N@I N@ ``` )-Ԁ !@$  M!܀`""0@ѐ`` :?1,ʦ ``:41,@^ , @ Y  `` ?$@* $@N`* ~"$#~@$b@ >81@~b@TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcapx~""P@!"L /"@!"@!" @#/@$r@ /,@`$@ #b" 6#@`/$ @ )*`:   :2`,@` @ *`:   :2L@`L@  @L@  $ Т`L@  @$L  /" 't@x 6't0?'ttx@xW2t t@Ѵ#-#@}Ғ :?L 2,?  t  ~t"bP ?@ ? ?㿐~"P@{ ?㿘~"P@w :@ 㿈/ //~"P@zɔ찒&  @@ǟ @ &@㿘-     㿘-     - `*` 2`@ - , ?, @ $"8㿘~bX  "bX *:  :: 2@   㿘   ?   b    8   b   S @ & F` @  & & `@ & :`  @   € @` €  ` : @ & F` @  & & `@ & :`z ?s #@? ?#@  2@ #x @  @2   W U " . 2 * 6. 6.    @ @` @  `@ =` : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82         b 㿐J? )@  0?@ `㿐?JJ  0jJ؁ JD' ؅…B' @      @, . @I  `6`@ 6  @ @>@Jȁ?&'J؁ JD' ؅…B'   @ f0J7JF' …B'   @ F  ` : #ddJBJ聠 B B#dd`JBD# * 22 2@   㿐   ?   b       b   U & F`  & & `& : 8 @    @`  ` :  & F`  & & `& :  ?}#@? ?#@  2@ #X @  @2    f[" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ b f. 6 @6  ?   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@D@@㿘S @ & F` @  & & `@ & :`  @   € # C ` €  # # ` # :  @ & F` @  & & `@ & :`z ?s #@? ?#@  2@ !( @  @2   W U " . 2 * 6. 6.    @ #C ` @  ## `@ #;`  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82     㿐U & F`  & & `& : 8 @z   @ #@ C@ `@  #@ #@ @ `#@ :   & F`  & & `& :  ?}#@? ?#@  2@ !x @  @2    f [" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ b f . 6 @6 ? &  @   @    $OpenBSD: setlogin.S,v 1.2 1996/08/19 08:18:11 tholo Exp $ 2  c@- `㿐' `v@}㿐`w@t ?" ( " $ " "  g"  ?"  ( $$OpenBSD: swab.c,v 1.2 1996/08/19 08:34:30 tholo Exp $2":J  *@ `*@`: DJ  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $  ( + 8: " ( "$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8J2J "$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘~@Pb`$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< ") b("# c p ? d ?" l0   -  ?8 w ? s*@` r -*@` w -*@@@`@  - @ s  x S*@`  r -*@` w -*@`  - s x S*@` r -*@` w -*@ ` "   - " t  x T*@` *@*`$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@՜$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/shx!'!'' '5 '@M8@OY'ܰ?  @M $?@M-!В@uX@~ @6  @2 @c  @Mܐ @' @$??$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘[! @  ` - +  L@` 0 L@ x XL`` 2? 0  ?@G?@C  )[/.!  ! ?А   ?ɐ?8?2  ?? "% @` @آ`4 `&@$OpenBSD: realpath.c,v 1.3 1997/06/20 20:37:45 deraadt Exp $./8 !! @K ! ! . . @Ȑ#.#@t /@` !(@(*`J@ /"*`@N e.@. '< ( 2`` . >M"`@s$ &G..<   @M :.!0@y@m$ /.N / N `?O @@ $. ?"``@pa(@m@M .  @m0 . @M@f."  $OpenBSD: rand.c,v 1.2 1996/08/19 08:33:44 tholo Exp $㿘!Kq!@bm `9 $!1 *K $OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $㿘`. "`?@6`?&-`8*@O  @@ $ ,- ,ܐԪh`@" @,` @ @,`  " @  @ @,` ,4: @@ߒ   @,`  ` @,` ڦ`@ $OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘-  -K"J )--" K" K* @"bJ -K#p"b?J` `"J` - -K"`""#p"q?-Kb"bJ`:"@Ʃ 2!J - -K\?"J KKb "bK" N ?N :J -Z#/cx : ." K"J 9-3KK"J@ .&" Kb "bKcp""N :K  :"   -Z#c8@ ?.K"* @"`K#p"bKb "b- $OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘>@ ڒ@  $>>> $OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @ $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘-c􀢠2~#` $@͐ 2" ?-c""c "*  "  㿘Z#H@y㿘 @? @J㿘  @B  x@/''`p' ' '' 'Z#H@耢  ?㿘'L'P'T'X@uL㿘` ` 2 `@ i . "`?`?` &``@ . :  " @ &@* `@㿘 ? & `& @@Խ$OpenBSD: auth_unix.c,v 1.8 1997/07/17 06:36:46 deraadt Exp $authunix_create: out of memory Р@  (JZ@!DK#& & $.  $` `$``$`` & `& `& $`H@ H''''''0P!@| @ 24@ @0$` $@@ $`P@@&`& `& @͐0Z#@'b@ @N ?@@p/@JM @J1 @  * > ">x㿘 $ ` 㿀@ ' $``@   "@$ @’ "  & &   '@ɵ $ & &  & @f `$ @2 8  $ ''  @ @"@M '' € @"  $ $ $@1 '@ `@㿘 $@Q   @K@I $  @C@Aauth_none.c - Fatal marshalling problem㿀 $`!@Ȋ @= @8 2 @"  @$a  `@`     $ @ @@f@: <  ! ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@`  @ 㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@7@0@% "|Z@@@ 5@@ .@ @ܘ" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #[!3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @̔ 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 @ N * @<   )[ @ N@@"    2        ,    `    `    0   ` @? ` !  _ !  2 _ !  `_{`  !  {_  {  @3@  @  @u` &  `㿘 0 @ N * @  )[ @ N@    2        ,    `    `    0   ` @V? ` !  _ !  2 _ !  `_{`  !  {_  {  @3@ 2@ @  @u`㿘  ى(>)' %#!$ . @"~%@"h @"I(@J@N?~@ @V @@@m@ (@^@ꀠ@@   @Z"@p&@(@ v82rm   2kf e b( 2a\ 2]X 4YT (  Q `J G(( 10>; &7(( 0(( *(( (   5>3$ @(@2 ((  ( (( 5) `     $ @ @@-@: <   ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@ ` @ @ `$ 㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@V@O@D "|Z@:@3@' 5@@  .@ @" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #[!3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @b 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 ( , 0 @ N @  ,@ @k@  +[ @ N@@ӊ "    2        ,             0  @?  a  _  a  2 _ a  _{  a  { _  {  @ߚL@ @@ c@ ^@Țd`& L@ ` 㿘 ( 4 0 @ N @ B ,@ @ +[ @ N@    2        ,             0  @f?  a  _  a  2 _ a  _{  a  { _  {  @&L@ 2@N @@ @ @d`㿘 >%' #!$ . @%"r "J) MS?~ʶ „@ b @w@"@"n 造 @  h"~@&(" 82@   2@x w@r  2r@k 2l@e 4f@_ (  \  U@P  @.  @O@@ F/@("C&> @.  @@@3/@O@/ (   5>3$ (  @ @.   ( "@@@/@@@( `㿘<"e@  @4"E@2 `( "`    "   '*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x` >@3 L p p  !@ !` @  !"`@ @O`@kbȲ@q @ *?0%d㿘L p p " @  "  2 @@c1#0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @@!S4v *`  $`@* $` $`` 2$`@f $@$`$`$` *`" `` " H!$ $ $ $ $ $ ($ ,$ 0$ <$ @$ D $ 4 $ 8 P @^!$ H@  `?$ @:  @o @ @ ʔ `?$ $@ @ '@ 5@ $ L4"E$ D& & <"e& ( @  ` "`@;`㿘  @  @* :  |" :`" @H @:  @ |*  2@ޒ  @&J@ |!` & "@    @ c" @ " "@ X   @ " $@ J"㿘 `& @?ܑ* : `X "*`@ p    D                                                      8                             H  @ @6   D`" D  D ,  " @Ŕ @J@ ) ) ,  " H@ @`&J@ )"`@ [@  `( "`( `, "`,L @  `( "`( `0 ?"`0@ ;@ݒ 6   @- @o (@$ @ @’ `&J@ @: , J@[a  @ , :`@ @  @?֐ , :  ? {ѐ` J`[a   &@ , :  +"%  ? *"  ) {G"@& @" "@  "@ @"k "@  @" @%""@ڔ  @ $@є K@* @J@ ,`&J`[a   !@@ @d @ J@ }2 `&@    J@ }`&  @ @ @  @  @?֐ , :  ? {`  J`[a  @Ȓ 㿘 @ @  @   `&@J@   㿘   @ J@ ^ `&@:  `( "`( `, "`,  @ @  `  J@J` `@!   ` ?& @   `( "`( `0 "`0 @] 㿘  &J`\a) @ @L `& @aa)ya)a{`." `[`*`!a("( a{ a}a9a1 ~0`[0|  @dy @ t@Ip@ k D`" D  D ,  " @ @ `  J@ \J` ) \A ) ,  " H@ @ ` J@ \ J` )`)&@ʒ %?Б, `H @^` `@D`H@U @    "`H@ @ƒ ~ @:"J@ *2`& "@N @/" "@B @#"|  @ r` p`$J@ \l`$J` {h`$`&@k J ,& @[Ja   !@R@O !@ @ `  J@ \ J` }2 `.&  @ @  ` : J@ \2J` }"  &   @ @ @  `$   㿘   @! J@[!@ ` ` 쀦 . * ?Ж #J `J   `  @Ւ [:<:]][:>:]]㿘@Ր @   a@  2& @  a@  2 (@I  & @: J@ ^2`& @:J@ ]2 `&@ ] ` *] ` ] @:J@ -2 `&@ - ` *- ` -,`  "J ]"     J -J ]"@ @ : J@ ]  @:J@ -2 `&@ - ` *- ` -,` @`&J@ ]" @.   t ` ,`?,"` %[ @ `@  "?@* :  @ ` * ` ,`? ` @$/  ?,  @ `@*@* `" ` * ` ?,`   " ` @ ` *@* `?,`` @@  @@@=0@[@X 㿘 @ J@ - [2  @  @ 0* :  : ="40e &  @ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0u &  @] J - ]@S @ @ @I  @ ` J@ = J` ]`G&@3 0B@  J -@ :,`J ]",`& @ J -& -@,`:`, : @@ ,`: , : :` @ ` * `   .`㿘 [! J@  `& "L!|!| @@ 2` @J "@` @ @ 2`@ 0 @ ` * `.` L   `@@ L 㿘@K = @ `@ * ` .`㿘 @ @  @ ` :&J@ [ `J` .``&`&J@@ . @ ` J@ . J` ]`&@V , > 㿘 @   : J2J ]"  &   @  "L""  @@ 2`@J "N``@   @ 0L@[V d[U* : D* H㿐 && / ]//&& 㿘  8  [!@   ɐ* : ے0@g`    4" 4,㿐 &&  ^/ / ]//&& 㿘     .2``@` # *`@ 7\ 7p 7p 7p 9 9 9 9 9 9( 8 8 9 9 9 9 9 9 8 8$ " p&  "@%`   @" @C""@  @: $@ 0K "@  @" @$""@ٔ  @ $@Д `@   "@ۖ @"0@l0@b0@  "" ~""  㿘 ` "`     M & 4 @   2 @L,   @,  "`   2 @> "` @  "`  ,   @:``  $ ` "  ``%@  @    - @  @˓:`  &   %  * . . & &  ` (    (*   *` 㿘`  *` @  (  2    @` @ @ @ @ @   *   &@>    @ `  " * :       @ `  2  㿘``@&`` @`&` @`&` ` @ 0?@``  *?  8 `         ` 8 `          㿘  (`8? @ 2   " `4`&`4   ,@ @ 2  ǔ 2,@  $ @  $ @㿘  @c   * .` @y. & 㿘      `2`@:`*`@E  `&  *`@" 㿘  ' ߐ ,  *`  "` *`H "`H *.   "  @* "    (@> "@㿘   @.` 2&  0& 㿘 &`  @*` &`  &`㿘  v ` >1)'%##$" @ "2 @ )`@"- @ ") @  `@" `@" @*  @  2`( @   @`@$ &`@ @ @2`@ $@  &`<&`@ &`(`<`@`> @  @ *`*   ! `>     4  2 `("`(%x.0.%x%02x㿐   7 7!~#`@*@>#    @` @ @@2 @ @`  `@ `(@1L 2  @`@ 0@*L@@`(@ 1~#  Mυ(85@(  F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F *   J ` H* *`@@4 1/@ # #@ .@  :  *  . : . '.   , ,4 `4 `4 `4 `4 ` 4 @I  2 4@ 4` 4` 4` 4` @Ӓ * `*@0 `$@+   4@`4``4``4``4`` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\`@/"#!#\#``@/!!Ք#\#``@.!!`@. '''@! @ h" 0ӑ* :  KY`*   K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K  ,@  ,@L@  @  +` N 0 " #N  L@ `" 4 @Œ  ,?ܐ @.@,@?@.7!@㿘`    @9, `4  @&@ߊ/ /&/㿘`@@   `@ .`"А  ?*`: &? *`: ? *`: ?N   2    8  % ,   N O, O O O< OP OP Oh O O< O< O< N?,@` ".`,@`  ,  ,@` ,@`@*` @$@$@.`.@㿘 8  @   @˒    :, @M .!؀",   @` ` ` , :` @ ,  @ , @ 뀤,1 8㿘 y`  @; !<А *`: ? *`: ? *`: ?N 2    ,   Q` Ql QX Q| Q Q Q,@`  ,  ,@` ,@`@* x $@ * x   *` .M0 *@ `*`8*@`*@` * *@ %8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈*` *   *     #\ #` #d *`  #h1M"bP@ "`@@* 1/@  # #@ .@ :  *  . : . '.  , `,  `,  `,  `,  `,  `,  `,  `,  ` , ` , ` , @a  2 ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` * @ * `@< `@7  ,@ `,` `,` `,` `,` `,` `,` `,` `,` ` ,` ` ,` ` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\a8@+#!#\#`aH@+!!Ք#\#`a`@+̚!!ax@+ '''@! @ h#< 0ӑ* :  KY`*   X X X X X X X X X X X Xl Xl X X X X X X X X| X| X| X| X| X| X X X X X X X X X X X X X X X X X Xt X X X X X X X X X| X| X| X| X| X| X X X X X X X X X X X X X X X X X Xt  ,@  ,@L@  @ !+` N 0!"!#N  L@ `" 4 @엒  ,?ܐ @+,@?@+ !@㿘`    @ , `4  @a&@\/ /&/ * ?*@#d?*  @ ?*  ` #dd#`? *@0 @  `?# @㿘-@+#@+@! `  @   0耦` - @  -#쀢 @+㿘-@,  @,D-@ -  @   0- @,0'ش  ?c  !$`  $. @ @ " " 쨅? E  耤@@9@- 3/@’ *     *      2?@&l @, f$@ː @ &&?€Q.$`` C1`"`;"   "/  J .  N .  2  J 02  "` b` @*`*@o``Ԕ @o"`1   &  "` bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap-!  @t?ؐ@-#@ۦ O؀ 2 c@Д  @J7 j f"_4c  b2` `2]    * 2"?"( $$@$@$ #\$@  @WĘ$&    `"" 2```" @ 2  $@ 㷈-!  @?@C?-#@ O耢 2 c@@  J7 ' f4   b2 @,$/  @W˜$& V     @  Ǡ  $ِ 㿘-@*#@*-@  -  @   0-#耢 @*㿘-@*#@* -  -#耢 @*LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@ !#P 2 @ $#P#PJ  !"cP ׀`   ԑ. 1N!4Ӱ!N!4,`@@@``$,`N@ J N!. @@NJ@ `N@!J@ `@Ր! J@ . !(. !@F  z,  N!'!,`@"J@ ,`ሡ,`@- ``, ^  . !@ R, @ / !,`@ ``, ? L /"L O!$  ,``@,`*`N@ /"`  `/"N@L  N@ 2ސ$` ,`!!h@`  @Q @L 2  2` ``  @ %s/%s/%s/%s/%s㿐"hN@ՒaT N!TN!4)+N!N!ԓ. @@  "h#\#` a @@ `1  . 1"hPOSIX%s/%s/%s㻘,`!Na4 @u +,`a @ka( @eaЀ  ,`1N!4@@@ 0,`!Na,`$P @g  㿘  ( ,1O@ 0&"4 N .` `(>`/``?$`   H .  ..@@(``?)?$  xNX8X .(.?$ NWа .(.7$ N(/$ O + +O8.&&&& O0Ox@  (@ '@' ( !@ @``$@ ɇ. + +X. & & @  b0b0(@'@('``$@.&& "@  b4b4(@'@('``$@.^ O($ O . .. ' O0@@(&``$@.$ O  ḁ, , (    (@"(*2`㿈''   8x'7`㸓*`7` #@7` `/`@6`/ 6`6``.`@@@@@@@@@e@/-~' % (`.`)>@0 @)@0 @)~@0 @@0@@. @(a(`(@0@@ 6` (o@ ( 6  ( /(1 1#*`1 $ #@1 (  ,/`@0`/ 0`0``.`@%@@@% 㿈O! sϐ/ / / / / / / /ј''.@.`.`.`.`.`.`.`㿘O! 2>   ##"#"#0c,`0b !@ 0d @(f@2h(@2j a@@2l !@*n  @cb@ dfhj@ln   !#!#!#x"#+Nb (@ %@0@ .6   %@,`) 2 !2 +c+a@2+c@ *@2@2 a@@2 !@ *@+b$+c8$@"  $  &  (  *@  ,  +Ūa $  $@ 㿐 O!+      + $$+ $ 㿐O! ^  O!0+ "? +  @ `*@"$ @  + ` ? O!0 + +  *@ @ .    㿘  < 8  1P Ⰴ&" ƞO .` `(>`/``?$`   ǒ8ƐƞŴ .  ..@@(``?)?$  ƸOƲŰՆ .(.?$ ƸO@ŶƲM .(.7$ OƆL(/$ ۨ88PY + 88+PXƘ.&&&& PPXƖ@  (@ '@' ( !@ @``$@ ɇ. + 88+ŔՇ. & & @  bb(@'@('``$@.8&8& "ƒM@  bb(@'@('``$@.^ PƆ($ ג8PXƞ . .. ' P@@(&``$@.$ P  `⬀    ƀ ⨄@"⨕*2`㿘P!` 2     8   < " 8 " <0`8,`0b !@ 0d @(f@2h(@2j a@@2l !@*n  @`8b@ dfhj@ln   "8 8"8 8"8Ʈ#Ƭ#x 8+Obx (@ %@0@ .6   %@,`) 2 !2 +`8+b8@2+`8@ *@2@2 a@@2 !@ *@+ƪc8$+ƪc$@"  $  &  (  *@  ,  + b8 $  $@ 㿈''  ƪ8x ƪƄ'7`ۆ8*`7` #@7` `/`@6`߄8/ 6`86`8`8.`@8@@@@8@8@8@8@e@/-~' % Ǣ8נ8˚8ؘ8ϖ8ْ8Ӑ8ڞ8`.`)>@0 @)@0 @)~@0 @@0@@. @(a(`(@0@@ 6` (o@ ( 6  ( /(1 1 8*`1 $ #@1 (  ,/`@0`8/ 0`80`8`8.`@%8@@8888@% 㿈P!`  / / / / / / / /ј''.@.`.`.`.`.`.`.`㿈N@ $PN` 1@0U?@);!` 2j* *  " (ϐ 2" N@ _   N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڤ  N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڢ@N #!Š A   N  *` @*"  W 2 N !Ő#@- #, @釐ON` z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` : `- ң*@@*##N`  #*Š#ߐ   2C 2`2`Ph , 2` ? , 2` `? @ ,  ? , * 2 ? , 2 ? , 2 ? ,  ? , * 2 ? , 2 ? ,  ? ,, 1# $OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`O" (0 (`M0($OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @]$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@<6 0`㿈`2@ '`'''@D/var/run/dev.db@ߢh @ߕ 29 <  #0 #   @ #P @Q 7P'T'X '\` X` 2 ``Pc@ϕd`@1P#@@/dev/8$@ ࢒& @e2@ `@!P# @j?@@ @@`@@mH @ E* , , # @mc&* , , @bc& ?@ )* , , # @Qc& * , , @Fc& @ 2?* . . @5c? I @*`2`Jg" 8o-"M XO+"KL* D`H*  u2D*  !00    ** **  *  +  +  "   *"* 2 㿐M@ O?' @濔@ ,`@2 8 @洔  @バ 8,?M@[a  / @A * 2 #` @  А `M@  @ @㢓, $@ ,` =/@ 3 0@s %",` M@ g"d8 o a" m  u"iM@`` +` - =*`:  =" }  *`> @?* :  *  t ( 0 L l |$`"Ъ``"ɪ`b II @, $@ ,?>@6` =" + @, i$@ ,? X@d6`  @, R$@ ,?M@>@M6`<=="  @Ó, 0$@ ,?>@+6` @⫓, $@ ,? X@6`5`M@  ,`,@R`g"*`o`= -`X`+`-0=0:`u05*2 -2   +* '2  $2 *2 2* ?2  * 2 +-  =  *   - +  X@2`2 `7 J@+-X   J@-+`8  X`8  `( `** 2   ** 2  "J@** 2 ͐ longjmp botch. 㿘 '`0@ 㿘@'@%u㿘 ?*  `@  # N  2# # `@ @2  $`@@12&`1   D '@͖ D @@ .  㿘 ?*  `T  # N  2# # `T @   $`T@ p2&`1   X '@ X @@p .  /bin/shsh-cx''N@ r w.K` . "`g @ '` @  @6?`  :@@@,I  h   @R  2 K@ r @} "'@>)  @s "'@> @j'"'b '(@<˘ @1 K@ r2@ܰ@ܰ@O" "  h""h㿐@  h      2  %.? @+ ? " ` "`h$@@ැ???c  @㎖ ??˰?#@Ȕ °??@ ?# @! ?E??#@!=?#@?@ ?# @! ?0??#@!(?#@?@ ?# @!  ???#@! ?#@?@?# @?#@ t??c@ ?#@?#@?#@?#@?@?# @?#@! ?#@?@ ?# @  ?j#?#@ b??#@?#@?@ ?# @!  ?G?#@@ ! =?#@? ?c @ ̀@?.?#@@@@ ̀@"?#@? ?c @! @"?#@@@@! @# #? @@ @ @\ #@?#@?@ ?# @!  ?H ?#@@ ! >?#@? ?c @ ̀@?/ ?#@@@@ ̀@#?#@? ?c @! @" ?#@@@@! @2    ?# D?#@ b . "`m??#?% #\    @     , , 4 $    2J@ ? Հ =?3  @8/%)@"" ` 2J@ "@  2 `$  `, `4  `? ,   2􀤠ۢ` ˀ@ SF ӄF @   "  ?b      @ᓖ ???#Ȣ@@̔ 4 4װ?Ɛ "?ch@>@ ?#?c@' ?  #\  @R ?```*` *   ?#@ ?#@* * `  * @ #\  @ а    , , 4 $    2Jk   @ ?  ]?[?7@?#ڀ@CK%E@`"> "9@ J@ "3@  `@  2" `$  `  "       ` ,  ,  ` 2  24  , 4 ? ,   2` @㿘 Q"D, €?  (, 㿘 @j ?@ 㿘!.$  @Ғ    ? @-㷐`"@`"`"`~"` "`"`d    \2 2   \? 2  `  2 *`2@0@㿐 {   }  @r {@ @ 㷐@@2@`@`    )`[2  ] `" `]` "  {2` }2 ` `܀`[`  @R&@M@ [" { ,#`?` }`9``@ ] `"@`@`]`@ "' &`#``@ ,2@ ` 2@ 2@ `R&``@(@& HOME㿘 ~; (7.?   "* /" **  /*N @޽ ,@!(@@,e "!  @+ 2 J @2@`@ 02@ `@*2@㷐$@ a  [  !  - ?"?`  [ *"?` K I  !" @D ] 2 4@ [4@ !9`7 !`4@` 4@ - ` ] 4@`4@` ]` !&`   ]!&`   ?!&` @    *@"  *4@` 4@@. "@!` 2 #"2?@  `* ` ,@ "@ -@\ 㿘@@㷐 @  8 5  -  @`?`2`@*`2 `  ]@ @ 2 8 ``( `" @*`2` @  ʰ @*@`?㿘 ` *   `@??2@@ .㻘 .#X7@:` @2` @0@㻘@* @2$@0€㻘@ @2(@0€    *@ `㿘@@@ @offonsecurelocalrtsctssoftcarmdmbufwindow㿘 !T  ! @u #[ #[   @!T @y 2N!T`? "`@Ґ  !T" •?!T a    N  2 N " #"  *!P  p" p@ڐ$ N $ $ @ϐ  p"`N "`@Ð  p" " N  #[ p/`@n   /N a  / ?|$ `@\   /N a  /  j$ `@J   /N a  /  X$ `@8   N a    F$ /`@&   N a    4$ /`@   N a    "$ /a@   N a    $ /a@   N  =2  @r$ @)N o/ J!P #" N #   N "  "   p"`N ""`@s 2.1  p JA "`6`2 J\2 J ""  *`'# *P&*  2 *P* J "   "   J "  "  " 0 Jŀ"*㿘@" =   /etc/ttysr㿘 !T "0@=o 0 "0@b "aT@ 㿘 !T !  @ !T8$!T@ /dev/ttyr+ `0#0@ߒcZ#P'Đ 'Đ 'Đ @T @ғԦ   ?'T @ޔ@eŒ@=# !X ! ? $ @?`$ @? : . .T0c@Ɣ Ԑ 'T  @Ȑ @ک Z"1 @1 !X㿘! !䀢     @   $! !耢`  !@ ߔ "a-   !* a耢@! % # !  "!@m! * @?$a耢 $a@  $!!* a耢@ !& !㿘-   !@   - "` !J!  㿘 "  @G   @ 1  "㿘@6   @ "  @X  " 㿘@  @i  "  @?  " /etc/groupr㿘 " "1@<5"!8!< "@"!<  #1@c "b@ 㿘@ 㿘  ""  㿘! " @$""!8!< "@֪"!<group.byname%dgroup.bygid: ` '%73!8Ш+2 "8 c@ 8@4@ `$8@| 8  .`J<@D#\#`2@5ך@`< &<'$8&<& D2<D@3ǚ耢 $8"$8@ٮ@2@5$8@8  @38a8@@+*'̐a8$ @9 2' @  Na8 `? "`@c   " y? v8 +rM :S  O@3< b @ ^$8 @3@ W8 @E@2 2a@~2@9@2a@4蠒2;8a8@@վ*'̐@6a( @6a(%@5a("#8"B%@~>%@2 @5a(  " @  8 $8@a @5ؒa(  "@ 8@5ɒa(%@5Œa("8@} %2̀8̀ ے  "% ")"!4J , ̀` *" J    ``""*" "̐  '" BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks㿐3"3@Ց"Фa"L ]@ &Q3" J@ J` 13J M"(3 k G"3 K '1 333 k m g33 33" !3"1 $"$!"@Y+"1 @3#@Y" @N! 13#0@Y3"Ȣ""1!H 3P@̘%&@!H.㿘p. "`@_ (~ @ (& `& $`& $@$$@@ f4a@@V ]?42 @ -  @@K.@D@6`2&``@&` $@ 6`4* 2  "6`4 &` &`% `@ ؤ@4a@@ &"  2 4 $ 4!H @Ք &  $  & $ "`@ @ @  @  㿘`&6`$`@ @[@1) /@`N`A "  @Z`@@H 6`& &`&``,& 㿘 " ` @֠ T 2 6 @А  " @  @@  $  @ ?  .  @ @Ӳ $ 2  `." ? ..㿘 $@7  8 `6 8@ٔ +6 4`2( 4 4?* 2   @ʔ 6 4* 2  $ 4!H @. & . &  6 4 6 6 6 4 2U`"  6$ @" , @" 6 "@յ  " @[$ 6 4  $@*@$$@M$ @?  . &  6 6 6 "b$  &   2 @   $$@ J$  \@ V 2 2 8$! @    $@ y 2$$ ݀ 2$ @. 6 4* 2   $  4!H @ & . &  6 4 6 6 6 6 8  $ J? /@   $@ /*@ &` @@N$@ү V 2?2 $@ҩ." $*@V 2 2 6$! & 2. @ # " 6$  @  !. @ $ @   2 $ 2 5!@  " $ X$$   6 4$ .   2`8 㿘`@. F"`."  $@2?  4  9 27   "@D@2  $& $ T 2   J / $ @& 4!H @ϔ @& @ 2 @l  x' $   @ 9  44. 3$2 $ ` 2 ?` 0 ''܀'2'@& 26. $6 46'. '@  '$ " @J? /B $    /- T2`     @^  $ L` . L` ?`  `@m ` . `@$ `@ . @q@@Z."  $ " ? ` 4 $$ 4 2 `  6 4 6쀢  4 4$  4 47$ "  $܀" $ `    $  @ $  #4 4 $   @ $  &@Շ @$ @k  4 4* 2  *`2  ``$ &`k @ @' $  ".䀢&2+ T2   $ @h    5@!   44 $ & $ 2     44 @~8 $ `<`6   @) `84 d  $ `@O 5.`@` 2 &`&N @X  . &` @ `A  <  2) &`, &`( 6`0N`@ .2`N`A  ?`@c  2 `! 2``,"&@`R`2 6`( < ( 2     <    㿘  (&  @W*` & &  `"    @  "`" 㿘 $ D@  @ @c* @ $ 26 & I ?& <6 & & & 6 6 6 8& & 㿘 @  㿘 a@& @ & `? " @""2  @"""R26㿘 @ 8  8 $ ,  ` @Y  ?@B ?`,@.`(@. "`?@.  @."  : xxswufsswap ,rwrqro㻘999!7!d;9+99!9!!`$@xg`9 @vba E@ &dJ # @$  @ $ @Da  $ 9@<Ȁ 9!9!$  @ϒ!@wq$  @ƒ!z@wh z$ n$ l$ j$ h$ $ e`@a &dJ # @a$  @a$  @a T$ $ $  @aఒ@w:$  @aఒ"@w1$ ap@ޔ#/ 9@~a谒,9"9!9!@, 9@В @˒ @ƒ @ @ 9 @Ta谒`I  @w OB㿘!` @A   $ 1 !d㿘@1 1  !d@ !d 㿘@ #!h  ah@n ? /etc/fstabr㿘!` ":@3 0"P:@w(b` "a`.@   㿘!!` @.$!`fstab: : p:"'А ':"P'ؐ ':#' '@uА@x'':#' ' @G 㿘'L'P'T'X@Lvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx!; ''Ē@%  !@tԒ!'Đ@ ,J |J@ :`'   *`J@ | :*;a@';a@';a@'  ;@2a 2X    ;@'a0 X $X;a@@$w : "X $X;aH@(]?"$(;aP@(S$0;aX@(L$,;a`@(E$4;ah@'B R@ a@ 4;ah@(1? 4;ap@('?,@`0$8$8;ax@(?28@R4$<$<;a@( ?.4H;a@(? 4J;a@'? 4L;a@'? 4N;a@'? $P;a@'ٔ? $T;a@'ϔ?$;a@'Ŕ?$;!!7 `/;!!7 `/;!!7 `/;!!7 `/;!!7 `/ʢ ` a/////Ē@'?8&&Ē@'||& Ē@'x? x & Ē@'{t 2 t@m . . Ē@'np? s  . Ē@&g R@1ax.  * :  p ,`: ?4;!!7 `/\ 0/Ē@'Cl? l& * :  4  !W$$@İ㿘@s@ "&@`@ N[a   > @t 㿈 2. ''   @b ? `@o찒  @P ? !. @ˈ$ ?@|*?@~  "` x'''' @؀ ?  '$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`  @'`'` `'@\ &㿐'D D@4 㿐'D D@( 㿘'D@D$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $㿘 @? . "`?$OpenBSD: getwd.c,v 1.4 1996/12/21 22:23:37 millert Exp $㿘@!B$ 2 .@r @{#.# $OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $㿘.`&@}2$1  c@$  c@$  c@$̈́  c@$<  c@$$  c@$9  c@$  c@$  c@$  c@$Ä  c@$`  c@$R  c@$S  c@$  c@$  c@$  c@$  c@$8  c@$  c@$7  c@$  c@$  c@$  c@$  c@$j  c@$   c@$  c@$  c@$u  c@$d  c@$'  c@$Q  c@$O  c@$/  c@$  c@$+  c@${  c@$|  c@$#  c@$   c@$)  c@$  c@$  c@$"  c@$   c@$  c@$OpenBSD: sigsuspend.S,v 1.2 1996/08/19 08:18:15 tholo Exp $ o  c@$OpenBSD: pipe.S,v 1.2 1996/08/19 08:18:07 tholo Exp $ * :" c@"$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B  c@"` h`''' ''''' '$'('`'ДȲ``` .  .` ` `@  "`?$OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $㿘 #?@  0,@¡  4?@  0,libcUnknown signal: 㿘@!@@uϒ S.  @v @y .` ?@@vH@yz .`@Ґ "@y@v$OpenBSD: strtok.c,v 1.2 1996/08/19 08:34:28 tholo Exp $ 2 J( 2J'   "JH? ( J  H  2*? ##( 2HJ$OpenBSD: setenv.c,v 1.2 1996/08/19 08:33:48 tholo Exp $㿐N@ ="`@s@_"l @h*6@,`  _ -# ` 2#0  !-`#@*` $#H? "#0`@ǭ* !-#@,`$#-#,` " '  `=$ L  $@ǎ -*` " -c* @L =  = ,   =, @,`   㿐!-@ * # `"  " @'L'P'T'X 7'@'''A!'''@(PL㿀'@''' '@耢 &@㿘 ( . "`;?@J @2 P (     ?2 2 $? "  : @ c  0 "  < :@ c "  `"   "@: @ C 㿘<"e@' #4"E@&$  " @  " @  " <@ < @@אNo address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N " .'@'B ' '.@  @$$  B $ $ ؔ$ : @ϔResolver internal errorUnknown resolver error SB !pHSB!4* /etc/servicesr㿘!S  SB!B@oDa$ @+ -c"c㿘!S "-@L$ -"## ,/㿘!S  SB!B@oa  $ S#8$@oA2LY #B@m9b."#<B@m0bS, L "  " B@m bS. @nXc<* 2 "`"` #L"`B@m b.  ##BN    $ @lb.  2N$1#</etc/protocolsr㿘!S ؀  SC hC@n`x$ @+ -`"`㿘!S ؀ "-@$ -" # 㿘!S ؀  SC hC@n~`x  $ S#ؒ$@nؠ2LN #C@la."#ܐC@laS. N "  " C@la, @mc"`#"`  p!CN    @$@`@l`!.  2N$@1#܁/etc/networksr㿘! x  C"C@nb$ x@*v x-c"c㿘! x "-@$ x-"## 㿘! x  C"C@mb  $ x |$@nx2L^ #C@l cP#.$`@R `* C@kcX. N "  " C@kcX, @C`"`  "` "`   !!CN   @ $@`@ 8. @k#X.  2N$@1 gethostby*.getanswer: asked for "%s", got "%s"-_/㿘*& #D ( (А (:`ah@ua 2  .2  N .2 *`߰  gethostby*.getanswer: asked for "%s %s %s", got type "%s"p'''""H   "  2  ?# @ "'$'耢` . @]貒Dl쀢 `. @z ""H@'"''"\""\"H" a"a"   @,*@]|貒Dl쀢 " @_* 2 @_* 4 @_* 2  q4 1 䀥@@]N$Dl %@`@ '"'@ 耦@4Ϩ @j H#&#@]$& @^O " @ 耦@4 @j'Ԑ'"' @: @9@9 %Db @Hr <090|@kj쀢  %Da88@\貒&l @^쀢 e  H䀥@%@`?T @ƒ '"I'H@k4쀢   %Da8H@H#>"T@29 @q H  '" '  "@'@"逢@  "< ܄'%@'"'@x "  ݐ6-%@%#L@ !!@!"H -@ 耦@.@i$"H'"'-!@"H@N." 1"H. "` 㿘-!  -@Y"?-@ 0!@@   @ bf㻈-!  @Y?`@Ւ `` .   ?"`. /"` . "` "H" " @s2 . 2L@@*ڐ2 L@[!  I4L ."DL@@?+쀢 !"@s* , !'#'"H""Hb\""b\a""a""-!@ @." 1"HJ@[!  `.2 L@J@ 2J@J .L@[a  D@rђ : 2L@L@ :DL@ )L .<@>є쀢 ~!"@rД , !'#'"H""Hb\& "b\a""a"& .X" J@[!  D2`:. `J@ 2J@J .-#@k O  Fa@r   J; * f" y b  2 `2 @ @)$ @Ғ   ֐%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈-!  @W? @˔`Gb@@!  GbP@!      .  / . "`.?"`  0)Gb`   @iT # )G " @iJ2?@G" ",@ `,` `,` `,` `,` `,` `,` `,`@p-#@ O耢  Fa@qΔ   "/!J7耢 E f"9 y b 7`25`22`@ِ-  @'$%J & & @g%ᴀ%-!@@  &  & ." @`` /etc/hostsr㿘!S!d  SH!H@iHa$!d@%!dS"!h㿘!S!d` S!h @N $!d# 㿐!S!d SH!H@i"a耢 $!d. ?S"$@iDd2L. "` #H@g9bx.H@g2b-.!@   @=쀢   !@="쀢 -!@"@    a""a""H" " " N "  " "H""H"\"`H@fb.  "#HN    $ @fؒb.  2N$-!@ "'$'"H@Y." 1"H㿘-!@@   @ 㿘# G @g   @g   0㿘     @ 2  㿘"H""Ha" "  " ! "\" H@fQb2 ,"H 2V$@W  $@ZLL "  " I@f2bX" L " , bH "bH"H@| "䀤@ $@`  ")HL    @$@`@e",  2L$@$1"H%u.%u.%u.%uhosts.byaddrx"D"D   @ * J`@  @g ! '@$#@bDJ`P@j܀  Qᬨ. "`hosts.byname㿐"D"D  @Ӑ  ! %@}$!@"DJa@@8  . "`㿐@8  .@  ` .@`.@`@* 㿘  - ) &  &   ! @ $ 6@&&@" &@@&@ &@?&  2@P ) - !d @ !d.lh".  ..  0 $ P& ނ`,.VV 66.@ '@& 봆./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345 *`2` AK(0     / ,( 00*$   ` ( `<0*    `(* ǔ%2.2u$㿘 $. 2.  a. .   KH@t. @6㿈   . @. 2 @*? * 2  2` ( 1# ͖ #OrpheanBeholderScryDoubt?#Kc0@ `N@ 241SN` $ a21S ` `N` $2 1S@eJ *?1S!p#@ G` @I` !?#@@;?c@ `@  ?#@?#@O @@K `  ?#v2@ ?#?#v?#x @ ,`@``"@ ?#?#x@@@   ?@ ?#?#x?#?#?#,`@ @ *@@ 2 "@ *@@ 2 "@ *@@ 2 "@ ``*@ # $*# 2* * 1# $,@`@ KH@  ?c@ @  @?c @   *2 /KX(0@ 0 *   (2 *    ( * 2 *  ? * ِ *@ (`0  2(2 @2  ( `(0  @@D@"@"@  (`0  2(2 @2  ( (0  @@""@1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?#M`#@ `H@`H  *`2`*0 : * *0 @  2㿈7 .#6, 2`@@ "@ * 2  7'' 3 C, 2`@"@"@ * 2    , 2 ,.`2 &" `* 2   * 2   㿈7 / #7 , 2`@@ "@ * 2  7'' .2 % x@'q@', 2`@"@"@ * 2   .2  , 2 P 'I '.2 &" * 2   * 2  ش 㿘.:6㿘. * 2 ` * 2  `㿘. * 2 ` * 2  ` S `?* 2`$1$$#$`!S@!`@! @!` $``"  @  $  @  `" `  $2% "@@6@@7 !S@!@7!@68@6@@6@6@@6@7@{耤  @6ڒ?   @} @eS @6Ŕ <   S!#@]'a#`@g#R@]:aؐ@6 8@6 8@< @6@ǒ  8`@6@   @"@6 8 @@6| @68#!1@##$ **`     $ **`     $ **`     $ **`     $ **`     $ ޔ  `$ *` @Ӕ %s: 㿘 !Z#SbP@s8`"Z#@۔Z#S@gbX@ϐ㿘@& 㿘? @  Q Q Q Q Q Q Q Qp QP QH Q8 Q Q Q P P P P P P P Ph PP P@ P( P O O O O O OUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0㿘N  @9 " @@o $Sc8$ "c8 @R 㿘S#8 " @qZ 2   2 㿘S#8`" "#8`@2@@02`S"#8㿘%, x'S$0,` (J@ S  ?@  ,@0"@w, S#0"``SJ@ S  ?@e  `@ВS#0" @\` #0" %S0`"`` "` `"`T""```SJ@ S  ?@@  `@0" @8` #0" ``SJ@ S  ?@'  `@S#0" @` #0" ` `SJ@   ?@  ` @yS#0" @` SS#0" S#0`$"`$ `"`t: 㿐'N@  J `:'J '!U@!h&@!h& @!h "r @[& U@ah "h @[ & !U@!h& @!h "W @[& U@ah K @[& $T"& & & $!U@!h& @|!h& @x!h& S#0`"/ S#4 ` 2&  t S#0 &  t S#0 & S#0  2& S#0  2& S#0 2&  master.passwd.bynamepasswd.byname` T @h < @@! d  l l  @ $ d d "~S " ؀ "M h 0@= "UU##!#\#``l  hp@@ h  $ h" d܀ "'@'"`hh"`p@ l U#U#hp@؀ UI" d@`̀ @Q J @ l UU##@ЖИ@؀ $+#< .@̢ l "UU##!S@#<@#<@ذ" d@-#<  $#<܀ L@$H`x@@';" d`x* 1 , 2f , X`" X 2/ X@ؔ ' '@ RM ,J@ + J`  @   "`d "`d ,@ 0"`d ,@= S"c< ,J@ -&1J`  @@y`Ԓ@̀  Ѐ`J@ L @*Հ ,C Ѐ1 , __YP!+pW!' ' 1/W!@l '  '1 T    T ؟   㿈S#@?'@x  S l l @  lUc@՚耢  S@VS "c@ S"#@ p T @ "4  ?  "`X13%/U-U+ l; x 2/X@ ' '@͐  ,J + - ,0`l @]`l  ,J   @hN h @$h`l @^Mh @$h2 ,@ ܒ@ДԦ@R? "hJ hW @2ؘؖh@`p )h "$h@$h" ,@$h , 7'؀ @ؘؖh@i`p  h "P$h@L$hh`x@l`p`p* , >< , % ,7J ``@2 ,@0 ܒ@jԀ  ؀`J@  @ ,  ,@mu  \ ! T @$ T ,SB"#0ah`X "`X   \ ! T @$ T S*"#0 1/@ဤ  @' 4  '@͐ \  `! T @$ T` , %umaster.passwd.byuidpasswd.byuid` T @~ "8 V ?Xc`@XM  "`X1/%) l9 x 2/X@ ' '@~  ,J + - ,l @ l  ,J   @hT h @$h3l XX#h#@ Sh @$h2 ,@C ̒@}Ħ@? "hJ h UU##@ȖȘh@3 p ,h "$h@c$h" ,@]$h , 'Ȁ UU##@ȖȘh@ p  h "O$h@@K$hh x@ p p* , = , %6J ``@2 ,@א ̒@Ā  Ȁ`J@  @  4 \ ! T @$ T ,S9"#0\h`X "`X   \ ! T @$ T S!"#0 3/'@ ' '@~ \  `! T @$ T` , 㿘" X" \" d h "@t" hS"#0 㿘 㿘" X! T " @$ T" d h "@S" hS"#0/etc/pwd.db/etc/spwd.db%s: %m㿘@ " d Z!xZ!   @o  "`T   Za@3k "`  㿐 T  2l $@ a"$!@_ ( $ (\  (" ,,   " 0,   `4@  `8@  `<@  " @,   " D,   " H,   " L,   `P@˔  &@``@   "`` $OpenBSD: getnetgrent.c,v 1.7 1997/10/10 23:07:30 deraadt Exp $*netgroup: %m㿘@ 2&  [@ `` & @ P & [@ ``㿘   2 & @œ*` & [@ ``  & * "@㿘`  .`@ ` @*@@㿘  , @j   * 㿘 @ [!   ` 2`L@  @[!쀢  J`  @   "J * :  [!   ` 2 L L   L & "``&@ [@ ``@@*? & 㿘@ސ 2 [@ `` $ ,  ,   )    "@ @@ݐ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀'x , @) @,@`@1?''x  ?\0@@8耢 )& [@ ``@1 0@  2" \31\0 \0 H X h@@ C䀢    netgroup: Syntax error `%s'㿘J "g [J@ #"b J " @ !     &J  2 @J (29 &\!@0;?9 L  ` !J@ "`&J`   `   "" @ &@ [@``@@@*? J@  # netgroup: Cycle in group `%s'㿈p  @\#@0W0-5 1 $'5Sm耢  ?0 @0 P"` &P㿘 ` `@h  `  @h     @h   㿈   @\#@/O В 1 "E '耢 9 ?40#  "@X  "@Q  @J@H  ɐ@: @6 %s.%s㿘@  [@``[N [ X`[N@ [ X]@vBȁ(%s,%s,%s)㿘]#h ]#h`]#h]@v%X㿐` @V" @P@ؐ   ,㿘ז  Ж  Ɩ   # @7^@ ’"NN? ,2 N`@[P  @ @ 㿘SScL`""#P#S!SP` $cL@ "#P@v#P  "#P@o#P  @h@f#PcL$#P ! x  @$ x/etc/netgroup.db+㿐'S#L ! x  ^"@   @kp $ x x   ^bXg 1 @00@$@64 [@``&SScP"#L} SP" "P"@P"P P 㿐'! x  ^"@   @k( $ x x  @`^bX 1 `@@`  `  3`  2  2 @5ǐ  /   ` . "`#@m#ְ  /,@d&@0. ".#@W#$' .-- _ @}' ''."  @}2 "͠? / @s' .,,,@e6}@@ v /,  @hb.@/ `@hW.L` .2 `L` ?`   ``@@|ܒ .." ``$ @ ` @`j$&.@  &@`2 `? /, `$ `@@eÐ,k ` "` "`@Ő@Ð` @e 㿘  "@" "  @"`!@z  $ "  @Oے . "`?K:  J (82 J" J  JK JK@:  K:ۀ  2K K@` 㿈#\?@ %s.dbtcX'''Ԁ` 'y?̀  @Ԁ  @ $V@On`' `d@$G      @ :'` P@s=   @i? #@6԰@@@^@ǐ@g@    @{ b 'Ĭ @$4 @Ā @, ?+ L  @($,@L \2 ,@,@`@ ܀$@%$@Ȓ2  . ĀӰ?@ϰ?Ţ,@``L " #"@Ԁ 2\\@ 2   ]  @q??  :`bXԔ =v  `:" L  ?$#\쀦 耦? Ā@@<0n,?" ?2,??ɲ   `: L  $$L? :"$,$%%$@$%%@@,2 . "`Ā0@f,@Д$@@̔@@?Ā$@@M$@܀ @. "` ?@Ӱ?0 @ 㿈@2''  ? "??J@ `'? &@J `? J2 JJ|: ?  ?J:|?  㿘@@㿘1 "@gw& " " "  r㷈` ""`!   b@OBa耢 $  `  ! "U ! @ F! "@g?  @r`"`  0 b@Oa "`0]*? [L@!@  2 `:`# J? \ "`" J? \ "`"  ' `: :J \ , J  ,,  @ ֒ " @f @הK?0%*?O J |  :*J *#\?[    &㿘 =?@i d d. "`?  :c"t*`:   ^2 N N`: ` x* \2t N`: `}?А   *`?N  ?А *`Z*?* :  2N *  @ | d X p L @ | d X p L * * * *  *  * :*?**  "  @`dg dN :k*" `? @" "?&㿘G =3?@ d d. "`)? @ : "*@*@`? `"@  @ؒ d dN@ :@*@`"@ ? @ǒ"@ "?&㿘  #2N@2? 0  `N@ x X `  @А *`: ?А *`:  ?@  *`: ?ɀ @ `& 㿘N@ :2``.`@ap.`㿈   `2,`@l,`  @H & ,  &  &㿘'L'P'T'XLӔ -@2!. @$ ?㿀'L'P'T'XL  * j ?#`L# * #  @ 㿘'L'P'T'XL @*!. @$ ?㿘-@?PATH/usr/bin:/bin:.execvp: : path too long sh/bin/sh㻐  N . "`@T /  G'e@5 (e 0@/'e@`@tL@  e H@@ $e `P@  @e ``@ e@N@ /*| @E@,|-@s. "@ e<` & 6`   `,`@ 2``@* $e x$$ ` @,`-e @C@2`4- @)-. ` ` "``@?㿘'L'P'T'X@'\L$  c@$  c@$  c@$;  c@$Z  c@$OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $ *`:`J "J $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐-J Ѐ  @    - &-@, Ѐ`?$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "t @ @ `"m N@ "i @ݐ @('b &'@&@*M̀ UW #T''?ؠ @ڔ ''` #\@` l"؟  `` `f@3ta`̐?"`h@)ఒ2#&@  &  @*@'@@  '  @@@*@"@Y7@+f́$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘&- J Ѐ  - @(u! -  & $OpenBSD: ypmatch_cache.c,v 1.6 1996/12/03 08:20:06 deraadt Exp $㿐@?      2  2 @ ' @6  2$"   " @$  @$ @v  $ @q $ @ $ " $ $  @  @    @^  T@} @- $ T t@$  㿐  ) & '$ @> "  2 @^i 2 @ll 2 @$  2  yp_match: clnt_callX L@ " @ @`" N@ " @ @2' '@@(̀ -  @^$ !U쀢 '@@ؐ  '@*Tf @q@@*@@*I[ U#T''''''ؠ @b ''` #\@` "T     `g@1b̐?"`h@(B谒2#'@@  ' @*@@* - @]  @ " "T@W@)́yp_next: clnt_callP\`  N "v @ @ `"o N@ "k @ @($d '$'@@(QĀ UY #T''?''ؠ @ܔ ''` #\@` "؟  `` `h@1vaHĐ?"`h@'ఒ2#'@@   '  @@@*@$@  $  @*@"@W9@)hā$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $   c@"` $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@F, : N   *`: 2N@  2N?$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H  2* " 2HJ$OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $i "2 J "2 J   "2 J  J $OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  "  JJ@`       9[;@``!@  `%  4@_p 2 !  "@  ?&  &2   @`xײ`j ,`@ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \  \ \ \ \ X \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ t \ \ \ \ \ ` \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ x h \ \ p \ ,  \ \ \ \   4@^А 耥   ?&  C&h f d @ l2` `] ,* WТ "@6   `1  -`"* ( @ @!  @ "  `  2 @ 2"!@     "@    @@^o  @#` !  `%[  ? &  &@^U m   2 `8@k X,`@ l  "    @:$@&@^+ "  @ "& & @T -"? ", J>   ` ?&  &  4 @] "` ` J? 2``"b J> " ?& `& @,  4 @]Ɛ "ۀ  @J? 2 "հ,*"? &!    ![` ?&  &  4@] 2 !  "`    #[ ?& `& @,  4@]m 2 , a  " ,$߮8!%T  Հ M* l <  P P P t P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P 䀥`$ "$" < :-`R <-`R`` %! <  ! ?"񀤀!  =, ? &  &@\ɐ !2s! (ݰ @>ذ `x`X @2 ,  2  : 2"8!'ll#h Հ :d*  \ \ p T T T T T T T T T T  > "! ?"! = %$ 9!, ? &  &@\$ !2!$5 @- `e`E@ @ ,@  :"$j? ^      *$* !? * -  -]"?0 ]6  -* 㿘 @ 0 2 4@$$& 0& 4  @,& ,` 0@: @&& 0& 4 ?㿘?.-!Ѐ 2` @` 2`0 "I?`  @ 2@?` ?6` &`&``  6` `0  ``4@& @ "@(?&@*`! ` ?6` ` "`@@( ` 2`&@`  &`<@&`8`@&`0 &`4.`B`B&@ &`㿘 @   ?6 ." 8-!Ѐ 2 (@ (.M  A.0C>.0@@ @2 P     ?2 2 $? "  : @ d  0 "@ < :@ d@ " @`" @ "@: @ D@       "`  2 @T (ˀ$  #T2 V  & @ݒ 2  <   (6 & L $6 2V  >`@Ò >`Ȫ@ B 2$ 0 @"  P    ?2  : @ d  0 " < :@ d 0 "  :@ D 8 "@ @ d  < "@ @ d  @2( L4% L@8 L @ D4%@2 L@%@ @&$ &  0`[ @@"X& 0@ T& 0 L :   @   ?2& $&  & 0` @@"& 0@ & 0 ?ߤ@46 @Y    & "$& @ 2 ?>`   ?2 0"? 0` @@"& 0@[ & 0 &&  ?6  㿘@2& @" &&@&$@@Y $@@"&@&$OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @( "?& D& H 㿘  4@Yk 2F&@ @ $&@  4  "$ 4$  Β`P 2+&@ D@Q$@@YE  @  @$@ 2&@ D@4 "$ $&@ D 㻈 ?$-! 2 #\@/=2#\.B" #`$#d  @ . 1"`@+ז6. &"` 2   `p!ܓ*`@   .  . . . "`?㿐'  -!   @..." ." . "` N  J@ .d?`J@  .@ J .`? -@Ɛty-#L2  ? @r 4i. ` -!  - >`=`-!"7-",", 2 ;./.--@@L 4C` =;      2    2  "" `@  ֐`  @ 4. " .  ?. "`?%.*s.%.*s㻐-!  @.4`." )?`@?"N .2c @X *; qa$$@?ӚHOSTALIASESr㻘-!@q@!@ 2 {q@@8bv @% /'[ $@@W dO   2LO   2L[! L   " L C,@?0 Ր L   [! L  2 L )L     L     [!`L@   "`@G$,@.$@Wߐ0@Wܐ H`-!  d@-e." ? @>9 @,٨-2@4 `*` * $*` a > ?$ ?''`E```?_?2]?? ѐ@0z ɰ$.2 @1ϒ .2 @1ʒ  `B5  ??@0`  @1 .2 @1  @1  @1  #5 ` .. 2 @1 .2 @1  @1 /`2 @1` @ 5 &rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`4s *`@  < < , < 8 < D < P < \ < h t π < ό < Ϙ < < < < < < < < < < < Ϥ < ϰ < < ϼ < < < < < < < < < < < < < < < < < < < <   < < < < < < <  < ( < < < < < < < 4 < < < < < < < @ < < < < L X d p | Ј < < < Д < Р < Ь < и < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < <  $ < < < < < < < 01r"1r"1r"1r"1r"1r}"1rz"1rw"1rt#1rq#1rn#1rk#1rh# 1re#(1rb#01r_#81r\#@1rY#H1rV#P1rS#X1rP#`1rM"1rJ#h1rG#p1rD#x1rA#1r>#1r;#1r8#1r5#1r2#1r/#1r,#1r)#1r&#1r##1s  1s 1s 1s 1s 1s (1s 01s  81s H1 s@<`X icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`<t!*`@ , 8 D Ҽ P \ h t Ҁ Ҽ Ҍ Ҙ Ҽ Ҽ Ҽ Ҥ Ұ1t)!`1t&!h1t#!p1t !x1t!1t!1t!1t!1t!1t!1t !1t!1 s@<`X 㿘-#HE  !"@rI\ -5-H  @ @.^  @/>* 2  &H-#H  !`?  '`@ '@ *  @!N㿘Z@cH;; res options: %s㿘u@q`0  -!#u " @ @q`@2 `? &`@ &@ * @!;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈-! @)?i -#H  (2 !-3 T `< TT+ u`@  @qU? & & * @ -#H (-?`&@ ; & ;*@ m-#H "@-u@q$a @u@qa($u@qa0"u@qa8!u@qa@ u@qaH @u@paP u@pa` u@pah-#H !-uap@p!?#ua@pה ua@pua@p̔ -#H +"? & & * @q-#H  "u@pa e@)- #H  @u@pa@#H   @ @+$ @ `q@k#H  " `!u@-* @ԑ2 @pn!Ȣ`@X#H   @-n* @ʑ2 u@p[a#H ` "? &`&*@ @#H@/?#u!#\  ܚ$@u!#\ @Κ@u"#\   0 ub(ub@@p 㿘"㻐@@+]$O ?`&@ . & .*@ @㿘"Ֆ.㿘@+,& @@J? ."`w  ! !.  *`㻐 ؘ$@f0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c-!  @'.@"  A$8@ϒ@,* 2  @,* 2  @, @,* 2  -#H $-wa@n-#H   @Lw@nݒa@=w@n֒aؒ`ex!*`@ | | | 4 8 X 4 8 8 x | \ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | T T  2w?!T@{   ?!P$@wa2a?T?!P@ "@@@  @+G * wa @n33 G?`&@  & *@^o2/C w!@֒`8 `5'w \0@@ "?`&@ \`&*@@/ ?`&@  `&*@ @? Ҁ?`&@ " & "*@L `G w!@`5%w \0@@v "?`&@ \`&*@@ݒ ?`&@  `&*@ @Ȓ? Ҁ?`&@6 " 2w"@8w@mpb?`&@  & *@" ?`&@  & *@iw"8@@*I wb@@m2@*@@* wbX@m'@*5@ wbp@m@**@ wb@m@*@  wb@m@* * wb@l2 K2  @)* wb@l2 :" ?`&@  & *@"2 w!@`8 `5%w \0@?{ "?`&@ \`&*@@ ?`&@  `&*@ @͒? Ҁ?`&@ " & "*?`&@  & *@| "+w \?`&@ "`&*@@`6 `30b@?  "?`&@ \`&*@@t ?`&@  `&*@ @_? Ҁ?`&@ "`&*@@K?`&@  & *@7  ?@  wa?   @  .wa?` @ޒ wa@(ܐ* 4  @(א*  wb@kė2 !w"Ȕ@k "Ȕ@k "Ȕ@k2ϰ @(* 4` @(* 4  @(*  wbД@k3 ݔ2 ?`&@  & *@Ô" ?`&@  & *@2k ?`&@  & *@@R 2P@(Hwb@k2 F B!?!T@@wӔ  ?!P@$@@ ϐ@|wb@k  + 'w   `@ʒ  @Œ?`&@ `&*@@/``, *?`&@ ) & )*@?`&@  & *@@'͐ * wc@j2 w@jc w@jc?X"@ @ ܖ✢ 1w?!X ?@j#J?`&@  `&*@ @ 䀌 ?}@'*  @ב2 u@jp`@ w@jjc8 @5@wc@@j]@'k@" wc@jR @'_@D w@jHch@'V@; u@j?`@@'H* wcp@j72 ?X"@ @ `✢ &1w?!X ?@j#J?`&@  `&*@ @C 䀌 ?w@ic `w@ic(@wcx@i? & & * @&wc@iז  ` X P H @ANYHESIODHSCHAOSIN ` X P @ 8       p h ` X 8 0        p h X P @ 8 0 (        x p ` X 8 0  ! " p h X P ( d e f # @ x"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘   @1  2 2 &   2&㿘   2 2&   2 s@1`X2&1 Ё㿘   2 2&   2 s@1ے`X2&1 㿘}!d 㿘}  initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1"/1&'1=1&'161+1@"#1+1$11"1111"""1"("0"@1"H"P "X "` "h"x @1Rb 0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘  # #* `.  `.  `.  `.  `.  `. @r <@ <@r <@  <@r  @  ! # c@0 L 2 `  , `# `@0 L 2   `, # `@0ʔ L 2  2 1`2121  `2,, # `(@01! %ld.%.2ld㿘 2 @q   @q  `T*`@@ @| d@qx d1!Hb@0z!H㿘  @* : [ a   a+ @ *`Б*: @`L@   @L@ .+ `L@[!@  + Б* * `L@@  + Ж ` *  *  T",  *T  , Tb,  @ 4 * $ 㿘   (8[ a(`(Ѕ.8NN[ N2(8["a) (Ѕ.8NN[ N2(8["[a.`(Ѕ.8NN.2'NN[[Ѕ/ ((NЅ((N[?иN[2 NN"N[ N2(82\؇( , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,(` (.  (.  (( ' (` (( (( ((& (82@`( 8 D D D D D D D D , D D D D , D D D 8 D D D D D D D D D D D D D 8 D D D D D D D D , D D D D , D D D 8 # ##N[2 NaN"N[" "aN2"㿈      ''@'@a]@ 2& `   2 쀢 2  J@ - +?`'J@ +`'J[!@ ` ",`* ?Д 'J J  ,`J .,`'J[a  'J?Б. * J  ?'J,`@*`@*`@~M@&%b J[!@ `  @ `'J`   J[!@ `  @ `'J`   :t.@aJ[!@ `  @ `'J`   J[!@ `  @ `'J`   :=.@*J[!@ `  @ `'J`   J[!@ `  @ `'J`   :.@.@.`.`.`4.`4.`4.`.`5 .`5 .` 5 .` .` 4 .` 4 .` 4 .`.` ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm@  @-'c0/ /߰ /װ * *  *    " * *  *   " * *  *  &%"&%"" ??ڐ!   N S @n#'@~#@n} <'@~y <@nv <@~r <` W  E@ng#@~c#@n` <@~\ <@nY <@~U <@nP d@~L d@|@WT"@OT"@G2#\T"#\#`#d#h#l#p#t#x#|##`@,~T"ЀT@T"Ѐ@T@T"Ѐ@㿘@l   L ." `@ &L L * 2?J? .2 %04d%02d%02d%02d%02d%02d㿈'@'+`'l#`` #``#\@#`1!T```` @,'`!TZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR?Ѐ 8?Ʌ(8㿘 `A %['U@< ` ."6 +"3 /"0  `/   *D  `@  D" А   D*  @  D"  ,  .@```Ű  h   6%* . @0 07* @` 07*6*& @* 㿘   .@ @W /"`?0123456789㿐  /N (  @3Œ . @* @*`"@`#2,@  ,@2 `,@ N ް  .@.`.`.`  0123456789abcdef0123456789ABCDEF㿈 @ N :   N :p I   NB ?#!@3f ! @3^  ",O &N:. `DN`>4,@`,@`  6 `2e + Nİ   ` 4,@`,@``@$@   % # @ * -@ @  @   㿘   .@ @$ /"` %u.%u.%u.%u㿈c  @*Q @)+. "` %x8 @]   4`@: *  * $@#* *@@``"?''  ?,` ?  ?'' '??Ā@$''''``,`? ?Ā@''?Ā Ȑ?'Ȣ  :?#@  Đ@@ `@ 20`,, ``,  ,`Ā  ,`,`Ȗ$  . _" "* @ ,``@)`` Đ@ 2, :, , Ȑ$ 8.@(q "` %d.%d.%d.%d㿈'#\1 h @LI h㿈 N 0   N x X2  * &'[:`   @y?*:  `D` *??  *`:`N .2 N@ $@`  [!  2$@?$@$@ :  @ **` ?``@  ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=㿈`D  @/` @/` @/`2`/ `*`2@/ *2/ ? ?/@逢 ?@ ?@ ? @ _ .  .  .  .`° `F //񀢀 / @* `2 / * 2` / `*`2 @?/@逢 ?@ ? @` .  .`  =` .  =. :?.?㿘  L@`Z`' [!@  2ML@`=N@0ؒ "`  `09 ,`04o"@* .@/   f"@:`@ .@ `*`*   `  U"@:`@ .@ `*`*   F"@@ .@  @KL@```=5 L@  `  `0- +)?` [!@  `=L@```=2?L@`` [!@  "?L@```@ ?  + @+@  @0(@( @(     +  @  ( ( ( @     : H";j" &."  v" 㿘 * 2 2 `? 2`*  *` @ B >  @"   @@C  ?@?@ @ ?    @@y&㿈` '`'  `*`2 2 `?`7 x 8" Ua    i  @P XP   'o @5ک x@. @/`7`@@:1#V@. . 6@  ۶/ .6@0os"/@ Đ/ 7 @=_#@. Ȑ@/`7`@@"*@. ̐. 6@* "/ А.6@?Q!/@ Ԑ/ 7 @`& غ@. ؐ@/`7`@@"=#@. ܐ. 6@?֐#/ .6@"W5#/@ / 7 @!"@.  @/`7`@@?f!@. . 6@)P#8   .6@m !8  / 7 @=!b@  @/`7`@@0,#@@  . 6@ "Q/@ .6@:m#. / 7 @5Đ ]@. @/`7`@@ S@/ . 6@6(y"/@ .6@9#ȸ. / 7 @xs!@. @/`7`@@0#ִ@/  . 6@=5C!/@ .6@V . / 7 @*x!@. @/`7`@@?;#@/ . 6@"ٶ/@ .6@#J .  / 7 @?!B@@/`7`@@!}"@. 6@gX!".6@?yN  / 7 @)/"D@@/`7`@@#@Ȑ. 6@=Ґ#`.6@/ p/ 7 @ &ߐ"ƺ@@/`7`@@:I#@. 6@5;̐ .6@"!/ 7 @6u4 9@@/`7`@@9!@ . 6@蟐 .6@1+"e/ 7 @= H"D@7@/`7`@@ʿ#7@. 6@*#6@ .6@?$ 96/ 7 @V֐!ú@7 @/`7`@@#3 7@. 6@? }6@.6@!a!Ѹ6/ 7 @"O@7@/`7`@@?9"7@. 6@(P#6@.6@!6/ 7 @=ߐ"@7Ȑ@/`7`@@/N"57@. 6@ "6@.6@:ᴐ#6/ 7 @@& &  &  &  @< @%s: : %s 㿘.  !Z#`@Y8` #@Z?#@Y̒`@#]Z#@YĒ`@,㿘'H'L'P'T'X@H㿘'H'L'P'T'X@"H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~UD* R 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p< #cӔ#U ": .# U"@(( @Eݖ(6'@$@А@9(6?@$U" 2Ub U  8"bU" @E86?@$U" U@|@E@6?@$U"   :,@`?  ,@`?$@* $':` % N` m `@" @Ev86?&$`,?`@*`:`,@Ӗ6?@U" $@ '%@ &' H' ' @:Z   UUUb"`@/ U"@& U"  P @M @* > 'А$@&' `'ؐ 'ܐ@:) @|I/dev/log㿘 U""U""1UU""1U"?23U  *  `@*Δ U"    @.ǔ ?&" @D 3Ub  `@$ ?@|b&b "`㿘!U@{"?$"" U  ━㿈 ''@ 㿈 ' ''  @}/ 8@?$  c@$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@ @` $OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@  @a` @` $OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@ @T` $OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@ߒ  @5` @H` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘@1$$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@2 @$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘@1}$$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  $(B(B B0BB0BBBAAA             $OpenBSD: yp_bind.c,v 1.9 1997/04/29 21:25:20 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D  "@KВ ?e @ ?. #@ziX @ze@z[U#X?- Ȁ ""  `" @ @w2 `-" U`"#X&@D "/ @{A -(  Ȁ  D@4    D 2 h@w l  @{8 l?& \& h  h 2? h$D@Bך @K^ ?". h@ . #' 'Đ'Ȑ '̐@ ̒@ @y& h@ym@yߐ"Ͱ @wuɰ   А @z  /А / 'Ԑ?'ab  @s 2 @ "" @wO # 2 U  @" @w? #T'''' #\@ lD"<耢 " Z#b@UKD  @?d& h  @//#쀢   H"Z @wV  @z}  . H . I . J . K . L . M . N . O J6 X & h D@' @. DU#T2  : '' `? @ ?& \''Đ Hab @)G \ & `@#& h \ @AÔ ?@~#-`&"`Ȁ`2&@ 㿘 ` `@& `?& \㿘 㿘- Ȁ  %-@3  2 ` `@`$@$@v0 $OpenBSD: strftime.c,v 1.8 1997/07/25 20:30:14 mickey Exp $㿘@" `" @   * &@%m/%d/%y %H:%M%H:%M:%S 㿘 ʒ#V`%2 N E O2N N`y"*`@LQ|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|Q|LM(MpMQ|Q|Q|MN Q|Q|Q|NQ|Q|Q|Q|NO(OPOtOPXPQQ Q|Q|Q|Q|Q|Q|MMLMMMQ|Q|MLQ|N8NTNlNNQ|NQ|OO@OhOQ|PPP(?` "b`*   ` b`* @` b`*   h` b`*   8`'l@o d @E 0 b < "X6쀢 `  @3 0怢 `  @-  ` @' 0ڀ `@__ "  @ 0π `  @ 0Ȁ ` @ € `@_G "  @  ` @ 0 `  @ 0 "hb` ``"p b ݒ @ @ڔ 0 @ "x͒ }"``" @o  @” 0u ` "  @ 0l ```  $ @n ```  " @^ܒ    " 5 @ 0G ```  " @nĒ  @ 07 ` @~ 01 b u+ b o% `'l@^ d @i 0 `'l @b 0 W L` 2`@ W L` 2`@@v   `??"``"`* N ; h' ' ' ' ' ' ' ' ' $' ('@Ȱ    @^L  0,?@nF @, 㿘    @^3  0,?@n-     ,? @ ` (  `"`" $OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@wV @s@v_0 㿘[!   -+  L0 L x XL 0  >??WQ7. ??X]    #[a  a А  . ɐ' "8?2 @  @  ??? " &V> <@ F ɦ ``` '@㿐'[! @  ` - +  M@` 0 M@ x XM``  0  %?%  >UL SM $ %D    9[7. "!  ! ?А  T ?ɐ?M H$4?   @ ?1  1&U> = @ f% @?2 @  @  ?1#? &Uڕ> = @ F @`  #㿘`&`` ` 2 @@i] . &"`@`" ` @jt 2? `?&`@`&@*@``  @j\ ?@`"7''''@P*@?㿘 @? @$: x N  .'@u'"' '. @`@u$$  "$ $ ؔ$ : @2W㿀@uw'''' '@ZK$OpenBSD: clnt_tcp.c,v 1.15 1997/09/22 05:11:06 millert Exp $clnttcp_create: out of memory `@q Z@q d2 Z#@Pc-` "`. }" 2@#% *` 26 @q0t 6"$`  @&Ɣ &@&   @-   -` "`. "?O`@tK`$`$@$` $`$` $` $` $` @Ea @> `L''Đ '''А`0 @&ޖ @(  2 `P` $`@s ``L @$`H`P ``L@`L"@ɚ`V!$$@&$$ `@qQ @qL X'H''\`L`0`  &`&`    2  "$ $&`$?&  `0`H "`$  €H "`$ `€ ğ  `$  &`$@ o`$@  &`$f 2b      &`$W $/..  H'`'`'''@ C@'?Ȁ 2`$ 09@'`$`$ 2$? `€Ԁ  &`$  &`(  `$ ؐ &`$؀  $@&`$?" `$ ` @ 2g$`$ $"@("`,"`㿘  " L L@` ```" "    "  """" "  㿘   " P@r P `@ L@pE@pCP2 ! 4 * @p ? ؐ  @s+.@C  ' 'Ш"@2`* ` * @  $@    @%0`@Cْ Ȕ"@'̒"@`'Đ'@'"@'Ē"@`''@'' ' ?`? ?  @& $@oӐ+?` " & $@& (@oƐ?؀@"@o@q 2 6& ( & $?. & ( & $㿘#. @q?$`& (& $? @$OpenBSD: clnt_perror.c,v 1.8 1997/02/10 00:51:39 millert Exp $㿘1! @oL!&!!%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u 㿈̠w   €@!@:e@r耢`W@"*`@hThThTg<g<hTgpghThhThThThThThThThT$@!$@@:<< $@!"@ 1@$@!&@ @:)@r`  @$@&@ (@: $@!"@ 0@: $@!"@ $@!"@ X@: . . 㿘Z#@Lb(jjjjjpj`j8jiiiiipiXi8ihhRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) "* 㿘Z#@L;b(%s: %s - %s %s: %s 㿘-5    "-Ԑ `!h@9 -  @ !h@9    !x@8 . . %s㿘Z#@K`xmmxmXm@m mllFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  * $OpenBSD: authunix_prot.c,v 1.3 1996/08/19 08:31:22 tholo Exp $㿘@$ `@& @$` @$|`  ``  @`P   V V #` #d #h #l - -?` d-*`  2 ` ` @ *`#㻐 $@$ @?@0* 4 `@+* 2  ` @   ܤ 㻐 ! # !?@[$ @@* 4 `@* `2 "  P'D'H'-! @@??'-!  H"$'''' < -!Ā  )V -!@6۬9.;V,`-!@'-@Vᔀ $  VᔐDH ԑ* rt4r xy8   )4Ű?`V-!!   V! 2!  @  @!K %!' !@   V "!J@t' 'D'H'!@,d H`   7!@nAޠ ސ"7ޑ*  @ @t 6-* @l'-@@2* 2 ' 77޲ހ *!@n2 ސ"7ޔ*  @  @D`$-"%"""!@mސ"7ޑ*  @! V! -V!  @  @  %!'a-! a` a  !@   "-@'a!DH@ H   /'7!@ 'a' !DH @  H --@!!*'@e^` '؀ $''! 2 @Is z!2 * -@ @ @ &@    @ hؠ@k@  !0b2'  ^'Đ '! @ XԀ R' '@!-!$- -!(2 DH @ 1 !  ?  --@@k-#H F-!  " @\'p-@-!  `-!!V@IVᘀ "   VDH 2* xt4xxy8   )4%?`V `-!@-,`-!쀥& @ .Ā. ="` <"`" ?㿘!V!  @l?$!V"!V"! 㿘.`` .2  ,`2 . @c2`@Tp,4 . 2`@c @Tf ,`6 㿘@6٪ #a$a%?# '@S4, 4 @62!ʒ$a ?  2Γ2`  @ 2a#aΐ@S *   4a@6#$a@Sc4 `&$a! ,2 , 2`@Sr@*   * 2  (, , 2  , 2  @Tc` , 2`{2aV2!!!@=Œ !ܐ "aV  ` ? @2㿘!!@= V!!/@!!Ԁ@!s!!؀ @6G$!aؠ 2 "aV!@!/@ ]4V#)'%!@bOaΐ @S 4aVa2a!aaʰV!. 6 /&fLOCALDOMAIN/etc/resolv.confrbfdomain lookupsearchnameserversortlistoptionsconfRES_OPTIONSenv㻈   -a耢   "a-a쀢 2- "a-a -""a-!$ , 54 $ d<*@ $d$`aP@F @k 2C@i!X<`@8 ,_`$DHL`  -"D :N   `. " $    N ꀤ *  :  ( . N  .$!h@ْa-#a@ 3--"H-!$@ O ;" #a@l  *O  2$ON "  " N "ؐ Ր@ /`@Œa2.Ʈ a@k  DO  > -#@  N   L y b f -#,@   , `L y b f2  -#,@ ` "`ϰ ~a@k  YO  2SnON "  " N "` ]bH@D -a_bH@% 2.bH&??NbH  -"D :N  `. " $   N 퀤 * : " . N  ` .$ a@k= ,O  2&#ON "  " N " @: -@"` *` 52`a@k   tO  2n ް)%[N "  " * :  ΀ ̀ ;ʀ *`!H@:` 2NN`;  @  2N N N.@ 0,"!h!H@s  ,. N   ;`  " N.@Ȓ , "!l,!h'@ܐ$!l .va@j  oO  i@uac--"! *`d* "d@(6-"HJ"H @  @ . @) ,`*-", "", $    *`:  .d N -"H?-"8` @ . $  $@i< -! @  " @gn!ఒ@a-a` "` ndots:debuginet6㿘 J-!#*`: N "  " `8@i  @   4!d* !d < $!d`@@i   `H@i  2  $ * : " N N  ` N  0?  ??㿘?    H  . \*D?@@:??(@`@/ ,- `. `\2 (@@:)?(@`(@`<  ?!?(   &@&  ? (@!㿘@    @ 2` H "?@u A:`?,  ` ` ?"@7* ?@$@`$@  ,  .\ $ "? >**,2$? $      ? * " ?  [Vd* P㿘C`3 ` & `?7?, .+ \" ֦ Ҥ< ` "&`." *   @ `Ѥ & ¦? .J( J.  .`.`Ѐ   Ѐ -2 @2J 㿘N * N  .   㿘N   ߀ ]`. `\ " N` `. J߀](J    (  ( ( ( 2 *@*`2 *@2 *`2 *`*`㿐@ ?㿈'[*:   s 0   N x X % `*:    @]?`*:   D  + @ . 􀤀: $*: ` = [!@  6$:` `+"*`@$?#* ?# *`* @  * *` *` `2&@ xph`XH80 phXH@8 %I:%M:%S %p%H:%M:%S%m/%d/%y%a %b %d %H:%M:%S %YPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSun%s: 㿘 !Z#a@A8 #@BZ#@Aa%s: : %s 㿘.  !Z#b@A8  #@A#@Awb@ Z#@Aob  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Vd* R 㿐@6  ?&㿈 ' ''  @f[ 8@?$x  c@$  c@$b  c@$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Ԕ  `@Δ  $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@[ @GMTJ( ( ( WLW@ L"  4WL!4* ( (  x*  쀢4WL!4 (( (  z,& /etc/localtime/usr/share/zoneinfo/?` @c  N : /N  /"  N /@ .   2N " ?N :" N /`?`" "?@d@dߐ $@@Œ`ؐ@’@T . 2 `@ o  2?@5 ??` @cv@c 2ڰ??  =95&@1&`-&`)&` @ 2` 8?`!r2  2?`@`2?? $ & `* @`* * @` @@* @@@ o  `. @"` `  *%ؒ ``@Y `@ , 'L@Ӑ&@ $` E $``@` @4Z? `.  `  @#L@ *  ` @cL*  @#!L. @&@$` @ * 'L  @L"` ?"`  `.  * 'L` @L"`  ?"` `.  mn ( 8+  (:` Ѐ Ԅ:` " JЀ   +  (Ѕ+`8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ;*`" * @ &@N :   <2@  &@㿘N -   + ’  @ &@㿘N J M&@ `+ 2!N &@ `   "1 N .! ` w "% N . `   ?Ѐ   &@` !m`2N  / u` &`㿘 ` @I| d 2  @Iv! 2  "  " *` * "@*`" * |;yTv!*` * "@*`" * n ?a,*  **` * "@*`" *    @I+  @Y$ d@I  d. * * ? @Y     < @``: @,`"@ @I &` ,  !,@*` *@   6+  +  * "@*`" * posixrules`  &8 N:?@b0!N ؒ 0 2&@N  ^& (?N  , ; 2N ?1'N , ;2iN ’ذ"?N , "?N ? &` &` &gL &gP&gT &g`&gd&gh`eؤ ' "P$ $$ .$ . .$ .` @H@ d 2  @H:! .  . *` * "@*`" * `gȤ} 2?   ?gL gL' ` `@ %ؑ* * @gP   @  ` `@ %ؑ* * @gP ݘ  @  + eؑ* * @ S*e\ 2* + X + "@ "@ @ " * * @'L'P     `Ւ@  &gL&gP&gT &g` &gd&gh  &` &`&` &gL&gP&gT &` &` ` "?#L@@@.@ `@.@ 㿘!#ݒ # 㿘*` ?"` !ʒ!耢 !zTZ㿘@]!࢒* )#@p 5!*@` (  $ )#@L@ a"a" "'L"'T!!4@|c0!!耢 L@ :!Z !1㿐'!` "gP`6 gP # `  * * @'P 2* ` * @&@  *@ %ד*@ *`gL@ @ @K & WL* cL @"   @&(㿘j 1*  㿘*` 2 "`"5 Đ"@`W @) &(㿘 1*  㿘1*ؔ  㿘  L !L!P* @&>@2=  4  * @ &$*  *   @ @2!L * `   *   @ *#T@VJa@FFa&@TT! T! ?"T! @V-.&@F).@V& <&@F" <&@F  & &'"P @F  d 2  @F! ,  , /@U!m?&* @*`@*`?@ < ?@U d$@U!,< @Uڒ d$@U֒!$$&&, @*`!@&@*  $  &* 6& & &$㿘ې@@"&  2` 㿘@ &8@U@U8@T2@"@&@`` ` ` `@ 0&' ' ' ' ' ' ' ' ' $' ('В < 21?Ԓ  2*?ܒ 2#?'l 2?Ԁ )!n"P? ؀`4    @E! d 2  @E! ,` ,`@`'Ԁ!n*"P؀`4    @D d 2  @D! ,` ,`"@'ԐA  Ԁ!n܀  @Dޒ d 2  @Dؒ!  !,`@*`ؕ*@@ Ԁ"'Ԑ ''ؐ  ? 8 2?ܐ'l'Ȑ?ŀ 2?Ȑ ; ' p'n''Ƞ ' #@Ȓ ? `?',@" ',@ '耢`D A@"! ?,K?, * 'P耢@2*?? %, * ,`* P耢@L L" '@Ȁ 2耢@,`?Б, ?@&  5`@ ''@ &?㿐  &  " S && #@"! ?,C?,`* 'P @27? 2,`* , * P @"$?LL"  & `?& h Ñ, * 'LL"@" & `?& ?֑, Ñ,`?㿘Jc 㿘?" 㿘" `d 㿘" `d|膀 L( `( 㿘'DDD&㿐'DސDD 'ِ"@D@ 'ΐ"@D@D ??'"@D@D  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈` "`* @"@` "`* @"@`#\@#``'l#d1* b` @\` ؁$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @(`  @*$OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $H" @ J2  @*` $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘*@b$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   @  `     @  `   "  2  $OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @J @'L'P'T'X"7''#''@6,L*@㿐 Y? @O 0`" &  @@"& 0@Wt & 0& & V @Wk  3\@N `@W1 ?@W)`2   6 &  C&&  & 2(" 6 &&   &  "& &   & & -#4"`㿘'H'L'P'T'XZ#H@5H㿐@& @N @*Ĕ! 66 6  6 &  "& $ #& , #T& ( #&    @Wߖ 㿘`6 "@"&&@YW+,(  @D 2,  @A|ܒ`"&&@Y0@ܤ,$OpenBSD: xdr_rec.c,v 1.5 1997/05/28 21:28:56 deraadt Exp $xdrrec_create: out of memory 㿘@Vk D"Z@$ <@$ @@@V]  $ Z#@4a0&    $  @$ (W!& & $$ $  $ $  $   $  @$ $ $ $ ($ 0$ ,$ 4 $ 8㿐 `4 `,`0"  &@`4?"`4`,  "`,@%   &@ 㿘  &  @ & & @7 2  & @" 㿘    4   8 2 @n 󀦠  @B @ 4"$ 4&㿘"    "@  @Xa  $ @ @ &$ @  2  㿘`   @X  ?@  "  0 ?  "  ," &㿘 ?("  " ,!  "  @  @ $ "  4  0@  (@  $ , 4" $ 4    " 40@"@  ,@0" "4,@", 㿘 @U[ @UY㿘 @ 4 " & 4 8 2  4@ 2 4   4  8 & 8 㿘 @ 4  $ 4 8 2  4@ 2 4  4  8  , 0`?㿘`   2 "  *" @ " ?  "" " 㿘`@? @  " ?"@  "  2  &   &  㿘 ( 0   $ " ?" & ,& 0 㿘$  0 ,@    ,@W# ,& ,@&㿐ݔ   2`& 8 *@& 4  㿘`$  0 ,@ @  `    ,@& ,&@  c(/  ?$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory 㿘@ @  "C  2; @L   "/  ( @T &@Z#@2Ub   @W : ` @  @T@&@㿘 :     @ 㿘 @  $!  c@$OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ w$OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $㿘* #Ġ?@=  0,@M  4?@=  0,libcUnknown error: 㿘!@ޒ W#<. ᄐ @ @ .` ?@@ .`@Vސ "@@Ȑ$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘[! @  ` - +  L@` 0 L@ x XL`` ` 0  `' #@=&@M"` $ %   3[/. "a  a ?А  3 ?ɐ?,'`&?2  ?1 % @K&?  ?#% @Kz @Ģ` 'NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @@T 2 @S. `2 h@S&  ! `*`:  :[ %O  ?* :  (F* DڤtڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڼڤڤڤڤڤڤڤڤڼڤڤڤڤڤڤڤڼJ@ :  @*`J@ :  @*`:  * L  *@?2 L 2 L ?0@%ג ?*@L "#\@Tv"?  ̔  @Tߘ@Tj?2???#@ @QА && @T%̰?㿘. <  5 @4-@08((@ @@@08((Ѐ66׺ո㿘? . "` ?" @S @Q $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $pX@(x`8(p`H8(`@(P8`@(hX@(ߨߐx`H(Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(`  (02 @$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $J H2 @ @(`($OpenBSD: pmap_getport.c,v 1.6 1997/09/22 05:11:08 millert Exp $h7֐?' o6 W#\#\'`'ܢؐ!#\ab @|!/W''''#d#d'`' #\ |#ր  - "  €`  ր 2 - "`  @䀢?"6 @P6 ց$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@˒ @ƒ`  @` @`  $OpenBSD: clnt_udp.c,v 1.13 1997/09/22 05:11:06 millert Exp $clntudp_create: out of memory X\@M  `Z#@,6c b-` `d@Mؐ@ ``Z#@,&c R-$ X@!Œ    WE *` VW6 #|$$$  $  $  $  $ $ $ ?$ $$ ($ T@I$ \''Đ '''в 8 X@ @I -  < @$ P 6$  '  @   '-` "`. "@  b~@Oݔ $ @K$$  @M @M 㿈''b`#\b'H'D\ `(? @'P``$'P`('T@!  4 * @M0N ؐ  @P'|'x`8&`8`< €`P`X@ 2@`< €H  `€ D 2 ؀@ @M$ &`,   @@`X `@2`. &`0؀@ @M  &`, P  .T .|@  '`'`'''p@ ’ Ш"??/!%. @2`* ` * @  $@ @   @`?" 2\'Lx`@'`|` @@'d'`@'d`'xd'|P@xT@&@6@ O@h@  hp"@'`lt"@`'d'`А"@@'dx`@'X|d@@'\'X@'\X'x\'|P@xT@&@@ @L} &`,d @```\ @L "'L #"@@&`0@L` &`,G (u@`X``@2o@``@ @ *@-`,`,  `€  &`, &`0  $@A ` @ ئ`8 &`,؀@"`,@L`, ,"@0"`4"`㿘  " 8 8@* (" $" ( $" ("" "  "  " " " " "   㿘   " <@N. < `@ 8@K@K$OpenBSD: bindresvport.c,v 1.9 1996/09/15 09:31:30 tholo Exp $x ` '` . ."`D? @O/ /`  '  @ఒ, 'ܐ  @ "@ذ` %.    @  &$0 耦@ @؀ ." $OpenBSD: auth_none.c,v 1.3 1996/08/19 08:31:20 tholo Exp $㿀*#Ѐ 2  < @)a @*/ "# < *.  & `& `&  & &  & W#&  ( @~ @1@.  @& < `@㿘*#Ѐ (` <   $a  c@$i  c@$  c@$]  c@$  c@$v  c@$   c@$h  c@$OpenBSD: xdr_mem.c,v 1.6 1996/11/14 06:33:13 etheisen Exp $`"WW" " " "   "  "@ "     "  @  "    "  +d+e+f+gd"@ "   # " @#d d( e( f( g( "   #㿘 "  &  @L &   㿘 "  &  @L &       @  @4 " "     @  $OpenBSD: rpc_prot.c,v 1.4 1997/07/16 22:33:45 deraadt Exp $㿘@  ``@Ζ!㿘@ 㿘 @w` " `    `€` @|`  @u`㿘@V " @   @``  @[`@?` 㿘@N @1` " ` 2  `` X@  㿘&` &` 2 @+ @` @!`  @` @`  l*  "@ "@ "@  "@ "@"@ "@"`"`     "@"@"@ "`"`㿘   "    "&@ @ے@&@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr.c,v 1.4 1996/12/14 06:49:42 tholo Exp $㿀 ' 㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿘            €㿘            €㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐N@'Ȓ .@  㿐@'ڒ .@  㿐 "     @@ '  €€ @ &@  㿘ɒ㿘% "      *  c2     2    X`( `?xdr_bytes: out of memory 㿘@c "3  2,  "   "    @F̐&@  Z#@%c   @Fߐ&@㿘$㿘w " @ "  2    €xdr_string: out of memory 㿐 @ 2  "8 @J ' .8, ` ` ` 0!  2@F[&@  Z#@$` ,!@Fo&@  㿘?$OpenBSD: qsort.c,v 1.5 1997/06/20 11:19:38 deraadt Exp $㿘  `@ `< @>@*@0$ )@$&@$6""? $ **? $ղ$͢@6`@>`@>`(v6`@>-    4  $@@    4  -%@%@    4      4  @&$@6""?  **? @=ޒ/ 4\2( $$6""?  **? Ґ0/ &.2($@ @$@$6""? $ **? $$@Ґ(@$$@6""?   **?  $@ ;@=K@@0$ )@$&@$6""? $ **? $ղ$͢@@=$$ 4 $2  ""? $ **? $%@"@  %@" %@2  ""? $ **? $( $@=z͖$%@@=oƲ㿘@ union8@ ΰ @>  .<  . "` @ ?@C @$#"`@ؒ  Ēc`@G          # @Cےy%@ $뀤#``@F @^ 2 & @C@Cg &   `$@   ,`$`* @਑,`$   ,`  @|  "$  2``2$`,` ,`@CU & `@C'*  &  $& & @C & @C@@E  & & && @& 㿈*##耢 * ' ' '  @Fߚ ?*?#㿘@v ?&& @C  @C @El$  c@$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $ (8J@ `   JJ@`  $OpenBSD: merge.c,v 1.3 1996/09/15 09:31:50 tholo Exp $P''쀦. "`B?'`?'@;P@B  '0?'@*@;>Ԑ'' ?Ā   @;0'̐` ?'ĀԐ  ?Ԑ' ̶Ā   ?Ԑ'̲@@ ? 䀠2@@N@J  2@ '@ %@(@$@4(&'- @@(#%@@;2 @:Ȓ@@4@@%@@@48= "܀" $ $? ,  ,?z܀`" $ $?h ,  ,?Z܀" $  , ܀`" $   ,  ` 'Ā '''Đ ?2Ԁ@ @:$@E'@A}԰ 㿘.@` ?@: @$`&@:@%@  ?@9@$ 4  @9@  ` `` "@"@  @, *@`$ S+& 2" &@"@& @, *@`"@ * ې&$& @, *@`"@ * $   &@"@ ?"`? 㿘$@ $ , *$@@8$@㿘@㿘@@j *c "c" " "  *#*""?㿘`*`*#@  @   2  )  @2   @" :   @C=  & &  $ @ "  @$@@@A㿘  @&   25 &        @+  &   @2 "   " $   &  "   2   2  $Ą  c@㿐@Œ @   ``  @. "` @7y" 6  `26 !6 6 &  "& $ #& , #T& ( #& $y  c@㿘  ɔ@C 㿘@ " ??& `& @㿘  @7㿘-!Ѐ 2& @7x&  2S? 2 0  . "`G?"  @7 2@? ?6 & &   6 ` @@"& 0@?_ & 0 < &  8&&  2 @6b @@^!  & $  &  ?Ȑ*@6  `4  `2&    @6  Jrrwa .  .      & "   J+b  J+    "@㿘V 2 . "`,?  @6 `" @  &? " 0@>  0` @@"& 0@>א & 0 D "6 @>& D6 & & 㿘!ɀ@8 .n6@t@ n6@@  n6@C@ . "` ?ʄ " " " " " " %$sniglet^&8`  . "`@!ܢ?$a$a  d .@.  .  .` ""`  @#?$a. a @ e   @J.Y 2$a Y!$a a@@r!?!.l 2j O@!a@2d O`?  a !8€ `@ "`U O`(@8%@$a@ 2U ` * ` * D` :$aa8 @A* `"@0@@ %$a0  a @ $a4?$a$@=͐ $2& !. @ِ#$ ː p& ̐"& ː & ̐!& ̐"& ͐!& ̐ L&   &`@@5a@=ΐ."  㿘?@ @= " ? ?.  ?8 $ 8 $ $  $ !$  $ $ @$ 4Y!$!  D @A  Ē @A @` @B 8 @ g$ $ - " @ ]$  *@@@$  2$ 4 2$!  2` ဢ@ d". "`  $ @@?㿘@7N 4  & @ ' * *``" D" H&  & $*` `@KP ?& 0& (.`?& ,! 2  & <  @7% @   *@ @4& @㿘  @ A!4 . !؀ !?&!!ؑ* @@=!??&!@<!@F `  .   !8  @<!, !?@?B@<ې`. " ?㿘`. "`? "? !4  @   2 ?@  2?&!0 㿘!4 :!a& & ! ʐ!8€ & @!  @? ?"$?@>!?!. O"`&!,? , !8` , Ė @J  2?  ,  㿘  @@ . "`#!,?㿘 . ! . "`#!,?  @ 㿘 .     @  . "`",?㿐 @ @ L ?K ` -``  @B`   $ 2   @ ?`  `2  ․@@M(2i `'@M?*` ē*`2`@  W   `` @H G `K ?`'` ``207 ` ?-`> ,`   @M) " ,` & " !&@FC 2 `@Gޖ  ` ?@F3  ?0 @< ` ?-`? ` ?-` 㿘   . "`$!,?!$  $!$ $!($!   ! 2! !$ @} "z?$!  2 $!$ $!( ($!$ (?$!$f  !(*    2*` @X $! $!(     $! !$ $!$"!  "! !*+`     @Mn  2 0?! +`2* ` &@  ? " &`! +`2 ` & " &`* 2  (+`$! !$ $!$ 2 $!( 㿘 ( & ( 0  4!& (   *!ؒ@2*  ,`&  @ג !ؓ,  " "?! &!! &! (@  **`@`D" D&  ,(& 0& ,@E㿘@:a @> @>&@:~$㿘! € ,  ( 0㿘 @   &! .@@   !. C$ ?6 !ؓ* ** " ! &! @, <'`'d'h 'l'p't'x'| ?"@.l  .t 'lt  | @'tx | 'x| "'|| @'t'd'`'| 'l 'x'p| ဢ@dT.@9Ð"$U @=g"$?$a|$a$at$ax$a$b@9 $C$` @=U $a"&b  $b && Ӑ!x& ؐ#`& А#& А#& א!& #P& Ӑ"\& ` .  "b   . $b @ [ $aaА` .@X?$ab  $b aВ @ ?`a@40 `Ȁ 2à rpaВ@;  ހ .L!b@b ?@$b  $b '\_/^/]/\/'X[/Z/Y/X/'TW/V/U/T/'PS/R/Q/P/'LO/N/M/L/'HK/J/I/H/L!b@.  O?"@._2|.'pb  $b $a$b `؀!'p"'pp@ 8'p` 2$ab  $b $a$bb  $b p$ad` p? `*  'dp* @d *'ddaز@2-?@2(l?4aܑ* 2   4aܐ aa@+$@b  ђ`Ҕ@ @3?b  $b  b  $b @b  $b . . O"`` ` "a@8aЀ?@:@8 㿐 @ , . 2+?." @ђ"#?@˒ 2?$$ $  4 !4  $  @;!@  @ 0?TMPDIR%s/bt.XXXXXX/tmp㻐@: @8"xЖ" $@[?' @;)@j? @ @; @#d d$  #㿘  `"" @4 & " .!А "`?㿈  `@ $ . "`'?@}? 2#\@@    @0!Ȱ" @"@@@ 0$ P" `2@0'....'....'.. . .  '. . ..7..7..?2   J *  *`2 *2  7* *    '. ***'**** '****'***** 2  ‘*0f  b*` _ *`2 *2  7* *    '. ***'**** `1`'****'****`'****'***** 2  *P" `2@0?2   N *  *`2 *2    '. ***'**** '****'*****2  7* * * 2  *l  2g*` b *`2 *2    '. ***'**** `1`'****'****`'****'*****2  7* * * 2  *'....'....'.. . .  '. . ..7..7..#t w* v*  u*  t*  #p s*  r*  q*  p*  #l o*  n* m* l*  #h k* j* i*  h*  #d g*  f*  e*  d*  #` c*  b*  a*  `* #㿘 ``@@ $`@. ?")?@@?2`"? "a@5k$` $`a "a@5c$a$aaȀ "a@5[$a$aa@5V@5T@7` 㿘  ``@} $ `. "`?"   " @? ?@" ?$" 㿀 @ L!b' '!'!'"'" '@9i @@  ?$   c@$\  c@$OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @`  ?  2  @'P'T'X`"7''''@\P*@?㿐@! ?㿘 @ ` 㿘 @  ` 㿘8`. "`@6L 2  ?@  0,?@.y L X`L X`?#@ @ 4``G`A,?L X` `  /%<'+. L /2?,@ I, `B%`8L`*@! &@5 ,. , " @! "$ .@ .  `? a[L  z2,   Ԑ a  , /dev/arandomx@ƒ Ԑ#@ @6 x@6Mx?.  .   @@ؒ .   *` * 㿘-!䀢 + x  * ``$ **- "a+ x㿘-!䀢 2++`x `x?*`x  ,   @@,   *` * 㿘-!䀢 ++xx(x   *  *  * @ `@ `+`x(x   *  *  * @ `@ `* @x(x   *  *  * @ `@ `* @x(x   *  *  * @ `@ `@  (  `? ` `:2Մp(WXXWWWWW*  *  *  *  *  *  *  * ؐ  㿘   "   "   ?@ 6@!ؑ* @-  ?  !0    2@$  `?@?  - $  "` "@!& !&$! "㿘 a a  "@2O " @2J` & @2n a x?v$a "` "@ 2   "j&  @ *  ?    @? 2f   " `? `2@aؓ*` a0  ** * " *"  5 $   2/&  2+&  @ *  ?      @? 2' $ ,  "` "@a $ a$a"  "  2$ & & &.  . a& a&$a " @ :@`! "!  㿘! 2!5 !"1 !   `    @?Q 2?`"   @5( @1  "` "@@1!2  "`"` *`@` `@ !"`!"@! ` h ``"b @@ $`b . "`(  . `  . "`?`a܀ 8 (`@ Ԁ?' '@5 ܒ`@5  ` a܀ @ ڔԀ?֐' '@5 @5  ` a܀ А2 a@`@  "?(`  @Ц2 @ Ц? Ѐ @@3  Ѐ "b "@V?2 @@ ?`@ ?  "    #\@ b0l ?* 2 *` " `@5*  6 -`@ "6 2`  `&  $ , @@5``@4`(@  2 a`@2a`  4`a䀢 2@  2  ?2 ?@2@ $a 4a쀢 2 @2@ $a4a$a@@   2b @@ b  $b  㿘!@  2& G&!!6 `  ?  "@  @*5&!!䀢    2-&! 2 ?@2&&!@ " &&!  6 6!6!  2&! 2&!@  4&!6!쀠 `?& @ H  㿐  `"" @ < $ " .G " (?.@4> 6  "< @  .' ?2   @.  2)? @; `?2  2  2 @  ?@ `? . "`? "  $" 㿐@@  @ G " @@" ,` [@ ˔  !?&! "9@  "  `?2 ?@2 @   !@"@!2 ! &!2  @`!"!2 ! &!@  @  % ,@  @ ߔ " @@2`@@l@ m @Ԕ 2k @@"\ ,` V@ W  !?&! "4@  "K   2 @ < ?!@"@2  @`@ , @  ", `?2 ?!"!2 ! &!,@  @ p " @@2`@  @ ` &@`?㿐 @^@?   @  u`?@  2[" " `?2  2 @a \ Z?@ Ŕ U `?2 @  @ o א `?2 @"  ?#@`4 ?#@ X @ ?"  "  @`4 `?2  @   @ ~ ?@ y  ?@ }?㿘?# ,!@&! "s@@  "? , @  @  ?"g`?2  2@   4`!4` H$` @ 2d?@  Ɛ ,\? `@  @2I$ `4`*` `` ?# 2 *   `?2 "?*     *2*  `?4`@  @   @   @  ?@5 2  @   㿘 (@  . @.  .@q 2l?.   @ J ?"^?`  @` @ ?@ ?2`Q?`@@`   @1$ 6. .  ?#@ 2@` *   ?2 "?*  " ` *2@*  `?6 (@  2   @2  ?6  㿈  ( . ("  `'7  #\  @g 2 `'7@ܔ 2 ` W,`?2 ?'7@Ȕ  ` C,`2`"@ c %' ?2 ?7@ 2 `" @  ?2 ?2('`"$'@ @ 2'/?7@ 2 ` ,`@ ʔ $@4` @  '7` #\  @  ` ,` 㿘``"`@  "?`"`@  ``" @ 2`?"`@   $  c@$  c@$  c@$  c@$t  c@x^7@  @ @`"?ޑ* `"@4`2 `" @ $@ `/@`'@`'@`/@`@0M@@0H@  ,"  @ ?@  N@/?"Y ,!@&! :@Z "E  7  " " 0< 8 : 06 4 ? ?! ,  2)`` 2 ހ (!` ? ? '` '' '!€ ?:  @,``"  :`@  @] @`Ԩ  ?ޑ* 2 *`@ " `@/*` 4`   "  0 > _0*`"4`2* 2 @@/r* `"@ 4`2 *`2`@ $@ '@`'@`  /@` @/a  T@ ?"{N ހ * @  @   `@@'@'`ޓ*`@`$4`2`, 4 @@%$@ * @  @   `@ ?2 '@'`ޕ*`"@ 4`2*`2`@ ?2 $@ '`@+M "@ 2" @?@?@˔ @ǔ  ,@ @  @ @ @ @  ?㿐@z^ $@ 4`4``$`@$`` $` ` `?2 @ @&` 4`7&?&@*ؠ2@@t 4 $@$ `$  4 4 ` $ ``@ 2@@*" & @S @Ú@.l؀"@* &&㿐@@ $@$$`@$ $ $` 4 4`!4 4`` $ $` @&&㿘!ڐ?6`6``@ ?2 @$$ `?6`6``@ ?2 @$$  6`` ? &` @  㿘!ڐ?6`6``@&@ $, `  % 4   `" 6`6``@  &@  $ ,  @-  @< ?  ?  `" 6`6``@ @-” $ @) 6`` ? &` @  p'' ڐ* 2   `?2 * 2 t *`2 ''ԑ/`2 '- 2 @2` 6  ",  ,0*  ,0$2  @ @2  @ @   ?  ,2  @   2  @@  ? @)- 2 @-2 ܀ :%?- 2 @ *  "@6 2  @-:* 2 Ԁ    - ,2 䀢  - 2   @6  ( @@-   2,2 @:"""2- 2 8 "7,2`/`2 @N /`2 ,2 `    ",  ,0&  ,0 2  @ @2  @ @    ?,2  @  2  @@  ?@(- 2`@"62`@,, 4   - 2 @/`2 6`6㿘@Ӕ " ?`  "` @h   `0(0 *0(0 @(0 (㿈  `"@@ $ ` #*`@ ( @@&. "`? @@h#\!@<!Ȱ" @@ 0$ 㿐`f *`@, ,, , . . "`L?@F @2 ">?`?2  "` 2 &@`@ @ )6`@ &  @ "?`?2  "` 2&@`? ?@ @ @ `?2 ?6` 㿐 (    @WS@ D "# D&@  "  ` *`2`?2 @25&@ @b @ ! %&@ "    , &@ 6``2 @E 2 @ 2??2 ?&@6` 㿐@"}  "Y " q' '@  @ ' ' 7  2&  +@@ @Y 2$@2C? @ =??2 4  ?4 @ "@@є & ?2 @2 @ `2 @ 24 ?$& & 㿘  " (@&l& &  ( . (& 6  ( . (㿘 ,&!   @ 2& k ?2 *   ,`2 6 @.   "A!&Q,` ,`2   ," 2%&, ,  @Z 21 ,2`?2 @2&  @# 2 &6  ,  2?!"@!2 ! &!, 2   @! 㿐`@z ' 7@Ĕ @   @ & &  & 㿐`@V '  ?2 ?7@ @ߔ   @ٔ & &  & 㿘\@`*   7 `  ` @ 2m?( 2@" @"@@@ @%D  @%@ "R?&@&` @)@@&&` & "A ` @` @  @` 3?/@ 2`" @#` `@(@@ 2`@%   @%M` 2'@?` '`@` @@ @)}``' @' @ @' 㿐    1    *     2   *       ''` !@A!̀ "!?'!€ `8@  "2  ` `` @@    2 ``@㿐@( `@( & :! @$d  @$ &#?'!ظ?@ 8@(Δ@ " '@' 㿐!ب? @` @h&?&@&`&`&` 6`6``@(` @$`@t @&ۢ@g  㿐@( `@( @ 2` ? "!@L  ?`'@ @ "' 㿘"`!"`@&!@+ 㿘!Ԁ` @ "!&@ $!@B8@ & <  . "`  @$( && * "`"` &$  &$&$&$"$"$ "$$mpool_new: page allocation overflow. 㿘$?Z#@Ò`@$3@ 2$%  &$"&@ *? *  ""` 2@"`" "@" " 2 &" & 㿘$@ .l @SF? *   2""` 2""@$$ 2"" "2 &  "`  2 &"`$ $ 2 &" &   L,@@$ $@% 2< @29 $@%,$$@`. O"`* $ ,? *  $$ 2"" "$ $ 2 &" & $"$$   * 㿘`2` &   "` ` 2`&  "`@" 2@" 㿘   @d?2  ? 2 @$` 㿘$$ @*A$"=$  25  @A?"<  ? *   2 " "`  2 ""@ 2  $  "`  2  $ "`2 $@"  & $ $$ 㿘$ "$$$``$@` $@% 2?@2?$`@$,$$ ?` .` ("    2  $_  c@$OpenBSD: calloc.c,v 1.3 1996/08/20 17:42:33 downsj Exp $㿘@}@! @%W㿘'L'P'T'X@hL$OpenBSD: vfprintf.c,v 1.7 1997/07/25 20:30:12 mickey Exp $㿘` @ &`&`&` @ ?7 7 ' ,'̐''$'''@0@ 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼀@''    2  @* . "`.?   V   ' '''''@ϔ  %@@ $$@'  'e ' ڲ` ' ?/'N@``X #*`@ @HHHHHHHHH t@x@LO' 2N@ /'`  *  : * ?Г*`:`  L?Ѐ , L $2 '@``- @ `- @ 6_N@ [` +X/'N@*;`  *  : * ?Г*`:`  L?Ѐ , L $2 '@`- @ `- @  ? * ?РN@`Ѐ (, $   ?` , * ?РN@Ѐ `$2 '@۔N@``@N@ l2``` @`- @ *``  `''`@ `- @ *  : `- @ :  Z ` -U/'g  G" `- @ ''Ĵ@ޒ Z?  -/'! @ ! a#\#`@8gGe?$ gg E e ef'@q' `  `O`@@ ` O `` $@  O 9 -7/'`  `- @ :`:```@ `- @ 2`- @ "``  `'' `@ `- @  `- @   `- @   !'`q x`- @ !  @ } "@$/'@"#``  `'`'d` `@ `- @  `- @  1 !!`  ''@'D@` `@ `- @  `- @  `   2``"/'`/''  ``W'`1` `70G ` 0,, 4` 4  2`2`<'L 07 04,  `0,   ` `0, `,, 4` 4  2`2'!@!p '?Ħ@/@ /'&O' `2`2O'& . Z$ $ '  ' ? Z$$'  ' O' '$ $  ` 0/8/98$ $ '  ' k ` 2& . Z$ $ '  'ɒ N? Z$$'  ' 8  - Z$ $ '  ' ? Z$$'  ' ae$$@;Z? BT!$ $ '  '^ @`` $ $ '  'D ɤ? w Z$ $ '  '* ? Z$$K `!$ $ '  '   $ $ '  ' {  - Z$ $ '  'ܒ a? Z$$'  'ƒ K$$@' M$$ '  ' 0"@ - Z$ $ '  ' ? Z$$'  'z `!$ $ $@'  '_ !$ $ '  'I Τ$"@$@l' 4 `"M$ /8 ./98$ $ '  '! Z? B3 $$?) ? 2 Z$ $ '  ' }? Z$$ $ '  'ݒ b$$'  'ʒ O`/& , Z$ $ '  ' 4? Z$$'  ' 2 &'耢  '耢 ~ '`@" @)  @?' '   @   N%_  N `XU#*`@hhhh<h888888888xLLPP̒  N * ?L@ `L@?Ѐ *`L@N*2   N * ?L@ `L@?Ѐ *`L@ $ @* 4f`@ * 4[ZNЀ XNЀ  Q * * ?Ж NЀ  $C> <:@86 耤@ܒ* 4"!N 耤@˒ *@ 4N@ *@ 4N@耤@ *@ 4N@* 4N耤@ *@ 4ѦN@~ *@ 4æN 耤@m *@ 4N@] *@ 4N@耤@L *@ 4N@> *@ 4N 耤@, *@ 4qpN@ *@ 4a`N@耤@  *@ 4PON@ *@ 4BAN耤@ *@ 432N耤@ߒ *@ 4$#N 耤@͒ *@ 4N@ *@ 4N@耤@ *@ 4N@ *@ 4N 耤@ *@ 4ҦN@} *@ 4¦N@耤@l *@ 4N@^ *@ 4N2N@* & >!4*"@ /*  x@'`'`@'`'`@'x`'| `@'p`'t``$쀢`@@a 㿘@  * @.&@+@@@l&@* @Ɣ$ &@ 㿀?\`f`  `e`E  Z聩 9/? -/#\@ `g`G`f&`fN 02 @Z聩 B  '@@Z聩 B3'   0`'*@@ `"$`,`   -,   +. ` @ے  0.@֒ ` `0.􀦀.   & 0. `0. &㿘``"    2 @@ . "`@ ``" d$ ,$@`" &` P ``" " @*@ "& &- @@ @ٔ&@R 2  @  , $s  @ "& &$@`" &`a  ` ` ``@ @ݔ"@` @    @ @&@ 2-    , $    @k "& &2@ސ   $@`" &`   @6 ?;`` @  ?@2 d2 #;`` ( d`?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: memchr.c,v 1.2 1996/08/19 08:34:04 tholo Exp $"  `  ?2  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2" "@ `2 *@ `0* @  "2 2  "? *@2" ?"@? *@$OpenBSD: strtod.c,v 1.9 1997/03/25 17:07:30 rahnds Exp $㿘+!,`@   "@ ,, @ & & & &   + ህ(" ( 㿘   ?# @ /@4 @ )4` 2 *  @$ &-    *  @ǐ- "  & 㿘 @_   *`  "` "``   N   ж       В&N ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘 "  " 㿐 `@6  `  `  .: % *% , `,`@'@E ?#@  @@ @  44`@ 74  4 44 $@  @ ! 444@  @   4 $`@  . 2' ' 㿘` Zap*  >``$!+!Ȁ``j"q$!Ȣ$@`" >`i>`` @ 2Z$@"㿘>` @   *  ]  "   * `@ " @* "@`@ 2  " @"`@ ?$H`(`@" ?8 㿘     D       +``* @ ?# @ "@@ : 22"  ` :`33 @  ?# @  : 2`@  :`33   ?? " ;hh?0 $ #`#d:  4?8#` #d #`   ( #d`#㿐  * @?# " &@ " 4 ' ?,  " 2 ?,  "@ 3 @  ' ?+  " 4@'''㿈?\  ?*@' *@2  '' '씒  "@ *  $@2 '$@$`   &  ڐ$@ &    ΐ͐& 5"  &&.`?.`"@&㿀p?l?"@ `" * * '*" '?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC`@ '  ''' [a    [!   2L - + '2LL "8L 0  L 0"L *    ``,*   ?4`+  *  ?Т`L/뀢9*: E`=L0ϦL0`π 6e  )`    `,* `4+  *   `,*   ` +  *   LЀ (ӖЀe EG``2 `2"L+ -І LЀ ,0ϦL0"π  *` *  ?ЦL/9$ "@" 2 ` `2 %@`w܀u`s`` '?ZaB?  - @D?' ZaBD?`1 @ 3 2-$@`A`  -`@"@$@%@ `* D?-` D$?  *`@?$@ G  *@D??!4$ < . ""`[!ho? y  ! * D?<  ?, '!*@D? @(8.$(#'N? K' I   *@??;<  &  ! * D?<  ?!* BZaF?D? DF?''. ""` 0B?' ')#;Z  *  @_ `      쀢 &$@@?d3 6"@ @ 44& $@ $   o  ے`U % 6   % 02  @?  @ ''   ?@@'?' р LdZa B9?0 Za@  /?Ȁ Za?f X* TDl|dtt* $&tt2  &t% X% X&`d&`d& p& p%`%`%h %h %`l%`l X% XӐ!% X`2L@a- l - "`p!-#\   @??$ <!(!-@ /2 ?$ 4-$"`@-`0 "`0[bt 2*  "bt[bt* "bt!-@ $ x." 㿘 /0- D * `""`"@  """2 6 4 - 4"- <* "  @ - <  * `@ "- p  @. ` -`x "`x@㿘 (  ?>  2`- <,`@ p-d 2 2 *   *,   @ @P  *3 3 23 3 #  `  ?2*  "  #@ 2 6  2*  (  @  "  26   +@2* +@*@" ?3  ?3 $ 6 - 4"@- <*`" ,` #"   -:  <,`@    "   *`@  @" ?6 *   - <,`" &": *  ,- p   @&  allocation failed. 㿘- 0 - \ @,  (+Ӑ- X  2-3!- l   @malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘- \ @- 0 4` `!- 4"@` X"- 8@Q"@-*` <@@ 2oD"h !  - d 7@50@20? (* ?@$" o 2@2`*  ` 2 " * - d 2`@ 2`@ 0" 0" @,@page is already free. freelist is destroyed. 㿘 c- 0 -z!0Z \ W6 - 4" m"0M- 8e"@0E- <*@ Ҙ  W 07 Q"01/K"h0+- <+  "  *   - <  * "@ * @  - p *  @Ŕ!- x  $ x- x"`"` "`-D D"@"`"D P# x- D "  *  -x" " $  "@6"x 2 @$  @$ "* @2%  $   $  $" 2 @$ $   -`x"" $"`x  1%[ t@*#- `t@&@ `t@  t $ $ @  $`t 2 - 4#-?  " 8- <`8* "p0l/ 4@ ?"0c4`*  ` 2 w"0W- p  @  4`* ` *  "  4 - *`<* 2    " " ` ` @ 2$""  @2" 2 -`4" -`<*  "  in malloc():recursive call. out of memory. 㿘-b" |!-    $ " ?$  |-`?"`- h  Ɛ"؁ in free():㿘-c" |!-    $ ؐ" ?$ O-`?"` in realloc():㿘-c" |!-    $ " ?$  1-`?"`- h  w"؁$OpenBSD: getenv.c,v 1.3 1996/08/19 08:33:31 tholo Exp $㿘L   J@ =-`J@ `-#  '-@ϔ 2 @L@ =2 $: &@   㿐͒$OpenBSD: abort.c,v 1.5 1997/06/22 20:21:25 tholo Exp $㿐?' ?' @^ [  - ` @"@@  @6  @F @@z @Ґ 㿘T @`>  P@ B < P ?Đ*@4 㿘 !" V   @  ?Đ*@6 V @'㿘V  @ ?2  2  ?Đ*@6  6 >P㿘@VV 㿘Z# ? T` "??`X2x ?`'  x*`@(())0)D) )t)))))))** *4*H*X*h*x****)L)` ' ' @耢 ? d 'g  ' w'  ' p' ' k' 'R  ' b' ' ]' ' X' ' S' ' N' ' I' ' D' '@' ' ;' ' 6' '  '  '  '  '   '   '  ' ' ܖؘ @ ? ܀ ?. "` ? ܖؘ @ٚ ??܁x''. ? '. "`? *@ @ @ ` '@؀ ?؁$  c@$.  c@$:  c@$  c@$I  c@$%  c@$6  c@$  c@$„  c@$  c@$  c@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿈'XX#\#`#d#h  Ŕ@d㿐#\  ǔ@Y  $OpenBSD: sigprocmask.S,v 1.2 1996/08/19 08:18:13 tholo Exp $@2@  0  c@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $[c@4   :\ c@ `X$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J  J@`J 2J $OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $($OpenBSD: exit.c,v 1.2 1996/08/19 08:33:30 tholo Exp $㿘-#`-`?, @,  ?, @`2`- @/usr/bin:/bin:/usr/sbin:/sbin㿘 @uh  a.`2].     "  bp@w L    D "?  ?`6 #*`@33344 444@4$4040404040404040484@#?###    (","  ". "`?$  c@$ʄ  c@$Ƅ  c@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $\X   :  c@"X$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $. `??8"X? &R?  DȦ ݑ, F?5" ƀ    ?ǐ `$@ ,` 4` ,`  应  .  &?  Ȧ ,ˑ. "?  n&@㿘@ ɒ`rf&Ѱ  ?.''''''' ' !ؐ  ! J  "  "&  & . ``& i& &`G9.'   L ?2#` ` 2``2q.  & [`Ȁ h&  @"& #!&  T.  & ߒx M. ܐ ؐ !& #&  @&  8& "&  H&  & #&  ֧ &.`  2  "`   4"  )€??.0. "`.  \`.A."  㿘  `""  & " (." "`?㿘  `" $ `7 ܓ*`@===8===h===@@ %.(" ( #  $    ( " "  $?2"I " )2"!€??>?". "`7?" " )2 "!€2&" ـ8  ?@[  ( , ($ $@" @"@@ր $ 㿘  `p $ .@ 2". "`-?" )"!$ €2?@ ?  @" @"@@; $ 㿐!" !Ȁ ɐ   " &!D?"&!!'"'"3"!!`? "`*!!" ?2,@?2,@"?@  Φ?آ`*"*"  !&"  㿐"O"!!!`? "`!!" @!'!Ȑ$' (@ p  ,?2,!ʠ$!̒!&!!Ȁ !@  !̀ &!ȑ, 2 !Ƞ , *!Ȁ*"  !&"  㿐!" !Ȁ   Z" &!3?!&" / "&!!'"'""@"" :" " !Ȁ *@ `  "@  Ԣ`@ 〤&" 㿐"" "@$" " !&"   ' " * $'@ ז `?@  &" 㿘  ` $ " (".@`"."@ @$ ." 2 $ @ $?$ $ "` ? "  @$" 㿘@ 2?@Ի  Զ 㿘. @   E ?2@E?@  `@  $ `6`.`: ?*  ` ?#@ 2@` *   `? ? @" : ?*  "` ` *2@*  ``?6`"?&" 㿘` `S $ @$ ?"?" $ "B"` " ( @! d" 2?u?"?p  `` $ $ ` 2"  ~  "" v !2 "!€??"l?"   2d?`2a? $ 'ܐ'" " ؔ  4?"䀢 G ؔ  """?"' ' ؔ ''"Ք ` ' ؔ  "?$ $"  c  "?  "  ?" *@$"  ?㿘'L!Ā ! /  s  "K?&! &!!L  &!& "= @`*    `  ` !ѓ!̀ 2+?'!" @ @ !̀@!Ȁ 2@  ;` 2&!?@ &!!Ȓ`m@@' !' `' 㿘 ,&!  Җ L. &@& 6 q  ?* 2 *2   * 2     8!!"!2`! &!  ̒*2   ?*2    "     )  ,!?&! `.@6 `*    ?*     "  ҿ !."  㿘,  `$@,`2 @` , 2 6$@,`2  , 2 66, 4 ,  , $@2 2 㿘`.  @G.? . "@ # *  ` *2 @# ` 2. 2`@2`@2.,*  @4 @`@ 24 8?& 8` .` 㿀  #    2 x?-.3 @q3`  .   -g .   - '  @   ߧ,@ '% 'E,%+  ` , 2 @@  % .``$6 @2`, `@@' " ', ,"6* 2 * @ * %2`* 2   ?.   ?- p* 2       #\@ 2?܀؀  ),`2 @  2#  `" 4* 2 *  * '2* 2 W Y   @\  ] ,`2   (W,`  ' %@ ' '  " ' 2  @`*  @ @ǒ";?j .  @`*  @ @2?M .`* 2  ,`,`2  *W @ 㿘`  5 *` 8.  & *  @ *     Y *`@  "R?``2 ( @`*   @8 `@;"6?` @`*   @ Д `@; 2?` .` 8   & 8 (8` 4 $  a@ 㿘 4@@ `2  & 4 & 4` .`@r,`2 `<  &` ` ` *`*@`2`*  ?2`2`2`4`㿐!?N K < Đ*  @6  *@  <*@  *  @ :@     ?"U??  . O"`F?2`2   2  6@ ?6` 66` ဢ@1`  :  + *@ '.@ @*`*` *` 7**    * 7* @  *` 㿐!? @ѐ 2q?  ဢ@+!   :  $*@ '.@ @*`*` *`@ *@ 7.@ @ *` < *  @6  *@  <*@  *  @ :@     ?"? ?.  O"`?㿘 !! &!<  ,  Z  T"?* $ $.2 đ."!8      (HASH: Out of overflow pages. Increase page size 㿘` -  D?``=@ ?` * ? `$: 2. !8@H2` * ? ` * ?`$  :  ? ?j*`` *` ӑ. - `D$`$`D "`D `@$'$`   $ $`  `a 1 -  @" D @" @ ` * ?2%`` - @ J i - @`D  '""`D  Ր $` -  @" D @" @ : *   ?$ *@ @$ :- C  : *    $  *   $ ` 鋓*` `$?$`$  .  D  .  . @ @$'4 . . 6  㿘` '2 *  @@ $@&& $  :@ * ? @*!8 @d   : *    ?$ *@ * " 㿐?' !\ΐ"?&!"!   } !8@?㿘,```%4, 2 @`$6, 4 64`4`*`` $2* 2 㿘!@6  .`@ "a8.`.`!8Ė  <  .`!8&!8  ?*@   *  2@*@ 㿘`e*2 4*  $@,`2 , 4 N%@*44*2`@* $@2`* 2 * 4 x`/*  %4*  "*4* 2 .4 %@ 4*`@`"2`* 2 * 2?`` .`*  `?F*2 @4*2  "*  $, 2 ,`4`ٔ*44*2`@* $2`* 2 * 4 :2`?* 4 ` .`*   ? 㿘 ` ?* 2  (   *    2*  ?` .`W `@`` 2+  ?  22`$$?$?2+ 2  *` " 2*`@  ?2`  `,0+ 8?& 8 㿘`. $* 2 ( . @  ", @ 2 ', 2 &. @` "?` " * 2 ܰ , 2 2 ?. @Ȓ ?㿘@   `*`    2&@*`@  "  &@   㿘`.   .*`@  "w?`  .   2*`@  ``B * @  2 "n 0,`G?*  &" 9& 2 &! !$ &!$ .&!(*`@ N (&!  &!(!   2! !$ &!$&! ,`2@?&  .,`! [2!&  "`?㿘`  "@  /`!  D&!2 &!( 2&! !$ (&!$*`@ -&! !   2` !$ &!$&! *`@ $?`  .! `  "`?㿘 @ ?&!& ?㿘`` " ``?* 2  ! xM .&!  "` $?@*`@ И$?`  .!``  "`?㿈'P\ 2d?@ P4 * 2 ` PR $ L?$ ` ` *`"``/`  `*`2 6`*`2 66*`2`@2`* 2 $$ P` ` *` *   6* 2 2 * 2 P ?6P`"$ $ 㿈  `""  & " ""*" "%8Z.!̀ !Ȁ 쌐  " L&!"&!!!" "!" !'"' 3'!L.@qqxqqqqqqqqq ( .! $@2"  @."@ ." Z . "`U?"<" )2 "!€?"F?" ," ""'" '"'""'" (" @( 2#?"`" "%@ 2 "& $"  &"   x! ǥ䀢?/' '''  "@     ""@b?2   L?`   " ` ,`2 #\ 25 " &"0  ?,`2`* 2 *` " `*  4 ,`2`@ "4 2`  $  * " &""  &"   $OpenBSD: crt0.c,v 1.2 1997/06/24 17:15:53 tholo Exp $s.8.@.08x.(=. =.D.X.p-0-"p-P-8-8-H- -P-----@-x -p-h-`@-P`-@$-0)- A-EH-Q`-@-@,ވ,ވ,ވ, , , , , , (, !h, e, , , , , ň,x ѐ*X+L@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.8 1997/06/18 18:37:56 kstailey Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.6 1997/06/28 14:45:43 grr Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. >@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.10 1997/09/20 17:34:34 millert Exp $HD$OpenBSD: utils.c,v 1.9 1997/09/01 18:29:19 deraadt Exp $$OpenBSD: args.c,v 1.6 1997/02/14 07:05:18 millert Exp $$OpenBSD: conv.c,v 1.5 1997/02/14 07:05:19 millert Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.6 1997/08/25 15:24:07 deraadt Exp $$OpenBSD: misc.c,v 1.7 1997/09/12 04:33:24 millert Exp $$OpenBSD: position.c,v 1.3 1997/02/14 07:05:22 millert Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.19 1997/09/01 18:29:24 deraadt Exp $@A/@A΄BmeC Ck&4@$@Y@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.46 1997/10/24 00:18:55 millert Exp $xph`XPPH8( xph`X/tmp/EdDk.aXXXXXXXXXXA$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: editor.c,v 1.24 1997/10/24 02:49:55 millert Exp $XPH@80( װרנטXא׈׀xph`((((((( (((((`AA?DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--rr] [--nn] _d_i_s_k ddiisskkllaabbeell --ww [--rr] [--nn] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--rr] [--nn] _d_i_s_k ddiisskkllaabbeell --EE [--rr] [--nn] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN DDiisskkllaabbeell can be used to install, examine or modify the label on a disk drive or pack. When writing the label, it can be used to change the drive identification, the disk partitions on the drive, or to replace a damaged label. On some systems, ddiisskkllaabbeell can be used to install boot- strap code as well. There are several forms of the command that read (display), install or edit the label on a disk. Each form has an addi- tional option, --rr, which causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk with- out kernel support for a label, such as when labels are first installed on a system; it must be used when first installing a label on a disk. The specific effect of --rr is described under each command. The read and install forms also support the --BB option to install bootstrap code. These variants are described later. In all cases you can specify --nn to operate in no change mode to avoid committing any permanent changes. The first form of the command (read) is used to examine the label on the named disk drive (e.g. sd0 or /dev/rsd0c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. If the --rr flag is given, the label from the raw disk will be displayed rather than the in-core label. The second form of the command, with the --ww flag, is used to write a standard label on the designated drive. The required arguments to ddiisskkllaabbeell are the drive to be labelled (e.g. sd0), and the drive type as described in the disktab(5) file. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab entries describing each, or to edit the label after installation as described below. The optional argument is a pack identification string, up to 16 characters long. The pack id must be quoted if it con- tains blanks. If the --rr flag is given, the disk sectors containing the label and bootstrap will be written directly. A side-effect of this is that any existing bootstrap code will be overwritten and the disk ren- dered unbootable. If --rr is not specified, the existing label will be up- dated via the in-core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In ei- ther case, the kernel's in-core label is replaced. An existing disk label may be edited by using the --ee flag. The label is read from the in-core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an edi- tor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. With the --RR flag, ddiisskkllaabbeell is capable of restoring a disk label that was formatted in a prior operation and saved in an ascii file. The prototype file used to create the label should be in the same format as that pro- duced when reading or editing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The --NNWW flags for ddiisskkllaabbeell explicitly disallow and allow, respectively, writing of the pack label area on the selected disk. The --EE flag to ddiisskkllaabbeell will drop you into a simple initial label edi- tor. This mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some command or prompts take an optional unit. Available units are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, cylinder when units are specified for sizes (or offsets). Commands may be aborted by entering ^D (Control-D). Entering ^D at the main The editor commands are as follows: ? Display help message with all available commands. There is (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Undo will reset the disklabel to the state before the last command that modified it. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: bytes/sector, sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders, total sectors on the disk, rpm, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allow to modify. This option is probably only useful ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter '*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for large disks where the fdisk partition table is incapable if storing the real size. a [part] Add new partition. This option adds a new BSD partition. If no partion letter is specified (a-p), the user will be prompt- ed for one. c [part] Change the size of an existing partition. If no parition is specified, the user will be prompted for one. The new size may be in terms the aforementioned units and may also be pre- fixed with d [part] Delete an existing partition. If no parition is specified, the user will be prompted for one. m [part] Modify parameters for an existing partition. If no parition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, parition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). s [path] Save the label to a file in ascii format (suitable for loading via the [-R] option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the label to the on-disk label. q Quit the editor. If any changes have been made the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. The final three forms of ddiisskkllaabbeell are used to install boostrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. The --BB option is used to denote that bootstrap code is to be installed. The --rr flag is implied by --BB and never needs to be specified. The name of the boot program(s) to be installed can be selected in a variety of ways. First, the names can be specified explicitly via the --bb and --ss flags. On machines with only a single level of boot program, --bb is the name of that program. For machines with a two-level bootstrap, --bb indicates the pri- mary boot program and --ss the secondary boot program. If the names are not explicitly given, standard boot programs will be used. The boot pro- grams are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the -r flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the -r flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. SSEEEE AALLSSOO disktab(5), disklabel(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the ``a'' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the ``a'' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the ``a'' partition on the tahoe, the ``c'' partition on all others. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also in --EE mode, partitions outside the OpenBSD portion of the disk should be changable. 4.2 Berkeley Distribution October 27, 1997 4 $OpenBSD: buf.c,v 1.6 1996/10/12 19:38:28 millert Exp $ޘ$OpenBSD: cbc.c,v 1.5 1997/06/18 19:22:35 kstailey Exp $@ $OpenBSD: glbl.c,v 1.6 1997/09/01 18:29:28 deraadt Exp $$OpenBSD: io.c,v 1.7 1997/02/01 12:03:07 tholo Exp $Y$OpenBSD: main.c,v 1.13 1997/09/12 04:35:18 millert Exp $ZZH$OpenBSD: re.c,v 1.5 1996/12/14 12:17:57 mickey Exp $$OpenBSD: sub.c,v 1.6 1997/09/01 18:29:31 deraadt Exp $$OpenBSD: undo.c,v 1.4 1996/10/12 19:38:43 millert Exp $$OpenBSD: dir.c,v 1.7 1997/10/06 20:22:31 deraadt Exp $X ... ...$OpenBSD: inode.c,v 1.13 1997/10/11 20:19:36 niklas Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.12 1997/10/06 20:22:33 deraadt Exp $$OpenBSD: pass1.c,v 1.6 1997/10/06 20:22:34 deraadt Exp $$OpenBSD: pass1b.c,v 1.3 1996/10/20 08:36:37 tholo Exp $$OpenBSD: pass2.c,v 1.6 1997/10/06 20:22:35 deraadt Exp $$OpenBSD: pass3.c,v 1.2 1996/06/23 14:30:32 deraadt Exp $$OpenBSD: pass4.c,v 1.3 1996/10/20 08:36:39 tholo Exp $$OpenBSD: pass5.c,v 1.5 1997/10/06 20:22:35 deraadt Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.6 1997/10/06 20:22:36 deraadt Exp $[0[([ [[[[ZZZZZZ[[[[[[[[[x[p[0[h[`[X[P[H[@[8\\\\\\\[[[\\[\[\\[8$OpenBSD: utilities.c,v 1.6 1997/10/06 20:22:37 deraadt Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@(((($OpenBSD: cmds.c,v 1.24 1997/09/10 20:55:08 millert Exp $hxp280$OpenBSD: cmdtab.c,v 1.11 1997/09/04 04:37:13 millert Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macroset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retreived filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modeܠĐHP@єh(ԀhԘ|Ը@(И(x pXδh0`ՠtX4PH800(И(X4 ՀphxPְLl `@Ը@hT׈ɀר\(@Hhؘذxxpxh`0XX׌PوոHՀp@8(8xPژܐ((ИHhhxlJPۨP `Hhߘܐ( ܸx p@hX`xXXݠXPݸH@@8ϐ0((H  `R$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.16 1997/09/11 01:55:15 millert Exp $$OpenBSD: ftp.c,v 1.23 1997/09/05 00:02:29 millert Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.36 1997/09/04 04:37:16 millert Exp $$OpenBSD: ruserpass.c,v 1.10 1997/09/05 00:02:30 millert Exp $c0c(cccc b$OpenBSD: util.c,v 1.15 1997/09/15 04:57:54 millert Exp $A.A.A0@$OpenBSD: getopt.c,v 1.3 1997/01/15 23:42:32 millert Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.11 1997/09/20 07:51:39 deraadt Exp $7phX@H@@80( |||p DL7 x@pXX i@i33p i@i33$( i@i33x0iti3X333(3H3833(3H3833(3H383h343@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.11 1997/09/14 10:37:45 deraadt Exp $ƈ(p e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular fileaphP0b u BpHcth@dp (etftxgp\X(htHAtpipdP8jp|kHHlHmtn"txXoHOt8pHP(qtr!pxhs!pP0S!p$ tT@u"tV(w!pp`8x$t(XAtytzphH?|j (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tH290@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $$OpenBSD: stat_flags.c,v 1.2 1996/06/23 14:20:21 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.8 1997/09/18 07:58:41 deraadt Exp $P.$OpenBSD: print.c,v 1.7 1997/09/01 18:29:36 deraadt Exp $$OpenBSD: util.c,v 1.3 1997/09/01 18:29:37 deraadt Exp $@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.6 1997/09/01 18:29:39 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.5 1997/10/04 19:30:16 deraadt Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.18 1997/06/18 09:57:04 deraadt Exp $@ X @ (   @xh `$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.8 1997/08/24 08:07:08 downsj Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.8 1997/08/20 05:34:24 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $  @(#)getmntopts.c 8.3 (Berkeley) 3/29/95@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.4 1997/01/15 23:41:21 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.9 1997/09/28 22:54:29 deraadt Exp $$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.17 1997/09/26 01:49:18 millert Exp $SxShS`SXSPS@S8S0S(S SS S@S @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.10 1997/06/03 22:27:17 grr Exp $>......$OpenBSD: ar_io.c,v 1.17 1997/09/01 18:29:42 deraadt Exp $$OpenBSD: ar_subs.c,v 1.13 1997/09/16 21:20:35 niklas Exp $$OpenBSD: buf_subs.c,v 1.7 1997/09/01 18:29:46 deraadt Exp $ $OpenBSD: cache.c,v 1.6 1997/07/25 18:58:27 mickey Exp $$OpenBSD: cpio.c,v 1.5 1997/07/25 18:58:28 mickey Exp $$OpenBSD: file_subs.c,v 1.13 1997/09/01 18:29:48 deraadt Exp $$OpenBSD: ftree.c,v 1.8 1997/09/01 18:29:49 deraadt Exp $$OpenBSD: gen_subs.c,v 1.8 1997/09/01 18:29:51 deraadt Exp $$OpenBSD: getoldopt.c,v 1.3 1997/09/01 18:29:52 deraadt Exp $$OpenBSD: options.c,v 1.30 1997/09/01 18:29:54 deraadt Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZa-.`2 T3 <{4aLH D T! <{4an$%$(4 T) <{4an$%%$(4(D) <{4`((œ`€¬H`(ϼL4œτ€¬{4$OpenBSD: pat_rep.c,v 1.11 1997/09/01 18:29:56 deraadt Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.11 1997/09/01 18:29:58 deraadt Exp $$OpenBSD: sel_subs.c,v 1.7 1997/08/17 23:05:09 millert Exp $$OpenBSD: tables.c,v 1.9 1997/09/01 18:30:00 deraadt Exp $$OpenBSD: tar.c,v 1.12 1997/09/01 18:30:03 deraadt Exp $$OpenBSD: tty_subs.c,v 1.5 1997/07/25 18:58:39 mickey Exp $ ` l l / Py X H @ 8 0                x p ` X H @ 0 (         x h ` H @ (  h`H@(    _@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.25 1997/08/06 01:45:24 deraadt Exp $8. ;@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: pwd.c,v 1.5 1997/01/15 23:40:24 millert Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.10 1997/09/03 21:18:38 mickey Exp $@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.6 1997/09/01 18:30:26 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.23 1997/07/13 23:12:09 angelos Exp $0123456789abcdef       X 0     x H ( pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD 8                  x p h ` X P H 8 0 (       ! " # $ % & ' ( ) * + , x- h. !{}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. B0 K M$OpenBSD: cchar.c,v 1.7 1997/09/01 18:30:31 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.8 1997/08/24 06:49:30 deraadt Exp $ o@ p o8 p o0 q o( q o sT o q$ o qd o q n q n r n t n rt n t n r n tL n t n r n s4 n sT n s n s n t$OpenBSD: modes.c,v 1.4 1996/12/16 20:04:41 tholo Exp $$OpenBSD: print.c,v 1.6 1997/09/01 18:30:34 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.6 1997/09/01 18:30:35 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.2 1996/06/23 14:21:55 deraadt Exp $$OpenBSD: test.c,v 1.5 1997/09/01 18:30:38 deraadt Exp $$OpenBSD: map.c,v 1.4 1997/07/25 22:13:23 mickey Exp $$OpenBSD: misc.c,v 1.4 1997/07/25 22:13:24 mickey Exp $$OpenBSD: set.c,v 1.2 1996/06/26 05:41:56 deraadt Exp $$OpenBSD: term.c,v 1.4 1997/07/25 22:13:24 mickey Exp $@(#) Copyright (c) 1980, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: tset.c,v 1.4 1997/07/25 22:13:25 mickey Exp $$OpenBSD: wrterm.c,v 1.3 1997/01/17 07:13:45 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.5 1997/01/15 23:41:45 millert Exp $ x 0 Ӡ ӈ Ӏ 8 Ҩ x Ӏ 0 Ѱ xa hc `c Pd @d 8f 0h (l L n N q q r S t T v V 1 Ը9 ԰Z Ԩb  H ( ظ ؈ X  ט ` ֘ p H  8 0 (   8  0 8 0 (  Ӏ Ӏ Ӏ Ӏ       `H"(T"@#           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- H @ 8 0 (    H x p h ` X P               P p h $NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$NetBSD: tputs.c,v 1.5 1995/06/06 08:14:37 pk Exp $5MS7) $NetBSD: tgoto.c,v 1.5 1995/06/05 19:45:54 pk Exp $$NetBSD: termcap.c,v 1.7 1995/06/05 19:45:52 pk Exp $+AAA@$OpenBSD: tcsetpgrp.c,v 1.3 1997/07/25 20:30:15 mickey Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $ `  p ( Ǩ ( 0 p P H$OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.2 1996/08/19 08:32:59 tholo Exp $$OpenBSD: fscanf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $$OpenBSD: fputc.c,v 1.2 1996/08/19 08:32:42 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $ X ` Ԉ 8 @$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: regerror.c,v 1.4 1997/04/28 20:44:59 millert Exp $    h X 8 (      x X H 0  p X H   $OpenBSD: regcomp.c,v 1.5 1997/04/30 05:51:09 tholo Exp $  P H @  H   H   H   H  H H @  H   H   H  x H p P H H 0 H H               x p ` X H @ 0 (                        h! X" H# 8$ (% & ' ( ) * + , - - . . x/ p/ h0 `1 X2 P3 H4 @5 86 07 (8  9 : ; < = > ? @ [ \ x\ `] P^ 8^ (_ _ ` { { | } } ~ $OpenBSD: ns_ntoa.c,v 1.7 1997/08/24 21:25:48 millert Exp $$OpenBSD: ns_addr.c,v 1.4 1997/07/21 20:31:05 deraadt Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.3 1997/07/09 01:08:39 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getservbyname.c,v 1.3 1997/07/09 01:08:34 millert Exp $$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: getnetnamadr.c,v 1.8 1997/08/04 10:34:48 deraadt Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: setlocale.c,v 1.6 1997/07/09 01:08:21 millert Exp $ d d d d d d dCCCCCCC$OpenBSD: morecrypt.c,v 1.8 1997/03/30 20:24:47 deraadt Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: crypt.c,v 1.12 1997/09/10 23:15:43 deraadt Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: ttyname.c,v 1.4 1997/07/09 00:28:25 millert Exp $/dev/$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: setmode.c,v 1.7 1997/07/25 20:30:04 mickey Exp $$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.3 1997/07/09 00:28:23 millert Exp $$OpenBSD: popen.c,v 1.9 1997/09/11 18:51:04 deraadt Exp $$OpenBSD: nlist.c,v 1.21 1997/07/23 21:04:06 kstailey Exp $ $OpenBSD: nice.c,v 1.2 1996/08/19 08:25:05 tholo Exp $$OpenBSD: glob.c,v 1.6 1997/09/01 18:40:33 millert Exp $$OpenBSD: getttyent.c,v 1.4 1997/07/09 00:28:22 millert Exp $$OpenBSD: getpass.c,v 1.5 1997/07/09 00:28:22 millert Exp $$OpenBSD: getmntinfo.c,v 1.2 1996/08/19 08:23:45 tholo Exp $$OpenBSD: getlogin.c,v 1.3 1997/07/09 00:28:21 millert Exp $$OpenBSD: getgrent.c,v 1.7 1997/07/09 00:28:20 millert Exp $$OpenBSD: getbsize.c,v 1.5 1997/08/24 21:25:45 millert Exp $$OpenBSD: fts.c,v 1.14 1997/10/11 04:04:40 millert Exp $$OpenBSD: fstab.c,v 1.6 1997/07/09 00:28:19 millert Exp $$OpenBSD: errx.c,v 1.3 1997/07/25 20:30:02 mickey Exp $$OpenBSD: disklabel.c,v 1.4 1997/07/23 21:04:04 kstailey Exp $    x p h ` X P H @ 8 0 ( ($OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $  8 8$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $  $OpenBSD: sscanf.c,v 1.3 1997/07/25 20:30:12 mickey Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.2 1996/08/19 08:32:47 tholo Exp $$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $   x ` @$OpenBSD: getservent.c,v 1.3 1997/04/05 21:13:09 millert Exp $$OpenBSD: getprotoent.c,v 1.2 1996/08/19 08:28:52 tholo Exp $$OpenBSD: getnetent.c,v 1.7 1997/04/24 08:37:09 tholo Exp $$OpenBSD: gethostnamadr.c,v 1.26 1997/07/09 01:08:26 millert Exp $:$OpenBSD: md5crypt.c,v 1.9 1997/07/23 20:58:27 kstailey Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz I$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.11 1997/07/23 21:04:06 kstailey Exp $ l$OpenBSD: getcwd.c,v 1.4 1997/07/09 00:28:20 millert Exp $$OpenBSD: getcap.c,v 1.11 1997/09/12 08:53:08 deraadt Exp $$OpenBSD: exec.c,v 1.7 1997/09/20 09:46:10 deraadt Exp $$OpenBSD: err.c,v 1.4 1997/07/25 20:30:01 mickey Exp $  h  $OpenBSD: vfscanf.c,v 1.4 1997/07/25 20:30:13 mickey Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.2 1996/08/19 08:32:46 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $ $OpenBSD: res_query.c,v 1.10 1997/07/09 01:08:53 millert Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_debug.c,v 1.8 1997/07/09 01:08:51 millert Exp $ d'B@;$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $ph`XPH@80 $OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: inet_pton.c,v 1.2 1997/04/13 05:08:24 deraadt Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: md5c.c,v 1.11 1997/07/23 21:17:56 kstailey Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $5$OpenBSD: syslog.c,v 1.4 1997/07/25 20:30:04 mickey Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getdomainname.c,v 1.2 1996/08/19 08:23:22 tholo Exp $>>?(?@8@@AXB@ IS$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: wbuf.c,v 1.4 1997/05/31 22:41:32 tholo Exp $$OpenBSD: vsnprintf.c,v 1.2 1996/08/19 08:33:14 tholo Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: perror.c,v 1.2 1996/08/19 08:32:56 tholo Exp $$OpenBSD: fputs.c,v 1.2 1996/08/19 08:32:43 tholo Exp $[^paa`ab<ae`m$OpenBSD: res_send.c,v 1.7 1997/06/04 03:18:41 dm Exp $$OpenBSD: res_init.c,v 1.15 1997/07/15 18:33:50 flipk Exp $$OpenBSD: res_comp.c,v 1.8 1997/07/09 01:08:49 millert Exp $$OpenBSD: inet_addr.c,v 1.5 1997/04/05 21:13:10 millert Exp $$OpenBSD: _def_time.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $@$OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: gethostname.c,v 1.2 1996/08/19 08:23:35 tholo Exp $($OpenBSD: localtime.c,v 1.10 1997/04/02 03:57:30 deraadt Exp $WILDABBR\@\@$OpenBSD: asctime.c,v 1.3 1997/01/14 03:16:42 millert Exp $PP¨ĸ$OpenBSD: sprintf.c,v 1.3 1997/07/25 20:30:11 mickey Exp $$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: printf.c,v 1.3 1997/07/25 20:30:10 mickey Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $<(˼X͐$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $`$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $HP<@@`P0`<|$\4 $44 $OpenBSD: opendir.c,v 1.4 1997/07/09 00:28:23 millert Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.2 1996/08/19 08:21:55 tholo Exp $@$OpenBSD: seekdir.c,v 1.3 1997/09/22 05:09:39 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.2 1996/08/19 08:25:35 tholo Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.6 1997/04/26 08:50:12 tholo Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.3 1996/08/19 08:33:00 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.2 1996/08/19 08:20:25 tholo Exp $$OpenBSD: hash.c,v 1.5 1997/07/23 21:00:27 kstailey Exp $$OpenBSD: bt_open.c,v 1.5 1997/07/23 21:00:25 kstailey Exp $$OpenBSD: bt_get.c,v 1.3 1996/08/19 08:20:06 tholo Exp $$OpenBSD: bt_conv.c,v 1.3 1996/08/19 08:20:03 tholo Exp $$OpenBSD: bt_close.c,v 1.3 1996/08/19 08:20:01 tholo Exp $O$OpenBSD: snprintf.c,v 1.3 1997/07/25 20:30:11 mickey Exp $$OpenBSD: mktemp.c,v 1.10 1997/10/07 22:21:34 millert Exp $$OpenBSD: hash_log2.c,v 1.3 1996/08/19 08:20:38 tholo Exp $$OpenBSD: hash_func.c,v 1.4 1996/09/15 09:30:49 tholo Exp $W8$OpenBSD: hash_buf.c,v 1.4 1996/10/14 22:17:27 downsj Exp $$OpenBSD: bt_put.c,v 1.4 1997/07/23 21:00:26 kstailey Exp $$OpenBSD: bt_delete.c,v 1.3 1996/08/19 08:20:05 tholo Exp $$OpenBSD: bt_split.c,v 1.3 1996/08/19 08:20:16 tholo Exp $$OpenBSD: bt_seq.c,v 1.3 1996/08/19 08:20:14 tholo Exp $$OpenBSD: bt_search.c,v 1.3 1996/08/19 08:20:13 tholo Exp $$OpenBSD: bt_utils.c,v 1.3 1996/08/19 08:20:17 tholo Exp $$OpenBSD: bt_overflow.c,v 1.3 1996/08/19 08:20:09 tholo Exp $$OpenBSD: bt_page.c,v 1.3 1996/08/19 08:20:10 tholo Exp $$OpenBSD: mpool.c,v 1.4 1996/09/15 09:30:51 tholo Exp $$OpenBSD: fprintf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $p 0000000000000000$OpenBSD: fvwrite.c,v 1.3 1996/10/26 06:58:58 tholo Exp $$OpenBSD: isnan.c,v 1.3 1996/08/19 08:17:39 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:17:38 tholo Exp $8θ`}A@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$OpenBSD: wsetup.c,v 1.2 1996/08/19 08:33:16 tholo Exp $$OpenBSD: makebuf.c,v 1.2 1996/08/19 08:32:54 tholo Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $(j'&'T'kH'&'T' k'&'T'jj$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $X$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: isatty.c,v 1.2 1996/08/19 08:24:32 tholo Exp $$OpenBSD: ctype_.c,v 1.3 1996/09/15 09:30:56 tholo Exp $hp$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: malloc.c,v 1.29 1997/08/23 10:43:25 pefo Exp $$%$OpenBSD: stdio.c,v 1.2 1996/08/19 08:33:08 tholo Exp $$OpenBSD: fwalk.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: sysconf.c,v 1.3 1996/09/15 09:31:06 tholo Exp $$OpenBSD: signal.c,v 1.2 1996/08/19 08:26:09 tholo Exp $-@$OpenBSD: mmap.c,v 1.6 1997/04/26 08:50:12 tholo Exp $$OpenBSD: lseek.c,v 1.5 1997/04/26 08:50:12 tholo Exp $0X1P1$OpenBSD: sysctl.c,v 1.3 1997/08/24 21:25:46 millert Exp $4$OpenBSD: scandir.c,v 1.3 1997/07/24 00:08:41 deraadt Exp $$OpenBSD: rec_open.c,v 1.4 1997/07/23 21:00:29 kstailey Exp $$OpenBSD: rec_seq.c,v 1.3 1996/08/19 08:21:10 tholo Exp $$OpenBSD: rec_get.c,v 1.3 1996/08/19 08:21:03 tholo Exp $$OpenBSD: rec_delete.c,v 1.3 1996/08/19 08:21:00 tholo Exp $$OpenBSD: rec_close.c,v 1.4 1996/09/15 09:30:53 tholo Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: rec_search.c,v 1.4 1997/07/23 21:00:30 kstailey Exp $$OpenBSD: hash_page.c,v 1.3 1996/08/19 08:20:39 tholo Exp $_hashXXXXXX$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.4 1996/09/15 09:30:48 tholo Exp $$OpenBSD: rec_put.c,v 1.3 1996/08/19 08:21:06 tholo Exp $/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/catwards compatibility with older PINTs rm -f scan$unit ln -s ss$unit scan$unit ;; local) umask 0 test -s MAKEDEV.local && sh MAKEDEV.local ;; *) echo $i: unknown device ;; esac done  . ..MAKEDEVconsole ttykmemw@ mem!null "zero#eeprom$openpromq%drumws&klogvJ'stdin @(stdout)stderr*ttyaz8@+ttybu:, fb-mouseI@. kbd/random0srandom1urandom2prandom3arandom4fd0ax 5fd0bu<@6fd0cx7rfd0aՀ8rfd0b]9rfd0cv:sd0ay;rsd0a9@<sd0bvL@=rsd0b>sd0cz>?rsd0c=@sd0dz?Arsd0dՀBsd0eu7@Crsd0e@Dsd0f Ersd0fI@Fsd0g Grsd0g@Hsd0hw|Irsd0h@Jsd0it@Krsd0i Lsd0jsMrsd0jNsd0kvMOrsd0k Psd0lt@Qrsd0l@Rsd0mu;Srsd0m Tsd0nxUrsd0n @Vsd0ou<@Wrsd0oՀXsd0pngYrsd0p4Zsd1at[rsd1a\sd1b ]rsd1b]^sd1cy_rsd1c]`sd1dwu@arsd1d]bsd1ez>crsd1e@dsd1fz?ersd1fIfsd1gt@grsd1g<hsd1hi@irsd1hjsd1iv@krsd1i@lsd1jw|mrsd1jO@nsd1kz5orsd1k;psd1lxqrsd1lvrsd1mxsrsd1m6tsd1nwt@ursd1nvsd1ot@wrsd1o8xsd1pvMy rsd1p@er the upgrade" echo "software, when you are done." echo "" echo "GOOD LUCK!" echo "" #!/bin/sh - # # $OpenBSD: MAKEDEV,v 1.33 1997/09/16 03:03:03 deraadt Exp $ # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV 5.5 (Berkeley) 5/28/91 # # Device "make" file. Valid arguments: # std standard devices # local configuration specific devices # Tapes: # st* SCSI tape # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # ch* SCSI changer # uk* unknown SCSI # ss* SCSI scanners # xy* Xylogic 450/451 disks # rd* "ramdisk" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppies # vnd* "file" pseudo-disks # ccd* concatenated disk devices # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # Printers: # Call units: # Special purpose devices: # audio # openprom # bwtwo* # cgtwo* # cgthree* # cgfour* # cgsix* # cgeight* # cgfourteen* # tcx* # bpf* packet filter # lkm loadable kernel modules interface # tun* network tunnel driver # *random random data source PATH=/sbin:/bin/:/usr/bin:/usr/sbin:/usr/etc this=$0 umask 77 case "$os" in # set os in the environment if not OpenBSD SunOS) add () { expr $1 + $2 } mult () { expr $1 '*' $2 } hex () { case $1 in [0-9]) echo $1;; 10) echo a;; 11) echo b;; 12) echo c;; 13) echo d;; 14) echo e;; 15) echo f;; esac } trunc () { expr $1 : $2'\(.*\)' } unt () { expr $1 : '[a-z]*\([0-9]*\)[a-p]*' } ;; *) add () { echo "$(( $1 + $2 ))" } mult () { echo "$(( $1 * $2 ))" } hex () { case $1 in [0-9]) echo -n $1 ;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" echo ${arg1#$arg2} } unt () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" if [ "${arg1#xy}" != "$arg1" ] then unt=${arg1#xy} else unt=${arg1#*d} fi echo ${unt%*[a-p]} } ;; esac for i do unit=`expr $i : '[a-z][a-z]*\([0-9][0-9]*\)'` [ "$unit" ] || unit=0 case $i in all) sh ${this} std sd0 sd1 sd2 sd3 sd4 xd0 xd1 xd2 xd3 xy0 xy1 xy2 xy3 sh ${this} cd0 st0 st1 rd0 sh ${this} fd0 fdB0 fdC0 fdD0 fdE0 fdF0 fdG0 fdH0 sh ${this} uk0 uk1 sh ${this} ss0 ss1 sh ${this} pty0 vnd0 vnd1 vnd2 vnd3 audio tun0 tun1 tun2 tun3 sh ${this} ccd0 ccd1 ccd2 ccd3 sh ${this} bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 sh ${this} ipl sh ${this} bwtwo0 cgtwo0 cgthree0 cgfour0 cgsix0 sh ${this} cgeight0 cgfourteen0 tcx0 sh ${this} lkm random local ;; floppy) sh ${this} std random sh ${this} fd0 sd0 sd1 ;; ramdisk) sh ${this} std random sh ${this} fd0 sd0 sd1 sd2 sd3 rd0 cd0 ;; std) mknod console c 0 0 mknod tty c 2 0 ; chmod 666 tty mknod kmem c 3 1 ; chmod 640 kmem ; chown root.kmem kmem mknod mem c 3 0 ; chmod 640 mem ; chown root.kmem mem mknod null c 3 2 ; chmod 666 null mknod zero c 3 12 ; chmod 666 zero mknod eeprom c 3 11 ; chmod 640 eeprom ; chown root.kmem eeprom mknod openprom c 70 0 ; chmod 644 openprom mknod drum c 7 0 ; chmod 640 drum ; chown root.kmem drum mknod klog c 16 0 ; chmod 600 klog mknod stdin c 24 0 ; chmod 666 stdin mknod stdout c 24 1 ; chmod 666 stdout mknod stderr c 24 2 ; chmod 666 stderr mknod ttya c 12 0 mknod ttyb c 12 1 mknod fb c 22 0 ; chmod 666 fb mknod mouse c 13 0 ; chmod 666 mouse mknod kbd c 29 0 ; chmod 666 kbd ;; fd) rm -f fd/* mkdir fd > /dev/null 2>&1 n=0 (cd fd && while [ $n -lt 64 ]; do mknod $n c 24 $n; n=`add $n 1`; done ) chown -R root.wheel fd chmod 555 fd chmod 666 fd/* ;; bwtwo*) mknod bwtwo$unit c 27 $unit; chmod 666 bwtwo$unit ;; cgtwo*) mknod cgtwo$unit c 31 $unit; chmod 666 cgtwo$unit ;; cgthree*) mknod cgthree$unit c 55 $unit; chmod 666 cgthree$unit ;; cgfour[0-9]*) mknod cgfour$unit c 39 $unit; chmod 666 cgfour$unit ;; cgsix*) mknod cgsix$unit c 67 $unit; chmod 666 cgsix$unit ;; cgeight*) mknod cgeight$unit c 64 $unit; chmod 666 cgeight$unit ;; cgfourteen*) mknod cgfourteen$unit c 99 $unit; chmod 666 cgfourteen$unit ;; tcx*) mknod tcx$unit c 109 $unit; chmod 666 tcx$unit ;; audio) mknod audio c 69 0; chmod 666 audio ;; openprom) mknod openprom c 70 0; chmod 600 openprom ;; bpf*) rm -f bpf$unit mknod bpf$unit c 105 $unit chmod 600 bpf$unit chown root.wheel bpf$unit ;; ipl) rm -f ipl mknod ipl c 59 0 chown root.wheel ipl ;; tun*) rm -f tun$unit mknod tun$unit c 111 $unit chmod 600 tun$unit chown root.wheel tun$unit ;; fd*) umask 2 ; unit=`expr $i : 'fd.*\(.\)$'` typnam=`expr $i : 'fd\(.\).*'` case $typnam in 0|1) typnam=; typnum=0;; # no type specified, assume A A) typnam=; typnum=0;; B) typnum=1;; C) typnum=2;; D) typnum=3;; E) typnum=4;; F) typnum=5;; G) typnum=6;; H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $unit in 0|1) blk=16; chr=54;; *) echo bad unit $unit for $i; exit 1;; esac nam=fd${typnam}$unit rm -f ${nam}? r${nam}? basenum=`expr $unit '*' 128 + $typnum '*' 16` mknod ${nam}a b $blk `expr $basenum + 0` mknod ${nam}b b $blk `expr $basenum + 1` mknod ${nam}c b $blk `expr $basenum + 2` #mknod ${nam}d b $blk `expr $basenum + 3` #mknod ${nam}e b $blk `expr $basenum + 4` #mknod ${nam}f b $blk `expr $basenum + 5` #mknod ${nam}g b $blk `expr $basenum + 6` #mknod ${nam}h b $blk `expr $basenum + 7` #mknod ${nam}i b $blk `expr $basenum + 8` #mknod ${nam}j b $blk `expr $basenum + 9` #mknod ${nam}k b $blk `expr $basenum + 10` #mknod ${nam}l b $blk `expr $basenum + 11` #mknod ${nam}m b $blk `expr $basenum + 12` #mknod ${nam}n b $blk `expr $basenum + 13` #mknod ${nam}o b $blk `expr $basenum + 14` #mknod ${nam}p b $blk `expr $basenum + 15` mknod r${nam}a c $chr `expr $basenum + 0` mknod r${nam}b c $chr `expr $basenum + 1` mknod r${nam}c c $chr `expr $basenum + 2` #mknod r${nam}d c $chr `expr $basenum + 3` #mknod r${nam}e c $chr `expr $basenum + 4` #mknod r${nam}f c $chr `expr $basenum + 5` #mknod r${nam}g c $chr `expr $basenum + 6` #mknod r${nam}h c $chr `expr $basenum + 7` #mknod r${nam}i c $chr `expr $basenum + 8` #mknod r${nam}j c $chr `expr $basenum + 9` #mknod r${nam}k c $chr `expr $basenum + 10` #mknod r${nam}l c $chr `expr $basenum + 11` #mknod r${nam}m c $chr `expr $basenum + 12` #mknod r${nam}n c $chr `expr $basenum + 13` #mknod r${nam}o c $chr `expr $basenum + 14` #mknod r${nam}p c $chr `expr $basenum + 15` chown root.operator ${nam}[a-p] r${nam}[a-p] chmod 640 ${nam}[a-p] r${nam}[a-p] umask 77 ;; ccd*|sd*|xd*|xy*|cd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi case $i in ccd*) name=ccd; blk=9; chr=23;; sd*) name=sd; blk=7; chr=17;; xd*) name=xd; blk=10; chr=42;; xy*) name=xy; blk=3; chr=9;; cd*) name=cd; blk=18; chr=58;; *) echo bad unit for disk in: $i;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh ${this} $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? umask 77 ;; vnd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi blk=8; chr=110; for name in vnd svnd; do case $name in vnd) off=0;; svnd) off=128;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh ${this} $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` minor=`add $minor $off` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? done umask 77 ;; rd*) umask 2 ; unit=`expr $i : '.*d\(.*\)'` mknod rd${unit}a b 17 `expr $unit '*' 16 + 0` mknod rd${unit}c b 17 `expr $unit '*' 16 + 2` mknod rrd${unit}a c 106 `expr $unit '*' 16 + 0` mknod rrd${unit}c c 106 `expr $unit '*' 16 + 2` chown root.operator rd${unit}[ac] rrd${unit}[ac] chmod 640 rd${unit}[ac] rrd${unit}[ac] umask 77 ;; st*) umask 2 case $i in st*) name=st; blk=11; chr=18;; esac rm -f $name$unit n$name$unit e$name$unit en$name$unit \ r$name$unit nr$name$unit er$name$unit enr$name$unit sixt=`mult $unit 16` mknod $name$unit b $blk `add $sixt 0` mknod n$name$unit b $blk `add $sixt 1` mknod e$name$unit b $blk `add $sixt 2` mknod en$name$unit b $blk `add $sixt 3` mknod r$name$unit c $chr `add $sixt 0` mknod nr$name$unit c $chr `add $sixt 1` mknod er$name$unit c $chr `add $sixt 2` mknod enr$name$unit c $chr `add $sixt 3` chown root.operator $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit chmod 640 $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit umask 77 ;; ch*) umask 2 case $i in ch*) name=ch; chr=19;; esac rm -f $name$unit sixt=`mult $unit 16` mknod $name$unit c $chr `add $sixt 0` chown root.operator $name$unit chmod 640 $name$unit umask 77 ;; lkm) rm -f lkm mknod lkm c 112 0 chown root.kmem lkm chmod 640 lkm ;; pty*) case $unit in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; # Note that telnetd, rlogind, and xterm (at least) only look at p-s. 4) offset=64 name=t;; *) echo bad unit for pty in: $i;; esac case $unit in 0|1|2|3|4) umask 0 n=0 while [ $n -lt 16 ] do nam=$name`hex $n` rm -f {tty,pty}$nam mknod tty$nam c 20 `add $offset $n` mknod pty$nam c 21 `add $offset $n` n=`add $n 1` done umask 77 ;; esac ;; random|srandom|urandom|prandom|arandom) rm -f random urandom srandom prandom arandom mknod random c 119 0 mknod srandom c 119 1 mknod urandom c 119 2 mknod prandom c 119 3 mknod arandom c 119 4 chown root.wheel random srandom urandom prandom arandom chmod 644 random srandom urandom prandom arandom ;; uk*) unit=`trunc $i uk` rm -f uk$unit mknod uk$unit c 120 $unit chown root.operator uk$unit chmod 640 uk$unit ;; ss*) unit=`trunc $i ss` rm -f ss$unit mknod ss$unit c 121 $unit chown root.operator ss$unit chmod 440 ss$unit # back# # Internet (IP) protocols # # $OpenBSD: protocols,v 1.5 1997/02/22 04:32:53 angelos Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol sip 41 SIP # Simple Internet Protocol sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA sipp-esp 50 SIPP-ESP # SIPP Encap Security Payload sipp-ah 51 SIPP-AH # SIPP Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP reserved 255 Reserved # # $OpenBSD: services,v 1.14 1997/09/30 18:46:47 kstailey Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp sunrpc 111/udp auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp # Interim Mail Access Proto v2 imap2 143/udp snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nnsp 433/tcp usenet # Network News Transfer https 443/tcp # secure http (SSL) photuris 468/tcp # Photuris Key Management photuris 468/udp # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # webster 765/tcp # Network dictionary webster 765/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # klogin 543/tcp # Kerberos `rlogin' kshell 544/tcp krcmd # Kerberos `rsh' kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos 750/udp kdc # Kerberos (server) udp kerberos 750/tcp kdc # Kerberos (server) tcp kerberos_master 751/udp kerberos-master # Kerberos admin server udp kerberos_master 751/tcp kerberos-master # Kerberos admin server tcp krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' eklogin 2105/tcp # Kerberos encrypted `rlogin' # # Unofficial services # supfilesrv 871/tcp # SUP server cddb 888/tcp # Audio CD Database supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting icb 7326/tcp # Internet Citizen's Band # # Appletalk # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol # $OpenBSD: dot.commonutils,v 1.5 1996/12/09 07:05:19 deraadt Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # Installation utilites (functions), to get OpenBSD installed on # the hard disk. These are meant to be invoked from the shell prompt, # by people installing OpenBSD. # we know that /etc/fstab is only generated on the hard drive dest_dir=/ if [ ! -f /etc/fstab ]; then dest_dir=/mnt/ fi # counter for possible shared library confusion TAR=/bin/tar GUNZIP="/usr/bin/gzip -d" Set_tmp_dir() { def_tmp_dir=`pwd` if [ "$def_tmp_dir" = "/" -o "$def_tmp_dir" = "/mnt" ]; then def_tmp_dir="$dest_dir"usr/distrib fi echo -n "What directory should be used to find and/or store " echo "installtion" echo -n "files? [$def_tmp_dir] " read tmp_dir if [ "$tmp_dir" = "" ]; then tmp_dir=$def_tmp_dir fi if [ ! -d "$tmp_dir" ]; then /bin/rm -rf $tmp_dir mkdir -p $tmp_dir fi } Tmp_dir() { if [ "$tmp_dir" = "" ]; then Set_tmp_dir fi cd $tmp_dir } Load_fd() { Tmp_dir which= echo "Don't forget that you can't load from the drive you booted from." echo "" while [ "$which" != "0" -a "$which" != "1" ]; do echo -n "Read from which floppy drive ('0' or '1')? [1] " read which if [ "X$which" = "X" ]; then which=1 fi done echo "" echo "WARNING: during the floppy loading process, you should only" echo "use Control-C at the prompt." echo "" while echo -n \ "Insert floppy (hit Control-C to terminate, enter to load): " do read foo mount -r -t msdos /dev/fd${which}a /mnt2 cp -rp /mnt2/* . umount /mnt2 done } Load_tape() { Tmp_dir echo -n "Which tape drive will you be using? [rst0] " read which if [ "X$which" = "X" ]; then which=rst0 fi echo -n "Insert the tape into the tape drive and hit return to " echo -n "continue..." read foo echo "Extracting files from the tape..." $TAR xvpf /dev/$which echo "Done." } Extract() { Tmp_dir echo -n "Would you like to list the files as they're extracted? [n] " read verbose case $verbose in y*|Y*) tarverbose=v ;; *) tarverbose= ;; esac cat "$1"* | $GUNZIP | (cd $dest_dir ; $TAR -xp"$tarverbose"f - ) } dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:\ :tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: # $OpenBSD: dot.profile,v 1.4 1997/10/20 22:24:13 millert Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export HISTFILE=/.sh_history umask 022 set -o emacs # emacs-style command line editing # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt100 dumb" TERM=sun # editors believed to be in $EDITBIN, smart and dumb defaults EDITORS="ed" EDITOR=ed DUMB=ed EDITBIN=/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /kern/rootdev / # set up some sane defaults echo 'erase ^H, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^H 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # get the editor preference if [ "X$TERM" = "Xdumb" -o "X$TERM" = "Xunknown" ]; then echo -n "$TERM can't handle $EDITOR" EDITOR="$DUMB" echo ", using $EDITOR as text editor!" elif [ "X$EDITOR" = "X$EDITORS" ]; then echo "Only one editor available, you get to use $EDITOR!" else _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported editors are: $EDITORS" echo -n "text editor? [$EDITOR] " read _choice if [ "X$_choice" = "X" ]; then _choice="$EDITOR" _forceloop="$_choice" else for _editor in $EDITORS; do if [ "X$_choice" = "X$_editor" ]; then _forceloop="$_choice" break fi done fi if [ "X$_forceloop" != "X" -a ! -x $EDITBIN/$_choice ] then _forceloop="" fi if [ "X$_forceloop" = "X" ]; then echo "Sorry, $_choice isn't available." _forceloop="" fi done EDITOR="$_choice" fi export EDITOR # pull in the functions that people will use from the shell prompt. . /.commonutils . /.upgrutils # run the upgrade script. upgrade fi # $OpenBSD: dot.upgrutils,v 1.2 1996/04/25 21:31:32 niklas Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # Upgrade cleanup utilites (functions), to make sure a recently-upgraded # system is safely runnable. These are meant to be invoked from the shell # prompt, by people installing OpenBSD. Cleanup() { upgrade_dir=/ if [ ! -f /etc/fstab ]; then upgrade_dir=/mnt fi echo "Cleaning up miscellaneous files in /etc..." mv $upgrade_dir/etc/rc.bak $upgrade_dir/etc/rc chroot $upgrade_dir /usr/sbin/pwd_mkdb -p /etc/master.passwd chroot $upgrade_dir /bin/rm /etc/sendmail.fc > /dev/null 2>&1 sync echo "Done." echo "" echo "All that's left to do now is to install a new OpenBSD kernel" echo "on your hard disk. You should now halt your machine using" echo "the 'halt' command. Once the machine is halted, replace the" echo "installation floppy with the kernel-copy floppy and hit any" echo "key to reboot. Use the kernel-copy floppy to copy a kernel" echo "to your hard disk." } #!/bin/sh # $OpenBSD: upgrade.sh,v 1.4 1997/05/11 22:47:34 grr Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # OpenBSD upgrade script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. DT=/etc/disktab # /etc/disktab FSTABDIR=/mnt/etc # /mnt/etc #DONTDOIT=echo VERSION=1.0 FSTAB=${FSTABDIR}/fstab getresp() { read resp if [ "X$resp" = "X" ]; then resp=$1 fi } echo "Welcome to the OpenBSD ${VERSION} upgrade program." echo "" echo "This program is designed to help you put the new version of OpenBSD" echo "on your hard disk, in a simple and rational way. To upgrade, you" echo "must have plenty of free space on all partitions which will be" echo "upgraded. If you have at least 1MB free on your root partition," echo "and several free on your /usr patition, you should be fine." echo "" echo "As with anything which modifies your hard drive's contents, this" echo "program can cause SIGNIFICANT data loss, and you are advised" echo "to make sure your hard drive is backed up before beginning the" echo "upgrade process." echo "" echo "Default answers are displyed in brackets after the questions." echo "You can hit Control-C at any time to quit, but if you do so at a" echo "prompt, you may have to hit return. Also, quitting in the middle of" echo "the upgrade may leave your system in an inconsistent (and unusable)" echo "state." echo "" echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) echo "" echo "OK, then. Enter 'halt' at the prompt to halt the" echo "machine. Once the machine has halted, remove the" echo "floppy and press any key to reboot." exit ;; esac # find out what units are possible, and query the user. driveunits=`ls /dev/[sw]d?a | sed -e 's,/dev/\(...\)a,\1,g'` if [ "X${driveunits}" = "X" ]; then echo "FATAL ERROR:" echo "No disk devices." echo "This is probably a bug in the install disks." echo "Exiting install program." exit fi echo "" echo "The following disks are supported by this upgrade procedure:" echo " "${driveunits} echo "If your system was previously completely contained within the" echo "disks listed above (i.e. if your system didn't occupy any space" echo "on disks NOT listed above), this upgrade disk can upgrade your" echo "system. If it cannot, hit Control-C at the prompt." echo "" while [ "X${drivename}" = "X" ]; do echo -n "Which disk contains your root partion? " getresp otherdrives=`echo "${driveunits}" | sed -e s,${resp},,` if [ "X${driveunits}" = "X${otherdrives}" ]; then echo "" echo "\"${resp}\" is an invalid drive name. Valid choices" echo "are: "${driveunits} echo "" else drivename=${resp} fi done echo "" echo "Root partition is on ${drivename}a." echo "" echo "Would you like to upgrade your file systems to the new file system" echo -n "format? [y] " getresp "y" case "$resp" in n*|N*) echo "" echo "You should upgrade your file systems with 'fsck -c 2'" echo "as soon as is feasible, because the new file system" echo "code is better-tested and more performant." upgradefs=NO ;; *) upgradefs=YES ;; esac if [ $upgradefs = YES ]; then echo "" echo "Upgrading the file system on ${drivename}a..." fsck -p -c 2 /dev/r${drivename}a if [ $? != 0 ]; then echo "FATAL ERROR: FILE SYSTEM UPGRADE FAILED." echo "You should probably reboot the machine, fsck your" echo "disk(s), and try the upgrade procedure again." exit 1 fi echo "Done." fi echo "" echo "Mounting root partition on /mnt..." mount /dev/${drivename}a /mnt if [ $? != 0 ]; then echo "FATAL ERROR: MOUNT FAILED." echo "You should verify that your system is set up as you" echo "described, and re-attempt the upgrade procedure." exit 1 fi echo "Done." if [ $upgradefs = YES ]; then echo "" echo -n "Copying new fsck binary to your hard disk..." if [ ! -d /mnt/sbin ]; then mkdir /mnt/sbin fi cp /sbin/fsck /mnt/sbin/fsck if [ $? != 0 ]; then echo "FATAL ERROR: COPY FAILED." echo "It in unclear why this error would occur. It looks" echo "like you may end up having to upgrade by hand." exit 1 fi echo " Done." echo "" echo "Re-mounting root partition read-only..." mount -u -o ro /dev/${drivename}a /mnt if [ $? != 0 ]; then echo "FATAL ERROR: RE-MOUNT FAILED." echo "It in unclear why this error would occur. It looks" echo "like you may end up having to upgrade by hand." exit 1 fi echo "Done." echo "" echo "Upgrading the rest of your file systems..." chroot /mnt fsck -p -c 2 if [ $? != 0 ]; then echo "FATAL ERROR: FILE SYSTEM UPGRADE(S) FAILED." echo "You should probably reboot the machine, fsck your" echo "file system(s), and try the upgrade procedure" echo "again." exit 1 fi echo "Done." echo "" echo "Re-mounting root partition read-write..." mount -u -o rw /dev/${drivename}a /mnt if [ $? != 0 ]; then echo "FATAL ERROR: RE-MOUNT FAILED." echo "It in unclear why this error would occur. It looks" echo "like you may end up having to upgrade by hand." exit 1 fi echo "Done." fi echo "" echo "Updating disk labels on ${drivename}..." $DONTDOIT disklabel $drivename > /mnt/tmp/${drivename}.label if [ $? != 0 ]; then echo "FATAL ERROR: READ OF DISK LABEL FAILED." echo "It in unclear why this error would occur. It looks" echo "like you may end up having to upgrade by hand." exit 1 fi $DONTDOIT disklabel -R $drivename /mnt/tmp/${drivename}.label echo "Updating boot blodk on ${drivename}..." $DONTDOIT /usr/mdec/binstall -v ffs /mnt if [ $? != 0 ]; then echo "FATAL ERROR: UPDATE OF BOOT BLOCKS FAILED." echo "It in unclear why this error would occur. It looks" echo "like you may end up having to upgrade by hand." exit 1 fi if [ -f /mnt/boot ]; then $DONTDOIT rm -f /mnt/boot.bak $DONTDOIT mv /mnt/boot /mnt/boot.bak fi echo "Done." echo "" echo "Copying bootstrapping binaries and config files to the hard drive..." $DONTDOIT cp /mnt/.profile /mnt/.profile.bak $DONTDOIT pax -rw -X -k . /mnt $DONTDOIT mv /mnt/etc/rc /mnt/etc/rc.bak $DONTDOIT cp /tmp/.hdprofile /mnt/.profile echo "" echo "Mounting remaining partitions..." chroot /mnt mount -at ufs > /dev/null 2>&1 echo "Done." echo "" echo "" echo "OK! The preliminary work of setting up your disk is now complete," echo "and you can now upgrade the actual OpenBSD software." echo "" echo "Right now, your hard disk is mounted on /mnt. You should consult" echo "the installation notes to determine how to load and install the new" echo "OpenBSD distribution sets, and how to clean up aft# $OpenBSD: dot.hdprofile,v 1.5 1997/05/11 22:47:34 grr Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH umask 022 # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt100 dumb" TERM=sun # editors believed to be in $EDITBIN, smart and dumb defaults EDITORS="ed" EDITOR=ed DUMB=ed EDITBIN=/bin EDITUBIN=/usr/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES echo "Checking filesystems..." fsck -y echo "Mounting filesystems..." mount -a # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? 9600 echo '' # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # get the editor preference if [ "X$TERM" = "Xdumb" -o "X$TERM" = "Xunknown" ]; then echo -n "$TERM can't handle $EDITOR" EDITOR="$DUMB" echo ", using $EDITOR as text editor!" elif [ "X$EDITOR" = "X$EDITORS" ]; then echo "Only one editor available, you get to use $EDITOR!" else _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported editors are: $EDITORS" echo -n "text editor? [$EDITOR] " read _choice if [ "X$_choice" = "X" ]; then _choice="$EDITOR" _forceloop="$_choice" else for _editor in $EDITORS; do if [ "X$_choice" = "X$_editor" ]; then _forceloop="$_choice" break fi done fi if [ "X$_forceloop" != "X" -a ! \( -x $EDITBIN/$_choice -o -x $EDITUBIN/$_choice \) ] then _forceloop="" fi if [ "X$_forceloop" = "X" ]; then echo "Sorry, $_choice isn't available." _forceloop="" fi done EDITOR="$_choice" fi export EDITOR # pull in the functions that people will use from the shell prompt. . /.commonutils . /.instutils echo "Follow the installation directions to install the OpenBSD" echo "distribution sets." fi