ELFa( 4\>4 (  $e$e55((\>\^\^ I_DO! "&@00Q_: 0/\>\@/ XX@0 6QQO @@( @0 <  B00 RР -L \^ad^main() returnedha   ),@@(LQ 0/]a - 0LP@pT`LF`VZ -LM`P@p5@D0D 00``&@ -LM`p@P 0 0 0 000  ׽ѽP@XP 0ý㽽@TZ㵽X 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i| -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PU@ PU*00 ,*00" 4 tx0\ \0@D P gfp00 㒭 PL5T5P5\5X5 -4!L01 M, P@0 \00eS4 Z0p , 0 Z 1!R,00 )  aP,00  @0S0 0@` V H0dP$ 0lP, 0 04P5T5X5L5 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `otpQP* 0 P(U:p p-QLM0@`  `tpQP* 0PXU:p p-QLM0@`  `}tpQP* 0P\U:p p-QLM0@`  `1tpQP* 0 P,U:p -QLM@0 L3X3 -QLM@ p33 -(L  -(L  0-" _  P0L @ 00hD p-LM@ 㹻P` 0㯻00PY YR` cUpp p-LMP@`V0 pd㉻p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P`?XP 0s UP(0Sp(00PS 0U 0 0 30P 0UPp -LM0pS 0S 00 87 0`%`K% [)0S ) %0K ~ 0@P&PK& [)0S ) &0K g0VS UR Z   Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 㜺000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000㿳00廳I05 p-LM@`ᲳP᫳p -2LM PR|2   Jh0S`2`h0 0SL200l0S 2 2  (B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ00,0K,pK!0(@ *pK+KV ܹ0< VP202202" (P2$00$0h0 ``000P wH],5  05j`50 3P_ p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@Pῲ`@ᵲp 0-LP㮲@0h駲 p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L    ( 05j3433 0-L@LP Ǹ0( Ὸ0( 0h鶸' -0LM@p 㦸00 ` 㕸00 PZpd3 <# R}00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWD0++'0K 'K$0 Q0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PL?4p`V 4h4$0( 00xur$ 0  $00 $00 DPT$0 0$0ma40433333 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,o0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 P0 0  0 S   50S0`00`0 P0 VE00@p x0 Pk40Sh@@j0H 00OK -,P000/$`3,5 -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|P00 `0 0T2 <201$2$3434H3\3l3 p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0 333 -LM0`10#0P8pKP@0 00 0000  0 0, 0 004 P`0 0@ 0 0 @08 @i0  @$ & ' 3 -LM0p ` P_㍵0ST  0 PE0 @ @00$00$0 00/A#bJi ^ i* W 0 P(0 0S  0 Ph ,000i? 3GMb5 -LM0` @2c1RP,p 00 P 00 0 (0000  ~dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph,000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,2$` 3 M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K~ 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,$`,3 p-LMP0K`Pc @7_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@ެP(@ԬT` 0P_ p-LM @00P $0`0$0 @R 0$ 0 00  0 ~ph鬬\P_ -LM4@0S @440S -L M$X @R0  l0@ $@ h<3H3 - L  -LM ㅣ@` 0S@0 @WL_ -LM@N R000 Fh 0-LP=,0@T 0U @T10L_ -L MPP@`x &`006 &006 , &6`&`d006 &006/`P@K0 5K$KPT6P6$[  D6QW BQ/ +>4K5 05KP4[S;0;  ,~ T`5%#K #K<KP5  [5\# P6K 00 Q0N@D%D5̫ 0ѫ 0̫; 4 4 w4 N4 ޫᙝ~ r$;$0;0pD3#,] 0ᐫ 0 勫;   0 0y 0s; 0l; 0e 0`;  \0T 0DN; 0,G; 0@ 0;; v 0/p 0); 0"; 0 0b; M 0 G 04; 0;  0/ 0";& 0;1 1@ \`0+;Ť1\;0;Ŕ1Qt1x1 P0+;d1 P;0;D1 ,1+81@ Q01}>;1+ 2R1R;<;;0;0 Q; ;$`#t4444@43+ 8  4 l5_e"Na'(j) -+8 L#8 $ː R2 d X -+8 L#8 $ː R4 h X -LM;`0 5R˖ R2 d 0X KR4 h 2Xxrː R2 d 0X ;R0 ` (˖ 0R4 h  X2Xo_  ;R" D ( ˖R@4 h 0XH;$HT@ 0  `1˖ R4 h :X41˖ R2 d $1X1S0˖ R4 h 0X"0˖ R4 h 0X ˖R4 h 0X  ˖R4 h 0Xp -40Lː 0R (  -LLMT 0 `@6 0pR,6 R @PP  !1 01$0  1 ȧU ŧ@j$ὧ$ R 1 0 +10 ,( 0 @  DP 8 4>  D0  4t$[Q>K  8K  *K  0 0D Pl00l0 # R간[>0S6[¸ D lK_0 <0 < P  8 \<00 0lK 5# "z`x`{`44 08,4T44405;505t0p000t0p0 p-0LM`a 0@}5K p,L0,0P@@T  phh5#4 -LMA0P 00K  00"[80 41R; R 3[pCX#~mW`˕   20K!0˕ R8 p (K#[0 R3K#[101pW0 0 80xL@L0[a= 40   # -KL@DtpP ˗ (0  @D8tTea˗ 8R  #8X KR8  #8X 0[R8  #8X˗ 8#8 XA ˗R0 ` (0P@DtT8< 0 ;R  (˗ 0R4 h  X0X  8 q$4X4 p-0L M PR`0 PEu @0@0 0S PE⦫uU;0;d `01K02K01K80 K p,2p;P#4 0-0L PR ;+$@˕<<+0Tc˕@+0T0hX0 -2L M @RP 2R 2R 200!P 80Plr; R8 p (0 hVu ;R8 p (0 Pe`\0  R L8 p c0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0AS$P 0P 8P @P XP XP HP PP XP XP XP XP XP XP `P  0P 0S0S` (PK?2K02K]< <0(PK U #*D "#(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂˖ R8 p 0X KR08 p X0\  R L8 p bP2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&վU?G  K5K70 Pp@W 0"K0C "K SS T T S T (T 0T S S S 8T 0[,PK2KX0000000S>L0,PK0K2K #!( 8 #<" 6S-L@p6 8S `,P˔0S8 #8X0˔S8  #8X|Pt0˔ R (0  PEyuU<  `4 p-LM@80PP`0 ( R8 p Rap -LMPp60 P a 0? R6 l da ˕R6 l 0X KR6 l 0X 60mP@ ;R6 l (P0 S ;R6 l ( 0 S4xV -|1LMp00  @PHQJDa˔ R0 ` (0PEԨuU4 ;R" D (  ˔R4 h 0X 60Po?PPl0˔ R6 l 0XP?U< > #4 -LdM⌐Kd Z108K0p8K05 -BTP @ 00`W {0S PTp`@00X 8K0 5<5 d$0 # p-LM 2@RP`0 Oʐ2RH +ʄ2R ? R `pd2 `P2R H2R@2@@{ .@@0 N J1R 1R 1R111R 1R{ 11 1RL !ʀ1R t1R l1Rd1>X1R P1RH1@<1 @ ,1 $1 1R" 1R 1R10 0R 0R} R0`y Q0u Jp 0}D 0w 0     -%* C 4 84< 0 -LLM]p@\ 张` ;h l  0` \0P`娠x=T (l=Td=T*\=T IP=T H=T h\ 6lQ 0`僠EP \ h:P\1S p 凗hh ߻h ?0\ hP5 (=  0<T> (<T 2 = S! =@S <  8C8;;  d< R ; 2KK"Kp<0K ; < R `;2K03KK@ G 505\ 0S ;  x;  \oh幠Pi \| r \ၟ4P^5@Y \ԟd:T )X:T P:T;h咠PB  h =\0*hP' h7 "\ 9. @RA\0S\$9T2 $9TgP: R,\;!  d)000?K2K 9"K 0K$9TBP \ h8P@ | 劖th \0d)h匲Ph \ 8P* Y8PP  P  P I 0hP hP5 0 h0 "w7P7 Q7 P! 7R 7R 7R 7R 7R\; } ; y ;u ;@q ;m h7f7P 7P 66P h7Pp7 RR\7 R T7  h!87 @&0<h咟PB6 R> 52: 6 R8  ٕh 1h6)00 0 6  hP5zM`4@U` 0% ?A1c バბ ٺ0z 2c00x%`%08% @5Te85T]*05TV $$5T 5T \ h \傕Th ڹh4,0@5  hP\0h 74T& 4Th ah 幹\$hcP5@ 4 R hG P\ hd$̱k. \0 \ \  3T 3Te *3Tr3 R{\; u h ph <03 hPTh2 R \ 101K2TG5 2 R(  h Hh2,02  hP,h0 S( !ؔ!l 0hl  \ l! \{ ! .M*hgP !㺔\0l l! 㾰Pl  Q10Sl{/@% {].P  @X`K@&@@d1@5KEK A%K RKQ 5 0 l{/@ Pl0  0T C0T&$`i2i 1i iii i i i i i i i 4i8-%C5q gfff4i i iiiB5i i i i i i Ai86i(i| 8171 8#D0Tq`ǝPwh0 R  T\h n0h,0|0  R 0  hPNh0SK >\0 d  h00iZ@\0|S<:Vp h  pPf @|?0 p0 婼 p奼0@R0S@00 ⓼ %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p 5Px00x0\d | P\ 000hd0 |0 iZd0  |0R*V  |x`Bh0 a 4 50h20k \}h ,`4h 帷\0D#hbPh0 Sh3 RL  R 3R 3  hh 3 ᳠ᴠh ~ T h0+4R$  4R ʜP hDz} hD `4R`4 RxDh a4 ջ0h04h 峠0㴠0h0$0h0S00h h Ih4,05  hPh0\0* (꺛 0-M0LM PcR  0 R ;AKA A 8z 00  00 |0|@x0 Kp ̠0KPT0K z R4<0< Ca04#5gfff -LQM; `! 0]d 5@:7ܧ0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK \7 0%K5K?5KTK 070'5K K%K\K 7'6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK; @sdtvPK@&@c@{mP6@/`@K KK;KK 0@T 5 R, 0S R& UAoK@@@&@:@K{  @`l 04@K3K0O [0K W 4K44 R 5 ll4( K-K00QK3 ;Fg>PCP 0nK0  P+`!0+  P;`! +0d$5 @05%l3+%ac8`,\$$3( K S0BSKR/K00"2(K UK >K 0 2}-#00} 2P 0S P W_KVoK h2 0`0\2(K!0q828"Q1"W_K(KVoK01( KOKN/K00 0KPK&@@,1@K@ =KMKKw 0\10K8KKK 0,1,!8K 0(K8K 0K;}00/K7K'K 0|K;m #   : 5(4L4 0<B *! - 4 -LGMA0Sp!, 000Y 1 Rx10 S<0K ㋷8K ᇷ18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9<0K 5Kk I=L0 B8@7$[I4[Q04KD 0  0000 <  L8@ B0 DPp 0 P0 0C0 0 c0 R 0 R 5[000` 5e=5# 0-@LP, 0 t00t00l4# -LM8@@ ; #< Rh鳢l5 -L\M4@KP 03K2K [ R 0 S  R R2  2  | pb0S  㽱\23K@2K 2[[3K2[K3K 㪱2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@>["[2[6 ! 1QQd@K&W0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0#g34 Qh4@444v'N$ -LM;`P(0Bp S?ꬊ h p x 0H S$ X ܊ @ X `  000NP@+ᬗP l0l 㳀pT0 R    p-LM@!0! 1P` 1 R x1  , RT BRP1   R p41 00S x   0 8 0 \ 0 qdp0 ^0 V0 t0 h0 \0  R  R40  R; 0 0 # 0-MLM@P800000|1 R;  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽  ؍ ؍ ؍ ( ؍ ؍ ؍ ؍ 4 000000000 #D -ML M;BKI0 I{ 000CSt}D -0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# cP`8 0(K 0$!  0  P`   JP` 8L0  @ T P`@ # p-LM;@}̀( 0 P `  000w 0S`V@PpR 0 SDP ppp0<$` -<0(,0L0  #0 0   p-QLMPC  R;`:; ;!:;`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@8p, 0, v; `p"#84 0-0LM P0 0> @P`0˔ R  ( P, 0B=C01; 0000# R-L Ҳ 0 0C SEꘕ ` ` ` ` ` ` ĕ Е ܕ `  ` 8 D ` ` ` h 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40"""""""""""""" 0-LM0@PShL L @ | З l t L h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @P"#""""""""""""" p-LMP\` 0@S0\0S p龱  d B 0000 0-P@0@@L ᥱ00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 00$`4 0-8LPJp0 R 0s/0000@0p  R0Z,x0 20h鱭 (4 -8LIm(P኏L8@`p"ˬ`0  0  , (밠 .8D4 -8LIm(P኏L8@`p"㜬`0     밠 鹏X8`4 -LM8{s/000, k`V( f8c@0S91!@Pސ@dDFA 02 Sp&h1b1 R0``00`ƐY `0;,o黐@ S ~2X@TZU @ @dP壐DFA@04 Spʄ1d|A R@0 @000@0 @ሐ@/,  ~-`-`?`,5|44 -LMjm R @$ 1 ! 00p , W00$ 0 !0*0!00 @@X00W00S@ 1  R 1  o9ガ00 1+ 8P   1R010000 0 !0*0!00 0@@" VPᵎT 8P  101! R009Pᖎ 5544 p-LM0@Z؏ `R0000 0 !*!0S00@@@P2 ph黏0 Ca5gfff -LMC0ID`@Dz!D20u? @$ R00000   R 0 0 0 @0S(("@P冏@dDFA@04 S1d1 R0``00`n10C1ꔀ匠@@dP`DFA@04 Sʄ1dXA R@0 @000@0 @ E@-`-`?` -LMp0! 1?2c!c2c*l@jP0P0L UF D㕪 @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101 ɮ L$H0– #D P~HA`4 5-0  t0 a1a2cP  0Q P 0S!0S~H -SLM` 0 Z ʴ8?0N0  0A 0  pK0K@K @0 SK 0K@wPZ Pp 3• ৪P P; (3 p,\8Pǩ3   O+  ' #I- 0Z $ Ӳpڨ K0 K[& qm(2 R RF R (pZ (p@\ 0  @K!1@RTں1H"01@<2P @dDFA@04 Sʄ1dA R@0 @000@0 @֍0@0(p}@x@0S @0F@00K@Tڴ( T(㴍@AP0S@000 ᩍ@0S  „@0 R~Q1ᴠ01(s? ( p9!0R ʴ8 ㄍ @Ap|W(p$X  08458H4p4 -`-`?`4A`44 -LCDMSd0 0`, @` h0 +ھ00 S0 N`0 d dPK [pK!`Kh 0FP\K`K  80K;PP 8܂\0[ R 8B,0 S ,巫{͆0/\[ `{ /ᘮPp ;P@ 1 8K ZPm0 S㶓 < 8/L8@b1 I͆ _ ` ì  㿬 㻬`0`KⰐ`0`0 岀` 0`0 h00l1`00`0 P&   8 , 1 R$  0 S !3h0  8 0 12 8!8 8 8p8*XNRT0 B`0 d .$` 44L48 40544 48 4\ 4 0-SP@L 0P 8 0 4 0-SP@L 0tP 1 08 ڊy0 4 -8L`@P80  P f 0T$`' 45 -LM0 T2Pp40 0< 08 @ "0T4 @0T<04 T< B404 T0DD4 @T04 T04 T0d3@ SV W+K,K @T%pWZ4 $@ @^@ 00 <k08<@ R8  ,0K+pKEP Z8 ,0K`008  @D,0K TT"@@EPZ0@,0K@D+KEW \ pW80dӻ 4 4 -LMP8@P#h2@0 TT2P,0 p  0 0 , 0p` .Ϡ@0@nH$Hp@p@dH $h@ -LMCTbsPR@D3T@@  @ -L M `@ ,0 "0PT` 0T&40 T0 TG40 T 0T Z, 0 `oD,` 04 -LMP` p "0@T @0T0 T(40 T0DD @T0 T 0TYd@  0 D $@@T  0d< 0-3LS@ 0PP”T 0TqP”T 0ThPUZP”T 0T p-8 ML@!n,D 0HL P 0 ;4”"\ 0 "ph+ 4 l!!!  -!L 0-@L!P3<20@" 0 -LM@!Nh!7 -P2TL $ 0-LT2P@P $P”0PPT 0T0-Ð0\0 n3m3 0-LM(P@^ 00n3m3 -3LS @2P6T0T p- ML80,2D"0 !n@H2L"Pd d0e 0 ~4”"\ 0 ^"ph醆  H l!!!  -!Ln 0-@L!P<20@" 0!^! -3L $ -LÐ00 T0 ;$n3 -LM@ 0@$n3 Q-L@0 ?-#@?Zc?!NP  ARN `PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-LM0 00 PU`00S PU@ 0@}$ 0x$8P<⎠T⌠lp] <] -LP@Tp` T 0@`(R 8S h - LMş0 0 P)((, @4 o0qWk Ѓ8PP` ȃp5% 0 lZ   0 Q㸃00 p0 00 ᬃh 5 ᣃ, 0S 0Sp) `p$4%P@ p  0Sp0 p0 HQ@Q p 0p0 R, 0 0 H0S HH00 lK H e@TP0 @TT000 T0   0T0Hp0北H$`5X 4 N -LM@ p0  0p0 p-L M@~0pPt`x0p0t0~880V @U 0@@7p@5@4 4 -PLM@D 0R@ 8p~P堀`U UJ +<W0  p0 o~0 0& ~U*嬠`0 x p0 0RTp0x 00 h `P"U:@0aؚ0400 T555 -L M`84PP㈠ $8 ,    $g  $@\  p $0  ,p@;0  , 0-  , p0 0p0| R,0H⮖, h0@"20S  $ 0  `0`S  0Th0!20, h0!,2P0 000 Tlp @}0 0SA 0}  $ 0@.0T:x t0 0Rt0x  $@l0Ta0T, 0 0 000 TD0 R +000 0pp0 }55t5 -LP `}0piP $  $ @$}}@ 0T_ -LMP`pj}}N $0 @T ,P80 T00 0 }N $0 @T  P|@ m/} $0@@T ˃ 0T 0T_ N -LMP `p@ } 0Tc@0DD @T0 T 0T 0T @0T0 T $i| p-L M0 K `0  PP pX@ T \0\@PU HPH0 0Q S00 4 0(_],_<] p-LMt`t0lP P0P@HH D0 0S0b$0@p|(___$_ 50_d 4 -LM℠Pp@0 `V 0 =8808 40P( (0p_5 `(__$_5 0 (__0 0 (__(0 R 0 R(__ 0-@L |04 00P0 T0h| -0删S@04p@@00  LT5 Qb  $  0P T  0T0  T 0 Tdw 0S S  $ P0 +P0% 00 R  0 T R R)P  < \ p0 S0 00 0 T  $0@  T@0  T0@ 0Tß#00 S Q0Q3 r 嬱T ភ< ᚗx wPl 8S080m%0$04 40 Q00|000Q 00m0@ 00 ~e0 002  R |o0t 00T  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0%0  T  $0 0R 0  T!0  T  $P  0T  0T $ 0 0P000 00 @0 0 h勯`刯_ 4] <] ` 4  < 4 4 4 4 4 48 4T 4_4l 4 _'t 4 4 -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T d㹀p}N $0 @T 0S\ KpT  $0PPpT W 4 Q0- L@P Q 08S0@^  0-8PS@L <L4QK0굜PPl5 p-L Mh@V PK 0P ,0"  000(^ `08 v00pp80 -L MX`U(pK 0P@)myP(,0 0@00(PU 0HZXyWyH 08<0$00N Fy p-LMP@;y`L 80Hph0y -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 <@`p`B0 Xp0C$ 0P8 R <0 ,4 0 P@ 0P0NPP`  0 0B@$B -LMxPW$`K 0 P@)xp$ ,0#  0@0(0(?^ HxxH 0p8y040 0x p-LMP@xx`8 0Hphmx -LMp, 差h— lp2  h2l ,* B: @P0  ᝮTU  單0\20\2 0``V $0Z0``V &0Z>❟ ($8 0s P@ t2 |, [03iP @ 090_P @ 090UP@ 0`90K0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`h—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\dhBlp2 P h—l 0\` }h—lp2  h2l ,` Vb @`1`>V|  h—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\ hBlp2  h—lH 40\hBlp2  h—l80L \40#g ` Pa h—lp2 P h2lH ,` V P x1@Tp!0040`THPH0L8 %h—lp2 P hR3l1 \hBlp2  h—l ,0\d hhBlp2 ` h—l 1\`VJA`V@DZ@ 5P4@4 4 4P5 4@%I$p5 !l5 40 -  -LM HTe | H0S 8$T| al@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPpJuUU U m@uteh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2q 00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\ hBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\x hBlp2 ` h—0H l\2f  0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 RH]= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 復(N@gޏx ᥏p1@`㥏X妩hB lp2  h•l 0\ 咩}`\80\8P`\(}0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pLd4x!5444 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@Lr(PM0hr -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p啧4 -LMT2p0T2r0H0,08,8xrT $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200Ê3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0#r`r0S R000R0 A60S!0\@Px R 00c0C20000#2wq`q$0S` 4 00hB lp2  h—0l \Z0 00q`qJ@s$0S  -LM`@(0 S4p8P!P 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@> T 0 0 m9Tph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0Ps0 QhBlp2 h2 l,3 `VZ00h/0S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`EP, @ ?P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0i,0P @, k4040<0<@   t140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $pZp08 08hBlp2`  h˜0l \0S 0 R ;pP@᲌` yX0 P0 ,!u ,(0=!!5Mb0 0  Q-L 0S S 0SQ 0 0 4-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@<T"! 0-L@oP0ho -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y #!$$!8$!P$!0!<00  P :o@3o00S  X 000o{000o, 0r00  o+ RP 80(S"ˠ ʠ0S80 S0000 555Ԏ555 -LM04p@Pn`9n0 0004iP -LM@P0p14 RP80 TrWL1 R@ƣn`P0n090 n0 ` @0 pnnL0$ `Rp 090}on0 #>WS @ $0S Z002sn`P$` 4H4 p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@P 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳0*!*!(!(!(!(!(! +!(!(!(!(!(!(!(!H+!+!+!+!8,!hB lp2  h—l 0\0ISh— lp2  h2l , }hB lp2  h—l 0hB lp2  h—l 08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0WP`$ @ 0A,(0"A 0 P `4@  D 00ph(04 0,08`090oh0  o740 0P  -LMP@0h0pSS 004`090LP40S hhp0( 90 ih P40S hi4 - 0p`L<0@@phP4zh 0-0L@P80h -`V`V` pP0UL`p` _@d 00S APP U 姞h_p54_t_44 -LM@ګ0 00\ h髍ꄏ5 0- 8x 8#T0%PLT0AT 0S 0* 8R(0 4 t_4_ - 8h LM8#0!P @0 A0T S  0S  t_4_ -L M @ 6@na"hA! -L M@ 0@^a"hA! -LMD0P#((0"tP1'ATN T0SKȀ<`(P 04000@`;00g@ig0S 0P*0SSS <`00$0P$0S i40 < 8dppx 88#0 p忯44WEVhA! 0-@0P @L rP 0000P05 -LM0s@S* 00 0000 -LMq`PU @ 0@}P6PU $00<0$0@T0 P:00 Xf@7Rf004;0000 `\ @1@!0 H jyP@00d@0 H y鈏54 p-LMPK@` 10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$:  -T LM@HT00  (0R *ꐏ55h_$4 00ᐏ5 -Lp`P7@T@ h R(( `@ pp00 <4L45 -l`L@PTp P 0S `@T$h0T0 hꔏ5d4 p-T0LM@PT` P 0S @Tpp锏5 -LM@h 0-pPL0S`0@T P@T00020#J꘏55 0-XPL0S H0@T P@T000 .꘏55 p-LMP60@`TL  (`0#papL4 -LM@ h- -LMx@0SlhGdE@T BLP0 @@ 80 ,2@T锏5p44 444#4 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0Q505 -L[ P00@-SP@  0P PR  0S0P 0P 0 -LM@QĚ  0S4 -LM$0p@$0  P`y Pq P  $0S $T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K $`444`t_p_5l_h_4444 fQ 괹# fQ1괹#4 fQ 괹# fQq괹# fQ괹# fQ 괹#0 R 8s`4$4q ˔괹#Q0 2`$`#괹#0 `5`5 -0LP4M 0X 0T@K@彫t0 Rh@ P`00T尙LL00 R 0X  飙t_|_p_l_x_54p4@5`5 P-L 吙0叫8E5|_ p-LLMHKP@2 H` P TDK01@ T400 0 ,0( 0 $0 0 DK|`pDKP@@PK P  T@P P0Lp$ P x44444 - L4< -L/<I -I L)< -L$< H -L<H -L< X -`LQ 0R 0 PS00U@ hp P 000T@"0@S 0U s`a0 -LM鴹# -LM@, p   `P4` 0S !֘1(S! 0#!!0 V000 8` <` <P0SI <000~0S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0N p ,0 d儘 <000D~P0 `P 0 11` R0040  4444(484@4H4\44 - ` 3p11#XLP@0XS (P~P 3X0011 84 -LpPPP T*0 S@T:, P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CSl[![![![!+00 <0 @ @T:`*0&0/0d^ 0-L@\Px $t@ 0h4d5 -LMRP J0,0 @pT ,`ZZ2PP I0D1S3]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!\]!]!T]!]!]!\]!\]!\]!^! ^!\]!\]!^!\]!\]!$^!\]!@^!L^!h^!\]!^!\]!\]!^!\]!^!pgP@Tc P 0@^SXXP  <Ppp  n p d ] R 0BP ^SÖ M x F ` ? H@  8姖40PVp_444444444#4l_ -0LS !!00a0CS_!_!`!$`!_!_!_!_!_!_!_!_!_!_!8`!_!_!H`!_!_!T`!_!_!``!_!p`! hj 0A^Slld ` _ P  D < 4 (ܓ5#444444444 -LM @ 8h 괹#4R- R 0S0 \R000Sa@\ 0-LM|P* uP@KP ~0@vP KqP00 cP \0 0  0%0 K]PhNP TPP{PP 8<{PP ({P 44444`t34 465 -L@PT`p@Dt @ PDP TP@Dt0Pl_p_ -LM@ P2 P0( P) P0" P0 P0 P P P  P p`: P 40,P (`l_p_h_$4t_4`44 -LM@P P hPP  P 00c0$4 -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @-} 0 s0@ PS@ P f 00 }  } Z$PV PH4$4 p-L M`KPpF0@S@ PKPT T K 0 K 0C0 30@S@)00'$4 p-L M`KPp0@S@ PKPh `RT002320 0@S@00 $4X4 0-@QLPJy@TZ0 0-@QLPJn@TZ0 Q-LPp`@00eT : 0c00e000N00eT:p00e0$`(` p-LM<@<`04Pc0c000p$`(`,` 0@-L~S 0S; 0S8 Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00 0c0c0 0QWu$`,`(`555_5_p4 ` -P@L@PpP`P0P @D@PPP P  000c,`(` `$` -8@LMxP00  0@``0`0 00`0``8 04S00 0 0S40550``0505 -$ L0S 00 5 -L 00055 -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U@t T_P Q:P00\P0S0p P@$0?Sbv!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v! v!(v!0v!8v!v!v!@v!Hv!Pv!v!Xv!`v!hv!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!v!    .P@ -Ő:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P4`5``t4445(`4 -LM||`P0Ulp@qx0T UPe > PUP0U00 3 P555 0-@PLP % 0S cP  P h 00C0\@P  0SU00hz0 qPP454 0-H1L0@S4!0CQF!0D]S& T T T T 00h 00000P@w00 0 0 0n p@x0 0 S 0CRL000 (00  y55555 505 0 0 lQ 𠱞 554 -LMS@ \00S SL L0L L0P 0^0?l 0я 05444 4(404 p-LMP@PLU` phw8`t0 ,$0kPp d^84\4#@44 -L MP@0T(*$K(pK,`K$$0 = $f , @Q h0( \$0T\ ((0DS<"0T:,0H]]x4|5444a -PL`pHpAP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 t4 S 1!0S 2!8S  a1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@宎,1@@DT$@D⦎T_ 堎 00CS0 00CS0ڸ0 R劎E冎00  0 00Sv h00S 0So P00S 0Sh Hpf<`@`,`8`4T+544`455 -LMp0@SSHP S 0S iX 0  uP{i  T`0 Q00 28 6S Q 000<`8` 0S00l<`P0pQr  8 80, ,0 04`@`0`x_<`8`D`D0<08 pQ(0 0<`0`@`x_8`D`-L0H D0pQ, ,0 0<`@`0`x_,`8`D` 80cR   (0 0 0<`0`x_8`D` p-LMHP@ * D T h0\ `` T` T0V D0\ P00pP 055 0-@@L08PS0S0000055 - 0L@TT xP\ lp`bXd0 4P 0S<00hLp hEa5l5L`444 0-\L@P 2S P(0P2 0054 p-LM`P`@2S@T<phrPT0"2 000p54 -LM@ K;40S0:00A0 R0  d^ p-LM`@PrP  0S  prP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$NrP5H` 4 -LMP`@V 0FS \oXP oSup0S  SuP<4@4 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP xW0`p0@2S @T:0T0 P0(jqP5H4! 4 -0LM pR K >TP@`2S@PT P Wp t55 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5H`5 -PLPM`\p 0K@  0SV 000H` -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (sl RW xK| K0P x| P@hK0@@ x5$`|58E5\4h4t4 0-LM(P@ 0@?0H`-00 CH` -L\ L` - 0L0S L` -L\   L` -L\L` -LM$@TL` -L\ L` -0L0SL` -L@PMK!P 0Q0SH 0 U0 RX7PT劊P刊H兊@傊<<0 4|a8`x44t_8s`444,40`D`D4 p-LM`P pP@0T:tPt@0T*d0pP 0 @T:@p0#pP 0 @T:4ȕ55]]4` -LM@KP -LM KPK -0 SL 0  -L \   00 -L MbPh^KP Z PT@K_P RP,NHE444R0 0 0  -T LM@HT 00  (0R ԕ5Е5 `4 0 0ԕ5 P-PL` @T pP 0S @TP@ 0P0`0 000 $m郉0S4ؕ5̕54<4 -p`L@PTp \P 0S0W: ` @Th^ 00hؕ5d4 0-LMl@0S`0hLXJPU G@P@D ,, @: PU0ؕ544 444 -LM@.h 0-LMPKP@@$ h0 0-pPL0S`00S @.0 . 0l @T0!000̕5ؕ50 ̕5 -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@ؕ5̕5 -LM0PhS` /S+ bS` `$pK 0S /@x $ h嗈$ @PX @ @0f0P,`lS04#@4l_p_P4 p-L MQP@D00CS $!H!P!X!`!Ԙ!!0 bp-p0 R 0lbp`0K0,0 |bPU 0S0pD0 R< 0(`$p5 5550K`p5t5ܕ5 -40LM @R sp< pH] 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@هa@0a S_R@ zTh͇@n3tn3d4h4 -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 mV@xq l0PS`LK0 PBTU@P !0001 ,0S ,o$pX T KT@ |T0cP T K0T0 q0X P=U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQ$` ` `l454x! -LMtpP ` PXu  0S %D@ @0   ` `<] -LMP@0`p 0PS$ KP $P0 %D@@@0 Œ000 ` `<] -L0L0P 800P 0$0Œ05 `<] -P0LPl<00P  Ġ 0 2 05 `<] 0-LM^P@ Plx0P 40`0Œ000,@0S PP000bt5 `<],0,P 0S0P5 ` -d0LPlP0P  404 02(,5 `<] -$0L0S ` 0-HPL0@S P0 T 0 ` 0-`0L @R LP0@0C000PS T0000 `5 -@0LM\0 @T  ` -1LM1\@pP P  FP`^ 0! P?@0H0  0lKD h0 l` @P P@0\ K0 P@?\80S @V F 0 SR@ NFP @\ 0K0 K@0 | x t pP \0K P0@\0 F\ %`$`4 -LM!N, ,0bP !0gP!hPl!! -LMr@W,1R2p U8`40: ?㳀-Π@4/00 000E ?PPY( n0 S|0 0t0@0l0 5\M\BgM U? ? \!`!l!!"4 -L3 S   -0L"R"0 0 3S 0-L@mNP30hdN -/0TrPR`L`"0H@T|"$@T2S -LM@  ㏃000hl4 -H3L M 80PbT5(3, /003 /0 `"0T2   0""H0T" 0T" 0T"  0T0" T2SHB0l" T0d" T/0h" T" 0T|" 0T/0`"A0 TP|@d"0 PTU@4pK P@"0 PTU@4!40O000|" T0`"0 T0   PP"0 T0" T2S0`"0 T% @ %5;5H0 ,0S P,l" 0To$`4 -LM5=@S 2/0Q| @T 0S1000! B!1q <Pf? ˜2 \$Z  PX0ᮟ0 (<U!<3 ="PL1    Q (q/PBTb0 P`"0T -0 0Xp"0T%8t"0%\Tx"0T/0`"0T00("Q 0 80 %n 95;5́4 -LMPbT@_0B0`" T|" $1 )Rc 0`"0 Tp1p!”0"c\TM , K 4+[0[^0'0c "*1/0a0` 0 A S0AĀ \!p0^:0^* L("(P+ [ 00C0Q0ԇl"0C0 T0)S 0< ⠁000, K4 -LMPrPT8`O0`"0 T|" $  0|" T40  |"$ 0 |"T|"  0T  2 R; 1l00l02S' /0`"0 T |" $" $" $" $l00l0Nt" $@Z p" $ T@t00t0x 5 x ;D %500C(0 $1/0T"PB, P`"0,T0- 0 0Xp"0,T%8t"0,%\Tx"0,T/0`"0,TX0?("P< 00 %`p" $p00p0 -PL@`JK1TpT!T7*1T" 1T p 8K%A0@S S  Pp5@05Pp505 0S82Sp T 8J4Pp5@p8Jp0T d0TX0. @R\0S\<0T!.0Lp2i 1i i i 5i i 6i( (0-"(L8@TPP h0< 0\h00hH7l00l00 -5L,p`0 <5 00 R0 RQU@ P5<5 Bf0S I 0  U@P5 <500 R -LM(p"hhJ@( yPP8  !1 01$0  1 NJUp 0(KV`@0*% ,0SIV',0S 0 000C b b(0"HT@! @—\  0 0d8#hP, 0J@x$ J$ R 1 0+10 (, @40L000  p:#04 0qcp=@0 <04p<@P`40\ 0L 000K0P@ L\ ` d $`LA`-`-`?` -LMPp` @_ (K0GP@ X( H0 (00(,00 -00L9$0 &L0 5$`$`$` -0LM||p@P!f0  P 0T P0U$  P $`$`$` - L| .601 R 0S R R @ J40S$`$`0S R00  -PPp LpQ  $ -`L@ 0S(0 @@aP?DFA 02p Sb:p 0 S0 0 000 ?'70 0-`-`?` 0-LM0@99 90:RP9 HP0SP U P0I9P[?09P 09<9 0@9@0909 09090909090@909 040 0$ 0 PR0a/K -0LMR`(0 P1 HP0SP U (PP5 ||=P @ pP  @yP   @q0 PR(Ka/0`( G-M1vΌ \0000 0c?0cll0 Lb1a/"ba0l A ?#όO$/LNpBNa|P0PP 12c!b  <`C<2c2c!dV!B0 Ѝ*Q989QA0!0Q0CZ 0-LMP@0l0C0K00K00K0 0K0 0K 0K0K Kz0@-0 @  0@- 049 0@ 48<0 0@ 4 8<0 0 $*000 0-PL@Mt 0h4 -L M, 0@000 0 $0T` p,?*Z2V/00Ǵ`0㸑 P Sa!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!2P`V  ]0p0@00T:$0 p`,, 0S000  $0,0  00a 0 P22P2pf`0pf `【 \P2 s2P0P44,K`dK` -0L@dap SLP!`!!p!h!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!p!!P$0  ("Q *0$00 0 e0b 000  ] 0W0 00000`PCpP `s2P0`P44,K`dK` p-L M$0P" ` a dR^!0S$0  S! 0@0  $0dp$0 p40@-0 @P $0(,# 0000CP 0$ 0x00 p-LM0@S`P0- P$ P00 |00 0 0000p|PXP P0 0 |00  |PW O@- @ 0p`P$4@(8,P?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00Rp?` `! P2 BPNP  -LDM4 0 0 0480 H  pD 2lVH0@L0 PP0 00 2<64&460s4@0S@3 0#2A TL0 bTX TS%T80BPP2 `RP 00@ 2PP@SL`Dcp`0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  \*!l0!X0  @00@04 00,00S0c,00,i0C ="=",?" p-L$M@P0`   K0`'P0Sp -LsM , `Dܡ  ! 1 儀 |` Kp,PPȁ ́ @80S P104 ,0S p,@L0 0 PPT0$ 0 0PP`@K 40PPoP  KPPC[B $D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ BP!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0,"-"-"-"-"-"ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0 X c$ܡ  AP PApH0!>0kK1 ̑  c. . j?K!#[ ̑ -$`@4 -L,M 0 D 0 ) K3S`@  gP1D RBB#p  0@tP@01 1PP"0PS@ U3 410  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%0"1"1"1"82"l2"8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R h[A#Z@@@ )K@\0 S*d-ZD   D0P@( ) K P ę5P45` -LLM@Q@D1U d0 ` 8d0K00pW "[-Pp@ `K "[0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 >p`0S -L MBpBP ,0 ""` 0@ P@"@2V*0S @T:@W "" 0 PP: !p  0P@0 S 0R , vFP -L$M (14 D @H `p 0S$ rJ P 0 @S@R*0 S  R:R*0@ S S8  Q Q 0S< 4 # S S 40040 0S S SQ 00 Q Q Q Q Q @ 08S8 0!0;L0  H  0 00  (L0 0Q0 R0S .,K P0 (1, 0(100,0@, $,0, (00(0,,00C,0,(0<0  (1B0(1* PR00 4 @*?  ! P< VK@0S 8?@ !@ PHK? !(10w+P?00 0i0 P0D4!(10(1 DY(1! 0(1,L0 001H  L0 100 0(10(19 00(1 0,4rYZ P% P ?F!0S0 @P) @dDFA 02 Sp1b1 R000z)>0 ?!0 001H P_? X,ABX45l@``-`-`?`\4 p-LM@P0c0? h Ad`A (I 0P? `p p-LMPU`% *@0 PR@ U: @0\0 ? 00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV fPp  @ Ȍ qΌP00 ``;P@0  -L$M`. .\@0  @,  @p;Pp@0P 0  00Pp ,0R   . . pA -LM@. .\ 0P p`@@ ȌqΌ $; p-1!LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp,?" -d5dLDM"DH2LL8^1M뒆& 닕4e"뽼#w# ş0 0S 0 0D 0 `8 R08 P<0 < D0娔0S0 0$@`D0x4 ,0l4 1 1`4 l`X ` GD C< CP@l( 0P,4 $0- 0:N0`V000#3@p@A Q-@Q0@0P K3PK@cFF_Pp00 0BPP@`0*`144,`E(3 >0L! C"`Gn/0S P0S.'@HPK&' "@11@T|ExŸ0 @@ @P@H-@0S P0 $"@e>0S@320SPa $09$00 PP 00!A@0q0@00 P 0 @00@0 0X! P Z 0000Z\1 jP_0 bPW0 Z>$`p'`o34LF`(`DF`H`$`(`%`52h4@#M#H%` 5t)`nad)`T)`&`a`a5$`$`H"p4q`|4d554``4)`(`d'`)` +444J"44J"44J"4 4 +4,`t5l'`P4<0< PHP0P P `R[M@;PPKPK,PPK! tG0@@y20@>4/ -@ LHM0, X 00 TK0P0 T ( 吾P0 S$ e\c\D}P4`44 -Lf9`  ]> f9 RH02 0"2 SA' S~', y0 00202a ,5>,0@f900202c0 &>00Pf900202S,00000''' -LM@`p PK 0S Szpp1 Q300TLXPy90(0 0 R 0S00PP 0 0Q 0V  000PW 00,00,0 0S00PP@  0^ R1s 1 11 ^ PR1 11d+` 5*`h+`d4 0-LPKLJ@9U(   @00@0 R @00@002P0020@ 00 00 0)`\45 202 -Lp<LP@ J= R@00@0 R@00@00\2f@0 `P0 20BT0Ҩ 0 ' `3' ZB `@=B =!C= =00s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 )` -pL2`0C(2P@U R ,00,0 ~PU@Z000Sl0202S_PZ PU4Q,<Q|hoLp1p!@P@dDFA@04 S`ʄ1d8A R<0 <000<0 <<&0 @P@dtDFA@04 S`ʄ1dA R40 400040 4Y4꿺'''0)`-`-`?` -PLMP`= Q ,0 0SW ( M 00CS 0,00C,0,0 S( p,@0L!p|3,0Sʸ0  0S 0S@ R000  00C0K@p0K$8K @㲂Kp@ 0 㴂K,0,0C,0P4p0K$8K@@㲂Kp@ 0 㴂Kd4d+`*` p-LM0@AP3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -LMŸ@,p \`P 3 R \0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 Ve1 211 21 $` p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PcH, (@0P@ZH0<5l4l+`t40,` -4 L014 s$ 08000$540$ 0S00 Q0 0 0S0040$ Q  p-LMPP` 0@ 0\ P 14` 01! 0 00 10Q p,0  $`(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`PU0  0 00 0tH@C5P@ 0$@$  00S0P` (00(0 ,00C,0 (0,0$2l+`5 -L$M`8 )P 0S ,00,0P^P$< B @ P !!@4 ,PP?4p P" @0 :0GPUp  0<S< ' 90 P  - 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,10@K Z,PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 80` P (00(0*   (0  (0W  , (0` R0(0  (00(0 YGPP( W`4p8 ,0( 0C,00p,0 0 p p00gP,   ,0 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S T50,` -LlM Q$P  S& 4 P,/A#bl p p@K \0 0  % 3Pjp X4R P$002c2c30 xKP t0p $x0P 0p 0 =9@ =C  0p p\`YQ# 0#00F0U/YAp0Sl0S x@Kxp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! W+l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 u1G 0`01 ' 0 (0 0(0 00C0ZHW " * PYp ` 00 0 @(  ( 00C06800 F ,p80 P(00(0  B  X, Z ⌐ p l MbQ5?B|4 -LM0@$P`A@p 0 S ^a000 p-LMP$`pW208O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:ldF,0$80HZFP4,00,08  4? KFPl+`0,` -LM0@  t h ` .0 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT 4 0 P!450`14P 0@4P40Q000p(0 8\ 0< #4# 0Q80 @!8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40hE40,  , 4t0,` 0-@L P00  0@(00(0   0h 0-@L P R 0 0 00  0 (  ( 00C00h~P(0 0 (0!P -L$M`"0$0( PխP@8pW@ W @4L"Eᢳ0  0P@T0$0!0@;00 0P@1 I 0  0hP@ 0  @p ,KdP@., 0@0b 0(1 Y#q0S  p( 0TYT$1 !S@#@3R 1$ R: 0S* @T  0 4`DP418 (1TP#2@0T00S D`55 -LM,06KL ,0D P0H" ? p1 1 Q Q Q 匡 0<˟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Pp*m!H0P `: D@P R   R? 0`SDd:d*@P@dcDFA@04 Sp0 1d1 R D0D0D00D  HH00H0 D2PUp H0#KPP@f7  42 _'Pp?KP 0"RX 4"*P42p` ?WpWKH0C0Q=8QL" 0pH C8P'l? ,06,08(@P@dDFA@04 S`ʐ1d1 R 808 08  008  8 8C0@ H0 D"0PT2 U 7  42 &Pp?KP0"R T" T" 4")P42p`P2@f G0 `R T< 0 P"0100b0P 0S42 pw !P0 L2h0 P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00`Pp;42OKcT2( 2 K P2<$P, = 'P& q |1S0# 42 8342  0> Pp fp@00@0, p0) 1, V  RD ,07,02 ,0<,00  0  ,0bD%P'@BL"p 0LGz G<,0S KP:< H2 K( <P.,0 '?l 1S H R < S <H0 3  @0S@0[30@0S,06,0K < ^l?s  ,06,0 @6/0 00000 0  0\~ Pl ,0@7<,0L2` 0" 2 0 " 082 0S/KK 82 3XVPpH: K␯PpD 0s@ Pp#H@"D00D082帀8"82<@"82$ 8(00(08",00C,08(0,`VŻ*<; 8@妰!P0Q68Q AL"p 0]T'PT@1@!@P@dDFA@04 S` 1d1 R 808 08  008  8 A< 80R 0R0R,070H,0V*KD00C +?D} $`54]-`-`?``l5Z5 -LMp$K4 ,@P  `@\% PT4(  01 B10R,0 P@( ,K G%Q'00K@8,'P4( 0,0 B0RP,0 ( 4K  -%P@"`V@J,K "%Q'00K@,r'P0 ,0`V0P,0 Z  %@P  -LM40H<`N@~VpNP0p p@ "&H<. <0@R p` @@$0S{G<  됐<(KL <0x !0 `` #`V D 0,0(00, 0SG454 -L  -LM40`S  ,0  ?,0\*;,00 (1!S-P-M-D @0S~   8 0R10<0<0<0 Q 0 0 0S0 0 0`T@ T @r!)LP,0 + QU@,0"[V? \H 0\0 V\H0Gv|0 G&,0H@H@,0 |1]T0S# H@( R ,0 H@((1@@>1@H0S!000h(, P |0S P0000DqꩮxPhP * b >H,0(FG:!$ )EG`PF`$`$`na4 0-HP@L@<08 S800$< @P+  R 0 0 0 LPP0P0P 0/  00CS0 PH>D 00C0>0>*qG`E`5C` -LM,0@ h3F -LM8@ $0 @@@9" -LM 0 ' -LM  l  \ \  @@    0 0\$  -LM`wP@UD ^P, ^ \\!*P#HKC00 U  t0S: p0S*} 0#0C06 P <@P000X(1@)II( - U*x Q*0,0,1 1P6, ,0  0 , ,0;0,0 < -0@ 000 !R !@00@0, [, U e0000GD1 Q ,0,00,0,0040 ,00,0@0@0S@ @0D0,@0@D0,0H`6,0T0@PSL0T L0P00TPl0T0,t T0 P0t `P  1D0S10S1 ,0L @P#T@  0P@,  8 D0 0000  t 0S 67cAP@,0  4 H H40RX088QwC00S 0 0P 040 !R8  00 8 < 0 0 Q40 0!<  o)  j) " @2  1 k$ 1Gv0C1 4G"40,S000000000QP4 R ,0 @0 <"@S$,000S ,0 P4 00 k *!140!0400v/ 67c@Y,0 @0 0000  =, 0 0000  / 0 0 000  $,0e$?y,x0 G55 e^545E`@#M#C`-,`,`,` LF`HF`DF`K"K"Zna4 -LM@P P80Q 40S D1 R QPF` 0-0-LM@0lKP -@ @P@ 0 0,ό,BU00p'` P0-L@8P P04 SB$`4 -p0p`PVL  P@  e'$ p0P`@@@-`54 0-XX0@ TL  P0 RP q@T0錤5-` -LM$P`p@1'0 00 00 00 p`pp 0- @L P 1S0PSP0    -LM09@P` ]0y0p0`4` 0700700<)8 R0 y P0ES񟗕P""x""" ""0 0S]  0 V6 00 00 * Q @ Q 00C 08 000 X80 S 0 % 0 0S 0S090#0 X 00 0 0@k" 0P0C 0 0 M0000 0S L?1S 1 8C(0 11090 000 0S H#0S0Su0? 0 0S  0 0SUl 00 00 * Q Q 00C 0 0U:00 00 00S0 * Q Q 00C 0} 0X:0B090 `1SP}013 110S0  00 0 0@! 0P0C 0 M0S0 0 X  00 0 0@! 0P0C 0 0 M@1S  0101 1S1 0SR0\ 0S0S00C0 0 0S0 :0:0 00 0 R Q Q 00C 0 0X:^0S 00 0 0@.! 0P0C 0 M0S0S0 0S '"0S0  00Cr1S 0 0S 0  >!1S0110C1!R0S0S00C00W 0S  0 z0Sw 0St  0  0S 0S R \  R V 090 `0  P090 0@ P  0 0S 0SXM0S 0S0S  $`pp@ 84@T4x44444D4|4 -LM0@S0  !p(B(O?0XTH?0 0S 4h>?(;? 6?444444 -1LMP`R P_PS PMPppQAgA, 0@S1 V0>0nÃ0g`ƃ. Bl!l00 0L PP -'PU`V 00B- P"ʀP P P80B`PK8 t'@8  0`@ \@ Q @P Pʄ  P|  P P Pd  P\  PPL PD P-0ꨤ5 -`d 4@`A`A`A`dB`B`DC`C` P>0à PP PP @P@ P P   P   P  P P   P  PPP -LM0@ ;Ph? -<0LM   @)0Sh,$` -LM0@ CPhY -LM @ PhI0S00 00 -0SL M00` @ p(P|0 P  0S 0 @ 0 P  #$`o3 p-LM@P`@V0D  Ppph -L$M00 `0 P43Q&Q8 , 0 b< 00 @005000"@0000<000K0D`40,p0 40 S} 04 a Rq 0007 0@ D0 D000$;T0 H 0S8<01 0L | @ t2Lx p@000P<9o3L5"4#421#4#4 $4Q($4`$4 -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *90nS& aS @0(T00S1@TL1 h 9wS0S! P$$D1 1U4pP,0p0 R 0S΄ 0 8 08wP 0d 08|8x8t8pi8$4LF`$`$4PF`$4@4x 4 4 4 4 4 4!4!40!48!4H!4T!4\!4d!4l!4t!4x!4!4!4!4 "4`400H400D00 0-LQ@P 40Q P DD1 R 000D 0-LQ@P 40Q P DD1  Q 0 0P 40000D000,0700 000 0-L0\0P   0@\!:P@0 p-LMD14@ Q ` APU  p4K400p p-LMP`U6P1 40P. P@ PpDD1  Q p,0  0 R U4P 40U phP D1  Q pD@p -0P` QL@p pT  `X  WV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U SPPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p {pT  s`X  lWV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T DA@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!|P P,0<,00 R*0SR:0 0S 000 ZP -LM-P@00G` 00CS0.G` 0-0LSP P @000 0-L@P P000 0R0 D1  0-LP@P0 0D ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@PD P ( 0@T@PP2LF` -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pPD @T   @@TpPLF` 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @@e02 p-LM0(@KP `P0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSHL"L"T"T"T"`"t"L10S0S0P 0R W   Q0 PQ0ba>0>0  00ab0PP0<@0 /000B0 P555 50S   -L$M@ , 0 40 /0 @@0K%@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% . p0@R/ "M2 0S @##mSPU`!q p0奎 @K3'  ,@  4X 8< @K@KP à ]C@TPa`~ pà &z@K( u4@@K Y@B)`5 0-LP| 0\@ IH 0h&00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L*@ 0 0 pP)00e^H`$4<5 00CS0+H` 0-PL@ 0S  L000@0000h\0^ L L0L0lS RL0L0@꼤55 -LM@ T T00CQ000 0 S0  0S00h꼤55,0 P L0SP5 -LMP`p P@@ 0R,0 jĤ5|"(0 R0S RĤ5 - L0 FP0"$4$4 -LM0S7 䀟` PRp@ f  P` RU@ 0PSU00000  \U@0S%Ĥ5)`5a4@-x0 p \ @ 0S \00  0  0@)`Ĥ50@-P@Q9 P7 SM ,0 4 ^-("("("`"`"`"`"`"`"("`"`"`"`"("("`"("("`"`"("("`"`"`"`"`"`"`"("(" Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0D!D 0S -L M$$@ O 0@_($4<5hI` 0-LP D)$O/@0810hI`$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$0?*hI` -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0 PP Q P , $00$0 $0 0$0  -LMP0 A` p$@ 01 0!000W8<0; 0110 010@ 1 10 0 10110 010110 01Q 0! Q 1W 01(10(1,1 0,1i(1 0(1 R,100,0,000,040S 0 0S ,07,0,07̤5D- 1B#20R00S(1 1(1R̤5 p-LM@,$PP ` @,1 0,1! P(1 0(1101 !,1S0 1,07,0P RPp̤5 p-LM$1@0P X0`S S `Np0$!8< $!S08<$1 $1010 0-LM$@$!1!010P8<$1 J0PP 0$4 0-LM$@P1 10 1Q#P0 K 2 P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 P 0-LM$@P1 10 1Q"P0 PK P0 1101  !0 S1%Fτ"0#1%( 3(F S P -@LQPp% RP` @ 0zPTr 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\09P V RD@T 40S@@T,  0P V 100CSPLF` P-Lp`P# #` P @T U 0 V  V 00V U U U @@T\P@ U 0 V V 00V U U Uhi -PLM@L P h p-PLM`P @T U,0 ,0  @@Tp@ -L M,A P`p$@,10(,q$ai%0$!<  < $!@ !$10$1! ,1V0,1 0!(10(101̤5 -LM@,pZGt G,X 0G a(1$1,10  "0S00ć D1 Ru P13811%711, 0Y1a -, 10S7 S 1 Tx1  ,o,   W! U Z 1010S  $5,0H{Y101Y 0S010&.02S200ć,   20Y00S&10Y00S H1,0V/p1 _U 10S ̤52$`8_ -L@$!,13P & `!(0@ !, , $!> S6 $0D! 1 S S  ,1 0140S  D1 RHV?,  xP(+qV gPH],  P 0@$!101̤5$4, H*010,  -T1LMP@0!q$@ !$1!S0, 00 ,!(4 01, 40 00 R`5 #101$1$  $!1 ,1V 0,1 0!(10(1010<  < $Q001$1(1,1400 ,0  0 o$`̤5 0-LX, 0*00D0, !@P 0h$0$PPZ̤5 -<#LIM0,  ,0 Pp  006:D R @0S Ÿ,0 S ,D0  00 D@K |"01p%,0dK- 0 @ P ˭P` l@JK 0P`80S ` T0 ᡮ@QV Y, $16d JKDCK 0JK 0̲T!L000Y/)L70 pK|` $t` $1|K\0 (!T` X 06P0 &L  Ơ0H ­P` 02P`, 7[` pPX`P`S, @ (0 RK:$`$4$4X`Z`5 - L~N -LM@P`p[T0EP@S # # # # # # # # # # # # # # # # # # # # # #p $ 1 01410$`4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SyP 0 0S  l 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` P 00 P0-LP@T*@T:P 0S* !0S:0D00(%4 -L@`p PP0 Vp P  00 00S0@ R0000 0 c p-LMP @T @Tpp@T ` R0000 0 V@T8 0- L@PP( 0 S600|5 $0R0000 0 |5 -PL cUp ``@T @ThQ(`@T @T|5 -@ML0(( I@x 0I@rlL`%48K` %4 -LDM0`SP\` p} 0B Sw!XKEP@BX00C Se######## ##T0圡 S PC\ | nP@`!X)\`0 \KA0TK 0 @Q X PT  Q  y@ $\ 0P@  2\K P@`\XTP-D@iP@{`#lL`xh+Xn%n$T#-̗!Xc% -LGM<\, P`p @ 0B9S9##########################################################,0 S ,0BES񟗳####$#D#L#T#h##D#|##<####(#####(#<###P#X#`#h#p########4#T#l#########4############### #<#P####5 s55 5ş 0Xşş 7h0 0K DPPW 0S0\40Ssp0|jğ0 L@P00W00SP4 D0MK 4 41P0GHC y>m:04,4 G0ğ0 L@P00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOKᱩ PP3Q 2R  04L 0@@2 2 (2 "0L 0\PX"T"P"(2^ 2R  0kL 0-%ANK 08 QPP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0eL 0^L 0W  0R 0 PPTL 0?-= A$`0%433355 50K`dK`,K`L`a (`,J`L`35 55 ``5s`a0)`H`,`w`5055l5x5d+`x`h`x`$505 -L M@ \QP@@ 0LS## # #, #D #d #x # # # # !#L!#!#!#!#!#!#2 -1!0 1!06!0 0b6 :CPx10Sp19PX1X!l0  $!A 0@@10S $KP $0-̀0S p0 pJP0dSd00SV h00SX0T0P0L0L]a5]na5@4r`5L`\K`5L`4K`hL``K`dL` 0-LMPR@@ K P0 0R 000, p-LMP@`  0STRPPP  0T0\00S p p p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  0T0\00S p 'p p M-PL0@ 0 SR0 \  0 @ -LMP  -LMP -LPp` @>U  0S*T S 0Z030#WQ$U T 0S: @0W0P00S 0 00@SC *00@C -L@`pP T 0 S:U T   p-LMP@`P  0S:T\P P  0T0R00Sp a p p 0-PL@P 0 S:R 0\  P -LMP@p`& V00P P P`FU@ WVX X`F PX@PU0h00h 0  !/ h+`d+` -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  P4 2< @T 10S Uf+#4*#+#+#+#,#0,#*#40S$ @T< R < 82 ,0S D  0cR0  080S 04 R * D00 R= 0H0S @0WSD00D0 4X 1/#4  P@  Bph@ BW*D B.D 8L Y/PY8/PBB~G,0 D1 RD1 0S 40,0 D1 0Sl00 Q0 Q Q0 SSPS ``-@ 8 T0LF`PF` p-LMPD1`   @P 0 1 0BRSo1 @0S1c 0$0$!018,C/S  X"10C1H0S40\2D1 ?`"D, ?  R; l0h2x0S0 1l2|0p20@SD1  Q020Q0 @@ =/@@ |B0 @0/@P P0p0h2,0M@S$A,A0A8ACXB@4{ -LM   0 @( 00@ 8 $0@ @DH 0PP@\1X@ ` (0@d0, h 40l0H0S40p0D1 0S40t0D1 |@x 0 @ 000 00040 0 -D11=, , D1 R' l00x0S00|0|0@t00 @ 00x ̊ |0B0 n  .0t@! !$1$1(!(!,1,11 3 V/ M? 3   N D1 1 0BRS01111D 0 R`00`0D 0 R`00`0 R P  =100CS> @0.10S1t 00K z_!08 K0 :, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0@!0S,0 =9C =C0 ,0 , 00 2$"0 10C1,0  0$P!01 !0@ L1@1  00 00!!00  Q0V/@1 1 0023Z6?B1 -QLTMQ0DS'P Y 100CS,0   V 0 00  80K`0 \ H D T P0K =p`KX @P <  XK[P`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt P`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKP`@P@*0S @T:0l00S0*d P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: `  0dKt d0 `,0  TT070- -LM@ 3Py0S| b PU ,7 PUPhPa2x"@`@  @L2  P@U`@ p ,0"S0f"  ,0 @ ` 4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC 00   T 0PU ` ,0 @ 4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U8K`r`r`55r`@4<%4 -LM8 p-LMQP`@ \0  Tph p p-L M\@` Q 0 pppQ0 \"\ 0 1PU P P 80K00,0 $0080pp 0"pp鸙55 -LM@Ÿ,0 82^`p@2PU 2 ~ {2.`pP倀/0S0@@,0@S00]Y P ,0!0R,0R  $10M PU?0S  1 @00@0 E1!, 0 ,0# =U,0 Y U !R ,0 $10 fPU $ E00P#,0S 0S010%P,PH]$`8s`P`L`1p` 0-@L 0PS 10S ,0;,00h0-SL 2?\ 00S00 0R0L` -PL p2 ?`@T 0S @T m 倀 0pGS10S0S,0夀010 4 4000WL`8_8]p'` -L 0-LM $1B1/AbP  PK0 R@@0P1 0P0 b0 Y0  b$ 0cQ=9 B =$  0 0$ h0QL =9A =C 0600QMb~@%40K`)`)`l%4(`?B 0-LM0PKS@ S  00 0-LM@P 0PK -PQ Q0u0 0-LM0PSX@ S0 D0  A0QK 0 00Pʚ;5 p-L,M `K@ P p 81(PK 0@a(0 $ =PA0S;{P0v0P Pp0#PS 8K4 ,08c00Pc0 A00 , 0 ,0  ,0 c00PcX0 A@ 0@ < <0 @0@KS@P @1  D00D00hLV$`1 &4 p-L1 M PK``l 0PR 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S 000  dp 0R 0R 0@ 0S$`d'`?Bna( 11 R00 p`p` -LM10@Sa#a#a#Db#Pb#a#a#a#,0 1 0S,0  >0Sx x000hh,0  V?Q1A 118&4p`8_8]p'`D t0< 0 0S0#0(0 R0 21p`8_8] 0-t0P0$S$0#t0L f@`01S0 Շ Ň01@-@@@@@@0 00 00@败5q`r`q`r` -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h W0TR0S <L4Isp05h&4&4hH4&4&4 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVq`5&4&4 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00q` -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0PP4K 08S,5\5 -@Pp L4`V 0 h$W  0]ĥ5 p-LM @`PU 0 phDp&4 -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP i 0R0 S0 0R,0 S00q`'4q` '4 -LM`@/PpU PPN 0 S0 (0 @00B 0d! P7$` 0\V@@Tʄ@T@ fP fAV 0 !R0,0 : 0V|* 2S00S \0 !R Q,'4@'4x'4'4'4'4'4'4 -LM @`P0pS[ 0S-RP WdA0S S2 $@0S R 0,10  0P , 0Q % U1S RR d00000S Q0 0Q B 0 R00$P  \5q`'4 (4 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ jP4  0@ P0 0h'F<(4r`p(4 -xpL@`T 0P$ R U@U00000 r` 000q`0  B Q|q` -tp@0L P `R $0S@0  P PT0q` p-p0LM PR` $0@S T pV V -P T8q` -QLM@0Q 0AT (00@T,00,0,00CS,0I -0LM@ 00  0@@r`-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <{8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`G0 0,8/,@`9P' P< (0R0# p3@#(4I5(4(4(4(4(4L50  0 r`r`r` P0-LP P0 RD0@T ,P @T000r`r` -LM@ @000000 -LM00@(  e  0 Se Rd `⓷H00< @0 00 0@ ,(4r`r`r` -LM@ LR 0@00  0 $0 BR  Er`r`r`()4 400Sh40O -LM40@0CsP40B ,KAh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*H0P@ ,,?BD)4 H D -PLX`@08P@H p`ݶ0p0t0h -LgMℑ 0,0  D!(0("4400@$04 T` 0$q$@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |x0L0 ,0S \,SL00< \4Z[^$`$`d)4<])4edA!)4h))4*)4 *4 -LM ZYP@Z/ 0 00  5 |#(|#`|#<*4, R  00SS 2 0 R$0t$0\t-  0f^ r`3 -LM`@pPP   pP0D 000 0  0@Х5f^8 0S00 R0 00  0 f^f^ -LM`Pp ^H QDP?1@ T 0S2 @T0NS `~#~#~#~# 0 7-T 00 PT 0 T 0S 0\f^ r`@@ R4 000 S00  f^(f^ -L M8@4^ 0 P00$f^@r`\*4 -(0LM@T @T(f^ -L MV, 0 XP. ,PG@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  P@ 0-@LTP  @T000@YT R000   00hi -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP+  R 0S 0S * R 0  0004 0P  # h*4 -L4M@`paP, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  *<R0#03^0S< 8@ 0P L<0 0Q\8@0P  000 0P& ,#,0 m0@4 L , h*4 -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp000X0D 0W d U*00 U R000 SPp    p*4*4 -LM0@`p& PPpU 0W PP  P @R000 WP$(@{T00h*4@r` p-LM P@* 00  00 R 0  @000phV`h O0 p0 0S0 0  @?` ph7@r` -PL M@ L 0@e @T  ^ @T % *4*4+4+4 Q0-L@0PA 0R x0 0 PR0 R P P0000 0S0SS RRs`a0 s`s`-0x0 R0  0^0\\00 0RP00s`a0 R00s`0 s`s` -L1LM P@p 0R`) 000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0Tddd @P` 0R \ X#s`s`4+4 - L@PLA@`p 00( Sp =s`s` 0-1LsDP@   0,0, 800<0&00@! s`ԥ5s` -LM@ H 0S00  Q0 0 0S00hs`<0 A P 0-0@ LRPD0y0u 0h遽00S000 0s`s`s` p-0LMQ@, 0Q 0Q p0 p` 0 $PBU0 PPx0Q p0Q T 0  0 0S$  00000}ff@wt@s`s`~fvt00  -LM0@ S##T###$#,#4#<#T#T#D#L#T## m00 b<+40 S N 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 ph h0p( N@ G,f^ -LM `@tV`Pp0S:000 0`0@0@0 0WpUP@k 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% %`( `+0<0`%PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pe<<L 0 P] <50s`,f^4s`5\+4d+4f^l+4 -LMX @R\0T \0\00X \0 P PQ  Q R0 00  0 5 0-Lh0P|0 P 0_@PW,f^ -LMPpH L0Rz `V.P@  `VT  <000T Pd0` 0 d0l0000@T[ R0000 0 D H0 B0D H0 R00C0 R000  R 0``0 00 S  R000 R 0` 0 `0V0D, 0Q0:""0Sd0` 0 0S0P `묐4+4 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P!04 0S0T0  0 R000  R 000v<00CP 0 R000  R000<K7p 0 S:`=+4z -<@LAPspP`@P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p` -D ,0LR@p:PPP  ,`VU  0D, 0Q0:U> p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@4p -LM@0T`80  r@T,K FPU 8 00R8 K @,0 d@4 $0pLc^=9 =4p 0 00 40S"PX8P P R000 h0p 8PU @0D0<,0lS:\5,f^ -LP`p@ h 0-LM@PT $ 0@T0+4 -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH+4(,44,4h,4,4,4,4 -4 -48-44L-4p-4-4-4-4-4 -L* 0S p$`L5004 -p-LM PV 0@``K,0 \0 Kp`s` -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh5pT0n(PW  0U008s`5 s`|5 --L0LM,  D!0 \ $` --LM 0 --00LM Q0rܕ5 -p-LM@XXP 0`@^00@ R `>p`5l58s` p-LM@\PX`  0PP=00@ R Ppx`5l58s` --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSU #x#x#L#x#x#x#x#x#x#d##x###x#T#l#l#l#l#l#l#l#l#l#x#x#x#x#x#x#x#x#x#x##x#x#x#x#x#x#x#x#x#x##x#x#x#x#x#T#x#x##x#x#x#x#x#x#x#x#x##d##x#x#x###x#x##x#######x#`#x#x#D#x#P#T0  0` 00x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,d\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm``  [cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  .,D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @T@D ]0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D K$`804@04H04P04X04t0450404H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  9P PaPh hp ` Ph l  S -L鬐4 -@LM4 -LM @pT0TX0P / @ 0` 0  00 00@- 0P^c: 2#80S$H*,0 9,00 08_ -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@ 0S 2[02K}P E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0\55555 p-LMh`@qP T0T Q 0QUqU@@0ps0@Pꐦ550414,0, 0$ Q 0÷ᘦ555s` -LM0(h h`\@\ 0 0S<:80 ,000u4ds`55s`000 Q 00ᜦ55s`5 0 S-L< 800( S $S dh`L55!514 -t0@LMA \O0S#####,hB$@h<\58E5L514(14 4 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi0S" hPK֓h`0\b 3` KpKl 0pcPl=9 A =p p l p l0 T2RHL"002c2cs |, P@ 0S s@0,0"F0@fT t@,0#T@@0T,0QQ QL@0KPP| P@T| P@X| @p\ d0S`K ZP@`KP@hK^\ d0` h0P=9@ =C` \ ` \0 \D| =P@Q H| 6P@G L| /P@= @Ky<0K8 KH0 40KD X0 0 K,0K@KT P0 L )w`Q574w`?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#JP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0   Z<0H0S<0 H 0@  p3E 0-04PLS@ SP0P 0R0000w` 0-@LP 0Ѱ0PP0 ` x0@R ,0@@0,00hS10S iz0(0  w`w` -LpMW,0 P`*0 S0!P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -LLM0d $@0dS0!ph WH0Kp0  Pl dl pPP *p0 R0:z 2 PKBa2a11J"c11L0 P MP_XKL T0PX04"PP L =9@ =CP L0 ,0@0`,0 h0poh 0S>z" XPKܑXP0\Z 4PK`K\ 0`cPl=9 A =` ` \ ` \0 d1R@\!002c2c ゴ, P@ $0S x@0,0 !F0kY ,0#Y@0,0 y Y pHKP d0l pd pl P L T0S0L0 P0  Zp H 5Mb?Bw`Q5F4w` -L M`(pPP@[|P@Q,K0 KP@J,0, 4K,00$P,00 K000ڕP@040 4 0040$4 000<W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt }@0@0c@(⻎0@0B<@0<e .p@ < @0^ <@0,Y*0#p@@ 80P̹t A@00@0|| 0Pp@0 p@0@0@0@0<@0w`74740Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||]5D` -LM`lPg0 pz@"t  0@D  D \@0訠 $☀ ";p05  R @? 0SU 0S 2 )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU WZ x U WK 0xU U U|Uu 05 00  (0r05^ UZ   ^;8p09` (0S.@H 20U0S 6 =   y0PD 0@$  $ x`x`p3<]x` - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$(2$02$82$@2$'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0S2$1$1$2$2$1$2$QA0 0(!)^  so 0@d 0 d  0=`H T PPT JO  L-0c Z0 =iPH @ 0`0Od  d W-x`p35 -PLlMUp` e9U9^9U95Z:D| 0S , x0\ (1$1F0S ZTT)T9@ P@ ,9U+ 9U b8UY 9U 8U p0;p0p0;8U 8Up   5,0p  D 0S 0S||^ ^^ 00CS0 D 000D! 0|0D!x D1 ,00,0|P@ 7U; 7U 7Uh00㝪X7U! L7UD1| R OPxP,06Ur  _uq<nH0ipm0&0p" yt6U7 ch6UU -6U P6UFJ0Sp0p000p0`0 R ` 0 R D1| R,0 h 52&@5U' 5U5P lU*h0U deh02 P@hP" h0  Q4U 4U 4UcD1| Q_,0\ P 0SxPx4U :l40SȩX40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  j`(p@ PKK020  0<p0 P@WP@Px2U@  PC  (x o:6t08t0 @8t0  t07t00@t08t00 t07t0 P. q0S S p0(0(S" @0H0 1P pKl p0 LP D` yAP@X `c0 `0Yf@ `g``GT  0X , U0U 0U 000St{t rtzt ^t p`5t,@ot t t at nt D`st@f@t@[t@wt@ht@<]bt~f}f5t5Ztetvtgtt,5P4 4-0L0Œ@P㜨Ap`@ .H0S`VW Tቨ  P`0 p0<] p- 40t 0LM"@`1Ps sP<0 p80<`W00@R0<]5Ч5 0-=0p 0"L@<P>0S00  Q0 0 0S000h*<] p-LM= x0 2`<P@J 0 p0191p 0Sp<] 0-=0p 0"L@<P0S00  Q0 0 0S000h<] -LM= 40 @2< H >P<] -LM0@  (0 P0SM0 p-LM@㯧P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP }p5 0-L@PP 0 p-LM@Pd` (Q,Q&p0 >;-p0.(phKp0m h< p0ŒHQHP᱿HP(<] ꄧ5 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@Lp0P0p00hަ -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =UP@ ( P@0p 5*0p l-=`b0V``V=J`VZ0@   p0  X:p0\p384 Q0-L@PA  UPE0 -LMPP2 $(`$pKP@ $! P@`P@ $ P@p0:p00>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@Mp0 /t hTx0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10S4 S1 1R0 0lm$K0, K HAN=0S 0 $00!0 $0 q?B6c$ R(N=0S(0 ,0 0 ,0 ( (0?B6c, >|01c1 @R  1P2;P 0 <0/0"bT# uDsaQD84T84p8484848484?BHh84848484P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS p-LMP@~p0`(0(S U  &mphp 0-LMP  0NᾸP>T00  x`x` p-LMD`P0> S@0B0" 7B㰼 ( H P00 D @000 0@_p6@A`x`x`E$ - `0L0C0 R 000  0 (H0 @P@dDFA 02b Sp>L 0 S0``00`hנꁘx`x`-`-`?` -0  L0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qx`x`x` -LMQP`/00CS ^$^$^$^$^$000 Pi錱-p0l0h0PpT0T@ 0 ; px`x`x`x`x`x`-R Rt0t0\ \t0t088Q 䲦 -P@pL >Z岻0E/>1 `W>p 0 0P0  A噻 -LM0@S0S000A?₻>㮗|>㨗 p-LM@0`SC 0^P` a/.!0AS1l0PU00\ ֟p -LP`͟Vp&0S 0\@l0% @l T@ ᡿00S 00`d d0Vp 0SS 0 0h0 -L@Pᙟ`\p U/ 0 ` \L ?>1A 0S>0`Qv\L0 Q` \L0 0H`F V0`b 0-@LPS U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h, p-LMP@% `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0p?>1 @ ,? P0 p94Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpF㠞 R- R0S1 0 0V$ R! 0 @cR@cT@ k`dPp  00S 00 0V  Rk 0 A( P094@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 i^@- `0R   00\ La/.!0AS1@ i^ p-LM@`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 0p -L Mp۝0S# 0S 0R ͝p @@`KP@K ᱝ -`,0pD1P LP@U @ qX 0Z @z\ -LM`,0pD1P HP@U PX 0 [ @Y\ -LM`,0pD1P HP@U /X 0Z @8\ 0-LM@,PD1 P \0Q T0Q  0PZ0D1 Q 0,0000at qt @-,0@D1 00S   @Z@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ &ll "L$P0h  x`555]{`{`i^x`p${`i^4p$,0 P 0SPx` -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am鵊 -h0LPpU` @ T*0S4@  T:PUx` p-t0LMP`U @ T*(04@S T:PU(0phO x`5 p-|0LMP`U @ T*$04@S T:PU00(0aph* x`5gfff p-t` M@Lh 0\P@L 0@z,0; 0ph6z`t94{`|94(5,50 <0S$55{` p-LM㡛l0`PU @ T*,04@S T:PUጛ 000p x`x` p-LM@`zT"@@PLH0@P  a101!  apz`x` p-LM@`VT"@@PXT0@P $ a1010  1 :pz`x` p-LM@`/T"@@Phd0@T  a101!  T  pz`x` 0-@L P 10C1( 8P<0<0< 8 0 10 |@0 (0S $0, $4傒$ x`z`{` P-LP! pš!` 10C1* 8P<0<0< 8 0 10 @vᥚTP (0S $0, $4=$ ]x`z`{` -LM`@p}T"@@P@T 1 1 101bT !0g)P$ !0 0!W0`00 pwz`x` -LM -LM -LM40 00 p`80 JQ18 W V, 0W:pcW`0X,0 ,KRV 4 @R"PP 1"1 101岡UP 8\s 0!0gS0! 0f \,0$00$Й80!8018P 80<`1 0S 5`1P1l0:嘡 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XP 000PXݗ@P` 1 1 101ŗV 1@  @ :)01@1 0$ 1 x`l|`z`x` Q-Lp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@! o 00 0 pd dR0 00 VW W`cP!000Z` Wa@PP 1!1 101IU F@$>$ R 1 0 +10 ,( 40#s:0U00SL( 0S% 00#0X00S 3S0 @P`PU70778|07xUi  Z00R00SxU^ @04 p< 4p4 5 L 0P0P00S 40  70778F0x7ḥP 0RS04 0070778. 0x7៥LWU @0 0S 40X`hd 0Sh4p<  R< V14  4 40pPD @T L0,B0aT L01000cT00P P0P P`P0pU XhP%X`dh ՌT & 10C1) 8Q<0<0< 8 0 10 0`0凼T嶌`P (0S $0, $4P$\p8噌D0 P 㑌P8 \ H R WX`dh T L0,B0aT L01000cT0\ @0 Q 0 R  P0`0 `P>@ 0Q 0 R9 Q$@ 10C1( 8Q<0<0< 8 0 10 0`02 (0S $0, $4̓$Pe T L0,B0aT L01000cT0,\ P0`0L`P"@ 10C1( 8Q<0<0< 8 0 10 0\`0᯻ދ (0S $0, $4y$噻L4S  UiU 1S, 1)PU 0 9p0 SRk  407077L$8咋Z 0x7#PP4L$  0@P4 0   @Pp Q! ϖRpZ00W00SP PU x`z`{` p-LMQ@P ` Q p T  0pQ -L0ML@2 p@022P021`2022!LPK0ウ2[02(0$00 00S80,2c -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@SԶ$$$$8$P| 7sPPPL0T@0P0T\@\00RU 0S@000 00婨04  ` ⢨Q!k401#8S#00Sd0W  H0WS 0S 0S S d55 -LM^P@p \ 0S*p 0{0 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 P 0T 0T 0T0xP 0@T0 3 003\ 55 -LM@@ D0<^l@h 0-!40r@L$ r 00LP<0<080f$  2$@02^ 0|Pة555 0-40@$PLOp0S0p0  Q0 0 0S00p0S7070h640$ L 0  191# 3S,000\0Q 0-40@$PL0S00  Q0 0 0S000S:0:0h40$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6Ld0S |0h[LS0S 60h齠 -LM0@00 68 |6L30S  -LM0@00 6. Ѡ|L0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤضPD 㥣0 @P@0@ <`0 3 @pDP@P0A3 <` @pD#PP`P@P@ @ 0 0 @ 0P, R L 0S6T0,@00  0 # ᛷ{`Qx|`$5(5R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @Fƞ,q3 p-LM2@  ,P`02@ @F0`实P2 02p4q3 00-@LP202"00 $t$ 0hp0< 2ᓟ p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ S5P0H L07R{` -LM@00 0Q R 10S (  -LM @00Q  0,0 0100000S0Q0 ! !101 Q-Q 1S( S  0,0 01000000 0R0Q ! !101 0Q -LMR`P  10` @X 0R@ B 0CS0Q\4 ٴPp 012 02!  W0 0 0 T`X@  0,0 010000@0S  0,0 0100000Spp@pz`x`:4 R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0夺:4 Q-L@`Pp 1 0\pW0S00t@TW U 101hhû0SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0   0  0 00$00 00a\U0 ;4 -LM0@S0S -@LTP` V1T Q 0,B0a 0100`a0c0딂!p 10C1 8P<0<0< 8h 0 10 <@垴̈́VT? Q. 0,B0a 01000c0!` 10C1; 8P<0<0< 8 0 10 t@mᜄT Q T@ @T 0S@@@ (0S $0, $4#|$C (0S $0, $4 |$h*t0 f0 0  f Z @zE Ox`z`{`$;4 -LM0`SP3 040  0,B0a 01000c0&!p 10C10 8P<0<0< 8 0 10 @ڳ TP0S 00 (0S $0, $4{$ 廳3x`z`{` -pL @M T`1QPP& T̓@r$Ń$ R 1 0 +10 ,(0c0Q P0SX0   X RX 3PP)X0X0 XK (PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,⾗ @ V05@1 0305 0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$ @,00C,0(0, -LM` KPPp*0 SP 0S p0pS$W  PP 0 0 0 $0pPW  0,  B, (0,C7P~@Pm$~$ R 1 0+10 ,P(P0C& 0S0 0000@00x!xQ 0 0SdP D1T!0Q 00phu00500#0@ 0ۍ00 000:00 .0 B600 h08 . XB000000 @@08 . 0t}`T~`d~`X}`p}`p~``~`}`h}`P}`t~``}`-l0 `0!X0 P P0 S P\0S00 5H4x~`\~` - `LMP 4 0 x!xt!10AT P0S& @T, K P@,0sS400S04@TPPPupt0K\0St00p00  t000000tT 00L 500 0@@90,0 t,0S 5H4x~`\~`;4 0-LP yP@ 000:00 R0@0l~`> 0-~pWL`V80S/ ,*L RPP 00(:00 R 0P8 80H@bHT@!d M800808 <0 dS< 8 e80S:S<jt0@PU |00000]tH8 H gL8000g 80< 8p0?JtSl~`h}`;4 -LMp` 0C& 80 >0C&   0P@00000  I00 , 0嵊$`}`t~``}`X~`L}`t}`T~`h~`4 p-LM@>s00`< P0X P嘊00  -s00 00  40Sp00;00p<4 -LM00@ +00p <R00 00S00 00@ 00 h00500ho00@000X00\400t}` <4 -|4L Mph4PQ` 0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q 7PT    YF0S l#000\ 0P0 00 @#000\00000 R000 R 0S  0 0S0 20 0 @$, P0QT" 00 0Y@00@0 *0 b  '10 60 P@0!0 R? Z8P0, R {! 00 00Z0Y0S0!0 R  ,P060 r07 SRX 00S*0S$R"*r X00St0 0 0SRr %sus0suu0sXR0S0 uq000 0scg=4 -LM 0R ) 0 `R 0 4 Pᾇp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00 \0 -L,M,0$ 000 `P 0S 0+_}P@ R@@T 7000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 %P@380[c  R?@# *\0× 000N0/Se @0 ؆弖pR 嵖R300媖 p>@ % ;0 p咖d厖P劖pGWc:0/S Y0+|6 S)`` -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < Q!, 0 /S K  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@v@00@0T 00@060 #P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00Tk00CS<< R;T0$ 780S2 T0$  3#0S 8@0S00- $P  @00@08Q   $`20S 0 0 j 0 ( |`V   0S  8 R|`V   [$00K #X0@@ @ p<QT0$   @00@0<@@@00@0W 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SV0S8 0Q0R00SH@090%` @ -LM80@0 p,0   `0SdV 0 R !PP p 000ZT0$  P0  @00@00`0CS ZT0$ ,0S T0$ 0 @00@0,0S 0  #0@ < RP   }# 塙=4=4 -@ MLdd 0\P>P0P @L@HHH0H @@@@h3 <5=4``l`````i^` p-LM 0PS`@<P @ @@@]Ppz]=4] -0LM`@Vp PP $`VV vJ[v@PP ` 0$0 P0 00$0$(0$0p &/Y 0y@ܪ5 -|0LM0Sh0@T 0S$@TP0 $ 7\^ܪ5=4H- P L0S PP 0R䀁` p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0p]i^`0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00, Wc 0@S Pq R#Dq R 0S Dc P~ 000@8@널4,80P@0@@PR # P XPUc#PU X R\0\0\00X \0 H  H c80S 00|0<0h`5i^$`````4T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d \ P0@0  P8p 0P 0 P Pꀂ` -LM800CS1!p2?0P`b@T | 0V0 @Tbdp R| 00 b|0p `| |00| p|0p|}TP < +< <0;<0 Y|8 80S@0S  %PT Y80S  5!  ^40 840 L$``@` -LM@<0PX `   <<00!yH @p00Q00S0@0 PP @ 0W0 BR00S@ aL0S X R\ L0 \0\0\0 H00H0a@ X X R\ 0=4``` -LM@aLH8t t0P\HX 0X0 \ 0@ha0XSX00X \ @\``` -LM@0T 0CS@@0  h S @0SH0 h$` 0-h0@ P BR@ L@L 0T0S3 @0SH00h$`-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0䌁``` -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 $`` -L M@0 K  0 @ P[% -L M@P@U0@0<0`p48<,<0`<U5 V-P#U @00CS@0L0S0t 4  @UJ<0, 0< <<0iy\尕 0  0C>4>4x`0>4 -L@\ 0$` -LM<0`LP <<0"0w yT0S800CS_|\ [ 0S00 S | 0S S8X0Q0 <@ | |p0Qp | 0Sm QWf Q<0;<0<@;<0@T  P0Q |1!@P @d`DFA@04 Sp=ʄ1dXA R|0 |000|0 |`0|0@0 S8 H0_L0S0S X R\0\0\00\0X  RX 0X0X \0 `\h_t|~W X P}8 80RWpZD>4L>4-`-`?```\>4p>4@-2@H?0\ | 0T \80Q脂` -QLMp@`P$K40 P@T$| -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -LMQpp5^ 0\ 0S $\-\ Ap0,0S SQ|0\ 0S $\\  0( hp- 0 hoܪ5ت5 -PL M0 `L 0 0@!X P@ 1T0 0j04` \,  T0S ,KP! U`prP@ ` ,~rP@W,p @}0 0j0v <0 R4`( 012=0送`5>4h`-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p$0  0`004P _~ 4 $0<$0Sld RiSgRe0@ 1~U`ᄠyX\ qP@( \0R\0ń0d R>@!T@0\ 0   0V0P@@T@ 0004P ~0401U0 R 0S  R0\7@ \ $ \` 1qP@d0 Rd0 0Dzx` -LM@0  01U p-LMP!`@4T  U00`VPZph% p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  6^P @  0S 0@ 0S 0 @  -LM`@pT P R0 U@W L哓X @叓0 KP  pんꀁ`>4>4$`>4 -L(]@u<0< R  0S hh>48s`p'`?4?4 -81LM (1R ,  q q !0`!c1QtPEU:0 00S00`0tPEU*V , Rc'Y@|&\@00000\W`pG,0S $`p'`'H_<] ?4 ?40@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@m0K`5 -LMA\-P   -LM@pPp `pPH00H0 0sPp0S P- L p00Csp0 H Sp Hht[,?4 -LMPp@`g`A\hP : V P0SSR3 @R VP P0S00A000000  X00:00 U@ \i00500H!0msP@ \lQ  V P0S RVQP [ R P0S R P0S[0p Nl0S [0 P@[p0Sl0S  [tD?4P?4h?4 -L`p[l@PT 00  @RW 0| l0S [h[00 00000[\0WS b劐?4?4 0-\0LSP@\@800CS|00 D0D h0h S0h0 hP 0j?4 -L\\8  R R 0 0 0 H  l0St0QH0x0x0x00\0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 (!Ce```?4 p-LM\`@VP0 P00S  R 0 0 0   pp00p0!Ce 0- @RL\ R 0 0 0 00H hP l0St0QH0x0x0x00S0 0 0@ P0H0lP80SP 0? S 40|0 R 0 C!Ce(5VUUU p- LM@`T PvP$  $@TL0@Q$@`0(0Sppܪ5ت5 -pL@`T PvP $`$@TT  R$00@T 0$@R T0 ܪ5ت58@P -LM@D\T0P,4P0`t P `\ HLPp`Xp88PP `p`?4@4@4(A4 -LMP8P1p ^0T|@10` @Lp@@ D0@Wh@T  @T\l@T < @Tԫ5$B45,B4\B4B4B4B4 -L M`$Q @p0!P 0PP<@@0@DH t`L`X\ Lp 080@PT P !`\#100E SP`@TX@T `\#10l0E SppP`@T<B48C4dC4C4C4C4D4@D4hD4xD4|D4D44D4D4D4 0-0P0@ 0L-e0 000$5j^j^ 0-0 L0@L Q@ @P@YH0pt t Rx0x0x0 H00H0 1t0S0!x Q01x00hX$545j^j^ -<1LM 0100 p(!X1 P0 S 0 @`T  0S 0S@X0S0C0ʄ0 S0(x x0!pX0 0X0PS(0$`t`45,5)`$5j^D4p`(5 -LM Xh0@P T0R XD0D  - L8D4 -5LKM⤕ R, `p X P@PKZ 0mP@ ,0 S <,`vD0 QK A 1 @! DQ q *P@ 4 <0 TP$  T0 S eXP@0 R   0000#P@  e0$ 8 $ 0$00$0$4$03#0$0 0$0 Q?KpP3@ $0` h $0$07T8$0$$0 0S @P00|PT-H!00000 R0PPP $0 , 0 P@ u0|`NrJ.F-*B&0K 0ZP@] 0R WP@Q0 R  00T $000 0sP@680SB 0  PK d g pKP@ 00PP   0tPP $0P Y 00Pl|m 0D0$ (0kPPpoX` -T0L$  80 ST%h%h%T%T%h%T%T%T%<0 ىP <00<0 -`@p D0L0CD0P(0 @ -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0! @R800 Y   e8 P00R00S@HK 0 = -LM$Pp@`0  (08 R 0,    ,  l P` `, -LM$`@8 RpP. PT0S $0 P0    0 p,   ,000c P$ -LtM0 K@XP@x0t 0 800C S6h%0%@%P%`%l%x% ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQ%%t%t%%%t%1U 1U 00S 0 p&0 K0P l00b0 0 p T0PU D! 0P @@00@0D!f@zfat $ -LM@`@@p< H 0X <p}\H PXE4-$ 0 8$ -`0@`XL pPU0@  IP $` -@ ML̠ 0@P -LM0 @ S` @  K0 0, P@0P <0 0P 0 2 K0 P P P P@j0`S` _ 0 Sp| ᔐ;`P@0K` 040 D0 0 K,0 ؠ p H 8p 0 ܀ 0KHK @0KRP@` `P 0S @ 0 0 <P80 cQ ڴ Rb@0 S Q 0P PbU"@'d @P @ PP}04 -LM`p`P@P p dPPP Pt P0@0P0Y L0<0 P@ ^00$` -LMP Q8 , 4 <0 0 @ 0@ @0,0@0, @00@0,P@a<0,S8 040 \k 80S@:0W<0  R0 T0, ,P @& @00@0,uP@9, <0,`K0pK4K <0mp@" T 4IQ0A/ 40  A000@ SY,0 80S408 00P,P <0@,, 0 @ 0P@-,@ 4Q0A/ 40  A PU0Pq`0 P 0 S 0 WS00 -LM@ TpJT"" B:P$ K0E0"`E0p'P@(0`0 V@: -$ LM  40Kܬ5 -L(M    40 K5 -L,M   0 40 K45 -L,M   0 40 K`5 -L,M   0 40 K錭5 -L,M   0 40 K鸭5 -L,M   0 40 K5 -L,M   0 40 K5 -L,M   0 40 K<5 -L,M   0 40 Kh5 -L,M   0 40 K键5 -L,M   0 40 K5 -L M8 0  0 $  0 ( 40 (K5 -L(M    40 K5 -L$M   40 KD5 -L$M   40 Kp5 -L,M   0 40 K霯5 -L(M    40 K̯5 -L(M    40 K5 -L M8 0  0 $  0 ( 40 (K45 -L,M   0 40 K`5 -L(M    40 K鐰5 -LM00 0  0 $ 40 $K鼰5 -L M8 0  0 $  0 ( 40 (K5 -L(M    40 K5 -L$M   40 K@5 -L$M   40 Kl5 -L$M   40 K阱5 -L(M    40 Kı5 -L(M    40 K5 -LM00 0  0 $ 40 $K5 -$ LM  40KH5 -L(M    40 Kt5 -LM00 0  0 $ 40 $K頲5 -L$M   40 K̲5 -LM \  40K5 -LM \  40K5 00 -LM@P0< u8G4 -LrPuHG4 -LM@dP 0 04 05 0- P\0LS KP  00;00M@@,G@00h 0-0@(P0 L 0)0S 04 0ı5 -LM@P  - Ldv\G4  -LutG4 p-LM<0@ ` P`<<00 P[W<0 pG4 -0 L |` 00 -L Mp`|@Td  00S0R  00 0 0SP" 0S8   PU  PU  0("F P W PrU 0  x0!FPVP ZU0 QW0  Q Wo?DP0S@00A d?|@,K 0PP 70|0,000K0 PP ,­6|0000,PP  00, ,0 00X0娭,妭6| A6@G4G4l@` -LMP@0| S`p 0 0<0  0Q PL 0 0#U<0 00| R#PP -LM 0| `P0<p0    0; @  00<0 -L\M0@^ 0 0| hKD P0 |0hKD P0~f p-L\M@P A|0pK0 `|0 RL |0 `A 0pK| \L p P P - L<  Q00Q00 -LMp|`@VI 0 00CS0> 0 00CS 03 0S 0S X埬圬0 p@P>@dDFA 02 St1b1 R0``00` >0|05tl-`-`?` -LMp|`V$ b`0 @P=@dDFA 02b SP0 S0``00`=0|0k5-`-`?` -LM@t tG44|0 sG40S S  (00S 0 < - -LrG4@-| q  qL@H0 800@< $  2 02$ 0|45D51EP!010 P?U@U  |L1 "  40 $,o|  40 KoP@   *| 0 @|  0@* @T ?|>1 1E  C00  | D`<0;<0 | !88#`o$`H4<]H4 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ40 Ƞ!$, *o0<]H4$`G-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ85`ųE.Œ``nm;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$EnQ``Tq34K,0 0P140PH@ `0T*^ 0p ^ D0S 0P4 H0 @0T `: ἲ{DP40P 4峲᯲4嫲P8J4DJ4 -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0儱Pp,$H0 P >  .DP7t0 qD0 4Ht0T$p T q! (0$S (0K$p (Pp( $\ W (0SD^ 7<0T$p<0RDJ4PJ4 -LMQ@p``#T\P 0@30e^X05< 070 0`PP X 0X H 00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0ΰP@-0X0H0 R $0U  P 0 PE AX0 0S 0P@ 0X 00U00S铱0吱 -LM00<0 8 @ 80 @0PG 0K , K0uPp9<04K,0 0sPp*40H@ `0T*PU  0 @ H0 `0T: MW@ CP 404p<48P@\ -LM0p`P(K,K 0 P@(0K(, 0P00,H 0R *@T T 0S H0 0R:P  -LM⤐Kp  | P:P@$  ԁ0S   @T8$0@-@T2PQ @0(0$ ,8P@|`80S|0" 0Q}0 Q $0 LM}0  0P@  $0U 0V@ Tԁ40 08  0,0000 05t0s/ KP@  0@*P000@KY 0C<ZaA0Y 9<ZaA M| .F00 03@ K\Z 0 Q10R`\ 0  0xP@  o ] -LDM|` p< PPPH rP8 V2 0@ 0@@P U $00D0  0 PPx04 8 5 40 K0pPP0 ,0(H  P 0崠 OP|0@@4PD 0R 80S P8;GA<Bꈯ ZS4K,0刮PP4 00;00040H@8 @8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x01QS 2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @QB 0A?8 H0P:0@70\T 3 HDC@T,0X P)@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@C8@D@@8 @D00cB`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08hB8 lE8@ 1@\0BX0` E8@` 0RT4]08 40 xQ 4K+0\PP40H@  @P2 80x04A040 8 <L e80<`8PP$08010DQ8 80010d08 0<L P |0y ?P ?P ?P{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P0 840,0%`hdxJ4J4lt300 -@L pP`0 A|`PQ`<4;1$0 :$0! -LM0K"@CP0   p-LM@`0P0` ` H0 0P T P0Z 0,0T` 9CZ 5CMB| 1C D \>p p-LM80@SP0 0<l0S 0\S `V p 0+0S0  -LMQ`0(  $0 ,` d0@Sph, K 0STL  0P$  $WS&J4 -LM0@ 0KP0 00  0000   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K >\ KPPC00 K0 !P0 PK  DP @P }0  < 0 0/&00  K0`PP0  0  ,0 S ,@%Rp!RLKN KO0KtJK0n0FKH KgP0[ 0P0K$`J4` -LM 0@Q{` p-L M@0@SpPP `K 0 000 0  0 00lj i0&00n 00rp h0 0h0 -LM 0hh0`0  0 $  10 !   09m -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 i 80x0S1\T \D<0L aP` 1 E,$P`! lj i0I0r0nC0j0rp X PPE5@ D 05P0 : P8PP`P / 0pW$ 8P X` 0D<\0L@ \P b0P@L``0Dp0x` P<L0 S0P `P D0 808```` D@HP0TP K800`0 \P >P`QTpP\ `@t>H \0 c @H0pX 4 00<@ 0P`_> ?Q PDpx0 0SwRtHP` 04@Pq, <H(:,0@P,TP0\Q T0sG < H0<@X \P`0`0fDp SP1 P!xpŏ0 SRD0x0 @a@a,0H< )`0 \H0` S ,D0 0R009<@0SH@Tq/,?,廧L0\0 # %\0TT c\0DP?P,0 0 T ,H,K` @409P0 ,)0 H`Xp`0T00C3:0C21SJ4E 0-P @QL^ Q0h -L80`PS@p pV  IGa -LM@ 9- -'LTM@0P,0 H L T0Tp\6T 0T0 !t  `p ! nH0U HPc'L%d6 ,0S T,M< Q T0\Q T oP0L`0 X h0 0Sl ` X0R 0 0 X0@ T aX @00L0p0 H` Q`\ $0 h `(l T LD0 tt\Żp0Y00S Z\ RH`XP0 G HK 8PH0P`0 \ \ \\ h0p0Su`\6Po\ Hq8 KPx d00 0 0 Y LK LPp\ qYFT  R` X0$Rd ` p RZYT\ p0Y00S) X t@TG t0t T\0D c0D` PK0ϥP3P $4H0@t t0` st# !4;0:t t0s PT L!\0SHX0@00!<$ $(!50 4t <0QP勦 T vX0\@ DK\ p<8K l<l `( h0$0X0`\ lP<Xd ,0$ 0,0X~P Y\ T JL弫p0StX Th0< `JPX 0S th X0X0 0XYZ T %UY pDK <Yxy  T  $PBt p Rp |0 .R$`$`J4J4K4k4 ܤP.\ K P'@ PK K 0@ PKD @ P VP0  孹0  0 ,0S ,9K K咹;[0 [ 740w 5 <0QLKN KO0KX0O0 JKQ0F0FKH KJP0[ 0P0K6$`5lK4` -LMP` V$ P 0@ B`TSQ P`PE 0 f@`CT5 -LM@ )- -LWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KK56d!0t1 P 0@ 0 7 ,0S ,A9dA `H0T S! 20Q Ul1 U U&U80B`` pRh! 00} H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT X9`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?K;PL 9QK8@!0:PL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:dA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0L@PH0 t0 pĂ0 4ȌD \p<3 (K 4 p\- KK A?(KA/(@K0K0000d0 Sp! :MK %PL h1S lAh@D 0lA T0h DD口A?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`oD2 (@K 0Kp!MK6p DTr\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MK$PL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0g:@(0KKK,@!h | @Um Ut  Uhl  Ue U UT  U^L  U[U< UV4 US$`|K4@`4&5A`A`A`dB`B`DC`C`  8@  8 9 08 0-LM0 P\0@ 0  ^ \  \ T bQ P 0 -LMPp\8@PT 0`/T@PT t |0 0D 4 y@Xs0\TnT_P0T0T@tH<3T@@gM5K4 0-0L@Pt 0@NJ 0"P  0 0.$N0K4K4@4J4 0-LM 0Px @ 40K00  B00Rꐀ&&&T&t&&&&0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QL M,  Q :Qz Q 000 0` V"@]FPP  !1 01$0  1 0p0aV0p"@ `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 j-0\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S Ꜧ&&&&4&&Ԧ&Ԧ&00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P5 - @LM c*h j^& -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  PF)P11 0AP P7)P0P0@0@0a!R0 0! Rob% - A z- :0\0 B(55 5$5P45x`XL4 -LM@1SA(P,Y0Z0J0@(@`  p(@(000 (A-0Y%X00` q l0R0 000  0@AV@ @@ p `F0V $5& p-P0LM`%QU $ @ w0@1ph p$5 0-L ,0P@T @T0h ` -L` pQv(H0PU ,0SPUh @ADx` p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`PP $ 0`S00@ ph A5``lL4 p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`0SD$0 `0`00 @phO qA5``L4 p-LMP[ 5 ";52 0!1 0`$~N$Qbvsp R0 10  0 PA xA R0000 0 0S> 5 P  PQ hQ0% %01 $0@T 0 R 01DQ@T#ph < R@0@ <0@0 < @0 &(&0&8&\5Ԋ`Da`$5x`8` -PLQp` 0@S` TV@0@S0 0C0` p000 p-LMK`J@T  0S  Pu Pj p p-LM@*P`% PP 0S 5p@ pDa @[ -ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T *0S  @T*PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S 5gfff, ,00S0 0005` Q00 00C0` -LM܀`0 V$0  % P"0 @PPPTU 4pK7& , \P`PU@00T00S$0 S $=)$``5L4 -LM0@S  P, & 00ah&̶&5Q 00 p-0LM`PV @T 0  R @T`Vp &P 5 0S 0 S %Pp` p-0LM`PV 5 @T 0 R @T`Vp0S %Pp` -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  P  P 00 P$0  Q 0 ` 5(5$5H0Q P 0 RPQ` -pL W`4 @T 0S @T XR 5 R%P Q J%P0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   & 0-5P0L5 @T l@TQ 0 S01 10C1dn0h^ -LM5@05R h4\ -LM@I hY 0-@PTL @=nT00000 p-LM`p0P@T %5R0C @T80ph1%(50S `5 0-@0L@PT ($P @T00` -LTM|PxU, `@ X7U P7t U @70Sm P7U t,0 S ,6'ttPp 6%Ux u C6Uq 6U| h6U. 6U \ p  0 x 0,5 a@u[[- Pt0 `   Pt( t1  %q< 00\5   ,@&t"@t1 50SPm0S  P^$5ATO @TL t0 SG0DX0S 9S SDr 't 'g 5t@K0 P55 05 @TM 0S 0S @TAJ#S SSL3UO 5@3U 83U!_Pt0lPKp0K@ xP@@ t"@ (\@DP0S  \0S ᧑p2Ul2 UQ(P P P %1U1U0*1U 1U# 1Ut0!1U1t0D X` t0 p1U d1U \1Ul@K@ o(t0@ p0K\ 1U 1U0U 0UdV0U^"PMPG/D#@$`i$ii$zi L4FixIi i i i qϖ$5i$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,.%P0pD1XU.LK(  j& 0S7 U@` 0S<Kc$ PU Z 00pZ@ PETUXUP0 0eP  0 :& p<K! P PE p $``L4 -LM@Q 0 S01 10C1Zk -0LS``PU *"PV PU  (PPD  !PpC P@T "P6 $@T, P@$  C'0000$0 $( 0@000@00 pp  0Pmj T9%0P/S3%0P9S` p-LM@`TP !P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0pP R000 0 0  ` -LMȀ 0R$0 0@T 00@T$0 S |$#@`TP 4pKV`F  & PP@T$`L4 -1LM@ T$ P %!P $@T$0 S $#T  R0 @T 00@T@`TP 4pKV`F\  (7& PP@T`$`L4 0-P0L@PT  P $@T0T 000` 0-`0L@PT  P $@T0T  0P"0` -LM0@S SL = PT(  5 P h0S3 0-T1L0MLQ@ T  8 P< $@T(@K0 (0K'KhP@ <P$D P@D@K /$ SP@ <P / P@0 S X"0 T @T @zT`$`L43L4 -L$M@0Q0  %2 800S80 0 S h"<55P2K4 K 800CS80ʴ5<55 $`L4i -QM 0P P -Ѝ0 ЍrP0  Ѝ; -L$MPA`AVDP HP @ p2P Z h@S 40 40 \0S @40  TQ 3 R*TAP@P@0 R񟗿@&&&&&&&&&&&&&&&&&&&&&&&&h&&&&&&&&4PK  @0PCP 1  5 sH0S02K H@ 0 1^  80S $00cN  hZE 1000@*K  # #D0 S<Kr#Q@#!1`R001S00 000!005  !P   2h 10 177PF S 0 B0 0   0h0h$0C0C!0hH @0@4PK "@BK@04PK  PԕP02Ky (9/P@0<K0D0 @0 @".@0 \@PAP 40 @P80@0Cp80P)`ʚ;M4 p-LM@`Pj ph -LM`p@ 0$   R \ 0S  R\  Pq  P11<<1000 |000|0 "48<#X 5 3U  UO 3U00SF0SA0S> X3R: R1 00C B 0 !  80S$00c  g@T 1000 ! S0 0C 0 0d0d$0C0Cbzi i$gX2  @2 P`0pS! R 0`R 000S@0@0@0i000f0S$000 0PP0 p1U! h1UlL1 $ 帺41 P`0pS Q000 0PP0 5iD50 ' 吺0 P`y0pS r|P000 0PP0 ir P kiOf,5aaԊ`5݆Da\5@-@@:@0\#" 00  @Z00$j^45 0-r/0L@P0S0 Y 0X \ZP@Y 0r!01<0 0h-00@0  8000E  /s?G"0& -LM!@R \0700!R\@-@ *,  0!\ "0! ":t3@-^p`*#!^ ",!1 #: t3t3 0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l k d0ST c L 0^ 0 000  0 Q5W5E5K5 -LM@p^@,`K4K P@I,0[ 40[A IT  0S  @PP0 0007 KP@    00 p1 0S!00.A 1014 7  -LM@@,`K4pK 9P@A.T % 0S  @PP00CS0  R0700 w10C14 -@LMh`5 -LMp`P0S@0 r01 Tr 0%  0($60 \0%0 0 0 WPX0Z Y@Z0 <0@A`M4ȁ&t&$` -40LM @P0 0$` -LMpP`@y <P 5mTP 4 10SZp00p0  QM QAB`' 0R1000T!Sp0p00p060"1 @` 0S h0| 0h0  | 000 @@ 000d 7 (t35d/`@d40 3A0 .3DaaaM4Ԋ`$M4Q0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i &i -  0@  -@L`p  PP @  0` pP0 }3@M4 p-RLM`@PPU@p 0-L P@\p 0  40P \ 0 ~PC3`M4M4 -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ 0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  7@ 0S 1 \1Sx50S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00@j^ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f p@T0TS@DT0TS $P`U"0WP 2 AWkPP0DUpZZW ! 0Pp8 |10@0" d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |0  Ppg 00 F3a0`8j^45(`(5M4@j^ 0R P* 0R P: p-LM0P@S0` 0 T\ 00 00 0P0`@pb0p+@,`M4 -LM0 @ pQ8  x1R!   T:)@!@0Sd00d01c.0Q v?1`!h U 0 (P00?>1e  1E# = S000 0S000 0S000 "=" S000 >S0 000'  5P4 -LM@V !R1 11 Th 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMe.S@ 0`?C0CQCD0T T(0(0 0 P4P4 P P111< 1N P PP1N  -LLMß0囎P@ `,0 0 h dKh ]hP.0S5UPUd0[pWTK8h R2b3c13d0<3 ,0S ,,dK0  @T@p0d0[Wɖ 0  0 0  B0 ɖɖɖ@2 1l0 0}ɖ|rh _U 0pWp p00  t0 P@pp0Wl @ 0Tɖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0* 0$ɖ 0ɖ 0ɖl B0l0 0ɖl 0ɖl0 0ɖz$`Q48u3 Q00S Q -LMĩP8S ySp S p  Wp.0S7 B `<` ` ``VW > @R4p@TP1 R P49 S9䙅4S iV P'hP'tP'hP'tP'tP'hP'tP'hP'9<949<P` W@>\Ġ @Tyrpp iS Sppp 0-0 0 9PS009L@SPR'Q'Q'\R'Q'Q'hR'Q'tR' 0 0XK000 00CSR'R'(R'4R'@R'080000808070:00;0<0<0: -LM(:@SC \ (ʀ 0 S05(:A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPPu3 -.0LS1P` QY2/A Vy00S\ \u,pVT?>1 u.Q L00E\Q0?>1 u. 1LQ 1?09\Q $1u> 0@T@0` 1u> 0@T@00 0u.S L0100S0Q4u3DQ4 0-9L P|000 RΠ0S 000S20S@D0@0 d0 `0Q00R0S>S "=" S  R\W'(W'W'pW'xW'(W'T 1S1 RP 9S u30 1 SRv30 0000  p@-1 @^PT * ^0 0S0:W0 0CR  000 ^00S0 00p00d0bT00 R 0S00 000S00C0 ̫ -LM:@S0: -L4MH \ 0P,0 L P T  L@PpP`L 8&L 101 VT c LT 1:)01T00LTOTP$0P0T 0000C000I S %L0P rP^ Ip 0H@0Z0H P 5P50 S H 0: 00S3 p0@@K IH`: 0P =K>\ }YX  0 PSiYX P QX pPpC D 0 S %: \ DK0}LbFT3 ,0S , p!@P 1#1 1010 P0` 0pHD;0D;L0FT.F 0Pg0jUP!D KU \p0 }WD0XPH8;08; 00gUPS  U P  \0m}P P XXpX ew@aP " 101P0  QPP! 0Y` 0pS@=$$ R 1 0+10 ,P(P<`8`100 0P RH4;04;y H D;0D;tژ0@00L0 0#Se@ $]$ R 1 0 +10 ,(<`8`100 0P0SH4;04;E @L _PH\ \;0\;9 \0H :d$`z`x`\Q4{`440 0 0 RZ1Q`j^  Q-$00 0! Q ":`j^ -LMRP@` 1S9Sm  Rp:0:`0R0,0 9S 1#29  9S:0:K 00)RF !R; 0 t0S50t0!R- 0000 )t0S& 00t01S50S x R 0Sx0|00000C000|9S 9x)09|)0SXG QX l00l0V PoD ,0S:0:)R<;0<; 0Q' 5 @X X 0L((!D P 1 0 iQRXPX:0: X9Stf'c'Hd'tf'Hd'Hd'f'Hd'Hd',0S :0:9S #  P5  0|0@ 9 :0:  /P:`0:w PbP:`0:k h0)0Rh0p Vq <W00P00SoL 90- 0$#DPt010<pt01W !1R001Sp1p0V10q00000C 1t 0 1t RPP 9S p` ~ (P:0:y:0:,0S^9Sn P# Pf  P` ,0SI9S # P9U 9SK 0:0:  PP 0  P :)0R:0X5 0Q (  ( |u0 l ( PoT:0:E1915R4ʚ;,5,R4PR4pR4R4 -L$M 0pS EPp  @K h3 QH  qE?0[@0 S 0i'k'k'l'<K 6K  0V 0D0 D KZL K̒D@Tx`m PP 011$ 01  @@!@ @UZ 1:)01@$K$0 0 `hV+D0S0    B0cc  0R `ED 0L ZPLP BDpH0S 1@0C8#8#$0$ o@P $g$ R 1 01+00 (0,0 0 R!;0;9 P 9S ;0; / @X  00 P Pu 9SH 0 0S 6Q6  #+,@ @@)$DX0H ? 0#l0T0 7L@r@P@s804 @ 9S PU00X00S 1S   7@60 00 9S0Ss0P@S ,4 R 969P9sH30#  3 R   96P P 4@ >9S 90 1"0L P BT +9S\:0:P :0:8@ U$ UM0dS5(;)0RA(; R 9Z@ 5 o 7 p(0  0dSڸ1S ;)0R;0 8  ,@ 0@z0dS,;)0RA,; R 9Z 5   9S 9ST8 4 0 *0S4@  BS0@ 00@T:4 R 4@0S0P 0 RR 60R007P 9 0@0S 9Z , 4 80 P 0 P2S8@ -`-`?`4@4pQ4 Q4Q4 -L M1PS@ pP`^  "K"[9 S 5 y2[ (T9R 5 k[ 9(xX. 0Sx0|000  B @R0 001S5 00|9S9x0|9;( h5 , 4(5 " S4$S4XS4S4S4 -LM%@: 0S$ 00,P 8w3 -LM`4@Kp)0 , 80 +`XW@#0# <0 Pa T P ,0 S , 8KP79 09  DW@T 8K P<( HS8K P00  4 #( =<83<(@ +0 `% 8K ^P t t0T (@P@TP0PP pWP@@y$`S4T4(T4<4@T4LT4|T4T4@4L+5T4 -`LMPp @# 60 07wll0X0C4W B  j0R )TS  ^353576r0b0s c t0 d0969696l0p0t:70x0 Px00x09Wx00x0 0-@PL . #*0760 B0 W0CX535367b0r0c s d0t0696969l00p t00' 0 -:LM:, \@P` :\ :\ j:\: :\ `: ,0S ,x:P`@\ qP9;99S 9S 9  # ]P 4`9;9 9P`1p ȠTʅ \9u> 0  R! 1?09T:9S9S9 l R09TQ99\ 9\ 0`8KP`9@ 108%S84`|z88P`t8 R 9j 9 ;g4`9d9 a ;<8\ B08\ (8\T7P`N9!S F94`207P`;9S8 52`4 ) 09 9 S)  X'02cH'0y47\4 #(7\6P` 9S Pp x0  kPp`6\9S9l9ST $6P`wPp 9P` 0S S Sq 00 0x5rP`90SKP 㜐Kp 0HS   0SP`ZpV0CZ) 11C R# r P9<9<9#500#0053\ 3\.9 S >1(.  03\ &t3\ l3\ PpK! 9S > P KP [OK! k607P0KP [2\U *2\9妎 00`:p00P0SZPp2`V`:0`*nP` ,2\ `Pp 0|S:GK | Q`V0|00Pp| 0S*<Pp  0PP`PK! P`P0[ SN@ dP [0*OK]9S)R~ 9  Lc G`#$`ii iiiT4$`@w3i i   i8i i 5T4i|i|ii !i ii5i i 6i(i i i|i8i| 0-!:1)9!1L): t1) QP*\1 X1Q0 0@T@ 9 0  9l UhAN @0)00lP  -5L`@YG909l@( ~OW#p  9S9 #00#0!> 6 6 7~) zp003039  039Sr007 _( HU4 p-LM`lP1u> 0l@T@T*0@@R l0S@9S,#9@ # @ s 0:@S 6 R @9 p# P @7P  # -LAM\5 `$  9@#<3( 4[03 L @R90929PSs PpA 0@S \ S WTPW/  lT2 00)R   9W R ) 09 $0S $Z/9S9  0:SP )0S !00009$PWp 0 RpPP IKllA 0  PPIK?> u. 0!LS2 0S2 \\ 꽉?>1 u. 1LQ @p \$`@U4t%5\U4 pU49)sX 9S0 p-LM&T`P0S@0 0 T p1@LA` -`LQ0 @P@dDFA 02p Sb` 0 S0 0 000 00-`-`?` -L`0 @P@dDFA 02b SpD 0 S0``00`h_-`-`?` 0-P@L 000 00-P@L 009 S ) :S0,:X 0h p-LM`@PU;0 ;p p-LM`@PU; 0;  ##I9l l p 0-LMHP@0 L K@0 7KB 0S 0$`U4 p-LM9@SP 0 I0000+p( ` V 000p9SSP` WW 1S  p p-LM K@P3P9  ` P U 000p9S" ePP 0Q #WW 1S000p I000p`n^ -LMpL@PT`  l0S 0S`3`#0S60S`V P p-LM9`QP0 )I)"B0  :0C : R xQ 0 Sx0|0 00C041S:S,:p ZU4 p-LMP`F@@D@AT0S p:  ph2 0-P LL,@ Y0S Q00h -iP0L90 9:P@  *:pR 0S 0`S W@ h9S _X;0X;  0  -PLp`0 9P@ P@ h0@-\PW@W Q 00S  Q Q @T00^w3 0-3LP@0  Q  P000X)0R009693 979009 y $ " -LM9PS@`&10S7ip9"Ƞ2C3 ,^0 R%))9ɔ9!2C#0! `R 1S0 00  0i+ 0-3L  P@ 00C09 9S0D  00C09)6 90 $ " p-LM9@SP)9RbC ɐ 16109(0 R 00p U4 Xp@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP9ɐP@ S`` 0SF S p 0PQ Q 9S # *PP "PS00SꜲ'Բ''' 9SS#  PPP00)R# 00)RPPV 0Sp,5 -LM@PAAP`p Q20 8P 0iSS  0i=!1`R1SP1P0Q10  1 0005  L0 10 1(`7U4 -QLM`pPx 001k  80S $00c[  k0PUR 1000@ `  921)  ) ~  #1!S(5 9S PX ol@0(!(000d9SPh9`Y0h90dY50S)!0@00 S 0 B0 0  0e0e$0C0C5U4 V4 -LM`Pp 7P? 0iSS;0@S)0&00S!,'Է','Է'P` 00`IT000O`T( H;0H;Uv/V 00 0 S2PPy 4K P` @@10U  @@@"[ 1g  80S $00cW  }/PUL 1@0000000921) )9S|'('`'|'`'`''`''0#0 .K   9 0@00u00 .K  #00 #  .KD;0D;jS 0 B0 0  0e0e$0C0CV4 -LpPB00ʠj`P 0`/">C20`0E*S=d''d'''''''''''''''''''''''''''''''''''''''''PX`@ @@P -L4M, PPi `p p@k 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 ,0<(0 0` p+HV4hw3 0-0@0PLUPP @0 0-0LPCS  @0200P@ 0-0@0 LP@0*00 40 ɑ R  R    " -`LM Vp9X"@-0PU $ q1010  1 oUViX"@\ $_$0S !0 ;00,(0P008@Y YZ UY L;@0L; 6  Pp= 09S  l0  3    ` 60 Y0` 6 7IW@#10`P0c0 0 0 P@U(Z# `D; @0D; Y 0Y ?Pp 0  l0    `T@9`0W@`0`Y uPY{6 1 Pp @00 9"`32)R  l0   6 7W9`S% 00  l Q00   00  003 R W `00  p 7#40l{ #300ls` #31@r0`0Y/ Y5"0`Pp 2!$ ! PP!P PW4  00 M ((0X`Pp 1!$ ! PP!P PW DH$H0DS0SP T00R00S Q00P00S00T00  0Q00`P00 \ S @9SP00 T1915r Q 0* Pp 0000*l` BO@  z`x`V4V4 V4 -6 pL- PS @0P0 PPP~ L`# GQ3"`29 S  l0  9004 W@c0`0PPlc`Q00  0 R Y0`0c0 0n`00  00P006 7Q`,5 p-LM0PS@ ` 1S 00|0SP0xP0|P0@p000+5 0 0(20)p0W4D D0D @0@ 0!Z0 0)9 0!1 * ''o' -LM@`Q 0 S`9d9 h90Ch9*xQ 0 Sx9|9 90C9* -` V `PULp@0@ 0C^SPUU dV@PLPU<V@(hPPUlX45pX44 -PL`@pPp'''' 0 . Q( 0@!T\WL~H|V@T,ht  @mTieb #2 WRK\F x?,: T5DtX4|X4X4X4X4X4445X4X45lm4X4X4X4X4X4 -L$M@0 ,  9s 0 l,2 W0< , W` R8 4 p[0 00 0D0 @ 000 0 H0 L @0Ss 0 \oP@  0R\D 0R ,0) 0< 0P < H0S 0\  00 P0 \\3 L R- Y' 0J0 W 0 \ 00 W4 0R08 R0S0 0< 0R00S 80@8@ pY, 9S 0S40040 @ -LM 96 900|0 \@  \ L0 R 9 97 9799S9  " $ -Q99 8891LS p-LMIPiQ8X'L'''4'T0(''' 'x'9Sk SL SC S) 0(:`Q 0 S`9d9 h90Ch9(xQ 0 Sx9|9 90C9( PppJ0:@ P`  0P` 0|@ P` 9S 0yP`e9 0909 ? #;lW 2009T񟗜''$'$'L'9S TT2Q k9@ 0 P0`005 #( ^Te('''''R0\ 0R RR0IKTH('(''('(' 0 T9('T'('T'('W0 R250(:'#xɕ0\ (  67&0l0X@@@ `9XX  @@00<44,5X4Y4Y4$Y41P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD 1 <1.X0 ,0S ,0  00 0 P  0 0@w, T00T0,Tz`$`8`Xa4@` -L M 0@p@A`0d` 0p0#!dPj0 0d0  0ppB  -LMK/X? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`V*xp0 p``P PUẹP᳹Pڇ5ܾ55 0-LM PiP@ 40P00 KPPA0SL LĴ@808 P0鸴0鵴0鴿5@( 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0h邴JT:<0\ T0L0P0SSP@05@5 -L$MȀp0P4`K$0 * 4P0S L00P0 $0S $| 0@P  0pp庵D0<0. 10 S $`ha4$`5a4 - 0L Pо5Ծ5` - LMR 40 S 0 0 倵a4 -(!XL"x H` P  hU H -L_!!Q#7011A!1 Ƞ_1 _0A0 x!0hp00 cT1(0000 c( _ ! a c0#7%c!c1c X@0h08 #HT 00 0 R 900T| ?A7c%c!c1cW XEنn^n^n^n^n^yn^&3)`^5n^\5n^ 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0\5/u)`n^n^n^n^Eنn^n^n^^5 0-LM0P [[@[0[ P@'0n^a4 -L(M,`KD 4pKr4 n@$Ÿ$ 0@3 Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ2[S@ ` B1 2P13[@S `,@"!@00Q@0 t p l00\ eB!2b2c621b1c1\ 0T몁33a4`5$`55T58`Ԋ`܋`h`a4`a4`b4$`55b4 p-X`LMPۥ@T 0 S00 00C0ͥT pԊ` -LMv0@S e000 RqP "2SX00X0 o 0X000 0XQ0SF 0SC : t 0 00t P000 "48<#Q000 R000 0S  b 4X P.P 0%0S q Q \4 R(00(0  o00S 1  P@P :#0S#0023pW 0Q pWp0#$0$ h("( "4 4Z0 "48<#8  `00`0 ,#00S!$)-"("4 4Z00SY 쒟2  Q IP: 000 @PP@) l"@00@0P "4 408#8#$0$ Ǥ$"00¤40$"040 Ÿ0 10 㰤!@o髤!d00d0妤1d00d0W L 0Sh 0Sd 0S`c 00 0 R 0S < R 0SR t R 0S  R 0SR|00|0 $R(00(0 t00t00%p00p0 P@P000 P@8`@`X55`܋`̿5ȿ5`$`5@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0R8` 5 -L M p0 01 cQ c 0  0 RT 0Q0R  R> @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V  %  "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V ` R0@00@ .,$00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP`Q `0V0C0@  P`00C0< V@ 8#8#$0$00 0 0 000  R000 @"@2@Pߢ @dDFA 02 S`(1b1 R000Ǣ0 0 0! 0 0 0!B W P 0P U  T`! h00h0V 0S0 0 0 0\!000[ 00C0Q Q00P@P00 tY 00S0<0 0 0 0 0 0  00 00 v`̿5-`-`?`@`@`܋` - @LTp ` Pu R000@ 0U0C0 R000 0@P&@dDFA 02 S`T1b1 R0pp00ph 㵙̿5`-`-`?` -L`p0S000 R P00C0@ T h@00P 80S0C8000hԡL 00 0`܋`@`` p-LMt`á0S pX@00幡0S㵡00ph鰡(P000^0S`܋`@` -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@T܋`ȿ5̿5@` -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( ỖP H 000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0凖P, PE0S P T P 0 0H000  R H 0D0 P ፖP ᰖTx D XPi4@K 2 [R3[Q0S 10[#0 210K[8K@  10[0S% S 2[0<KA <0 20[020K@0iPpS20[3 [0Si t mdP. 20[020K20[3 [0SX0L0@ 0崖P H  Tꐿ5\5`5@`5 p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 9P@p齬`` p-LM@0`+TP p0D #10Pn^X5 p-0LM$0 (K0 (K'K1K PP+ 4 10 S 80S0C80p酬00 R0`V @T 00 Q @T`V80S0C80pc◻P80S0C80pP` -PLP& HP` 0@10 0 pD00 P᛿@PE0U :0U0*00X5n^ p-LM` 001PC@ c| 0!0e 000e00 000p -L M1` P@,`  0$(00(0oBP 0SsX  0R 80S0C80#000 00 0 ۧ3\  0#$(,"(DRD #0Pp 0#!DQD#p00C0< 0R #0 S0!0" P"(00(0"Y$00$0n ,00,0WM APAe(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(e(f(e(e(e(e(e(e(e(e(e(e(`  ,0uh1 R P!P 40 80S0C80 00(L00L0`W 400p 0Pl Z00Q00Sb dP_@Q\ 4 000SV4000P0,P ,0 `L 0 ',  0 @```555 -LMQ@` R0BS)g( h( h( h( h( h( h( h( h( h( h( h( h( h( h( h( h( h( h( h(4h(Xh(`h(h(,i(4i(U 1 Rt 0h饮 R 0Hp-4 0PhHq0 p剮0@S P0S PU`P7㣕P0p0 peh0@P PLD 0` {0K`5п5``555$`Ԋ` -LMph@ `P( @T @P 04PK*0 40KT3 K4[ 0 K-K.K/K 0S 8 4 0Phh`$`b4 --)L4M0 ,0 X 0 QL X`H0 P p D KD `H @001H0 @ 0S* \ @*\ 0  WP . P 40  0R 80S0C8000P0 0 00 0S r P P T ꤂((((H(T 0S p@T 3R ,0 S ,5@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p  1P7pw 000s 0RP@ 0 <0K; K0@K80 Ң@Q |@* 0P0l01 ! 0?0 m⚪ PU  0R? @1 0c0cS00062 Q V10 R ,*000  6x!06 8CR 6S 1'0 1 0 GP!-P$1`T0Q0'0 !\@0< <e $!0, 0cS ` 000T"0\"?08t0`0`S 㥍t07t00K 3㙍t07t0唍00C0#3# #R?60  000cS0H#LL10T1p3@_0yD 00 0 R000 0 0 00 0:80O$HT!0l0bSL|040/P$B R 00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0S \  0 0bS f00[;6t S7 10T01t 0c 0 0bS^ڰ0 00 &%0&?08 t0`0`S? 㼌t07t0 0KJ㰌t07t0嫌0!R$ 1'0 10000S00C0 `af0O&0 0 ,7b~P7P'X'R? R =Q 70 S\ L!p00bS P0Q0R00S 0S P@0S\ X10cS(0T1p L!Հ`Vw 00cS0nS 1S:6SDt 0R00 l R8 0!R 410cSb l 8 X  |P h0  HP2|@t 0h!0bS5t0`1 S`500 1R 40 :|0S m )0?0 E  0RpQ lLP a0lS0VG,:d 8  0000|  @_hX| 0 |P h0  HP40 ' L@ P0St; R  0t00D+t0t   0L@ @+0 ?08⡧HPKd`K˦Ȧ R R0 0 D0@ @KGKH@K(0 \K4Kd@KcKK0 &Q Qw ! 0 S- 00 %0 S   0P p  DX Pf 101  f R \=@T2 0R #3R ʌ tK 0P P P  ~P1010 S1010P 0 `( 㒪l ㎪0} ㈪0H0KGK D d0KKcK0`0 &K]> 劦P   0R00 R P1010 80  X00 x0  0{ `|0t0 0<4(<"4!*s000  R 0S0s 0S0S 0s R  0S0S0S 0S 0( CP000  0S P0 @ !0 00!0 ~P000 d 101x0K P p x 0R0%p * 巾Valb4 -LMQR0@Pp2K  R R` U`V00V0S RM R @00PfU00SV 0 6S&KX2[#$0$"K"[ R V 00 F<4(<"4!<0 :<4(<"4!<0  6St0@0>80Ua 5Ya(5HXa(055Xah($50Xa\VaUa -LMpM919 S6 0!0S.*!@0` P``p9!09100S00S000P T!0?0 ciP$ V P0@)QD0 )0 01 000Q000 D001  B a| 00C0P P 80S0C80D G5pXa055h((XaYaUa( 0-L@㽅P 凵0h鵅Ua -LM㮅\AT: q 9R09D0 0010`  0P 0Q000 D001  B 00C0P P 80S0C80 Hỡ㽡V@0 \1oiZYaUa( -0LSp; S* ` 1咣Q@A00L@T H0TS @T= 0Sp  P.l0l P@  !a000 0 0#! 5Ya\VaUa -LMPp , K@P`\ 0 0R /  0bS@000c0CS 9R09D0ş 001 0 0ğ 0Q000 040 D0401 0  B :$00C0帄0jP 00@h @,h00 h0s0s0030S S, 0S H0 0 Pp 0 0 kP P p00D@D0t t 0S \#!0P00 R?"" 43` t 9t0=t0.Pxg P0RP1 0 0062 ! ,!0"?08↠"000:S?9 S7 100! 00&?0f@Q  10cS1X!P@ P P 80S0C80ڰ 4@4B l7 P P 80S0C80 ,4 4"@0 E PE  0+Z h0 u H00080P00ᛃYaUaKJI555Va Xa(PXa -LMP@`ᅃp KPPJ 0 0bSE 9R09D0 001 0 0 0Q00`0 D001  B џ 00C0O 0@P P 80S0C80< ဟゟ魏&/YaUa8Xa( -LMP@`"p KPP <4<("4!<S  ) 9S090Q9D00 01 000Q00`0 D001  B ^ 00C0܂x 0@P P 80S0C800 :YaUa@Xa( -LkM PX@LP@@N@\ ß X ! Up`D@ \#t0D SD K1nK `P 0S o/KPP` b@0a Y Pl0L0Pd @0 0@0d QPPP  ! Ν˝ T31p .i᠐001 U 1r@ l0L0D= S909D`0`S5 000  @[P P P 80S0C80 (TV1P@ y|0d@  @ dm0[ 0 " 000  QlP0S0 000  QP0SY FDQ @5VaUa(`Xa -LMU0Sp`0 H S(  04 ,0 =0)0S4 0V㢁@GP` 1 01$0  1 ቁV xT0 0SV 0  dU0S S P <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R t30(,!$#, 9nU 0S[ SE 0S; S& 0S|0S S /, Q< ,  0"0S;0, P4 | 0`  !4 8<#` #8 0U 0 44"0004  0b!$(," "( 4 *U 40! c 0"4 40 ]1@0/91P <4 r 0 Q1 !0n@P\0 t@ z Zt| S2\ Z h hXZ00^1!X\ t P0  CX@0D P3S0XP@x0  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R4=!,=0x aS0b0bS T tp0 0bSt1Sd  S( h tp tp00 0S J? dh `Xt ɃXh  r X00R00S,,h00h0 0!0bSHD0OD@ @Pp 2 02$0  1 W' |Kh0 0SW \0 h  h 00c<  80S Xڐ\ 0P \| 0Sy h0| 0x0S 1x 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,P 4 P0x #R7R9ɟ 2Z`ZZ"("("4 40@0NS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S8H 40!0000@ 0R t(0?0 400t1SV uSS `P.d1l@ǟTdA@00@0tp 00 0tpZ1 0cS0Xt0 t^<p,0 S ,0t07P `(Q ` 2RAR6S87ó t0`7媚|7 1!"4 40| l t00| m0&00 |@S;0 0H @` S!@( B"40 0l 0|| 00H 0 Xa ⊚FZ 1 0cS!S 0d0 0 8#8#$(,"8S`PKdK(0D@XK0808( }$`Va:0555c4Fr5)ha -@Lut0`0p hu, N? , O?Ɍ LQUP1 Q 0r0*0r0P0,H0l <^*40  ^:00000YVa:5had5 p-L M@gut0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08}ph.u<00<<0 Vaha5ha5|ha 0-@Lut0P6 S \0P\ L0,  a R 8 80 ?0H0htha55|haMЍ -LM Q`Ppn \ 0Sdt, @0V0T00SNTD0@ 0 Vf ))d)))p))))0)@)$)P)h))D)p))T8 Y 0,t00A 0@P0 0Sx000Dh0   Ὸ _Qh0< ᱸPM0SK S. DPx% 0:0t P #08000#60 ?0A ,Px7P 0S PQPx Pro0 S0S0S 0S 0S 0SQ0s Q9PN \ 0S 0S ԿP E;08c [P50- *| 50,H0sH0S0@ 0 QϠ 0# 0 01  00# 0 B 0CS0 sg|| 0 0 0r @0r0h0   l "h0   { *-sU V V  U 0 Q  0o鋻 0o[nVa55E c4 -L M`@pPSs, 0 S_ UD 0 R R/ ,@s  0 0V, V ,)s W W *P P 0S0 Rڰ7R'P 0S0 Rt0t000t0 {0W 0 W* 70t0 0rV 6 P p-LM0PS P0S0 P@|P@ p`GP Fh0 00t1@00 0@070ph5l5ha 0-6| SL@@Pڲ0 0S L P@60y@ -LM6@S ))) ) ),)06@T 6S|0@ 6P S000 0όಎ0605ha -LM⬒X`, P P0SR9 Q㍯K"!: /mP@/D2(K0S S| K 0P@t 0KMKP@l'r1X ( K0SZ SM X W DP @0  @Xr,0 S x,姐5W @ 0  000 @ 040 Xq/ ᛅ040 00 0(K 0 S S W@ TU5 0Q0  h 70S%V h0L@HK0 P /0SQ  M 00 0DK 0K 00004#0R R ,0S00S40S80S 0, PPc 0S 0S$0S(0S  ׋P#0RU+ d%0P # 0S00  h (50S2V h0'L0HK  P+P  00 000 @P0Z\0S  K 0 K 0( R 0R8 R 0Rh0 0n Rn 0  0P@. 0P0  h 30SV h0#@HKL0 <P1 @LU@0Sx $K 0 K0$00P$0'  0P@000! Q  0 KxK0000 0@< 80(  0 n@HPKỊH@KGK0K dPK@ᮊd@KcK0K 4}@HK᠊H@KGK dK$K 0D0 嗊d@KcK06K0`0 i0S 00 0^    (0 0(0 0 ~000E (00(0>000 R U00 dRP0dU|0K 'Pp | 0R0% *0` G0KУha$`8c4ha? ʚ;lb4 -LM@0@@Lu@0 \|hk @0 -LdM̂0Q@,0 p`P㰢 0S ,0S ,+0SP0@ShP P T2 R Vy Pp 0t0 x U 0SYdK \KdK0PYA p0t 0R:l@KΉ0 pt @HK@PKĉ0 G0KHK,pᢿ HK00 PW [&[xdKH0K -[\K&[0Px0dK  dK㊉0 c0Kd K\KphL  dK0\KdK Pp` x` Z|`$`%)Dc4 (]ha3 0-QLMP 0S0S 00S P0@ SAPP T \ 0 0HP @0S  0j%)l5 (ha --LMP 0 p`Y (@#*X (08 S, 8@m0 OP@1w  80S $00cg  PU7@R 1@0 0008#8#$0$0 08 (00310#1t1!0S1 00 0! !48< (#( (!(!8#8!QA"A" 8#8tm#$0$ ,0H 0,0@0C>`@X , 8 N0mZ IS 0 B0 0  0e0e$0C0C0m3(0S9@s5haMЍ -LM QP`@p 0Q0T00SQ-)<.)H.)l0).)l0)0/)/) 0)/)/)0)0) 0)l0)0)@0)l0)l0)l0)l0)l0)T pZ Xlp lW2 Pph0 22  s t lh0  ðp lah0  0S 0S$0S(0S 8pxlͱp plW(0Sgl)h0  0S  0S$0S(0S9p Plh0<<,80z Cl000zxh0   0o 0o-h0  \ᮻXh0  QᶻM-pKh0   0 po 0 o# ha55 ]53Tc4 0-LPk@D0hk -L MQ@P`\ 0 \8 0*| @Pil}5` -X0L \<1  %( 00 05ha --H0L Q 1(   00 05ha -L MȤ@+@K0 0 P<+ ["2S S (00(0( 0S :"2`S0 S 0 $(,<4<#: *0K0S0000  + ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0KP 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R 2pW @T Vf 0S^ @TpW@ +[ i0, O\`B \B`{00S <P  T0,Xj 0pR)000SPP0!0P0060#t1 @Pj0`S jj000 @@ j000 00 0 0R X 0S 6P$00$0`*K :Pk>PP+ ['0002PP + [ eha5`iaԊ`Daaa`c4 -L M`)0K p6) [0""S) K S 1S1S1S1S `6 R T6,  , [700,1S01S41S81S  Q Q Q Q 1  80S $00c ( vpW 10(00@`00!( B("("48<##8005 I 0 B 0)P[Ui U^40K (40+K,$,"*)0+ K00*K *0Kg*[ 048!,!$ <0##$# 0D000,4p R 4 R 0 R ğ ( B0@ ( B0@0 R   B0@  B0@`#(0/0(0+K) 0P$#7000p'SV 0( B(0 0U  0g0g$0C0C00S9000500S/ 00S'0 0 0# 00SbX (0/0(042 R(1S 1S2,  , J1p  80S $00c`  ~pW 1@000 @ 0 000!"4 4`!0庀(1 0 !   440)P[U Ug00K 00+K,$,"*)0+ K 0嶀0*K *0Ko*0[0+K 0x0 Pr0#$0$ 090 "4 40S 0 B0 0  0g0g$0C0C %ha5ia-QM 0*\ЍxЍ5 --x2LtTMp 0 Q,0  pP1  00 0 0@S0510205 :x0K x [0S 000 ,0S ,w0[S 0S* P0p00 HK㬃dK㩃0 "bV? V Y000@@0K HKdKc@KG@K\0K  tKPo 0 `1/<1t [}000x  㤃P11<<1@D0K GKd@KH@KcK `0K5(ia$`c4Dia,5 -3LM0`SS@ S"2QQ2 QQ Q(!08# gpxRPP h011 01$0  1 gUr 1:)01!0 0$!0@ 0$00  h0O!0S- S @H(0K (K'@KVP@a0` 0 !( B("("48<##801   @2K .@00@00  1#$0$0 a A  440(! 10D 000N7$ 000FW%(ia z`x`5-QM 0*\ЍowЍ500@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o领 @Jy?Z@p ᕆ m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q 十p$`c4  0 00 -LM @00`XpW PU (<0L1`0/1"b0bS5T 0 k*P:$0WpW6 0lP 0 R h00h0 00pŏP@0000 0=*PT@ H0ۗ<᜘܀0 SQk)c4c4c4 -LM ^0 , 4 `@^ p (<0@4`0/1"b0bS 0 R0011(pX R ,K 0<P@00iT<0  0)P@ኀ8   0P4P - 0 R h00h0 040@_00 0P0 ,d T0SW,<00<00, H v},0 0 R0$0 \R0 Rz<0PS( P"?A3cPg@Ÿ80 0P=ؤ sP. 0 R$ < Ġ /0 0\0 d0, 3T0,,<00<00, H "},0 0P <h04h0T `P<@0  ޖ埗@,P 4 R 0&)i0,0 Ė@0店s<0(0CX0/"b\0P T嬖00x0 04垗,Qd4k)c4c4c4d4Ld4pd4d4d4d4 -LM 0 0 $5S @ 0dpPPT 00CP0  A0`TPyVXPK0K  !PpK0K !P0S  P0(00 0  E0`S 0!0 Sm @L(Ÿ  0PpQ `0 V!P0V P`80 VP 0 (0R- Q0S& y T0S r` VP d00 TQ[0 d03T0`80 VP P000Q 0 T 0 (0R|x  @`0 0K@yP0H00 @A 00 KjP0 @DPH0c Wpq)050 R45 -L M0p00 00 P0, S j V@ 0,T@#~ V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0 e 0Sh0 0S 0Sh0Po0`0 `N 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S :P 0S``l0P0S 0Sl0P0s  0S0l0P0 ll00Sl0  ,0`@ 0PD嶕L#0S0__@Lt)e4(e4@e4`e4c4pe4 -LM P@,`}0 }4 }0<  D }D@/">C2"/P!008BS@ C}4p?#@W8 40$tDCY8 ,0 <  004,  `}T@,}P@1@#W<}P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDpS,@&}PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@p|P 10SBt0 0Z|8 0 T 1P-|@ |`,@|`|VP3"0 SPPP#0 SP8 0|`X8 T`0l!`!R @ R D0| 2a |@|`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`|`VP 0 PP`,0UPV -LM PP`4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0P@,H"H`Q@ 8  3S 2 0O |0 T0XP<0 0!8?\>`0 0/ ?> 00cR#@[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00, ,x,1TU )` -LM PP 4 pP0 00W~ 0 0 ! 0d 0,KPl,"H`0S 3S Y00W "0O00W T08 WsW@!40 S@TTA 0 0P7^!?Q>`0 0ς?>00c ^$00g$0 P g 40  0W0g 0 40 g0C40!400400,哊$Z,Y, 0 ,?z0 8 W00 ?Q>`0 0ς?>0 0c8 ^$0g0$0 P 4  00 0 40040,0 ,U )` -LMH2@Q`0o`T p Pz 0Pc (@80  P(W`@ZD  000C0 P B 00C0\%@1R6 |0P yz]z@Pqz0 Sz0` OzPEcz0 RX0  200000C0 0 RT000T00C000 0哢 800c@"z` Z"IP U T -LM `Tp 1S0 0 ! 0d 0,KP, 8 80"H@0S 3S 8h$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000 y P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  P80PU,080 , 8 880`wy`0P,080 5U e4 -LM `pP4 PP00 0 0 0! d ,K0P, ,划H Z8  3 S  0S P2 U0O@ @*yP> Z!\000/ > 00cR#< 018 a^ Ϡ\0.Q 00/ uP  p1PR\0/ uPJ @1 Z\0`000?0Q0P PP塏0.Z\0!00> 00c# 00 0C 0  P B 40 P00C0 ,"0W W0 00 P 2 020 0尐U )`f4e4e4f4 -LM p`0PR 0O0  0吐I8T 0A0U2Sʼ@x0 $0X: h{ 0`ş R00p  D0r00 00 ! 0d  ,K0P,,$HZ 3S 4 0O 8x00U 80A040 ?80 d448Z`0.!48000?.a 0 bS1P4 0< T0USZ% #@?T>`0 0/ ?>1LQ 3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480  34R`008008?.a 0 bS1P< 0 2 `R4 `0RA P00,$08 0a$08P×n 0 0n 00000 P 000\%1R |04@Pww@Pw0 xw0` twPEwl1 RX0  2000000 ,1 RT000T000 0Z0` Z`0PB P! 0 R`0  0K000 P 0 000\%L0R|0Pk0 (%( f4Pf4hf4f4c4U )`Tf4f4f4 -LM Pp,0 Ww*w0 0 ! 0d 0,KP@, ,!H`X4  3S `1 0O v414AQ\000?00p S28 - 08X\000/ 0100 0W0p50 0 0  P 0 P00 ,00C0 P B 20C 20< ᗎ=S0 HFU )`f4g4Dg4 -RLM`, p{ @nv?Q1 Q`000.,0Ae8崁/.  b  B020!sPp1 @R, `08P/.  b  B020!sP5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` Xƌ, 0@ 8,0, @/>QU <5ԁ33hg4|g4g4g4G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 v85 0 00 0 @ R@  PU00\pP@ `r` VV V 0 4R@_i 0SE:0SA:0 @T00 T00S  Rʠp0(`VP@PZ P@P w 0S:0S: 0S @0 0@PPV8 8%0@P0L 0`@V \  0PP (0 P0@ xK P`@ PP 0x0(    w 0S:20S/*@5L 0`(0 @ xK 0vPP \  0P 0d x02T0 0<Hq @0@P0`|0Kd KPP | 0` B| 1X`tKV P    pd0G0 0@K@PPO`@K|0H \a V pQ @00xK  PP3x`0` dG0 P d03 T0 d0KH<@]q0@P=PPP ?\00Sa@  )vt`K V@ *0 a00V@:Q00 TkD 0 Rh00dh0   R0ad0F0 K0P `0KH 0 0 sj RV? P0! 0xK 00  zPP x`P` 0 0P d0 3T00 P00!a 0<Hp0@P# Rt 0 0 K0!PPZ0 @0b0 0 d03T0 0 T@ 00xK  PP;x`0t` 0 XP d0pK3 T0 H<ip0@PIPP"` 01X` X0 0  (0 xK00 @  @UPPP u@@000x1( P U  S>00K L0R-PK ?@K 00 KKK K0P00@0S:0  刉光g4g4- M ЍJ -LMPT`$ 80  000    0 08 00R00S 0pKA1  0 R 0U 000O 0 R U0D  0 R 0V( 000O 0 Ry V0  @ H0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RC P` 0p;r0 0 0$@"rx.r`0dCA0 4K0P@@0Q؈x r40 H s8 R T0$ @ 4i44,5Sʠ0' 70V0   V 0000uU0aU 0000RT h4 -LNKgMTQ`U@|a 8 0BRS p 0S  XQ0S R PP >K Ꮦ 0P(P,P4P 0 PSlQ  0.K0T1QSNXaqVJlT45S:05XS*00^K01 `qS?K 0 0PP 0 R 0^K000nK G !q Ls000  0L0K0K (lX850p1  0 R 0~K0l^K000P `Pwr~K@ 00@.K@`Klq8Kt 0KPSo`t0堀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Sjt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pՠ000  0PRoK p 0S㠀1( ? 0p0 0 S0p (0P UP@K p 0S㠀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0  XK@ 0 l`PtS/ PKt0 p0QO0@H K㠀t 0S t.Ka00h1dA0e@K 0 RYtPt Z\@ 0T PQ 0SG 1p0.Kh1dA0PE\!0OT`aS\\6 0S `a.K1p0h1dA0) \QUlQ0 0S ^K000\aVBlQ0QT @aT pՠlq^KT0`Q3/nK h G|a p堀d|a 0S ^K000 0 R |qg /0 00| 0- |ah00fh0K0`q WNKlP r p 0 S# 0S:0S*la LS>R-`0 .K a0000Qꠀ 0S:0 K0w`a VjNKlP Pr 0S" 0S:Z0SW*la LS>R-`0 .K a00D00Q= 0S:0 5`^K1( 0O& 0S!0(0 1p0p` U pl P01R/0 0S:0S :l0@h  q| pࠀ| lKS>0 lAL R-NK ?  K00@ꠀ 0S:0 1( nK0O`!SlQ~Kd q@FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l1h0 |AxQ p堀@|A c0t 1X t^K1X a0OPXqW0K0 ta0R00X0  p堀0^K000>l>KP o@@A NKPp` S?K 0P0 PP 0 RY 0^K000Wl0@ 80S L1pqHgpkLE LLL VlP q p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@ꠀ 0S:0 0.K00K0NT 0( S/& 0S :0S:(0S$h0S! 0S 0(pS  rj 0 R 0 0f00` 0S:0 0TaS頀Xq0S0TSf$`

-0`pǏ00  0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ<5ԁ33800CSЪ)))$)))))0S0 #Q00 #LQ0 R0S800CSꐫ)))ȫ)))))000 10B0  2 R0  00800CS0)L)$)h)$)$)$)$)000 10B0  2 R0  00800CSج))Ĭ))Ĭ)Ĭ)Ĭ)Ĭ)0S1 S20#B1  0S 00 -Lth4 -h1LM`Q`!00pP@<1S΁D 0 Q/0D@$P4`P05S`P RD0D0 0 < $0D000@ <T06PD P DP?DL?DP ,!?D ,LxcDPH~OPDxB~PWX00 9004X X040 a%`hdP3TTh4i4h4i4E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M$0Qp `; P@ҍ X00#00' PP@р L?|  0 0Q @P>>>$0ԑ:$0  -$0L Ppԁ  5P@`@0 S@`V "P@P @ 0 0@  -p`P\LP0d -40( 8$@<( b@`@, T0C0,0VZ  fZ fMBl f D a{Tj4 p-LM80@SP0 0hl0S  `V p  00S0  -LMa@@ -RPp =SAT8 K8 4P , 0@  88p $0 #=0T00S<K <0PpST 0$ @ ;  0m0S  pB@ =SPp| V{)f4 j4 -LM4 q8  |8 PU4,0KPŸ @Tt`a0T"0_: p@00@0, `,002 0zP@ ,xT PPd0 0 0$@7dxCd`0dCA0 0K0P@ ,608  t@xd00 H e00x00p1 4,0K\P@A 0S@@l0P0S 0S1 P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʠ 0p00t0 0S0l0P0l,80080Pjajam4`5TiajajaT@-@1T0, T:F@M 0000 0S00l0P00 -L MP, 40@c0 PPp#8  R4 g0@d 0  H` e,QE 80p W 0\'d0T   cd@000h 0`00h HdL5H sP5,5S,>QS. 0G0P0 SHŒp011pGW400P000 )` p-L Mp@P0Td``  pH@`sr< 80`@jrph n^<5ja j4(j4Tia@-QM@ 00CS `)))) P0 Ѝ@U-@Ѝ $  554505 -LTM8 @ 0< P0 @D@  45R 05R@P @@,@ 0S <P0  0S<< 0000`PU`VP0D@P c PH 0 < d P` 0 S/ <@0S:0S:D 0\ @D@08%\0pcWp!L0 0OTSp0@` h 7ed h 0S 0SF0SC 3 R9 d@< 0H@S00 $,K8QP@&H<$,@0cXX pL H@ FOP@,@,@ 0SvP<<000,<H$ 0AS ,K8H 0 Td0 0`@R4* 0S:0S:\4 4K,@K8H 00K @dD D@RS>L-0`ɯ00  0S:0 0St0p D@ S>L0R-P@K ?  0D0X00\0 0 040D0X0 0\ *<0 0S:0 <D <d P` yUv5 -L\M0 08  4 00PL 0UT0 p4@80S S $xT8l  8 0l R0000  0S|6d t6X 0S 0lS00S 0 Sl 0< S"4%R:05S:8408 0P0R00S l  R:0S*SK X 0SD 0@K0T`\ ^P <0l P ?b<8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000荅L 4e, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 MP`\0S<@H0 0Sf ,X00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^+V T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 ,,,0H H$]r< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@.P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPP@@T0( R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @Pn@..8; ,0S ,(Q R T0Q\  0 R000+d(+X R< 0 R00+d*X R/ P @!/P@8L D! 0SD1: Rx 0Sd X t:0S L 0 RL!00L*dD*X R @!@0: S w <1L H S0D!H1 0 00 RD1D  000DD!000D 0P@X 0 8\X@!@8LP!0TRQ  RT " TWH1S<6@0L0@0 D2P@P0  OK P@E<1H SL > 0H1 HQ9 H1L 0RD0R TfDH!0S< L 0S L10   R 0S 0R H!  0SH1  p00S@( HPLYD!000@!8QPD0 0C0 RD  00C0D!000080: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u ZKPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp %_ 0 P 2 ,0S ,M0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000rT1H N 0Pp3T3PpMOK 2TP 0GpW y g P10^o0 0C000C00000000PT  0S00t00t07$`` l455 -LMPp@` Vv |0S 00S Bu  iP 0 R00D!d*P 0;0  0S00tti$Y$``Hl4<5 1s s 0080<00 s0055 5< 0S00 Q0 0 0S000-<0@Q 1 ! 04  Q000   dR ,0000 0S0@Q1 0 ! 0,00 00@Q191 0 S  -LM @P `Rp% Q 0R 0UP#U($@`Gp6 P ڠ6 $ 000  ^A*c4c4 -L0M0 `P0Sp: : S@ (@@F 0P@' T0 Pp0@Q !R"C0 0S00505 0d0 L Dj^(@0ˆ ^P]C*ja)``e4pe4Xl4l4 0-FLPF\ ,0Sq 0 S R 00 -LMP @ 00Q ^ 0RP 0SZ(@OF 0" -LMPp  P,P F`VPUPa 0 P` FV,0F`VP 0 PP`6UPV -L M @p,凒0PP 0Ɣ&0,K墰PV$,0jH`EPPUI jE?>1 1@R#P P; jE!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,$0"Q ,< -L M P,劂@BP00  0ƕ&0,K+P^,0TH(` (`aE>1 1@R#@  d> aq AP/ 0lA0 P@N]\.!1D0,0C000*  R0C 0,& 101,吰(0J"p `AP;  $] ,彰f4l4l4l4 -L M @`P`$E U0: ] , &$K垯P$0$`HpD?> 1@PR#  0,0 00D 00$0$p; \[ m4f4f4f4 -L M @PA \00\0SC(D,6倢0 Ɣ&0,KM0S-,0(H`DQp Q ;  ' 0,&0 00 00 Q,& 10C1X0,֯s\< R,; ![ [$m4Dm4pm4 -RLp`$P@ $P`ADA0Qd @P 0l1 P0P:\LZP @@P; (\ f4m4g4m4 -0LM ; [m4 -L|M0   0 Q0p  0 Q0 Jʠ a0(@T &0xK埮PPx00x勯(0 v|K 0 PP  | p(0000&0P9x &|02T0x0 0x0<H@x0@P0Kd KPP 0` B1 X@t0KT0   d0H& xK0BPPNx``K H0QA T  % 0 |K  0BPP/ |@dH@ |   0&Pկ 6d K3T0` H<@0@PePP0SL 0A xVx壮x0t@KTpL:Q! *0P ʀ0dKA`0&0`啯x 00: 00x微0 @PW 04C0 00 000Ad0D& xK0嬭Px `0KH xxO 6Tp:T;0! 0 o|K 0 PP |@@0| 0 pA xӭ0P&0P, 63T000<H?0@PxH0 &K0HPPT& 0 63T0 0 |K  0HPP|@X@t@ &0P߮x p0K&0 |02T0x H<?x0@PxnPP`0| X 0X0 0 Yg4 -L M @^ 0    Q -LDMT@d ` d0 h P`P刀ԡ 4B@h pTXpKU\PK  0JP@sQ\ #0(1( `!R0 0  R` Vh 0S ,!$0(0Q0` 0 A1QXP\ p; X@i T3 Uu00d04  0 900P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pUA(0` 30000$ `V*h SH,!0 0Q (00 3&T00 tL0 ,00,0߯P@  ậP$`@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` R 0S 0S1ST0$ %$K$  000 >0 P 0S   0 0 p -LM@TP$  0`Ks0" 00 T00 0 U00 H 0@00  0  00D ]D@ 3 ,00,00 <80&Q0 T` P@4H\-8F TT TX#T80BPP3  `R< 00 ) 8 &<@80&"!h! B ; yLP<@L 8@ 6#1PCU bpaPEVX@Up4 RP@?>aV2< R) @2@"@<0@dPDFA 02 S`1b1 R0<<< 00 H0L<t00 :00嶩80&L0,K"0(PL@,0HL H  0R08&",KH @,0LT L H H0D 00H0 < [ @TL T  TG  TD T Tp  T=h  T:TX T5P T2 [0P0nT$`@`-`-`?`A`A`A`dB`B`DC`C`m4 0-@PLB/::  0000 Z:000000 -LUM0 ,0 08`1 Q`0p h 0l t &`1 B@00PT`UK@e TW?KT1 @ P XA DA T T,#T80BPPpP0`0 0S 9 0UK \a {Pd -D1P0c0Vx1 $*@TMKPd  ~`!>K0\ 9*Pd l1ğS t@t Pl1 xU:h!1!@P@dDFA 02 Sp;1b1 R0``00`0@h!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,=0 0$t  l 0t!p! i y`^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5$`@`-`-`?`n4A`A`A`dB`B`DC`C` -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `mh@h0@ PP<0 X@ \ h x  4T0$  00CS4` PPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S-p@L@ pP t t0 BOK|  @K : Pz00 ,ئ0K 000/ R0S,% /P0P00h@l70\00S0|00lQ \ l@0R0T00S x\eh /0S$ 4 T0 K0PP X0S x@Tp 4r06000`00 ` 4 4@00@0`p 4V00 K604T0PPX R x0S00`@0p 4(P0P60 0基4p P0600d 4PPK0S 4 T0 K0PP>0 `@X0 S0;04p 06x Rc 04d sPP!0|@Px0lx00S, 400 KT0PP 0   d@Q 0Q 00 R <X`\ 4Xp 060044@00@0` ,}8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  |t0 0c p ?ꕥ@_UT pL ,K/0 PP5n4j4 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@QcP,n4Ln4`n4n4n4n4o4 -LSMh! #hA0  ,0 6(@Kp1 34  L0S㈀ `0 0#60C S,t*v*$w*w*$w* w*$w*w*$w*w*$w*,w* A?(K h1KK  ;hAx 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa K?P@`Qx0 0R@`pd0S0@ 0Pp@d ` p:x0V`0MKS >K>Kp @Pl!y:d0P0@0|0S i|0`P/VUh1 0e@ J H F D B @ > A?(K <$`o4,o423@($6 F72(  6PU,& R04K0МP@*&4,0H34帝4@ 6PU8 0< L $ *<0P(0$ 80<p68#1$0&0,0( |0,L 4P l@ 0R  s80S 3 80 01s%`hd -LMp=P@+Q<` R% 80 S|00,< Q0@埱,   $0 :$0!P303 -PL a(P@H p 0 0"@  -1Ld1#pR@R(6L 0R&H d0E PU0S: RP6SS!/ Sa, RPQ0S6 0&U  0`0f 0 , 0T c 00   TZ 2Z 2 D -PQPGSp4 0-80LS@P0 0l0S 0LS  b0S 00  0P0ݰ -LMq̠PܐY@8 K`'8` 00 , 4P 'U 8` @  0r0S `GT 0S80 0 .P`HYG*)`f4 j4 -LM4 ԁ@8  }8 Z4,0KŸ PU@` -0TX"P_,0`,   p P p@ }PP ,{U (PD R0,F0 B>0$J06&0K0PP ,>0ޛ80  $ #000 H@LC@ 10ɛ! '0807!( 0S10 ,0K4nPP! @00@0 d0S0 0S00505 0d ,T0$ 000,8 ,80PP lajam4kalalaja)` p-LM`0\0 \@@TP (0&\Fp0  KP @p00 R Qd 0R 0F0pp 0000 d00- -LMpP0+p@`+H1U  鈚p -L MP, 6Z p&ƕ R0`00Λ&,@0H0,0S  6pV0Z0X00S Q -0#LRL R0SR T0 S5S L)G`0 Qd0 S(p4Lp4- 0|5 p-LMPt0!` 0 wP@ 000Hq0(08@@p|50   0 0S  -LM       -L Mp0P(K`A0H 00 (00H (0H0@0 H!0 0000@ 0:#:0 10 00 (0H00 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST04 $  L0T@$K48 8$0)` -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0$  0R PM 000 0D0 100 0 0000D Q 0 0  qk T0$ T 0P"0sX 80SS PSI 0p~P(q; T0$ 5 0R PP \0 0P (q T0$  00000(s00 000Pq T0$  000sT0$  S0s0s -@P0 LRp` P$ R 80S   P    0:0000   <0 0   RO -Pq@p@`0  v`SL P  QR0`00R@ 0S 0;0Q 0S 0;0TV yP -@L80SpP` 0 00   U  DPp0! B! -P p80LS`P T T0RGV  NP:@1!R/ 00' !000 0P 0! B!)>V  9ᣬ P ` -L\MP@H D `T T0RpX \ `  H0T `HP uDsSm \ T0R0 0"0   P X PD L 0T0 8!R 00T0 0 0d0  X 0: S 7H0 T P S0LP0 0L! !L L0 0$Ph 0 D hX DT` 0\Q ` R  R XEP RH TLPA0 H HK ~P6H0P ST  0P0 P R P T0RL0R uBP0L 0R T 0  . 0 R* T0R& P0S! P0ST@嚫YL000X DP L 0! B!L0D儫D坫P0 0: S YTL P` R00 S T0! B!T ^P0Y 10C1 P@ 10C10 P 0P 000HA00 0 0y DK  DPYM pL@P 0PT0 YTQ P RD`Q00 S hPP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0P.0[S L d#"[X3R`  04  0 D 0 ˛T P P P0!RBY ᵛ4T0L 0R` R00 S T0P2!R !T000P0 PL P? ` R00 S T@0! B! 0DX 0 tH0P0X00S*X"0S TL Q 0 0 0 X DTL 0\ 00 .RdDX  0<X 80S wH 7D500 0 0P 0DK 0 ᶦ D tp4k4k4p4p4p4..p4 -L(q4 -LM@!00CS  hN)l>Lq4 p-LM@!VU`"S Px P 0ap 0!R  0! Q0 00;>pq4q4q4 -L0!Qh 1S 01 0@^ 1 ! 10@0>q4q4 -P@0L`$ 00Rp0V $ Rr   0h -L@\p`P 0LS0 $ RU0V $ Rr U  0h000hT -L M$$@ ( 0@_6r4<5la -LM! MP@ !# -LM@b3b0 b-$bPphH8#la -LM$0  CLPH0"v!&`Q $0Ss0K 0S$Pp W a\0!011` g01$$0 Ss, , 0 Ab Qb Lb GY00X0S@0 bP` 0 40 ,@! @d' 0 <0 !< 'A@ " 8 !8 ' @"0 $R  !0'00@ "0W$aP0000 !0011, ` 4b{8bx<buXxbm g0X b`Y b[Z bV Ab P0 l$bI0$0f -LML`$ 0C#6PH SpP@ 01@ST0S @ T0!@R00R0S TH 0!P  0-0PUL@0 !P!R 0SC Q 0U0000hG< r4 -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH sPL 40040 $  f$ 0S $ 0C#vP@ LP0SB \ H0  0! ! !R&\  l!!00CS0 $0Ss40 040H L@$0  CH"&0000000 0 ! 0 0040040  B i -LMLX30 1,0 Q@T< 0S%0 R"2`)pW0  ```a2YW  //0 0C0,0 q2A02.XW87020 b;(r44r4;pr4r4 -LM@ b GP$ ! !0 $R01 0$0 -L@ MT, p$PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!11:000 r4r4 -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@ `FR00 -p@L`3@PAU0$  A0 0$bp J0S b0 B0S0 b :P0 b b40la$  ?#>C@0napan^ -0qLM|0x 0PbU|07 1  P`5 䠟 R0@0&  P `0S00@@ x 0 0Q0x h `0Q0`  b@:9na5l@`n^4pas44s4 |00`|0na-8`0P0 0C`  0  4pana 0-@LTP 00ST 0S 00 0C 00TT`  0`P0002 0201@4pana -LM 0@S@0 S p00Cp0naP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TPn^ p-LMP P` P p@ ? `202s$, -(0AL0$1@TPop 0S @TP \}20@S000@`p@ 0STma p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 U3 98TmaDs4`s4 -LM @R)(0 Z$$ aV p@P0S@PUZ0`+3V$ Zc|o3?p00Cp0@T  p00Cp0  naTmana -L@ fC X0SP=LQ00 0 `0T  0@P  @ P #(0cP$" T0000    0S,0 ,000P0acP   h7p @ DP0SL00<10Pp0`5s4n^s4t5,o^s4t4na 0-LMl@hP0TdT 0LL@H@@Pk08 440P@b0(o^<5Tma,o^0o^Dt4Pt4na0 0S  - L0SP+ BR ',pQ000000@T  0`p2 V@Wh000 0!6/ M-LM0 00@K, @ K ,@00 K6pǏ8  r 8 R,0Po `80U00S <8X 0!@@W Y 8\B $ 0`RP 04S:R 0S* @ 00CS**x*x***00SQ4*,0S00S2S2 02o 0,!6o/@ K@:XW@0K,)`U0@K0@K0@PK,{)P0,P0 @0K&0p?@PX0 W7,06pǏ0K,P0W@#&: DFɯ#oZQ8 NYK8 H6Xt4t4 -L$M0@a p W`P8 ,p 1s@:Pp` W80,S  )P@ 2! 0W  8 02A,  , 0%& < %0@S 0< ^0  P-P@ 2"A0 2"T 3P<01 \ p`P 1S @:Pp` W W 0 %&:40   (P@0  !L!0Q K @@@,@T= 2 02Q0 0@S 04$Py)2@02WA <P0 2  4 Z<202-0 4P40 1*2t4t4 p-LM@`P 0!6V00-0  @T  p - LPh!< -d0L@pT`  PU,0@T,o^ -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@mP0  S /; 2I02b(0 0008o^4o^ -L M|ŸŒ p, WP@` T2W L2W UV   ,0p @ PjVqPU 0ZV PUQ@ R0`0D PU 0Z PU1 00PP 0PP0PS 0  0$0`$U ,1,!@Pp@dDFA 02 S1b1 R0``00`X(q`U  0 00 0000H0< 0<]##4o^@`5-`-`?`8o^t4000 -LM`\ 06 q R$0$0$0  !0 @P@dDFA 02 Spl1b1 R0``00`hT0L0t48o^-`-`?`M0Ѝ -LMp4, 00 (^,00 14  b2 0 `P<0 0 ^8 p0#20# W@@ T @:0Pp`WZ 0W4, 08|  < p& 08 0 P Z  02</4 Z <]t4 0-LMP P0 4 U 0  00h@ 40 U 0   /t4 -xL M0p00 RP L3 L01001@T 00ST "!  "000\x U  j"0UU` 000 X  0pR0`00  J`X "GC "2 /Y\5&V U  0Hc7P000 $ T90 0*V U   V U 000"U  ` 0```P)P@ U  000  99kU  0H00.^@?0 L410411na$`t4t4u4 -LMtϟ@ϟ R   *0 P0@ < D 0 = DKP. 0@8P0 S+80 % D0P  4S R0 0 0  (0S   lDKΟ000( L Q00RP  0SP @ $0  0l ` #6P`1`!0CLS00 p P   0Ka0  H 0B0@P 0V0R00S0 ^ PUPPU R 0, 0 0cp @_0 P P   fp XP@ĐKT8 D0 KP00 1@ TZ0(Q00S  0S0(\00S0 7 0@000̠ ,00 @0K40 b 000P0@ `K 0 0 0S  P@P1sS@ TZD0X aDK P@ P00 0R0 P 0P  0S U 0SAʠ000 0R0  D00 Œ4 @0gP 8 P(ʟp h0R  c- ^ =$8@ ;D0#202^)@101P` 0' 0SVV8  V ɟh0p R000 000;$ 2A020@ 0Hc000C0 0O'P  $^ 000C000@ 202#2"0A 2"`M8 o T R`  0` 004 ``@T" \7 L01001VTǟ0 10140  00S    R04 D0 Œ0@P 2 C028 lp h0Rtg2Q X#2 C028@ OD0K2" 2  00!6H 0```&P " g#2H02,22020 V'0 Q' 2202"8 ğ000P` @| 0@@J& Q00V@@T' p 2" 2028 V 3Cp h0R 000iß 000p 10 1 x101"022@ 02"0@ 0 cH02 L410418uŸ00 00 ,0 0K P0@0@0l4 p000P0 0 0K P@ P 0"7800 0:840 S000  , 0^0P00 @%ST~22  <0000 $r" 202l0@ 0HcP T@8 T0 R !0 00040 D04 0Q 00!202555u4u4(u4$`4u4@u4Lu4Xu4p`napa@0  00ĐK p 0DK P@e0S 1S0T01 aP 00S2! D0!000D0 00RD4 \ 00@Ta 2^00S[2SW}.!S@` p+d8 [ 1D@KPU @ L0R:P0R:PUU  P Q-Lp@`: 0PPJT: T    -pL@P`   h -LM` KP@ P2 T *$pK PJT: $0T: $0T*D0S `$0#&R :0R*0a!(0 P ~ g-sadu4 -LM0 P 0 XU @p`6  P 0$  cR 540 X(@ 0  @  00U X 0    ` 0 X wP000 `]  eꘄ3" -L0P>@0T~n@@ p`M0 @ BL 0T0Q00S ,0V 08W@355@_<]- ^  0>0>0 S   -L MR,0 `LQp   *0@T h a, 0o0 0r,5u4 p-LM@ LQ,00`0,0**+0L1p50 00@- @58 0  0 @2(  0P 6Ona p-LM@ ',0$ ph , L0*0HPU 10`S ,0P04,0$ 000pT,5nau4 0-LM@P Q 10S Q\ 0Slm( 0P P;,0 0 1C0SLF`na2u4u4p'` -0P@LT`p , 00S @TV 0 R@W m!@U1S10S SL0 Q* Qp `0SPLF`"na5 0-@L {,0P  10S,  00lD 000L,0* 00h 0hYna5 -|0LM\ d 9\0+ KK>9$4S!G @+na4pasau4 -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ 5 P<   X00 P00S 0 X3ZP<@e, T @!8 J< P d0p` @000 `- 0  4P0000,h 00K L00  0P<\ B 53" -1LM ,0 0`Vp,@p娐PLA P 0_,p^,K 0  n TP@ 0F P00(h*papa4pao^p^\0ǠȠŇ@`P'0 ` p P`P000U 0 0 00 0FP($* PP @v4xv4v4 -0ap #6RL`QP: P@ 2% " ZU:s "@T  P PU@  0S:P 0S*2 "!6L! -0a #6RLP Q@: dPJ! T: R p$`QV  @P 0S:Q 0S*! -LM.0 L (0K^ #̌P@# 0p` @@TPD ,1, UL0`pc!  0 ; @T  ~0 04 ʼjzZEUd,4?H0 h p0S %,0 0E5v4ana 0.  07 -LM0@`p P000 `j 0 qP0000 . . (0KPP ` 0  (P~ Pꘄ3" -L$M>L0℡~(K0p!p@0 `P `@@PJ<1, WL04 c P` e0P@  4 ` We00S,,4P `0 @@@j@Th40 44 4 zG%{(4pa'5v4v4v4 p-LM΁TL0K! 0@`P `@2Pp4pa' -LMPNPA@Tp`Lp,K, X0    \$ 0, L4pa'w40 -L`@PT@@0p*v@ p-LM@P`*ph -`L0S 0 !,B$ R; 00S000@T \p\P 0@0 T0,  S(<@0hpa]5papa+0 u+$w4 -LMp@T 0R 0 @ TP`P @TPPU  0P000S  papa5pa0w4 -LMPrx`xp@0Th `U @ aD 0S 0 0C 0papa4pa -LM@G  0@00h<papa -LM@p@.X`P0S@ 00   08@LA` p-`@LM,P00LP (@DH@@P@T 0@8 @@@p( 00S0` ph8w4pa -L M@`p0 P000 `1 0t 8P000 ,0K 0  ,PMꘄ3"000 - 0 BRL` LP 0 @P@dDFA 02b SpD 0 S0``00`ht-`-`?` -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php p-LM00PU* j`Ph@T T10T1h\0T0pP  X0,P0 0tt? @ P `$X0 P L@TP80@$:#H]4pana_5@w45parapw4 -LM@T0<<h((h  T1h@0CT1h rapa4pana -<  @(0 Sb$@ ,0 @P0L0S!000 p `0`40  (0S 0S(ixHH -L R0ԑ00đ\0 0R010201<0 0R*000000LF`na5NN -L$M0 0 4 S@P` 0QT, KgP`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,Z ``0K |0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0@ PD  H D H0 KP 0D0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K jVp:00L00 S  0<S: H4@ }DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )KjpV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,  0 @`` 0K P000 P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0᎘PH  10S     0@ |0 +P80 J,0( 0C,0 : O,j VʦU^  R  1 0R-*  (  -LM`P@1/ 0S, *"*@S>0NPb@` *T p  004  , KP,0$ @D P Z  -L Mp0*"*0>0>0SpbFZ@ W>: W< @0` P000 `0 P0000 0P ,0KE0  ,P0  ꘄ3" -LM ! ^>0.@  aR0@  P@ P @@ -LM*"*>0b^@0  LP@ P@ -L0 *"*0>0>0S b^ Hy+Hy+Hy+hy+py+y+y+ 0   0P  0 -LM*"*>0b * 0H ,6S# `p0d$#&@PQ : 0`\:P  na -LM!>0 a 0* P   -0LS   0 ` P P # -L  -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < P@<X0Q9 `p0 @000x"`S0d ZP000@- 42 H)&R R 46S  @ ,  04,0 0P@, \ 0 80S 0 @ T 0 < <\ Tlj 80S   |0@ 0 P 4 00 T|0 0 , :#:S 0p$3"naLJ -p| '6JX0@@P`LA;@HVT 0 S @T. 0S0S4pa2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0naDpaLpaTpa2-0C22HSD000   202  B Dpana -LM2@ P0 00  202  B 2 0h0h0   @@2402   >" @002naDpaLpaTpa2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0LpanaDpaTpa202/202p840 #Q:0 Q: 10b1sa -LM , 0 "X00 ZY"0@0ŸT0T0\ XPx ^ `Y0  a0<"6AB4  8 0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@004PXL@L  00 0 c8 4y 4paDpa5_{4saB}_na_tpa5|44|4 -PL R: 00B 0 0 P S naD|4 -LM,a> 0R^PA0 pW 0gS*: @`0S:>0 N@ T *$PK0S J $T:٤|gPh5*DD@T0>0>0 05__t|4paa|4|4 -LM␢0^@xRxŸ00ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UT  0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0U54pasa|4 }4 -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0X TQ  0@P<0I 4mF ( naD}4l}45sasa}4}4~44~4P~4 -2L M0Z ! 0CZ pWpWa1T1>0> 00 PPP00 T Z !0Z00G Z, PPX0Tp3qPU,  Q 0 0 00   #&X:P !0 0X P01 P#&:XP P!UDF Z,l<0X ,00 o>o 5sa4pa5_t~4 - LM 0\ , 0` @,pP 000 p 8 00\,~ (| $0$Tow 5~4sa~4 444pa 4 -L Mp,0 `@S0  <0R4 @0R D0RyZ 00S, 0 Q00S(0QP 2|2< Q p2 Q 0 T~ T( 0!` Vi Q00000  B 2 $00C$0Y 2 00 004 04 00Z,0"S 0",I` Y 240P2pZ% '&:X PP00P%~,HF  0`s,0 0 0` " "000,1` VTu41`V a Vinalpa$`4pat`84 -LMp\`P-X* " 0`P "%&:X PP00P%FF`'`  0p ` 0p " "000 #&:X P00$ R 0 0 00 0   R 000 0 0 " "00C0"0 0"4pa -2L P0` V0 2Dr# :X P $ R 0 0 00 0   R 000 0 0V " "00C0"0 0" 2a |aR 0p10  0 " "00C02 0: R $12 000 202  B 2S02 00C 02<2!0@0$000P0P20$ 0R0l0 4 h R @0V p 2p 0 24panaDpaLpa5Tpa -`LMVp At00TPPU `V2  "  0S 0$"2 - U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA P V ? 0!6 P0 U00R0S  0 0G  0 0 -`0@LTpPP P W* 2$"  2 02Ŝ10@T0 $C02 ӜÜ!2022  0 p   0!6 X000 X0 0,A0 0 0|ꨤ+pa -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TX 00 \P Р^r2@ Z00S ^N!2022@02H@T}`$P,긦+ئ+ئ+ئ+ئ++ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+Ȧ+ئ+ئ+ئ+ئ+ئ+Ц+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+ئ+++ -LM`k`@`0< pQPP 8@ 00hU0 Q4pa$`p4na5pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0naVUUU -0LM @`P<  `@p@ 0Gpz1 0V1`0 p @ ?CSD00D SD0\ ,0,R0Sh$`4pana4VUUUna -䐟LMp 0`S' PS00U 008 0B6C0@`XTP,0XH4m`8/j(,J 0pananalpapa 4 -LM pW     ? W̠ b E@E0@0S0  S  R P U ' pWK 10 1 @0="0Q/S 00 0C002"$10$1 01001 @pTR 20p00p0Κk1 0R1000@ 0S04ʾ0  h p0S 0 l h0R 0020X00 \ P0S P0KU q 0 0 PPP Xd| Wx \0KQ0  @h(41X0P41 0P@ ` K0K0PXPP@P > Wp  402"  Q  FO  Rg 2d0 `0K$ T  T"SP@20208! W8!  2  0aD h0K @0 0@0!6 k K P 202 @@ T  K 0 !6D 0 P  ' 0!60P P@ @@ 2(10(1,10,1#na -8RL101@@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  WW<1pG0<1 0!6 P x2J02q J `2"02p T00R00 S n8,P101znaTpaDpaLpa -`LM Vj3PP >0@^PQQ:2h(0  0aS 0 8 4 y \v,$&R:0Ra0, 53:q 0,&R:0R03:0S @,10a%v1P12" Q4 0*R0# Q 8 P, P\ , 1`ABP2#40 Q0!0000 00C0" $00C$0"0 2b```"00 PP,00S ,0 4 0 < R@0RD 0S$a04nasa4palpa -LMp@T' P`Q0000 000200z0@u0$ 0R@0$0 4 @Ti_4pana5 -@0LM@T 0( T  @(54 p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`pna44404l44Ԁ44D4X44́44H4d44Ԃ4444l44pa4 0-L@M 0@d@@ P0 S@0fP!\0PPP@Tx 0@ d PnX Tx0 Pf0h?8na _4ta&`pa]4ԃ4_sa܃44ta4 -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @PR@dDFA 02 ST1b1 R000 :\ _na-`-`?`@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0 _na -X0LM\  0R \ @ TT000@ _ p-d0ML` @P0 K@ @P0,d(4p_4-X0^ P ($\,40\DP ^ _ -EMLPM0|$ ,0  p0S S bP@,P `V FK@0D @P4 L$ p t H `P@dd00C@S񟗖@++$+$++$++80S|0# @f ۼ3 ,0S |,p(PP@ @ \@p P\k#300@d80S|00 0080S+  x\ QBK@$@0PP@ 80S \\㾿<0PP@ 0 K@\ pPP@  OTx @tB~KpGpGG>K0C+P@D hT1` eP@_0SGBKAG>KA0C+P; 1` Y( PU! WpG 4 O#J6; 0LP@An2$DP`@*DTU WpG Y|@<0@d |4 $`ta[^ 4,4%`4@4 _na -L|Mܒ@0XpP 0 0ᣄP@80S S @0X 0 0ᢄ%$ P2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !0P C@\0PP@ 0R50X @00@0 0D!000dh00h0 !T0,0 $4>0CFT0 0P`d630 pP 0K 0BP@qp KT$;, PP@cT0 4P$Lv%`],5`4na`l444̄44 p-LM0@( +($00P2P(0; (aP` 0 00p@80S$ d0@ P0  σt$h00bh0@EP kL0(,$0R0\pN@ l%`na_4 -L M @ 6@׿"+ -L M@ 0@ǿ"+ -LMT0O$K4#&:P_Pp ($@ĐPb0O&#J86$[\d \@@jTPiT0 0+400 @Ri (4 -L$M8 @< `8@ @ 00  <_8 億 <0$SH H@0夛D 8L$@D? 4 c4K 00K, K帄P00s 8LD  ?40`PD"pe@8U`< H00 W p@0000^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8  e$0 0e#&B4A- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -L0HK 0 z0P@/ U8 W00W00SbP R00Q0#02SXT-0 0C0 S UX0 a {0HK 0 z <wPP TX 鸇4$` p-LM0 PU@ p0 S@`@0P0@0 {  w $` -L M0 p` 0S 0S0000P 0-LMP夵1@0T0 U( T0S% (@T@T 01 P0S @0@T0h飵0  (Q,0,0, 0<0000S @0 0@0000S0@lua__0S@-+@,  0 000@ć4\5X5 RQ-L 0P0000 P 00S000E܇4 RQ-L P P 00S00000S&4 -L@M\TK K < 4 <#:0K [0*":("000,4 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000T4 -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0GP\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: +P, 00w P @0  0,\,, P , # 010く/\a$`tua -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#h\ ,,00@ P cW 1Is`PX UPE000P:Pp 48<#h\ d,,00@ P sxP p 鰼5555tua -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K !Pk H0, ,pLK2P L0S10L0 (0 S h(H0S<0H0 H,0sS$[ 00S40S80S0 0@@S P0,0S 00S 40S80SQ  l0` x0cl R +<4< 4l :0 l 31$`|4,] -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,v R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  %P@0S X 3S@0S<0S80S40S ,@K PZ 3 SP0\ 0RP0 L,@K PT P(HKs$`43 (]3 p-LM`P@ P00P3,@0 p p-LM`P@ P00P3@0 p -LPM✡0``PKpDKA(0 d` a^4K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P YP 0S \00\0ZK KYPpQ|L5T <5T5` (K`` P K0[ pS (K@K K 1 0 1\KXPp 0P WY Y\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#000|3T 3TU @/1.jUy @#1 q8#0000q#0000L|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S & 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0[n 1T3Ye tEaWu 0Q0 T 0Q0Q*00Q 0$`liHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i 44Ri Ii Qi Si Ti )`i Gi Mi >i04Ni0WiHPi Oi Ji(Ki -l9LAMpWP0, ` 1  5 -0S S/cH0SV< Q5 HP`PP,蜠K E 0[S  -0S h@ 0 SRx8 RV5 H0S |0SH|0[S` q (0000q'00 00 0@P  Ad00d 7@ 0 0Y0  ǟ,0 S x,iP0005S Y ^P d0 >PK5$#Ġ0Č6K7K4xKl p0 lK0P .KKPKt0 P 0S0 0F0$ dKt\K0HKc0KdPKkPƟ@K.DDHK CKHPKGKP@  eP 80S0C80ŵ@T 80S0C80Ŕ0 .K00 VPA 00S 00$x5 H0Kp P] 5| PşHK P@7  +P 80S0C80A@T( 80S0C80 .K P 0S0 00$10Nx4 R*4 i(0  hGOK@HK dK  ,ğ(P0Q Q P   .KP 0S0 00$103 R /  (0g@K@Xß HK( dK0 mP  R F2 R (0 Y hK P 000 ` JP0 82 R 0L 9Pl 1 R0 1 0 & NVO  P`7| 800( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`N U 0 R 0 R 0[S0[0S[Q5#$0$)K%"48<#Q ,PS$`])`l4x3H3dK`,K`83|444X4\a4Ȋ4 p-LM@ PN0 `0S R Q0000S ph P0`00 0(0 `n4 p-LM@P R0000 0P @`U00 0S S @0S SS00>0S0@ R \00C\0 0@ 0 GV 0S0C 0 phӲᄿ !\al44 0- LQP 0 @R T0h? c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,/0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx  P KLU00  3  R0TK\0K"hP 0@ XC !xK .U0h0  d  P` 0@QP@0pS0S 12XKOK0)v2Xq  SK 0T1 `V OK0 S `VT\ ( (5 ` `F{00F'T!  pSoKo LQ,1HAP(1D@$1@ 1  LQ HA D @ @P  Y40Q0  $`ii4ixii Ћ4 -LM@pPl R` 0SB R(V)X0S& R`0$0P Y5S00a0S P0000S 8 P 0S`4- i - L @T 0S*@T(1@TE 0S @T>T< PU p ` 0S0C 0 00 R 0PV PpP阽0ST PU p ` 0S0C 0 00 0@0S00PVPpPv_4@-|0\ 0S \ Q @ 0 0R 0 0^@0 0_ p-LMp`@PT 0S @T 6㩧@0 0P0 S00@@ p_ -p0LM@T 0S @T P P R0600 h_ -LIMp`0,0 L00 P 0SvP,6 \P`g 0 0 PU 0SPU6ѧ $100,0 S ,0SU P 0 0 0R 0OK`0`0MK@0K<0A1T (K 000Sg7  R0600 厧 0S0C 0 ܯዼS/K ί700SP` V tP 00 0 `$`41i -LJMp0P 0 嫯 0`0CS 0 ᡯ 0S 9C7 R000  R 0CS  NKJK00<0 K 0-K 6#$`,42i -pL@P 6 ウ`V70 0 @T6@  -LM@P6 P RP0S0S 00S0 0- @LTP 0S@T00S P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\p] _\] -LM0@S S  mPP P 0P P P0P P(3 -LM@P P P 0-P0L@T P0 ,P0@T00\a-P* 003P: 00 ? >-RALQBp`L PUe 0 S\D@ @\P0 S $`ԅ3p44 -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ0`aa0]4 -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp00] -LM@ @0T0  0 R @T0K G%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* P`t] 0- LP  㡣 @ 㚣 㓣60 -LM@6    h -LpMpxPK0@X 0 ZEx0 p`KfEE &0 00   00#0 Q  $`,K`dK`4 p-LM P\ 0S \pQ  R X00G\`@` \^ %P QP ;PTTP P < P T# T 00#0  p  P00 0  00  0 00   #PT0S 7000   P GPP PT@#|]] -LM@pPrPT T kPD P1@T T `P, @T'Pa0S( 0S 0 @ `( PpP@ P`p(0 h`0S h(0( @`0S(0( < `0S(   `]444h4444 -LMtP0夀K@(x,0   :5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  ;PI@%P 5X0S0 000AK`_Q @K@KKKK 1 !0 1\ڸ0[00K [ K  yLP ,0 S ,U LP/P t0 R0 T KP ,0 R $`34](4|4 -L|MPK0`x@(p$0  LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$80 0\0$`3(34]4 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ ' [000[S  A0BS 000S |@KXwCK C [PKCFCf00l0 0 %"4 4  0 $0 S $pl$`4 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S GpX0S 58J0 R (  x0 R PPSH,K[PP$`] 4D4T4x](3 -L0MԢ0p(0 5 PU 0` RP U PU `0S6 VPDPKXB5HDH|0 @奶jW$`H34\a]4 -LMP\@`pi:,K<4(<"4&<,0 %pK RS RL 00 0 p1W4 W- 11!1!2["[[2[UT 0S @TP00U00S 0d^!0 ^00S`n (8#P @ @0N ^"J0 0 0 1!1!1 ^ Z J0 0^Z0 (8#P @@^J0^ZX (8#P @@~0,$!PUV r @TPUVV~<8# (8#P @@ ~0,$`FD!0 ^!^00S`n (8#P @ @0N ^"J0 0 0 1!1!1 ^ Z J0 0^Z0 (8#P @@^J0^ZX (8#P @@~0,$!v~ 0q~ 0d00S00S 00S 00S  B@̏44 -L@`@QpP P 0S}0Sz0Sw 0St\ 0S0S0S 0S P P2 u P P \g Q POWI R  P  80S0C8070 0R <0SM0 0  00 R  J RA00@0 P@ 00@@T ᬲ 100 ;3P` <P@@@T10RP P@\ P00Sh000S{Px D0 R,0 P000Sf(5$` 5P 0SQ1 0  ]p@-@P`U RB R p00SV 0S 0S ^ 0!$$ UV Q P 0 Rx0 Qp8#8#$0$  R R 5#$0$00S(5 50@-@P00 R! R 000S "48<# \0 R P0 Q U 5S00000S 5(5 R R00S0000S -LMp@ 0R0%` J:V* 0 0QR0%` .:V PEU@ R U00SR   byp P`U@@0  ,0K Pp` , 0R0%` *(0K Pp` ( 0R0%` *Ṗalb4080<0ua -L$M4 0 8 ` 0L < S o:X YH Pe 40[80S0C80T)000ISA P 㗭P @P H  0$( 0 "48<#8f L)H0@\ 1 x 0@0S(008Q8 R*H8pW  048< S  8pW0<0 8 Rt0Sf*0H00 ԛPp\ H*(T pp 048<@x 0  @( 0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 |@ D0 0Sp@ R@T 0 00SKZ @@$ ホPP  $ٿ 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cP000D ` VD @ 0S0@T 0"R@080 T8P 0S P0Se ㈛Z @0`C‛0(0C8#88#$(," @"(  ( 8 0VJ* 80 0 B0 8&YD 00b$0K00C080! S P 0P U8 #H0@\ 1 0@804 `v<ß00q8  PP  8 "Ÿ0D 0b0"00C0H R 1 0@Ÿ@08 s=XŸ008h58"000H-00КR R:0`PÚ@ @PE( 0 0@8 @ D 0SLh>ꭾ0S( *P'WZ'08 HQ 1 0@80zHP1J0  0= tP E,0K8 P<080  , 0R0% ~*0__ԇa_]uaua]ua$a܇alb4 -PLUp `2X !@@q( m0 $Z P$4D 00b0 00C0uaua0 0   00 80<808 8<<80808 < -LMD@0aS0098PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S 00 o 0@<b_uaaua]a -造L0S `P0080S Hp`80@@80Sס00mҡ_ua܇a -L$)(0۲ 0 ղ0D]T]x]]Q0-4 $Q Q(0 `0P@ 0R0Z,LZ,TZ,\Z,dZ, 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  ㌘P @0 S00 0it]4 -$L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) (P,0:S @0 40 P0MS1z  80S $00cj 0 XT 10000 00SV:XJ p4   R9 R/  R' R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S00000S 00S0 0 0 00S1 Rt]/0t0S: 00 B00 0  0h0h$0C0CMcu1P@  0R0% :P 0 SR0Q0P@ 00K P 0 0R0% * V UV ($P Zua]<4uaua}alb4 -L$M4 0 4 p0Qg ! 0@00X80 $ 0 S8%@ ` :V :0 0< jPP0X,!!- 0 @0S }ʀS S eS) < R0<  <0P40K 8 80@00 0S0/0P 1   0 @<0Sa,a,b, b,0b,0 ;P@ 00S 1 0@0 < 000<0 0 S S0P 1 (  0 @<\ \00<P0P 1  0 @<\ \000 00S 1 0  0 @00S=ʂS000S 1 @0@<PW X&S 00S 1 x  0 @0(0P '<0& 0 _900S1 p 8^000S 1  0 @X000S 1 8  0 @<\A(0 0P@<00 f 1 0@ S_*<PP 1'1$ 101< ԞZ< 1:)011<01$ 8L ( 㦾 㢾00 0g(0 0@6(@0~ Z0  ƟA.L` BP`0@ `0Pi0< 0 S! ʇSf DS! S000S 1 h  0 @<0S'XP%00.P  s0 <5000S 1 `  0 @< RX0T%0<0P  5R0 5000S 1 P  0 @<\qX$0 0P  ;10 ;000S 1 X  0 @<PPXL$0<0P  20 2S 0CS40S X X#00P Z ß `LP`0@ (` < R ͝<@<rP 00(#1100$ 101<0000 0ᰝZ 1<p 0g̐  80 S- p32( 8 Y } y0 4\ r0 @1P:)010P 0 $004 s0 (0P$00 p00g4C< R<\XO000S 1 H  0 @<0SX1T!00P  N:S0 I:1 R$!0`P0@0S 1  0@08  0u0P@ ',0K cP`0  , 0R0%` *P `P@ ua]X4}aʚ;~az`x` ~ad],K`dK`}a4}alb4 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,J 0KPp  0R0% * 0 S0% :X dK 0\ d0Kc K\@Kl  dK0L +PS@@KHK0 H0KGKW HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 RRfm\@K   0K0 \Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0K7Pp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ $`}a4a]]Đ4lb4 -L M@0(  $( ,<4<,4"|P@ӬU110SPHDPKŶ0 C0KD K<`K0SG C P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(圹t\0W00S0%" K$`x]|]]at]4 -&LDM0PTP ,0 0S80\0 `P dP @p` :Y  HK@h@ D0@K hG0KHK娺HKIP@0[S U5 ,0S ,J?0[0S 00f@CZ #Pv,Pv,x{,x{,0ST 0S  SZ T @0KC@ [R R h@K 2H0KPd0 Z Z Z 񟗳w,v,y,y,<0\0 k@PP !!$ 1$010 1PUF 1:)01``\ $0R0 R9@$1$ R 1 0+10 ,`(`SKA @a0@RSD0SA La0LRS00L S:XA @a0@RS `A@0@ \-P+^H`PP@X Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0W 0 0 `  Rqh@\ $`$ R 1 0 +10 ,(z`x`{` -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S ᬳP0pi0\0jS\ 0jSg ᎳP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P ;P040 ` -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 zPK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 `)` -|#L4M0Pp,0 Pp 0R0% :Z- HKN0 H0KG K0c HKT0 @T: h0 A@TW2 h 20S'9@HKLP0 RPPP |2 ,0S t,=@LZ@0S  PK 0 2P@ r0:S,0S00S40S80S , !P0S 0S$0S(0S T PQ 0"0 # W (!0PX  h 00S!X@P0LHKX P XgPP0P0 pi_@L@0S  PK X0L L0K cPP7 L 0R0% 0*$`a? 4 aʚ;lb4 -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 ĵ KMP` K`KPK嵵 K 0K@Kp8K`KPK   0 _6@T 0  [P0 @T0[Sp RE  倵` 0: 0000@S1\6   0:( @@ 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗꜍,0,H,`,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,؍,x,,,,؎,,, ,8,P,0S 1 0@\ 3 ,0S ,N0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K ʯKK0  tP 80S0C80 R01 Rj|K&0 ꤠ0[0S1@  TȠ }0P+^TPK(@L0(  00@S*PL ( @0 R 4@40(0@G$`\a ](4]84x44 -LM@P`p @0 e_ȑ4 -&LAM0p,0 `@0PK 㦳Z - L6 R @6 R 0R0%P s:Ui  K⏳K ㋳0[SU 0[SI 0[S 5 Rş@0 5 ,0S , Kr| 0[0S0S @5 R K`0 0H@Kޮ0@K KG0KHKB ZP` 0P 0S 4 R80S0C80űởK KKU @K P80S0C80ž0[`S 0[@S KK ծP00  3 R K KK)NK(H( vPz!R0 ! 僑Q Y0 00 S T3 R` KK@ KKY0PI 0P8O !@! 0K@# !R3삟! O20SPAdPK@KB`K>;0KxK c0KdK0K0KKK囲\KK 㗲KK 㓲FK !0@hP@KKK0 0KK}R 61 R K KK 0[0S@@RT1 R K KKd= 1 R XK@ KKw 0 0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K P p P  0R0%P {*L/$`]P]]a4484x4̒44]],`44ԓ44}alb4 -&L4M0 P`,0 E6 R VU 40 <0SL0  H@Ki0 @KG0KHKѱ LHL000 Pj 0Sg  Pp`Б@uP 5"$ " pp!p pḑXE 㵑@hZ$᭑$Q 1+ 010 (p,p<81 p0p0c,  80S00 0 b L R,#Y0T 0000R:DP  0 0R 40 0 SP  P p`0@0: 00 @ @@K  G(v0(0@@@@@40 PQ 0P 5@ 1P L P(` L gY0 0@T0 R4 30 S T  Q@a@ 0DS:?>0R@㛬!0 0 g 000 TPUC0Sn 0Sd 0SZ 0SP !@( B("("48<##80@@ 0:4( : 40 0@@Y P L0S 1 0@LQ 1`P 0@L  0@1P@ p1 ,0S |,P00S000 00S0 0 000S000 00S0 0 0a kbAg00SR\P 0SM 1 0( LY *^`g?XU 0  P MP00S0P0 $`a]z`x`{`4za\4 -LM`@PT :Rp/U U S*` T l \(`P Q` `S*`0S`  @`0T0U00S - 0L P`]p]_ 0-LM PP@ 40P00 KPP͝0SL LP@808 zP0D0A0x], - LMR 40 S L00P00 0 嗝t4 - LMR 40 S 0 0 ~렔4 p-L MQPPP 0@S0 `ph"P 0<P3p*p 0 ph3p]ua -LM@00K p" 0@ 00 "@0P ,` U0@K!!  0K  ?@0@K  p0 -LM`Gd4G0@!0c48G0!0c4<G0 0c4 DyG0 0c4 D@!390Q 00R D `G4pZP, @0*PP A0 R ~p0H, 00 S0 L 0C # 0 0 R Yp@ꫪ)` -LM, 0PR* L0QڂG, 0S*@Dp`@40x @T4<@0 ,0H 4 800 _,)`] -L4] -LM P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  4h\ dB!2b2c621b1c1\ 0H]a]]DaД4 -4@LM㪩 q0hqꌔa-5 p-X`LMP@T 0 S00 00C0 T pDa - LM(080 0 4 !  0 Sᨋ'='=P@ 0S ! 0@4`P0@ 'R`00`S +0@0S1  0@4 ! 0@@T  R0S 0S$0S d*0@0S 1 Q 0S0s R0S 0s Q 0S0S0S2 R0S 0S$0S' 0%  R R  R R R R R R 5 \ \^ y0S 40HP 8P@ 80S0C80600㮨0 0 㯕Q 400S h8 R  04,0 PU 4, (0AS{:(Q 0So a(40Sb Y\ `0S 0S0sN 0S0S 0sE ǟ0@Z 1 @ 0@`7@U TwTgHL0 S4K8K @T480\ ǟ011 6PP0@0S1 0 @04 l& Y ,04 (00P&0@,K0K4 K80KP4` 04%,0S"%0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps6 5 R1 5P@ <0K( P4  < 0R0% *!$40@0S1 8 Z<0X R@04 1910 P4 RM @ 0(VBx  㮧P3P@ 0S 1 0@40 P 0S#Pß0@ R p L0@0S 1 80@00S0SP@ T  `P@4T00SNxP04 > 40w00S8 !48<#,#80 4-00S' 00S !48<#,#8 0 4 00S00S 04 d1P@ 00S 00S 04 00S 51(pP4 c !0@Wp 1  0@070Sl> @ 0T  # 0@)05S1#=#=\뼇aTadada4ahapa] a$]]aaćaDaa]ܔ4,alȧa$`lb4 -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *婿ćalb4 -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K A00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K"[P"48<4 #8V0Pˆʎ̇aDa -0L0@Sp S +S S 0@ 0S 1  0 { @0`P``0Da -L$M4h, H @| 0 R[ 6 0(@3T QT +T,  PP> p3T0000aa 0V13T T +Th0@)0 H0PH ,0 S ,<Th0  )0H P1P@ <T (^P@  00Q  )0bH0SH sh DK)0D QH PhhH t@PK @ [R R Y 0S )00 3HPhhH T?0[0S03K?0[0S )0H PhhH :$` 4ća -LM$0K@ p3T#0[#0[00aa@X刷PP H011 01!  ͈UV#U !0 00l<  80S $00 00lV* 0 h `㥈@hJ$ᝈ$ R 1 0 +10 ,( 80S0C80600Q % 000   ㊤0SS Q> X0<0 X0 400  1Q<1 1 P0@UF 0S=  R: 565S3 +0@\ 1 X 0@A  L0KR LK\ ,0 S ,LP 80S0C80ʸLPU 0s00tK^\0K x@K@pP t \ ̠t 500   R R  R R  R Rv Rn Rd l RHx0S tt Q5 \,: 04(^ 1 h0@Q<t4(<"4\  0b0C0t S 0 d0S   h0S 00  l0S,0 0  ,00 ^㧃@LPp 7 !"$ "0000 0ᎃW 1:)01|7p (@PP f @ 0Ko P   0n8#8#00!$ S  n  04<#$ 0 @ 0D8#8#$(,""(  0Pe 0 S  0S00000 ,,<,0 00 0 @\ 1 p  0 @ ^ b0S 1 `0@p00/W \0  pXQ5P@ 700 @0 4P@ 7 0(S ` 1  0 V1@01|0K K! P࠳ C1 @01 00S00000S 00S0 0 0 00Sz00Sp`#0410 Qhe00S_ 00SV# 0410  00SG ފQA00 @0 1<Q<12   000S0 U 0S Q42  0S U 0s00Q\   R 1 P0@0S 1 0@5ST!0@\ 1 X 0@3 P 0S P0S 50SP@ T P@ R 0S  O Q X0<0 X0 ḍ0PA ]$`aLa4z`x`{`4a,aa(5]$`da̕400Sn0S 5 <000 dH `P0@3  X 0@  )P 0L KLK  --0\K   F0S @ < " B2 B@D\lwhuds`q8#8#$(,""(  P ppp `K ! P  dK !P  hK !P  lK ! P p - RLM`p@@囯PP 011 01!  U' V W `  ὠPр@hv$ɀ$ R 1 0 +10 ,(c*a0  [ʚ;܅3 -L`P@\ )R1S*P 0\0T00S _T T PP0p 0 :RpW 0 :Rpp 0 0pT \ 3 -@0`TLpP) P$`U` 0S{tUX }P P`@{t @{%t@$` -L4MT0pP,0 D5\P W`@8 0FSA,,`,,,T R 0\0 0S$0S \,0 S ,o0S@T5qt@PK⩜PP` d4 R X4 P 5`S10`0-0T RTK∜T 0 Sr3T0[ 0 T RXKuX0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 0 H0KG K@KLKNL0S <`шV 5S0S$ @T 0\  @T\ KP@[ 0S0 000@0QPT00J00S5#$0$ 00S1`1 Rj1 Pe `|P 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' ㉗PT  R000 |00S1#$0$ |P  5rPp7 $0P 0 0P$`$`]4 5(5$` p-LMP`@ U  U U -p0 0V0 0pL0 0 0V00V 0 Q50] -PLM@  R5h sQ000 0S  -L$ML0QPp,0  @㼖00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,帙00CSY,,,4,h,, RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPKb@0 H0KG K@KgpP Q 0%R 00S  100S1#$0$ *R  㙚00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0S$`4 5(5 0-0LP@ *P4 1 0'S(.P)  P P P P  00hz00S00000S 00S0 0 0 00S0ʚ; -LMP 0(SpP!z@ƨ`V $ 012020  1 zV (@ 1:)01000 (0( B0 P @ PЙ7z`x`P0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K P@` , 0R0%@ *#0S00q 0j0 @P0 0(0K P@` ( 0R0%@ * ićaDalb4 -LMᤢ 0\(0 ` 6 0p00 S0l B 0@S 0S0S0S 0S 0S  R0s RS 0S S 1P@ I(0 S (嫗0S  R0S 0S$0S R R  0s RS$0S S8PKp Ϙ0S  Ș0S 00S !48<#,#8 000S00\0a0 @P0 0Y(0a0 @P0 $`Da4 p-\0\@LMK` `00P`x 00@p___ p-LMPx @5`#Ġ0Č *P 00S q0D #211@,0($phZx$(P]Q_ 0-0|%L"4 40`P%@"4 40$0S 0P 00S 0h7P]`] -LM 0R @`P :U  0S O 00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V P`$(5#$(,""( 50S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\5#$0$ `V pp LP`V 00S0S 0S0S0S  2PX (0S S/᱕0 (  n0$0(5#$(,""( 0Sd0P@ $0K P@P$ $ 0R0%P *JQP]_}alb4 -pL0P@S.w0 @TP  0`@VPTV ( R  BR(  U` PV m wT 0`@VT$_\a -LM`8 P 0v@勥PP 012 02$0  1 vU v@oPp 011 01!  vW @@0( 0 p@ Z  0: `000  ざXh  {0 0@80`0``````` i0SI ( :04K 40 804!p`! 0@Y0K4  1 0@80S ʂS Z00 Y1   0@80SY 1 B/Y1 , 00S ` ` z`x`3ua_ -LMP 0 0 0 RT@00 DDF<00aahC hH]$_aa0(-5 4 0- LP|8m8@]00T0@  0C.0?040: "# ? 0 00uMb|om! -LMX0@S #S\ t0 \00h0QQT0 Qh( 00R 0\ 0@t]L4v p-LM`@(P0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(ېc댖44 p-PLM@PdW 0SS 0SLapP: 0BS( - - - - - 1S 0S0P U 0S p@0 \ ig0S |  1S$0SL `@0P`(`sp Ж4]4]a444al4 p-LM@Pt0U`$L07@ $0 00 pht 00E5)` -LM@t 0 S  itPUq <`Vm H1Q p QgWh 1SP-- -8--1 Q Q 0 0<   -0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q000H (E B됗4|]5Mb]x]444 p-LM(tP `HiD1D!00 g01@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| `0H  a R@Tphs@@-ap]5a)`\a] p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R\` 0S 0S~ꄔa]a]]] -L0M졟0D`KPp(0 ͎0@15SQ CSd0PUhm@0  _&00 ?0#3 00(-a5`]Mb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0❾ 0 @@pY 5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@00@!@10 r!01 !1 0 g! P@ H0pkPApPp\0S @40by@0 ,y\@PZ $y P@` 80< 0CR80Eꘙ45Mbt]]X0GS S S#S 5SS ʇSS S p-LM@!`\ XP P p3000  00  00p#P00pQ 0 0S XpPUⲽ( (  ᛌpԙ44 -SLMpP@` R00Q00S3R`U-  cP$ W W *`X 1d c0X0P00S` U `   -L Mp, ]l0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 45l0鮇0 0D D 2001100 %!ꄔa -LM, 4 0 l, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <k8<O @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  08#Xx ՠ],4 -LM\0@,0 `p XKY hKU 0R60帐 0 弐 Đ 0% P@ i:T_ `xK @0S@ u0S.0Sş@0 v,0 S |,؉XK*h ㇠0S hK!H ~(50S xK$ tP  @(0fX0ST0SP0SL0S&[4R t0S Nd0S`0S\0[Sx0[S S pG@K QP R010 0S  0S 0S 0Y0R00Sh0[ xKSppP`z K0P@BY Y0 00 S 8s0S[ xK⛻ Y0@4PXK OPL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXK= 㚟H@K㼅xK@K0 H0KGK8vP@ 40  00 R TvVe P` 0  p0S 0 R ^w0[0S5#$0$'Kp0S0P@ 0K <PĀ@  0R0%@ *H$`]]aP4`4x44444H3P4x444}alb4 -L|MPK 0 , :0S Y0 00@`i@l[Pp \ !1 01$0  1 iW 00S W U 0S @00 0     0@00 :0` d`K0HK@0U H0KcKGKd0K\PK  L R0S R 0(S@@K 5 0KKP @@K )(` x0(0     0  Rr Rh ^H 0@#$(,""( :( @@g K0R0 $  K@Z 1`P 0@ 0@@0 \ 80S0C80H2 ,0S H,傇 Yu P Y@ 0 @@ 0P 0I1 0 Y @ @ 嫈 00S0 0 0 00S1 R P 80S0C80uᖹ0 8TG  rPP@@@@K J5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 th@$lh$ R 1 0 +10 ,(_ P0L協DQ @U: $ V00R00S`RV)@TU V P HP 1S(@%TPV VSV PPPJ P HP 1SPPӸ]]]L4a4 -LMp^ PPC a@V; 0 @0a P, `R00$q00 0q PU @T PUP00 ``M^U  P 0``^^P1S (| UP` (@ypv^鄔aTP0SP p-LMP` | UP@  yT0T S@`0T@ php \0|00U 0-`0L@PT 0S @T0XX0\ دP ] -LM`pP`| ?UP@@ `y` ~U@X(0T0گ0( P00Z^0S 000@]L0W &PP D0 R خX0 (P0 ]]̤4 p-L MP0 P< 8 \0Sp] `R000 TP @|bUT]|ZUphP@ 80 R ◮X0 (@]4 -L,MP @p] T@ D  1 ; S00D0 7P` L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0j W P_ L0 @T 0 R @TY @F]80S P1 \00\0`0pX0 P0ԮP 0Y@ 8K0q  00bS00bc8 xRQ:Q0 D0S 0 <0 ,0 H =H 00+P@ 0 R ݭX0 (@580< S L0 < KP<Pt0 R ⼭<X0 (LtL0 ``8<0<<<)` ]X44 -LMT@T  @P HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R X0 \`qP` 01 RP X0 `]00SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKF]a\a]4 -L0~n0`pf\PP 0f0V@0*` yVT( K,0K JTZ:01Q P, 0L00 5a -Lcث4 -L\400-@P 6 0 -0LSkP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS - - - - - - - - - - - - - - -T- - - - - - - - - - - - - - - -- -- -$- - - - - -- - - --x--- - - -ħ-ԧ-- - - - - - - ---4-@-L-`-l-t- - ----Ĩ-̨-ب- - --- - - -,-4-p- 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P33444D4444t34x'54?4@5$5465438E5,353 3\4@44<34C5Į444̮4Ԯ44444 0-@PL> `Sl h0 $$ à 0 < 0 $00@443 4,4 -pL`@Pu$ T 4 Z DU pP@TXD4(4P84<4D4H4@44 -L0 Z\@`%Z' !00St 0t  rW\PD  e/L4@4Ȯ444L+5 -O8@LMpOSP!b$ $00S 0 hdX@@  fL4@@4Ȯ44T4@4L+5 -@$40$&S !PL$pdxl dVH\4d4L4Ȯ4@44L+545峂\4 )|3 -LMpL`@PL x p 00eZj! R ,0 $10 T\ U18]p`)` 0-0 L@  ,0P   H0 RH 0hj0,na$`8] p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `jP0  R R R 0  R R R0Spp p-LM0O`ThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0paaaaaaa aa`_d_\_a p-LM`0Pdd0K`TTXx T`P H0T;j<0`u900`p P!iAia<]ha !iadal4 -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00@0?00?0]`ahada 0-L1L@4 Pi8040< 8 H0<0 @ 0 -Ld d -LMp$`L Q@G 1 G1F?(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 00 !01BK *]Pp10! 8PHH1X <04Y 10 1S`K 0 uT$`ha 0-LPMQ@$P> P dK|\P8\00S 0L!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<$100 p-LM0 @P0 "!HN 0L`L @000ph CQ Hph\$`na -L,M \`p V\ H0C 0'Q HA$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A ~h@ i8![P \$6BS@-L!@0 H@ -LMp`mHLP0 S@0 0 `H`z?@l@`$ 0S00a -` LR000 | |0@P;H@dDFA 02b SpD 0 S0``00`h H?-`-`?` -` LMT ^LL @Q Q\ 0 @SP$`p'` (1 R 00ah_H- -LM0` 0 !HAHP1UP`!p000PG4 1 UPRL1`t1AT  0P= @Tp4 H` 0`OW ! R ,0 $10 P\ SQ0.0 R$g! R ,0 $10 P\ 8Qd}Tp  0O `m$`p'`naa18]4 -`,1LM 080@0K(UPUK  _PU Kp0(  PP  |PU K0@ @ P_0gP00P0GH 0-tPtL0n@Q011!!PLP@0L!0*4  40L0C0lzdzPa]`ap'`ha\a\aa$`3]454<]@_а4@]4]8]`[^na44T44 -L MQ@@@00C S0---L--------@-XŸ 0%V<2^ 0S- 0W2 0S0000  00K\W- 0,V1 Rڠ! 0 V^4 ^0 S QSR Q P(QSRQPq,PKP  0VP@  BE 0LMn<`p4 OP@B 40 R08 &8 P00U* Vؠ 0. f   0Z UJjF:804 0S80 d@X00K@, KP00L00  w5haa4>0 >0 N5M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K K, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 KHya  0-LMP 0 .@K PP@ PvP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHhaa -LM`0VPp R a :VP@bT@!W W `d L 0D@WHhaa 0-`@L\0P 0  ,0R 0 0S0hvdahaD4 -LM`PV r @0S  2S @2S2S lphvdv0JS ,-,-,-,--@----0  nv0iv0@dv0 P_v1`VAA0S 1 R$ 1 ?#+0AB%@Av Z 11@T !m5vt2v h.v81\ ?# $1H1@Q1@!+B%0@ Pvv0v0 0X @vu" 0|  1vcmuꈐ3aX44444 4,4444aaaaa3 a<4x3d434ĸ4aa484T4d4p44444 -L$MC< #@ 000 0, !@ 3p|#Pt3UPQ\LaXH0< XN@t T*3 R0S0"0S :S7 D H0&R~ 20Sz 6Sw 2"0S00D0 D 0 Px2 RT0p0 D0APH p X9|X HhXW H0H0H  D07u @< 0pH  R 0 H80 \0040 < @00 ,0 08, 40G0.S4  0S00,u 0pW 00 H u @< 0p;0 080  <0@4 00 , H 0R6BS^ bX080  t @< 0>80K0@<  0 P hana$` 3p'``a5<_x44̻44 p-LM( \@SP`8 0 t t (tttt$t4t00S8@< D tHxt@h6sdytH Ttt Lpt84@4 3H4h44444ؼ44 4 444D4P4\44 -LM \@P`p  0 P`0L1 -LML ^0P0p @`H   \l 0 `p0 L1@  -l!LM000 0.!0 S@C$1HpxL17 X1: `N @0\ PP 0d@P Hm P   0E0.S4  0S00Ts  @0 R  0H 0@na$`4`a p-LM@0P`XT" T hrKQ0V0P00S 0[0ppTKQ0V0P00S 00pKQ0V0P00S 1[0pha4 88#4S S - LM(4P`0Sp @"0poTP`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SPQU(4 SJ- -t-----------@\. 0 P?D 0 :#:cQ! H`*No  @Q`1h#R& DP  H`0S000S pp`V  Q#  3*cW`00xq뜗a4aaa p- 88LM#Đd0`PP 06 ?S R=P%&:FFp$`]-@-0  80@0@ h0 T@ 8 H0D000H0D0 0404440044a-88P0S P0S00 40C4H0 Q H0D00C0CH0D0440C0C44a0@-8P @+ 0Q P00RP @0 0@0 P0 "  4400C4 0Q  H D0 0CD0H 0D H0 0CH0D  $4 0C4$$4 0C4$a -@ LM0|@  hS `aLa0@-x@PQ0000  00 0  0 Q 00  0P0_- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0_ -!LM!:Q@T!h' 001PQ np$ KP$0W 000p`0S &21p,nfnP@ l_ah_ -0L0b0^@0TP 0 x$0'g 20PU}n'9? 000CS0 0hnnal_h_ p-L,*(0MP"1"(  P! 0 S: @#P0 0D`L L0S   0+Upaܗaha -L vU -L mU( -LM8@PTp`  0S 0` @TH 0L\R S @Q Q Q \ 0h0hS 4S  0h @T\  ipL -LM8@TP, h` 0U Z 0`@TQP U00P00So Vm \j @R U Z @Tb ``` *(": 1Q"( 001 0R  0*"%,`VLp7 W 0S  10#R0 S 1D0Sp10a@ 0S0S |a d1P U P@R `@TU VZ`(*(": 1"(Q 001 0R  ! 0L0p 0S  0SpP000S 00 0P `1ahaa -LM@ 80 Q@ e @ 00 8 40  `0 :8p#*  ! #8R 001 0R  :#58PQ ,  0`w  T"`0 0PPP 04S`  H0D 0C H0D 4 R 0` 80S 4 0S(  0SP U 0,SP  0S@Tt100S T! @!@ 0S P 0S  0S D 0S 0P 4$0C 4$ 0S  0 S  R H0@z0H 0S  Paaha -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p$`aha -LM8@TN p1L D H 0S 0L`ppT0 4W PE PC P%*(":1"(Q 001 R40C4 :#%40C4 00 `0@gT@W8@ 0S 0SPP@P,@0S P@p$`a_ha -LMXj0 @$ 00 4( B0S 40$@$$__ -L$MP<P $ȟ"&R:0R*0`,0  1 0````UpH   4 4 R 4: #5 < QD @ D@ >0S@ Tǟ#&R:0R*0a00  1@W2 0@0 HQ`  @0 `6W  T  8 4S44SSD0 SH0H0S S L6!X@0`0ó @0` &U  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`zTU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 4S44SSD0 SH0H0S S 4!AT@0`0ó @0` U  @0`00@0  300S p3 0 P3@q 0Sn ,3Ph ?dP8 ]  "U 48  k0 `D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` x!U:  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8de 0@ 0S 0P O0 |eg)*(":1"(Q 001 0Rؗasaaa3ha`aa_Ľ44 -L0? =#& R6:0R3*0l$0  1"R 8\ 0P \0T\ 0 @00@0   $0 2R @ ` #& R:0R*0l(0  1"R 8\ 0P \0T\ @00@0  saha -,0L ^  08$`ha -!*(L":M1Q"( 001 0R  0`* " !Q:0Q *0b!0 P 0sa -LM 0LQp@+0 T ?= ?0S% d1` 00#! @R00  00#!H0S  S 0 0i?10Q$`haa 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00haa$`<__ -LM 0@S000L00ha -PLM` 0S 0Sz0000CS0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!VLq& 10S 0 R *(I0  0 $R$4$4$4 id@00#!0 hP0 0  "!0000~a$`<__`ap'``[^_haP-0 R0P  0S 0S  R00L00 08   0 000<_a_ 0-<04 [ 0P L$@0dI0hF__ha p-0LM 40 x`pP0\\@ 0 S@R0Tp@a__hap` p-LM 084P4@KX0K@ P0@ H`[PP@P@@00IphEF____ha0 0 ᰗaa -PL0@P$ /0pS*`|(\ 0 $>"*01\06S0:0@<,v/ėa_aha 0-0 L"*("1"(P  \@! 0 SP!0!;   @00`aaha@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000`a@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pGP ` `000@0  0@0$0)$Ncؗaa__ 4 -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S 0" "0 "0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,P[0 "R@maŸP 0$T D@[ 0@[0!@Sa0 @[0!@Ea< hPJT:kFdo`P@) E1? P 0 01  @`P 1 000R ;P= d9W 0pĀ bbt_ahaa_a___a\aėa_____44<5_(_-_\]<4_D4_h_x-P4_l_-X44_ؾ44 -!: P0@S`LPp P@: #Ŵp0L L \  P0p@:8 0 0 U0lb ܗaha̗a(4 p-LMS@P` ,:8l#* #800R 0 SP*  ^0"5060p =baP4 -80L0 00 Ơ ]0 ]aa_ؗa -d0L \R00#P00*0 $s80haؗa]5]00 R 0  \05055aؗa]] -L$M_](\]1"0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEP`H0H 000 <0040 000 000 $0 }`4@4̗aaܗaaaat40ḗa -``LM0pS P0  @P@^00 R鸗aP0P0S  \:00Q0Sḗa0@-l0@P 0S P  T :00U0S000踗a@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 a aЗaaܗaȗaaaaԗad!.aP .aaaaa̗a a -0L0Όn`VPp@0?0?0000?%:E%6;PK #;J jV!Z_]]4 -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:haa 0-80L@T (PT ` DT0_a4 -X2LMP, @ @,8`, 00$ `080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $@`01!R.P I P \9.`9.`9.`9.9.`9.`9.`9.9.`9.`9.`9.9.DP  0PP0!?#=?00c?S `@Tjڣh`,@Y@ BP@CPmPFP$_a4444_4 4$4 -LMp`P1SP>U#&R :0R*0a!B 0 T H4$4DL_8@T V 0 *$_@T@_sap44 -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P __ܗa_a -0LM@0pPP% KSPU$: 8 #! R#8 001 R00*"5*C `  0@TP4 4paa -LM@p nP 0SPTT0 R0 00b81Q00@R][^]]]4 -LM@B2< r R0S tRP "88 #$0L^H2`KnP 0S@ ^th P0Up7*!A06T&*46!SAQ  Qx1 :P|p`UJ1 16T:0U00 pW0#02S0ES@.@.t@.@.@.@.@.@.@.@.@.@.@.@.@.@.@.@.@._^]^.O^L^ "88 #$hC^(0S} d8a[^ha]]4a4a?4a44@B4,484L4X4h4|4 0-LMPK :P@ 008@ha -LM0@Xha -0LS S  -L@LL`P. pGL!.@ L1:404L1L@H@L!L tG0V800`H`0 0 04HB3 -LM 0@;  h?p'`X" -:#:LMS`@PR pK D  UjVJZS\a4 -L M00' H ~p@g0>0L ^| P4U@`H@ $@K,0  $ 00ZUzj\8]a4 p-LM`00l H0N@0d0>0^P 0,0 2L 0L0H p[a8]440 ( 40(S"4S]40 ( 40(S"4S] 0] - 1LM @R)% &B? S 20  "!   \\\G-(`\\|?-`L2\00 S 4\0\(\$)- `\H]l5444[$4@4@ -pLM0`S" @0  2 Bl\0PU *   00VU:`2 0S]`4 -LM`T^@PƄ ?p 0p 0,`e0@@]ha-??!0S0q1!1 R  P 000$0$ P 000d@d -LMP  _$ ?x,~8ȟ 8+8 R(8* '8( X KE800 0 x\tXt\lI)à@XXȟXTȟT bPx@ 3`8`[0[ a,Ơ 0  H[000 )P@ 9#9S*00 S0)\:00 0C0j@ 000b1,0 PUZ0Q I$IT dxZ40 C\ g:0 0C007*I@Ɵ0 C\V:00C *08@0 L0b1\0匆u:0 0C06*!@L0 L0b1\0_:0 0C0D6* @00 L0b1\0I:0 0C05*?0 L0b1\03:0 0C05*?0l0l10l8[T%d4[H5X0[<şL,[0 C^ :$5L*?0[0$A `P PUE `Zd1CP PUE `Z4$ ZT 0^|DP`&l@0@N @@e 0@@(Z :@ :@ :@ :@y,0 9@r0C(P `:@hPU @Z <3 @0@ "0>0>02 a\2"& Ÿ 8 0xZ0uZ" !01 `2\"LT\ZDWZB=!==18=FZ"2 1!1 ;Z8ZM! 0 @N,Z5#1,- 0@0 hV0C ^:00C0>0 0b10 @8x4@haa$`Ai` Ha_p@P]G.]4a4a|a`a ]Xa44da4aD4LataaaPahax4444\a4aėa4#u5? ,4`aX[^UUUUL4|4 p'``a444-h[^p-d[^\E3t[^4444 P-LP t2R l2 `B00Pb 0j>@"P@0 SS  QQQ00 Qx APYY0-S SPX 0-S0SQ q00C@CSWTU.`U.hU.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.0U.U.pU.xU.U.U.U.U.U.U.U.U.U.U.U.U.U.U.U.@0000Sl00d0`0K@@HY@0 S DSBO$`a]] 404]@4H4P4X4 p- LM0@S p00>PP@` 8x10Sph>PHP`D >P4P `]]@4@H4]]] @P4p@0Q 0    -0L 0+R 0  hht0v>0Sdd  0\SQ RHHD0 XX 00aAi4$`]p4 ]V.4o3_ -L M8@4T 0 @@O_a4 -LM@`"0pS1P0U 'Pq9P0S UPPP x=00C0`!(@AX101!!P4a4 -LM @PQ!000$00S(h::꘠a -L,MRP,`Kp@ 0=%40K,KK P@ P030[4 [2[81[<4U @ /0[0 [.[8-[<4 00t0  W0 N4 -LM2(KJP`0p <,0 @p(@K@ @u0' -L M$PK@p`<0:$0K<  =<  9<  5<$  1<8k$P0 P ` PKB' -LM2(KJP`0p <40(K $`KPp@ @!0 -L M,`Kp<L0PH@X@0 ,K@+PK(KP P0u' -LMP0`Kp\<Y<@0K UP#K0 /K.KP @,PK -L$M@4`Kp5< 2<`0PT@!$Z4K-K [0 3K2K@ P,@K0 0 0bS00-0  4$ 00bS -L MYP pR`@0 0SX1 h 400Sd  0P@8 04SOX00 0>S  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@PV;0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p/;``$U-Kz4K 0 3KP `p,@K -L M0pK@` ; ;$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p50S h7Pu,0P" P 0`V U004P< (0;4P00@ @0$0 0ShV h&P 0,0hT -LM0$ @(X , ,0PP& !P&`V 0p0p Ps60 V 00SJp P` 0,0S<4D4 -Lp`PP Y@  >` 0$0  00 @0 000P 0ҕ20•U p` @  -LM,0@S$$f.f.,f.,f.4f.df.f.f.f.00Cs0 0 00, 0S P;p  ,T0S p4 0-LM0@0S S T@D P0`` P5P0@DS000Sa`$p`4 - `L$0p04PSu0@0p0CS0Օ Q?h.h.@h.h.h.h.(i.`i.h.h.h.hi.h.pi.$0( R0(0Q 0  f0@0@S 0S :S1U@01 0S 0CSh 00S :S @ 0RS 0SV0  0SS @ 0S 0)S 10101 @@@p@ -LM(00 S 0 T44 0-PL 4@ @0!qT p@DST4@ 3S05 00hSmxS0; 08< 4 0<S8! 4S0S 08< 4FP<PQ <P<P SSSS0 S0@ lSdS\S0,LS0,5@4444X444(4<4T4h444444 -8qLM@P8 0Uă`9 U 0 c>U <0?R0S0ASLm.8m.Lm.Lm.l. 0@0p| }SP0c0T  sS0D 08    0_$]555,585P5 -@LMMT`pP1 )@T 0 S 1S 0S0t P8S0S h=< 0 h'SpT 0 3h5555 -LM BB@7y 0S@0 @p\a -LM@g R000 _h 0-LPV,0@T 0U @TJ0\a p-LM0`@V@ P7 P0[0X Z ,0S p.0p.Tp.hp.|p.p.p.$0  B0[0$ ph 0Y0X 4(<0[0MlfR0H,X`R00 0X 4(Y0; 7phOR 2 545l55 p-LM@PO < 0Q^C0S>  R50ˠʌ ʌ00ɌH0 @P`00P  ph0 ` 300  004`;00Pᐨ8Q``Q`Q5553 -L"M\P@`p l2\ ,@0S p  02\U 2\ @}̠ 0@ @l1\뤠 ` =;Q 0S(   0|000 0  0p0#00, 00 |6@ ` ;L@D04p80P0&<@1011011 011@01101`0\ X0\x0P Q1400  00  Q@Q QQ`p.3 Q- L2Q5 -0PLQ0000 1S010 130S00Q3q P4 00#`Vq 4@40!`R 63V hbOH]]55 5> 0-LP>P#@P441S@T &0#4# p-LM P@| 0`\ p| 0`\0` -pLM@`p iLP@0T 0!R@ 0T] -PLMP@"0P0aV 0 q1 ,0 10C40  Q 1Q4 t T0Tu8@  40!Q<@ 0<0   P4 U,0U 40PUY  nP 40!ZY 1 L60d!0Q<@80T@3T SP@ 8 T1 0 08 <401T00  p0S Xp0 R @< T00T^80 T4040!0 0C< 80 ]3]'-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LMDŸ Q, @4pO / 0@\0 | w\3 \p 聟X- P`K PK@K ~  zP@0!0 1R 0t 5O<1 ,0S D,z7Z 7}.}.}.}.}.~.~.~.~. ~.8~.8~.8~.(~.0~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.8~.@~.ꨀ꤀ꠀ꜀ꘀꔀꐀꌀꈀꄀꀀ|xMt`\hd$`8E5@4535555555555$5,545<5L5`5P4t5555 -LM40p1` SP p P@ 0p L8l2 dd2  $0pPP0 @Rp Rz Rk U 40!Q 1 f # 0,Ky0!0Q  202202 202,04S!20\: 2804KS1ԱL0 1ı0 4@ !9P( U$1 ! 41 R0S1A0 -p 090 0 04P4 x+N 4@: _9P0S`RU]X_d]33v. |.D&4 -L MPB p0, u`@᠟  0PES u@,0Y"7 0 J3P 700 000 >3P 7  530 P 0  00 R0 ,@ -LMK 0X3 -P`P0 S00Ł0@p$ (00L\p<1d  0T 0Q000M4#0S$T1 hM]]43.,5 -@L)`$P P00$ ;004P$ $PԀ0 PUb p@0SP 0@ 0UP0U hpp@0SP 00@ 0UTP0<q#FD]@.]]<] - 8L8#Č M R00,p \, ;P@y 00 Ԡ<P`mPU< 1*X`  Y  Y 0  101PU 0<: -j1 010, 100, 10, R ,8Q2 RP`X-. P` V X` -8P`101EP1`0 0` .A`:] - 0!4LM#`py:P@4 0\<PP* V0 70  V0 700(PUP J<w:- 1 011    1<1_:] -D@!88#L!2:PP<`09 0!<`03 p<`($4P+V D00S 0 00KaP `A:":h<`@``ᡢU h:04000;00] -L,MԀ0SU 1z $@TN $0$0御g pT(P3D0`0S2 `<@3 P2 46S7 4pK 000&((*&<&%4K20K1 K0K/`K-K,PK p0P1;<H0  @0   dP0S ;K0S7U 7UV 0kd7U \7UHQ #  4IP 0,;6U=6U"*6U 6U"P$6UQ Qc00 "  d 0@9P 0 ]000v96U 5U 5U㲀>U@ R0`0 3.0HS"5%@P(@dDFA 02 Sh1b1 R0``00`  0P0S1 0" 0#$0$   BR !&4$@P@dDFA 02 S`1b1 R0``00`Ru 0 0bJ10000 2 0,$,!$#, \@Z `s0StCP R0`04 .  0@@@#P02 <4(<"4!<002 0#$0$ 0 S0S0002@2@dP `|2U t2U  E@0D,S? 0\PKP@PZ0[Y [$ R !%dP@ 0P@E`@K P 0 P0"  6[#$0$&K 10U 0,10SU0U 1U} 00U0v0Us 00Un 0$`] Q@c Q l5c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccA`-`-`?`ddQQ` -L M,0 0e00 P+- ,(-a@Q0p0m - d0( 008,!2040 1 P t , d ,0T*@KϠ<0  DX@&6<0`0`` &P0 0bP 0 PY *(0 ("4400$ 0 0,0X oIZ@ N,00 PpA`Qt54WEV.5 -L,M` 0 ؀"4pKP@ .,%4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ pPP ,0K ) 0K@@@ p?P@,0S@@T,4 ,0 , 0^ @@M0 N -LMP`p $P P@ $0K   pPPPPP $\00S 00  00   -L$M@`p 0@ yPPb 0KN 0@@@@ pP@0\@@T  0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 ;@ 0  N -L$M,`KP @p_+Y0,K0 (K$pKP @@@  -L$MP $ 1`L  Pp8 (K$0K @@@ `/P@$ R@@T00$000$ 0S (0S T0 @; 0  N -L M0pK@` *$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PPp@  -SLM@Pj QfS뜁pQ0`0V H*  Pp0 0@T@b@bPU?J! @0L\, 0 @=p0 @P@dDFA 02 Sʬ1b1 R0``00`0N^J0D@T;p `A`-`-`?` -L M0`KP pU*G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp 2*@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `p*BU0K/[@/K&.K)K4 Π0 -pK*K`(`K{ -L Mp0@KP` ))CV0K/['Ġ/K)K8'KP 0 *Kp (pKP - ML`0 PpPP@0nT `:PP` -LP -L 4pK n$00&((*&<&%4K20K1 K0K/`K-K,PK p0P.00 0 00<H0 @ 0   P@0S .  ?0SZ0  # S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 V#@ 4K 00K @ @v0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MP 60@0pQ2,Kl  ! 5,KX0L @` `0S0@00 :35 -LX  0 P0$0B(0P S 0f9`a.a@455 p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!p`ana p-LM0@P`S(.d.l.|.|.t.t.@ ?D0P!!00P ` p@@@9`a5-0!! R R0000 0  0!!  -LM @ 0@0hu]Da 0-1L!M@4 0800 0P0< *00S P/Cb1ϠN3l"c11A}S c•ϠN3l"cT!!A0D9)8 0h$(8a]P]0A@H5Mb|al5.5 -L$M400 ,0  00K(0  $ 0 0 @0@ ?%. p-L$M048@K4 0 ` P0 , (` (%0\H D 0@<4Pp0 , (` 4@ P %P pF8@.5@5 -LM@q}90sx955 -0LP<`  "!0>0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6<.<...\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  7 5 p-T0LMP`00@8 ,T00 8\pa p-0LM@ P0`<0 \00< ,T0000 0<< \phfa - 0L 0<,a - 0L 0<,a -(0L 00< \a)` -X0LM@ 00<,0 0S(000u8 @a)`@5 -LMQ@0>0~n0`pfPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 5aQ0 50 -L65 -L65 0Q 0R8_@ -0L@Mt@8l0d@ \@ A!0\@0 0  "!8_58a<_<_08a -0LM 0p0,0 ?o`sJ0,0S%0QU PP   0 @PU?o0cS`,008 401o8a4a<_<_a10400P 0Pp0 604\0 04?0\0 040\0 0@4A0\ 0@804\ 0@<04\ 004@ \/4]5 -L쀟M004 0\08p0L DL `0pP80SL@p@cL@` 8p,0@ 04,gP P0p40 \]5 p-LMP0`04 0\0<@ @0@<@0@ 04,dP P0@40 \p] 0-L PP@ @@004, @0<004\0] p-d0LM` 004,@P pPXP] -LMTQT1 Pq@La<@0 B@D$@H0L &0 D080-@< 0 0 04,0`04 ?0\0 0@400\ 0@8040\0 <0@ `40\])`)`555h. -LM̀0pS00 0`04@ , 0P8@u PdD0PP1'8D PG0= @ @P00@B])`?B p-P\!7LM!I@1<2a112N!!1c#!!?aL6c@T d00  R00C0  R` R^ d 0S00C0  R^pp004@ ,Pd00  R00C0  R0@ 04,ePCYѭh] p-L M0PQ`0 )0Q p0S 0 R 0K0 0P@0 TPlt @pp,0Q0S0S @]@_p@ 0-LtM4@P8 0 0 00| 00h] x. -P0L@4P`8 Sʴ8S 0 h+8pS pw0 T0  * 0T00 PaAi 0-LM0@080<04  F.PU 0h.F>80.0 804   #?%<)9Y6x3 v%%<0`@5 5/ -LM@<P 80 S04080P 0-00@L4 ,0040 \004 ,0P043 \040 \004 ,0048 \004 ,0048 \004 ,004 0 \000 PaAi -LMPh0d8p2/ p P` Lh-h•p0p2@ l@  h•l 1\p 0piP- h2lp"pb ~P@ d-hPPH < 0  -5@!(54L5/ 1h5 0-LPV}P@H8S8S lp2 S0h2lpB\HHH p-LMP@| 0U0`0  UD 00C0ph꓁ 97ቁ= -LMh2@ld ,P1h” 0l0d \,jh2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 @h2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \Dh2ld ,h”$0 0ld \' -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \JKLM0@ P P@@@Dt :@Dt hu@0 \ ,0; \8 , x0 -LMPD@Xp00`". 1 )  0`0@48@0PGK L0 X 0 0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X  *H]@a35 -`,0L(0(@dϠ>1 0(P\ p 0S >m@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0AP]@a]D0, S0D0D D @00H @0Pa 0-PH0LS@ S 04G04 HP0 -LMp\J +PU  ( i@T4`  P$0< 0:000 `@0@H] 0-@P LR000 @ H0 BT@  $Q  R8000hn80 8004H00QH  0Q 0Q0 Q 000D0T0QL0Q#!@0<0 <0 0 AW@_W@@W@DW@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40uh -LMH 00R@4< 0BH 04h.P0 S 0- LRP@ @s(p(0S #Sg(e(0S S S lY(h0hV(`T(XS SD@<S45 5 5 5( 54 5D 544T 5P4\ 5h 5t 5 -0L00x0 S -LM@dH0 R |04ShꪔH] -LM@Grhl @0\ -t0LS0 -L M@P` Q //H//////0//H/` 000ӂ?00 K5] -LM,@0D 0  $ -LM?@00,D 0 T -0LP 0-DL@P0000 4 0h1 0`1l!0h4PB/ 0-XAPPPTL 0S@T0$0S U  -L MP00 4X1,q0040 U? VR (1 RBXaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(`  $@PpTWd SP@ d0  `0```0 @Xa f%]RE/d2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@PT@ T0X140 0, 00 R( d `P d @$00@\ RPP \  X 0X P0 04 0 40  0 \ 7PP \ 0X00X P V,P@@Q UPKU@tFD@P1sw@Pt PpDPm Pix]R]%548E54 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`RV$p$@P0 P0 RT  0 R 0R3 -LM `8#0PU 0S; S XPU0430 0 S04 40@40PU Ö P†TÆ ?00 P#P ?φ40 40P3Ά 40P@$ PRU&11@F? R 0R Q pW P 1SpW Q0 K_P SU Y 0R P 0R 0R 0 P@2"32 #"22""30#3P–T 0TP2T $PP> 30CS D2D"3 #<2<"2"424"3#08 "<80S OP0 830 400834 400"8#4 040 P2T $pPT1T!3 #L1L!2#@PRU$$@Mn0KiPZ0 PT0 RpNN0 R= 0R:4 4 0| S h)5)53@ \ x 0 į!)5!̼!!ؾ!)5)5)5)5*54*5 0-43Ls@  AR PP 08#0 040 834 4008# 00 4 p-LMP@T`8  T@ p5@E <3S8i8Yh5 4005Pp h ` X S~p   40@P?+5+5 4+5+5+5,5$,5)5 0-@\5Lst ) w" PP%5S#h%\ 040 h5S 400`%r h5 400h% 400 0 -LMP@ Tp` T dhsh~=!`ht\@hh 0 : `h@0S8d5- h`]r"D,5 l,5 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0QP0 P 0S P<3ȵ3 -LP -L Mp,0 p`BKP| 0#L@ @40@0PmP#̆ @0,P^1  +Q1,+ @0Rˆˆ;2 d 0X KR4 h (1X!@0@GP P( 0\ u (P  0400U #4 00Uo`S XP PM HJ $###+5#x= 4@4,5x5 #\*5,5,5)5 p-LM;t`@0PpK=0; L0 400 # 0 40 a$# # -LM@PU`p0  U 5@ ;0Q;l0!\0<d< 0$0.0 $#x= # 0-P@L d0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 0P$/5 -0L* -LM@P`p 0 ` p 0 @ @0 -0L MЍ7 p-LMP $0$00. $0$0  $0  $0|yx`@$ @0S}lTp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  H00 0P@ 0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 (8 ^ [X0  L0H08>pW`F(PEZ@4@5 /5!5!54/]]$0S0 \2] 0-P@L0PS0 \0!0U  0h]$0S0 \ ] 0-PL0S 0S0@004( ,d0 0 @04( ,4004X04X] 0-QL0S0$ @T(0S0$ @T0004(0#004$ X004$ (008 84#8$ X004(#0 004$ X] -LMx@0S0$ Q0S0$ Q034X034X]0 0 RRHa` l00d S S P0i 0^0 0j ]0 000 0 0Ha` / -LM Rp@B R࡟t^(0KP0*0P`c( 0e(  0X( <X( 0X( 0X( 0X( 0X( 0X( 0X0S( 0 X( 0X 0(X0 S0 0(0p 0$ ( X0X( 0X($0 $ @]05005 p-LM0 @P` (V  V (ppeH05 -LM0 @P `pMT TU00Xi< (08U#80 U0 5h05 -LM0@ P` Up $ UL0S i (085#8$ X05 0-0 P@L 0X 0X 0X0 -LtM@4000\0@ 0SD h80;P$ hP]pA054X/05 0-t0L @04P0 \0P 04\00500h ] -0LMS @h p-0LM P@0`40\TT5TT" T pphT p04 X0\040 \004 , p5 ] -0LM P@PP @5004 , 004 ,@ ] P-L P 4ehPh05 -2L M P `0 04\0@4 1\5][f040 \004 , |004 , 004 ,P(pK04 0\004 , [004 , 004 ,APU5 0 04\( 0? 0(0 (!C3 0 ( ] -$1L R`P>U< q0 04p\0@4 0\5040 \004 , 004 , 004 ,@7 ]15 -h1LM \1+R pW`Vp`@P, 0 4 08  pn5y @ e a j @TPZc5T 04 8,oPaAi 0-LM@seZ 0s0 Zy0 t0x 0 P|0 P .0S j~H0H H D0082815Ⱦ/@15///|//8/\K`T>/@/L` -L -L -sLPB -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01H] 0-0L 0S 0 S 0SQ0@A0@ c cO PD00l/"b0H]Q0 0`H]Q -LM@hi -LM0@S eRRP0 00S 00T Rڴ0: -LMP Z0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`帀0V olVP0Ӽ09P000W0X0A-P 0S W rm0V QW 00Y00BazQJUPpW@:p@@p帀@3:5gfff p-LM@P0`S 0S 00PpN00 -@Lp`P@PUPV0P0  0-@PLPB000!0h  -Lpa0`@S@P`PP0S d@ V T_@D0Sd T` 6 -H0LM @0P h] - LM0S0 @T0Yv\h h0p,@ 8 #8~4P6 hp\]@B 0-LM@ P0 D0D0 @ v8 K0d00h X0x/H34l3\0 0-LM@PP0Ux0StL0  H\0\  @H 0P0T 0 7 t/L15/ -LM@0VL0S0P0]0L0 -0LMS@  S00P0:Hs 0hHiHg0P0P>0 -L@Pp`P PTU<@ p-LM`\PXP P@0dS:ph0dS: p-LM`i5@ TPPU $   00 00 @ Td 0 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00]a_VUUU 0-LP@0h -LM`PP yP P@@TX,K TpB fW!X10SW ppWT0\ `S, ( X, (0@@8, (0Tp`0\ 0 R@,0d 0ll(0h 0lPl,P ( Hh00`0aBafD0@H(00(0aY꘣aaL]5Mb]Q0Q00 W@R R | 0\q 0 Q  -LdM,3x0 | t3| , t0_40t#0 02  DP;.XK  @0S S P@0'\00pttX2X0S0H1H!|<2  |50|5(2  |5@0|5|5Y@C 2/@ H_50%0Px@K !t 0/x0Kl K3P |100|0\00lL1h! 0vP Y D1 ,0S ,,|!0`/͊_0@@%0P0`@#Hh P 8`p@5͊P%00|dd$`,5d15l15(1515]l5|/(/155~15JHFD 25,25 -@L`$P P00$ ;004P$ O$P؀0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0W( c c]/]]<]l5 -LMD@!88#0!Pp p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8h85|8585WEV8585 -80LSP`p (0S KKT r> 1R0S PV# u(@2@R0`! 0R 0R: 0S  P 0 0 V08e/ e/WEV -LMp( @Y@D@8PiX, `L T(0 "<00 @ A P@jHo@  0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  wAP@H( @0e?C\ 0R 0e?C@T e/000 YA@00:00>0SEP (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 80@4000;0000 -L M`$ pWP@ V Q0 00 P0 00 0 9PP 0S0 P 㲫㯫 0 0 @ 0p㜫a -L M0@S K K 0 ㆫルR Q-LpP 0S00@T 0a P@ 0T p-PLM@` <TA,!<0 ph858585 - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @#P@ <bp0S [04`0 0lpp@4(00  0- PRL R1<@T  0D0  ?0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hh 02]0<]5 - QLM`P6q0<@T/ 0R 0 Ѳp0S0p00pRp D0Hp0(  0 p0W 0  0 0 o H^5 -LM@ロp0  0p0{0$ (0  -PLM 0 0 P<W P-L`@ 0PU R@B $ph02T@D5 p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp5 -LM2"0!Q2@< 0j -LM2@p( R U)1<`V W 2s 20 2ih#2 02p  lPp`i,p 9595:5(:5 -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hDP0U2pPza,0P:5|:5:5 q-LP@p QR1< RL Zp R l0U RuM2602RDp`V) l02 1<   1<  ht1< &   0 2 -p0LS Q R h0 $  Q 1<0 S 00  p0 Sl  -qLMP`! Qq<@T ϫp0T 0 0 00`'<0`T 0`0 0ḫ㳫p0S @H 0@ p P00R00S`᛫:5Qp 00 0-4PL0@S\00d$P00a -dLM \L@0KK <P <P  ܣaaa 0-d0L \0R@P 00$\ 800S04 aaa0 p^a0  p^a@30 -H0LMQ <\ 0 40@a Q-0L  pS0  A b00\p40 -LM0@ 00 R 0tS0S00, 0-00L 0@S0 4Ъ PR0t0R0000h00 0-LM@P$KT 0 P  0@SQ0@SP  0 0@S  0>0 XW 0Ra R R P-L P ?#?00cS70$70,70470h^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0 02o@ 0(@~"P00R00S0P 0200 RpP0 b^:5Уa -LM0Pp 0崁p@,`@@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP 0 o: (0 p 00 0o^ -LMܠHp0$H 400pP` 0p < P)$p 6 :w0 `P 0^ 0-h0 !Xp0 L0  8#UP@008#HT^ -!LM0, p 0庁@1 8C00C8#0 p04`0p0@Pl  0 P8  X#, R Z 0J  X^ - LM0p 0帡> J , 0 8p C04p@0`DP(  0J8 P #,0XY0I ^ -8!LM`p0 P@10`00C8#8 4,0 p 0P  00 p04`0p0@P  H0 !0 R8, Z#X0H^T3 -TL M`p0  @JX 0`8#84,0 p0P   00 40 0Jp 4p 0`@P \ 0I!48#00 R, X040S0C040 4^T3 -LMܐHp0$H X0`40gpK 0p 8%X h`#80A40Mp1  1@T@^T3 -H!LM0 -L@M0 48 mQ`( C PMQLQCQ _AQN -@Q (0S (Ǻ 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3S<$ pW@*L0 0/S5y0\z0y0y0dz0lz0y0tz0y0y0y0y0y0y0y0y0y0y0y0y0y0y0|z0y0z0z0y0z0y0y0z0z0z0z0z0z0z0z0y0y0z0z0z0z0z0z0z0z00@TPp @TTK 0X@K@IPwT0X @p004 8PJ?H;5T;5i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L  ^0 /R 19R00C P^L0 0 C000^L00C;5AQ$}0}0|}0}0}0}0}0}0}0}0}0}0}0}0}0}0}0}0}0!R,00 ,R ,0,00,0 p-LM,@AP0CQK000808080@0\0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0x0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(00(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph|3|3 -LPp@| !0@TDD@`01| 0 !0@ T3|3 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C 4^@7<5<5<5<5<5<5<5<5<5<5<5<5<5=5=5=5^=5 =5(=5,=50=54=58=5<=5_$^53 -LM@ 0 S 000ύ h& -LM 0@SJ0 0 -LM0S@PM㑖0pQ- 0S0%\a2Pa 0 0#r UP 0`00Spe00P0W0SPUUP  Ρ`PP0U\\ P幭P`0Q IF#(@=5 -LMP@p8A@` 0R * 00000 Q- LjX=5 00sS0S  -LMp1 ` | 00 0SXlF0S\1l0B P 3l0 ` lp 0 t0 0 x 0 P:l0 P0@00SX P i 0`$\Q p $ʌ$l"l 00lx,^895_0^^4d=5_|=5`95=5 p-H@LM 0`P]$ $$P`B0 p_P000_ -$0@LM@@@70@__ p-LM@` `R 0S \P PUl00 0PU\\phC00 (0 ,!ᇱ 5MbQ p-LM`0PSZ0SR|0SX1  X@T 0S81P((!00 S P0 i5p0`0CS0000 R000S0S0 2c1KPd.0D 00I00I _]0<]5=5=5 p-LM0@SP`E0S1 U)  lP`\P l0 QPU \0`  p0,!ph߰l0\0PJU\P  U\ 0, P`00 005Mb -XPLU @ ?#<0 p` @cT0p  9q@0S 0 S0Dmu00岬m=5 p-LM\0PS`px@V0@@T tp0x@ 0-\ @RLP0Stp00 兰0SX0S7  - (L(" P`&0AT" P0S `0SXpW4P `P`Xp' \^0X0 -T0LM (("!X@ T  00X\^ -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0  \^@-$ @.MЍ@\^ 0-LMP@@ 0@0CS00ϫ -LM\. 0\ 02pXP D1` Q 40P d0\ \0\XP D1 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p lj ̥P` F c }l dH2^IP`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! a P`,0      00 000tpA@< S l0 K  $@ P`l@10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @^W@^ W WW W-00 Ƞ Ƞ,1X0S\^D0P  0(1S \0SP\^ -40LM@ T0 \ 0_ p-LM|0@SPQ \`V0U\0P\P \`pU 0 (pp\`Vp=5>5PP 0P 0!R `0SX0S X \^ -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G00__^__ -@0L R 000 0S 0S 0___ -4L,\ \ __ 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L Ml 0 \P  l 0 \P l :$@h`0Tel 9_l : ,- $%'(*+t5 -LMQ0 P` @Y TQ R0R 1pT R 00K0; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[00`80 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀  -p!LM04 S\q1Tq080 0K  R8P`@`V@DPEAJ3[ S"[00b0cS < 0K5X8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3^^ 4S @08#<@8oS: S>; S P 0 R0,R3 -LM@Q 0$0H0h00<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S D >5 p-LM0`PP@ S̈́P =0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ X 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S4 D>5l>50Q 0`c Q- La>5 0-0@l0P0 p00 LPU 0SC0h@^>58954Q p-LM`0PSMX@T 0S 1P!00 S P0 ),pŋ0`0CS0000 R00C0S0S0| 2c1 PᡋL0D Γ00 ]0<]5>5>5 -LMp ,0 0'0#0#@00 40 DXY 4@ |0t@0|04 @0,004  D 00x000P @ <0 R"8 ` 0S P?#<00cS{ 00p=hU5?5 ( (-"L@pPP@0 T0 `04@S X`V0p 0 -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00$^ -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S$^@-$ @.MЍ@$^ -L M`0V,0 :l3Vd3V \3V LP3V@ ;D3V% X0S\0S p@ppTP ,000 0 d@PPTU 2V 0x0 X@T D1` Q 40P \2VX@T 00S002V_ 1V0S Soo\1V 1Vp@pT ^ 00  00d@TX@T. ˇP 0 P?#<00cS`  dUPPB0S 0Sᬇ0D ݏ00Ꟈp@pT 00 R d@T 0RaX@Tu D1 P*XaWbW`Wvt}f|fW~fcW-00 Ƞ Ƞ,1 X0S $^ -LM@"P `0SX0S T0 S `0Sh& p-LM`P |W~P@|0 p04 p`庽0 00`x 0px'4^ -PLM`@@ pPdP`0ph0p R0pd@\Q 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ \0 S\0 S -p@QpPpp TL\` 000Sd@TV \P ` -LM@PTp` 0 S  0 P(0  0rP 00  P@<x K  0~ P 4?5X?5 -L M` P@, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  (@$$D1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 Pld` V,2,"0(2 $"0 2 "02 Q 0 (01 0 1 00A S+0000t000000000](  l1l!0h1 0`!`1( 0<(0,R(0,<(0H \0  c+8@PU  \0$!0" a<0 05  a8@PU  (0 0(0[ cD$_@980 00l0 00 0@00h00(00x0|?5 0-L@0PS  0Rc0Q 000 0 R@-@0P 10RS<8 003 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  8`F0v@P -L(@pP`0S P$` W(00(0(00(0G-`MPa PT - ,p 000. 0G 1(/P 0@W0ޕ0ޅ  gS220 R0ޕ0ޅ b BS22 0 R0ޕ0ޅ b BS22P P P 0@S ("("48<#8h0\@PЍ 1h<4<("4!" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  yP@ p  00@p00p(^ -LMX@$p@% bT0 apGL Bw &R$  ?pG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@Tp@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000p4^,^UUUU3333^4^ -LM@v 0 ST0 S D@00 0 000 0,0 0S0@0?500p000@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 H_(_ -LHM`\@p oT X !4.0 X@$P嬐 W& 0P 8PEpbu ( 0PE#200u0   @ \0 AD! 1000C0PE00u0 PEu00@L_H_(_ -LhM`\@p oeT X $!4.0 X@$P嬐W W- 0P 8PEpbu ( 0PE#200u0   0#2000 @ h0 AD! ! 1000C0PE40u0 PEu000 @L_H_(_ -L∡M`\@p oT X D!4.0 X@$P嬐 W4 0P 8PEpbu ( 0PE#200u0   0#2000   @ t0 AD! ! ! 1000C0PE80u0 PEu0000 @L_H_(_A-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000|4^^,^p@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0pph0h  @D1t 0p 00#0q0@D0#0t4^^,^G-0M, 0P@,P00X0PPP` U$p@,!0pG0 wP( 0b@U0S T eR0 APd 1Z * 0! j\8%1^<,pG0w0Ѝ%0Z:$P 00Q( 0e 0 0 0A22V$00S,P`00`  `VpG! a `Bw  02 0,Z0 @ V0S 0 S fR0 J\Vڬ3 00003 !@@D\ V0S Q fR0\@D(\% U0 S0 S eR0 0 @CTŸ 1Q !2 0 c\ 1^<  pGw] "0A\<X"0  000, 0pG!0 w> 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S3^,^4^0 0 S$0 S000S 000`0p0E-M pTJ<h@J+X< ,$P ` @h0 P- 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEup@-A;A'<00<  P@h0h`00 1 1$$l0 ! 1((T0 ! 1,,<0 !(  1,$,!$#, !\pP__ -L<M@\`Pp m^1 WT0X(# U$% 08 P@Pcp!!( P0@#1<0 p 01<0  0 \ 0<L00C0@p (P0@00 p__P_ -LXM@\`Pp m 1 W[T0X(# U$+ 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 d 0<L00C0@p ,0@000 p__P_ -LlM@\`Pp m41 WT0X(# U$1 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 d 0<L 00C0@p (0@p0 000__P_0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 000000G-M(T) <h@pX)'< ,$P ` @h0 P@ / 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@__ -L`MP\p@` md(1 XT0X'#@v$, 0P8 N`c~& (p @`0N0x0~  01x0  0 0  p 0L 00C0N80~   0N~____ -L⌡M`\p@P mT1 XZT0X'#@u$5 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~____ -L⸡M`\p@P m1 XT0X'#@u$> 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~____(0$8 Q!0  Q:30@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP y80`@T  @Tphyy$_ -L4M, <pP4 ,4< P,@$0 0⣡ , 0 404@zpP8 u ,  ̔,  0@ T,0D $0L0 L,0,$0, L0 (P 8 T@ H X@ L0pWLX0H ##,*,T  80@ 0<0 P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804P48p4p4 4p8 0-L@ xP%@xTP 0h(0-LQ@0 0R, 0 S  _0K^$_,0 P 0SP$_ -Lp `Px0@T U 0$ R @T xV 0 RX 0( RW 匔P nx$_ -LM` dx $ (0PZxr@ R0P0u Ox0 00 0X0`01 P:x7xq@ R 00M ,x< $ (  W.W$ W$!W80B@@x R 08  80 x088 0@ o8 @W W  W  W W W  W|  WWl Wd W<nnP w@`lK^$_@`A`A`A`dB`B`DC`C` -LM@ P`wp P@& U ,0U 0S0,PV 00V 0S 00`00("X0wwP -LP p`w@PU10  {wU 0-@L rwPP@ 0C(S"H bw0j?5@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS0P^ -LcMq0P@$0 <0@@R00}/#\B1\TTT S0P0 $0S h$嘕XFTa0S0D!0000iK1 A0@00 r`0`2S+@4 0P$@X0S 008 R 0  0S0 00C0tj00X 80P0H 80P0$`Q^ @5 @54@54H]=@@5T1`@5@5 p-LM0P\^ @L |0|@EjQl`lPll l0^ pP4jP <8z0弬,Q^8E51DQ^a, 1Q^@5@5@5@5A5 0-L@Xv0PS0000 0@@00hFva -LM@?v0S R 0 00  0  h-va p-LM0P\2S `0S @ 0 @~0\2S 0S ? 00\"R P0Sx@002c1 T ]P0S , 00C0d@L@_iQ^(A550A5 -LMu`Pp@ 0Tp  R0000 0  u uP@#@Ta8A5 Q- L@A5 88#$R\\ 0R01SP0SQ 00Q^0Q^ a - 8LbMؠ8#P( `P0 Sxu@jKq0S|||  0#@̌P@ auT (0 S 0( @$` Q^LA5TA5 88#P0 Q^ a -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P  7 0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 k00S 00<1 wP0T0 V 00S X llTH K)T H K$PT H0Q @0QQ(0$0p0Q^UU@Ut}f~f a0 0 4 S-L@PtA`p <0 Rp~tQ Q^a -LM@ltH 0S00  Q0 0 0S00hWta0 R=  0Q^ p-LM1@s 88 #4 pS0P`$0<`806t00@1t aHQ^ 0-0 _0LS@ P0S 0000 8X00 0S P0S ?  0 ?w p-LMX`0SLP-@ޓ f1S0Pk00C0pQ^ Q^ 0-LbM`P0PP@0  cK T fK' 0S f0 $`\A5 0-LbMPP0 @ bK0 ˎfK 0S H0$`pA5 -LcM䀟0k_K`$0 @P faj-p~`s @0iK0cS0x 0͇1pXT0P ss $0S ,$ {g$`Q^ Q^a aA5 p-x0LM R 00p`B PRs0`S phJs000 0@@0 Cs= p-LMQ@@P Q pTP P0S \ R 0`S 粖\ `1PS 0-LbMP@0 @S0 4P0-L0S600`"R 0fK1 Y0 S t嗑0n0 0`20fH0@ 2c 1KP 1$`A55A5A5 000XQ^ 00C0XQ^ -LM  -LMPp^@`   0S & 0S ^ 0S K09 P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Pei 0 -LM0p$0 @R1 1DQ@T XcXCXT#00LßQD  吘 0S 00B0S S3  偘X 0f GYP` 2X  0S00S 0S  ` KyP ` ` P L 00S 8 GV fY0X0f840` p\PP` 00B0S Sf XPd P010  P 0S}?d0000dB0S0 S`\ X @ 0T4`090 /P@TX 0 ߗ  ؗ01 0CĠ UKV0K$`425F5G5@4@545E5E5E5E5$[1E50F5LF5hF58_1F5F5F5 -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  T` GP 0  0 00  `PP   > d 5  W R d 0SS00D 4 0 $G5@G5hG5G5G5G5 -00QLX0 Q S R H5 0-PpLP d@WTp@0hW -L` p$R |Q)0\ t44 0R*\ ,1,\P  \ `1d1d1d1d1@U S:U `: ^?La1a1a1b1b1b1 b1,b14b11 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S % P 0SZ0  0S   -LBM p0004p`PD@tK0 \CI H0@0X0 @T@0s 3@R{ CKA A Bf0FOs\ sms>FOs s00Ba15Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PxP @T*0P\?@T:@T*0\%@T:L0W 1S c LKvq@VTP LK0|  @TVQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a:v 00@W0@m004\剌000_4_J5 0-LM00P@K4U %V4 000l0V 00C0_ 0 a -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P40Uφ0 PJ5J5J5J5K5K5 0- LP@0 PP 0 P 0S 000CSPPP 00 -LMP`@孋 婋000 4 080P@XY\` 0X0 Y 0\0 ` 0S4@Pp X0S0S S0 X0Y R 00CS񟗧1؏1؏1Џ1؏1D10 Y0X0S S0BSꔏ11111#0TT 0S0@T<0S| =Qy X Rs R00c 4D0 P i4<@0 PX0SG 00p@ZPp @TZX 0S- 4S* 0S% St2Y T00BS 111181H0 i $P 1P X S4>H0 P P= G iΊ>0S4P 0 S00S=  X0S 0@Th 00S> 00S<  i顊PL c @ > < : 8S*0Y0 00S PS 004258K5p 0@T  T  0Q0? "pD 0@@P @ 0@0 T T0 0 0K @ PY0S 0S00S1111P0  B000PP:S 1S 0  B000T  ) @T  T 0 T 0yz `T0Q0M 0i 娄M5N50N5LN5tN5M5 -L`M`8@p08P^#K DD$K$K0@K PKK"`K!`K`K`!P@ P 6 待P@N5 -8LMȠ,Ƞ#83 3 -L4 0-LM0088P?0@N0K0K KKPKK0K@K@K@K0 -LM@460S 02 04 S0Y00Y0 -LM@0! 04JS00X0 0-LP"2 !<2"`0+"(0@08 p00CS00I Ag$1!0 W4 J` (0P 0 S00Sp" 0@T00St"00Sl"  `425PO5x11pO5xO5d3jO5O518111d1 11\1\1l5O5 -LMp@0So0Pg`S`PJ5@ DLI">40QL0 20CS2vJ` Vl5Q Q? -RLM`pP P$ ; 0 0ֱ PMJ@xPP 0 !!$ !0``1` `5JU! 2J@x$*J$ R 1 0+10 ,`(`T15 p-AMLAO0P `0H P 0 C400|\\  #OP202p0 ~`p'x1P5 -LM@? R#? R 5+Q P 5;5Q 0S010C1<P5 ;%5 J5 -? LRP0p₏5@@ H*~o @yTڴ5 H - m7P9 7P3 H ] V O~Bx2S 5O@05% +%GVd XdT0mdP mG(~ P5T15P5 p-LM@? ?dPP? 3'dPP = τ%dd @*nPP ̠x ` P6bpH 4}pA = ꈹ1t1P5P5Q5 0-? LR_? ( R $@T HC0@TA0 0-@LOP B000,  0 -P?pLP@`wIA00S ^.l00l01R5 -LM@?P`Q0p ,AV VVi#At00t0p dkwV hS5e;5 B `1Sp00p0R5P? RH -PLM@+ ? 0pR&_o" @;$#R Z] \!]X0"]i@,0 00 0S $#1S Z15 -LMp00P$K1 o< H2 @1T2K2[@@02KL`0 0Z0@^P  P h  @6b0S2020K2K``@ 0 +@'1 0-@L$3S& 5+#PU 0S0! 10C1P 00!5R!; Q5P!0<P5 ;%50 S- -LM0p5`@@ +@{7Pp 7P| /0Pc 1/0 4@!?  H2 R95  0 ?L? #PP p @9vi??L? PP p )Nd8  Py%_@ %5;5?:\ \0i\/0` PD `0 P, 0EPp,uS5)*4S5TS5115tS5 -<2LMQP@p`o2QY*2QI 2Q `%: = S$ =@S @ 8C8`t2/%t2  0 Km [ 0[40 cFt2 8 0 KV[ 0[ 40`@ e5050 R0 0>4P`5@`0?h0Q \0QP0P\Սڋ@0Q/ 0@`2i 1i i i  5i i 6i( p-L Mt0@0t0pP`:u>O0 K` 0S>pgS5 -@L00%P-%U?[dPRhP9lP `PpPP`PpP|P0$3?|r֣b9rУbP lJP0l2Sp tMp tP h4P0h2=p xt7p dtP dPdR(p ,t"p tS5S5S5T56@d$66$ R 1 0+10 ,`(`dP5 p-AMLAO0P `0ӛ P  0/"-C4? 0@ 8\X  P|20|2p @kYpD 2HV5 -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 ! -L M0p5P@` 4@~υ 0@/ 005  00 @ 7Pp w7P 42S %@ %5;5i}4 P  jP5P5 p-LM@? ? PP?  &nPP ̠4 L P(p jp X 2P5Q5 -P?LP@p`j/41T[1TE*1T5 1T ` 4%$ = S =@S @ 8C8`@2N%@2  ?  ]@2 ?  @ [505.0 R0v 0w34P`5@`0340T(0P\եڣ2i 1i i i i  -LMP0/@|To t00t0i30 K p @1S30Q5 -0 5P=5U@4LPP8P7<Pl`PpPdPX`PpPPPPrꞘXbdrꘘlbuP <P0<2 i i_P 8P082 xi diIP 4P4R ,xi riHQ5hQ5Q5Q5Q5Q5 0-LM @P0PP 0@  PP 0S 0D3 -LM`P6@02  "0 ZP'>'.0@ 22u P`i022 @Tp>2s$ 2s 22~OP$K0` R~ R? 1 P1 h1!0@5 1!0 X 0`S%O11  2 㿾P 0 S00S"  h0@T00S00S" $ :P ,T}(0!R@TuLPp 0 S ,(0!0"(1425D3hV5V5V5*)`O522$2rH5I5V5 -PL2Pp`00@S 5@ 1%00 2mr -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5  - !LMOPp `0ᇘ'>  P ||  f咿0Sd20d20K# p Q'$#2 -0 5P=5U@LP7 P8`PpP0PP`PpPHPHr꩖Pb 0r꣖8bP  P0 2& pg  \gjP PR $g  gQ5Q5Q5Q5 -P?`LP@pD01 1T51T&*0T 0T p 1 @ p>@ s50530 R0s004Pp0040T(0P\2i 1i i i i -? Rt00t0'g0Q5 -LM0`5P@ 07P: 7P4 ?? Pp y gi0?"> ڽPp h tpO0\  pAm%@ %5;5fP5Q5P5 !2P5 -RLM`pP P$ ; 0 0 Ph0@ _PP 0 !!$ !0``1` `P0U! M0@^$E0$ R 1 0+10 ,`(` (00C(0 ( R zO(0 Sl00l0h00h0( ` / 7Pl00l0 <P, m/ V5 !2W5 -LM@?PU`0p V/5V;U5 VV t00t0  eV >/ z(K 0( P(0St0p000t0p01S #/S `dP5 0-LP@ 04 P*0S 0P:00SQ Q?Aq- $0A0 0!q "S^ -LM 0S4 0 0WP 003 -LMP`p@Te He lP@$ #?@#0S#@"2/@3S0 KP@000400 4 2>ᖽ080@0<0 `Tk80se <0sb @0s_ }.,`K 0P@J- d ON tPO1tp!51 !01o !4018  <0 !1p/  0@'$ R "0/"/!, PuJ0 2*. ctd !.02md4#P  0S 0S 0@T0S@0S80S0S<dEdP4R5(W5>2DW5x<2344292;24@2@2A2>2x>2LW5hW5|W5W5 -@2LSPotPIJ0ℷ0⁷-2p0CS2G5@ '0,L!02-0  -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`K2P0CS2 -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pK2P0CS2 -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PK宽2P0CS2 -LMP`B哏Tj,p0/y 0 5 T  7PE 7P = w} u m H'H0S D0SP5P@@05%+%,I THP0H,b$< P5>25P5 p-LMBPT p+ >$ 64`0@  3Tph3'Q Q -LM┡2 S`( tp5 U  <5   (0S (J0K G)[ 0)KDRU@ P5<5  0 M0S +?0 00U@P5 $`W5 p-LM2`SP4"8 "4D0 P&4<H0 POD0|  `m噹20CS2pWw ,a`p p72P5Q5 -RLM`pP P$ ; 0 0 P+@0ZPP 0 !!$ !0``1` `s+U! p+@Z$h+$ R 1 0+10 ,`(`252/02  -LM@ 20CS2hü 0-PLM@P 2 SQ 0 @      K0 T [0[Ă p-PLM@`P 2SQ p @ FĠ0 K K`K]     0SH08 #\ 08S0 S W^ -LMPp`@ ] ] FPR!1 `/`$ KP ]$@偶0PT32S 2S $2STj'0@;@!\0<1 8!0>` 5X0p H!1PZd Y0XP0PG' 〳$JP 0 S00S " 0@T00S$"00S"  4m]425PO5xO5O5`N2J2XO2Q2nT5 -@L '`p`00PS 5@ 00& 1&nQ Q0m -RLM`pP P$ ; 0 0 P&@vUPP 0 !!$ !0``1` `&U! &@[U$&$ R 1 0+10 ,`(` τ$ @pioPP ˠ( ` P匳帲鞺 4&[闺 ꓺ M2G2P5P5Q5 p-0LM@PQ00 5@ R R00R``V p|20|2%0SU(ph޳cp"0 Z|bm$P5 -0`@LQPp+$0T 0T p |$505-h0T  R\  @ p@ "mi i i 0-P@P0L HR 0t00t0Z 1S 0hm0Q5 -0 5P=5U@(LPP,P70PT`PpPLP@`PpP8P鯲8rF@bꩲLr@TbP 0庱P002ù KZ꽹 EZP ,失P0,2ꭹ x5Z꧹ d/ZP (厱P(R꘹ , Z꒹ ZHQ5hQ5Q5Q5Q5Q5 -@LP`#!1pR001SP1 P 0 Q1  #Ј 10 1#7 -!L000p0 @`P#0S$ |#{# 0R000Sp0p00pi#h0|0h0 |000]#000000 0@@0 R#aaԊ` -LM 0S4 0 0年P 003 -LMP`qp@twY hsYy λP@@<#?@#0S #@K3/@3S4 KtP@400400 v4 2>080@0<0 `Tp80si <0sf @0sc "0`K .0P@K|! Y B tPD1tp!51 !01o !4018  <0 !1p$  0@B$ R "0 $"4$T! P>0 2"  X ~"02X4P  0S 0S 0@T}0S@0S80S0S<l X T425PO5tm2X5j23O5Pc2`h2`j2n2o2p2l2l2T5O5 X5,X5 -@2LSPotP>0ޫ0۫ "2p0CS2塶5@ L`$ !02"0 = -LMP`P p 2S Q?0@0$0K20020FGD$K#0K@K!KK"`K KpKv2@0CS2r 0-LMBPT 0K K 0PP[ -L MB T0K @K@KP [0[ -LM 0K\ K  P -L M@B$\ K0K K @wP 0-LMBL^B$L K0K PK@KK 0[PPP -PLBpT㓯eK!o @Tڜl | 5R r 5 C h 7P5 z7P- g> j H0S D0SP5P@@05%+% n= p5=l06= 4W@$  /P5.Tm25P5 p-LMBPT pLD <` 00@  ^'T phY'.'Q Q -LM2`Sp`t5 X  <5  o$  DRU@ P  B0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 [P&4<H0 TPO̠D0x  `20CS2p᪴ʵ (RV`õ p(f2P5Q5 -RLM`pP P$ ; 0 0h P@NPP 0 !!$ !0``1` `U! @iN$$ R 1 0+10 ,`(`00S,KA ->+0[l00l0h00h000 0C00 0 0p/ 27Pl00l0 <P  4 (f2DP5 -`L2PS@pj 1TM1T9*1T) 1T p 5 - R @R @ p, V$ @ g505y0 Rt` t]4Pp5@ tl0T `0TT0P\կڭD0T/0kp2i 1i i i 5i i 6i( p-L Mt0@0t0P`SO0 K`s 1Stp0Q5t -5@=P5LUP9DP9HP `PpPP`PpPP02߫rvb٫rpbMP HP0H0 p{S \uS7P DԪPDP޲ $fSز `SQ5Q5Q5Q5 0-L2_S2(0S0h$@T 0@T0 0-0L"RPO 5@00"000000,  0P2S0r -PLM@* 2tpS&_P`" k"R 49 \8X08i,0 00 0S "1S ETm252/02  -LM@ 20CS2h$ p-PLM@`P Q pV pU UPpU] U 0ll RP`P`0U  X}U Q_0UPlX53B7F p-PLM@P` 2SQ pUUphU] U 0h hlR`P`0U   nU Q_0UP 3lX5B7F -LM 0S4' 0 0jP 0083 -LMp` ጴPP@R  R!( K5PP  R(1!p!1 ἀ1!峀|1`Pt!t1PP筪0pU@(婪P> 0 S200S1+ $0@T!00P P P 0  rp0 㪧00S0 00Sp0   XQPO5425xO5$#(#.#,##d*h*|*4#8*P5P5X5}#2<#8#O5 -LŸ2 RP0p  0  0SXb0S&;(oQ @ኄK!@00CS0 0S A ` 00C! 0Pa0 S AP?AP#xAP d1  X 瓨P00꛰ #Qᔰ QީX {P00ꃰ Q| QƩP cP00k hPe TPE3ix*|#}#X5x#8*<*L#D#H#$#Q5Q5Q5Q5HQ5hQ5 -0LmMSp  !`B!@%=?ZDP U@@T,0 @ C: e550    "P00, LP0PPX583<*H*X50*4*D#'2 Y5 -LM?pH0 \`,0 H \(A0S Q00C!00 S1 @I ]0P p0pᴠᶐ,0@000j50@ *|@  ,p @卨 ED0P@@KoE#8*<*(*,*D#,2' -2LM 2Rp` l2R `2R ]PH2H"p 0 00@052@ BŸ   @?*,$ 0@? SO 1 R 1R" ʌ1R 1R T|1 @p1 p p 0 00 0 1R 41R0AS{2{2{2{2{2{2{2{2{2{2{2{2{2{2{2 0P 0S0S? 2K"K,pKsH0 ,pK2K"Kk# *$*D#,2'*D "( -L@M`83? Q@ (3\ 3Q d3QA  ] C0?pP% W@-00 00 Rh[42  *lŸ $` p 7l2P@ @    B8%-( O 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&3V?G K5KV8]PpPW 0"K0C "K St222~2222~2~2~220,`K2KT0000000S:T0,`K@KBK# D#',2$* Y5( 8 <" -t0tPL @`T0 0 q @ 240P 0(00C ` 0@ #8*<*H* p-QLMd@ P L0L 0 S `7`p0` \#H*<*8* p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S 7pp40P$0P#8*<*H*`*\* p-LM 0@0 0`eP Pt0.P ; >I092iy9 RI l 2X 2P&N--PN>U0@ 2 "52 0"2 0 ( 2  ,1!; !!,-3  X0@0!=H= 1 1!1, =oמ2$PO,P=@U0@dPO,P=U0@ڕPKN,P=U0@ڌ yP 0 S00S+0PU?00S+   oH425Y5Z5O52 22 ,Z5332d222Н22HQ' H 3`Z5 p-LMP0@-`,/ ݛ..;S P;S 6 Hp 弟 帟ꛠ0; 0-@P L\L{PP  G0S4 < 05H  Z5Z5 - <p@SL`Plg | -Lp`{ GP Z 0SS @L[@0S@!< 101,<$00,01<, <S. PL7@$,$0S 0,1 01;00,(,<<0,8 ,1 0X<`8G  z`x`{`Z5Z5[5<[5 -@ `PLPp<S}v|k -LM@,4P 5A0AS < 00)R+> -0PL@9QD2222Ĝ2S +P D 9lk(1 1aM-9l_9l[9yS #9SSiJP`  9P  vph%GvD 9S L9S9s f(5gfff\[5|[5 -@L/]Pp `h(-%- {kF -LMRP`0p RRV FV t00t0 ğ@ u `.A`, B,p00p0Pl5;5il[5 -L`KM|0R,0 4 0p RRP3 ,0S @,.R ˠ(C04  @4 }>K .0!#R00@1  S0C⠐81 - @>PP 2!$ ! ! U  @4>$ $ R 1 0+10 (,g>41 <S20 0 s004!0 0>0 LH  姛 ӚP<@0<1 ,0S ,+ r L@PP 9l FK!4 0 )l00!$   1,K:)01B KKQ CzH͗1 0KK $A 1 ,  *P7 @j$` ,2[5 -LM5p=@S`0P `IT$ <S0Sd9`9h90Ch9 $  P $ .P0P<05 5;59S@T 0S1010C1,R$<P$ KAP@ P$ P $Qt00t0< ] Y00!5R!; A5@! -LM0 5P<@SC\0P̂5 h(jBt00t0l4 -LMP@` l1T0p! CT1T2 L1T  4p4W 5A0AS p505 0S 5 @ @  N 44Pp9S"L00S@0T   4Pp H i i i ϖ1i -L Mp@Cd? (K 'T(K'K%@K#PK!`K&@K$pK"0K/PS A[5 p-L M@?0P$` K " K 0K0KK0KPKPK@KPKP[p1 Ap[5 -L Mp@Cd?(K 'T(K'K%@K#PK!`K&@K$pK"0KP A[5 -L M@p`&@0(K  'T(0K'K%K#PK&`K$pK"@K!@KʛP vA$\5 -L Mp@Cd@(K 'T(K'K%@K#PK!`K&@K$pK"0K媛PΠ VA$\5 -LPp`@Mp @TT $h h:AL\5, !0-"(LXP@MQ @TT G0 A0h\5 -LPp`@x4  @TT 46@A%C("(4$He a1l|h@\5 -L M0p@$3PPE 0 #0Q1##0S222 2Ը2,2424242424242424242422(#$3 1 #@ 9S 9S FoZ  FMNo"|2 1 v#)D pd"Z -H"fD2 1 `#@ "Y2 aC0I D@O JZ  -D!@1` : 6Z  , h!,l1 1 &#)D  $1  01[8#Y#h #͠##: 0P`/̄<\l02-  0. <0p -L`@u0@cTdTDP@p  @GTP >83\5 p-LM`POV@ V@@|0 L\R@ #T@  8, @ ph  0-L@PT T 00CS 0h -LMPc0@1 @T@T0>S @~cTdT  "bP9l0)~Ol.0 NQH p@ 0'~ @pm !0@tT`pڜ P N 1 > 0 㹔PP|1 >0 㯔P@yPD3P,. 0   : Q 5QN n    5;5%@ %9 S=   \= H@|=3"VS\5 ]52D8]5X]5x]5]5 0-@PP\5L=05U   t P;S ;S0h 壔[ 垔[ꀕ[D .0-0@L PNq $W0CQ  T 00HSAQ B00HS00h#5 -LM`? (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@KX o|2 p-RLP΁.M`  0 ph @@ ˅K6$ 0ph"f ]5b d 5 -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 'P $000S$ 0040$0$40D`(00(0 ;`22^5 sr-LP`p  0 $@T uv u 80U 0@Tv D0VW W])P : :8^5d^5^5 p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@(:^5 -QLM@8 0C?. B"0; ;^5^5 - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h93^5 p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 T }TppT0 p0h@T0 0 0 T00T0| `X08<#30$P 8T0@ \ 0 <$ 8P< 25$_5 0-P(0L0`T0@08T0$P0 4PL0 0hL p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@@ppp p-LMT0@![Y$80 P8} `$8P0 4P ` cVH0S T0  p8$;P8 T0hTY -LL  -PP 00LR`p @$<0 T ,00@h, \00Q0S p-LMP0`, P@ @@0[0Td0`[@P`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00T 0@ T d00<0H0 0\0HT  0d0T 0+ \0T H 0d0T 0+ \0H( 0H0& X0H0& X0H0# {X0~H0# rX0sH0"jiHPFQ- -LMT0@h\0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P  3 p-LM@P`/  |[8(0tH0 L8 P`0 T0d  $8P4 00 X0pphX 3H_53 0-(0PL@ F 0ES 22T2H2 H0"S 00 H0"Syp H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P D3 p-LM@P`  tF7(0lH0 L8 P`0T0 $8P4 00 X0pphED3H_583 0-(0PL@ 7 0ES 222X2 H0"S 00 H0"Sfp H0"S 8P0 $408$;P 80% }0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 000 0000000000000006 -LcP 3 p-LM@P`T  t6(0lH0 L8 P`0T0 $8P4 00 X0pph3H_5t3 0-(0PL@ 7 0ES 2 22p2 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT2H2H2H22H2H2H2H2H2H2H22H2H2H22H2H2H2(2000000000006006 -LM@E8$P 08 -LlP 3 p-LM@P`]  t5(0lH0 L8 P`0T0 $8P4 00 X0pph3H_53 0-(0PL@ 7 0ES 222L2 H0"S 0"&0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LP 3 p-LM@P`  t4(0lH0 L8 P`0T0 $8P4 00 X0pph3H_53 0-(0PL@ 7 0ES 222t2 H0"S 0X\0 H0"Sp H0"S 8P0 $408$;P 80% )0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4000  00000000006 -LP 3 p-LMP@`  3(0 H018L0P`0d 0T0 P2X!3SC L T0 @4H00-H00@ H&0!,H&0*H#0,H #0H  0phH+-0?> S$  4 T0 0T03H_53CP 0-@L8P0 $40P$8`0 88P0 $408$9P 8P$8P0 4 P }U8P0$ 40P$8; 88P0$ 408$Pp0 8 $80P8$8P 088$P 080 p-LM(0P`@ R9 1R pH0,S p5 8P0$48@P0$ 40`0d 0S`0L0` R H0"SH0 S 8P0 $408$;P 80% 0S`P2H2H2T2H2H22H2H2H2H22H2H2H2H2P2L0$8P =8$8P 08L 06S $8P0$8P <8$8P @0L 06S $8P :8$8P 0$8P !<8$8P <pL0rp -Pp@ 0`,@00L 8P0$4 P8P0$48 P0$ P48P0 $48P0 $48 P0@$48P0 $4P08$ 4,00,0 00300  ; S 00000T0 + 000 00000000 00006600T0      004+  R  R ; S00400; S004  00 0 -LMT >@$8P8$8P <8$8P <8$8P > -LM 0T@|P  @%#,00R0S ? `5Z p-LM@P`1(0H0 L8 P@00T0( `R ph1 $8P4 00 X0pph`53`5 0-(0L@P0  H0"S0ES22220%%)0p00/a5 -LM@8$P 1<8 0-LP@P  0?.C5BBTL 0 0 P, 0 P34la5 p-LM@P`0S  0( |H 0LP`8000T0 $8P4 00 X0pph03H_53pa5 -(0L@pPA H0 S?0BS22`220% ` V 80P$ 8 0$8P 8uy8$P0 4 g 5R>/a5 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  000 006 @006  000000$\ 0 P8$P0X 48$P0 4 la5 -LP  3 p-LM PL5 3S@`* L5 3S?  /(0H0 P`8 0L T0 $8P4 00 X0pph\,0L0? 0L0  3H_533 0-(0PL@ 7 0ES 22T2 2 H0"S 0rv0 H0"Sp H0"S 8P0 $408$;P 80% C0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 00000 00000000 006 -LM@8P0$ 408$0P 8 -LP <3 p-LM@P`  t.(0lH0 L8 P`0T0 $8P4 00 X0pph<3H_503 0-(0PL@ 7 0ES 222x2 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 5h0 -LeP `3 p-LM@P`V  t.(0lH0 L8 P`0T0 $8P4 00 X0pph`3H_5T3 0-(0PL@ 7 0ES 333h3 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 000 00000 00000000 006 -LM@t$8P 088$P 1<8 -LP 3 p-LM@P`  t-(0lH0 L8 P`0T0 $8P4 00 X0pph3H_53 0-(0PL@ 7 0ES (3H333 H0"S 0JN0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000@006 -LP 3 p-LM@P`  x,(0pH0 L8 P`00T0 $8P4 00 X0pph3H_53 0-(0PL@ 7 0ES <3\333 H0"S 00 H0"S p H0"S 8P0 $408$;P 80% #V0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4 00000000 006 p-LM 0`0@P4, 0?.AB",,(0H0 L8 PP00T0P0 $840  X X0 \0  ph$,ph,$8P04\b5b53b5 0-(0PL@ 7 0ES 3 3P 3 3 H0"S 00 H0"S:p H0"S 8P0 $408$;P 80% Q0 -LP 3 p-LM@P`r  + 0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pph3H_53 0-(0PL@ 7 0ES 3 3X 3 3 H0"S 0150 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000006 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LoP 3 p-LM@P``  x*(0pH0 L8 P`00T0 $8P4 00 X0pph3H_5t3 0-0BPL@ S 33343 H0"S 0&+ H0"Sp H0"S 8P0 $408$;P 80% -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000B 00000$8P0 4$ 8P0 $4P0@8$ 4@ 000  @006  0000000068$P0 4   006  -LP 3 p-LMP@`t  )(0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH'H' 03H_53 0-0BPL@ S 33383 H0"S 0&* H0"Sp H0"S 8P0 $408$;P 80% -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 000 00000 00000000 006 -LP 3 p-LMP`@  ((0H0 L8 P@0 T0d P0 $840  XP0 8$4 0X ; X @0X : X X0 \0  php$8P04\3H_53 0-(0PL@ 7 0ES L3l333 H0"S 0AE0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 000 000000S S000 00 000, 00600S00 000P08$4 00<000 - LN5 Ó0 ?0 0  P 00X5 p-LM`@P'0 R %( H 0L80PP0 0d T0( Rp ph' $8P4 00 X0pph'd5,[^d5@343`5 -1`LQPp@V(0Q 0GS T33 3<3 H0"S ?CH0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@p H0"S0%  &',[^7P3d5 -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 &P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000 00600 &,[^7 4e5e5`3d5O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb%in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811  R R 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- #bs_notimpl_bs_mmap: args at 0x%08x - #bs_notimpl_bs_r_1: args at 0x%08x - #bs_notimpl_bs_r_2: args at 0x%08x - #bs_notimpl_bs_r_4: args at 0x%08x - #bs_notimpl_bs_r_8: args at 0x%08x - }#bs_notimpl_bs_w_1: args at 0x%08x - p#bs_notimpl_bs_w_2: args at 0x%08x - c#bs_notimpl_bs_w_4: args at 0x%08x - V#bs_notimpl_bs_w_8: args at 0x%08x - I#bs_notimpl_bs_rm_1: args at 0x%08x - <#bs_notimpl_bs_rm_2: args at 0x%08x - /#bs_notimpl_bs_rm_4: args at 0x%08x - "#bs_notimpl_bs_rm_8: args at 0x%08x - #bs_notimpl_bs_wm_1: args at 0x%08x - #bs_notimpl_bs_wm_2: args at 0x%08x - "bs_notimpl_bs_wm_4: args at 0x%08x - "bs_notimpl_bs_wm_8: args at 0x%08x - "bs_notimpl_bs_rr_1: args at 0x%08x - "bs_notimpl_bs_rr_2: args at 0x%08x - "bs_notimpl_bs_rr_4: args at 0x%08x - "bs_notimpl_bs_rr_8: args at 0x%08x - "bs_notimpl_bs_wr_1: args at 0x%08x - "bs_notimpl_bs_wr_2: args at 0x%08x - "bs_notimpl_bs_wr_4: args at 0x%08x - "bs_notimpl_bs_wr_8: args at 0x%08x - y"bs_notimpl_bs_sm_1: args at 0x%08x - l"bs_notimpl_bs_sm_2: args at 0x%08x - _"bs_notimpl_bs_sm_4: args at 0x%08x - R"bs_notimpl_bs_sm_8: args at 0x%08x - E"bs_notimpl_bs_sr_1: args at 0x%08x - 8"bs_notimpl_bs_sr_2: args at 0x%08x - +"bs_notimpl_bs_sr_4: args at 0x%08x - "bs_notimpl_bs_sr_8: args at 0x%08x - "bs_notimpl_bs_c_1: args at 0x%08x - "bs_notimpl_bs_c_2: args at 0x%08x - !bs_notimpl_bs_c_4: args at 0x%08x - !bs_notimpl_bs_c_8: args at 0x%08x `[^2-@@Pr?0RW` -3-3-3-3` B`p Bp` B`RE0C`R9`h.3.3 .3,.38.3D.3P.3\.3` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR ` /30/3$/3/3` B`p Bp` B`p RpPP2-B@P00O0RW` /3/3/3/3` B`p Bp` B`RE0C`R9``03 0303$03003<03H03T03` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `13(131313` B`p Bp` B`p RpP2-D@P?O0RL` 13131313` B`p Bp` B`R:08`R/`L2313232323(23423@23` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `23232323` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480`[^0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@pW`Fe54 e54-0 R 0Q cP 0 S Q!0-P@P !20R0-P@ 0bR03 B0 -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8 -LMK0KR @0S R -LM -LDM@PKP@ 4\T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@V8#C0HL8#90HB8#/0H8\ h "  P T P0K[^p@-^`@ Pb 0 2%$^ 040p@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   3` `! R0-P@ 0bR03 B00[^``0 B`3`1`1c11c!0"b2c3c0acP@[^_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q33334,4D4\4t44 4 4 4 4 44444444444448484848444 4!L4"L4#L4$L4%d4&d4'd40w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-( T @( T @  88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx !""`"""H""P"D "!#h "Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2006 OpenBSD. All rights reserved. http://www.OpenBSD.org  $"4@4%4"4"4"4"4@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UD&R& R&R&#S&XT&#U&dU& &#U&d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@))p))))()))L)|))) *)В*))l****x*x**)vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ8-D-#$44(4444484'4 t34t34 <4t34@4D4 L4P4X4`4h4`4p4`4x4`4p 44p 044p `44p p44P 44P 44P @44P P44 44Ȭ444̬4Ȭ4̬44444Ԭ44ܬ444444  4$54$544@4444  44  44/44o4 40/844p $44 p4,4 44,4 @84,4 `<4,4 04,4 @4,4 D4,4 H4,4 L4P4 0T4P4 @X4P4 `\4P4 `4,4 d4h4 l4,4 p4h4t4x44x4 4x404x4@4x4P4x4`4x4p4x44x44x44x44x44x44x444ĭ44 ȭ440̭44@Э44P44`ԭ44pح44ܭ44444444444444 44 444 444  440$44@(44P,440444<444@444H444P4X4\4X4`4X4h4X4l4t4x4t4|44 4444 44eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0- -#̲4Բ4ܲ444444 444$4,444<4D4̲4L4T4\4d4444 444$4,444<4D4̲4l4t444444|444,444<4D44Բ4ܲ44444̳4س444$4,444<4D444ܲ44,4@4X4l4 444$4,444<4D444444444 444$4,444<4D444ܲ444444 444$4,444<4D44Բ4ܲ444444 444$4,444<4D444444444 444$4,444<4D4̲4Բ4ܲ444444 444$4,444<4D444444444 444$4,444<4D44Բ4ܲ444444 444$4,444<4D4VA\43PVAp43VA|43VA43VAȴ43 VAд43pAش43qA43qA43qA43qA43qA43rA 43tA43tA,43AD43AL43 AT43A\43`A d43`A p43`A p43PT|43A 43 A 43D 4ȍ3D 43i 4H3 i 43 i 4Ȏ3 $i ȵ430$i ص43 ,i ȵ430,i ص43 .i 4H30.i 4H3!i 43 !i 43)i 43 )i 43-i 43Ai 43 -i 43Ai 4H3Ai 04H3Ai @4H3P4\4X4d4l4|4x4444444444Ķ4̶4Զ44444 4444,4<4L4\4l4|44444̷4ܷ4-ع4-4-4-4-(4H4-`44-44-к44-4(4-@4`4@````` ```44444D4\4t4444 4404D4`444444404D4\4444,4X4444 4 H4 4 44<4t44444,4T44 4 4 4 4 4 4 $4 ,4 X4 x4 4 4 4 4 (4 T4 l4 4 4 4 4 4 <4 h4 4 4 4 4 $4D4`4|4444444@4\4t44 4 4 4 4 44P4|44444 4D4l4444444D4`4|4444444\44444,4\4444 4H4x4444484\444444444\4T4t4444 4  4 84 \4 4 4 4 4 4 @4 h4 4!4!4!4"4$<4$T4$4$4$l4$4$4$4%4&4&4&,4&D4&h4&4&4&4&4& 4& <4& X4& t4& 4&4'(4'4'4'84'T4'p4'4(4(4)4)04)D4)\4)4)4)4)4*4*4*4*,4*D4*\4*t4*4+4,4,4,04,\4,4,4,4,4,4, 4, <4-l4.4/40404040H40h4040404040 (40 P40l4141424243444545845X45x454647484848448L49l4:4:4:4:4:4;<4;\4;4;4;4;4;4;4;<4; P4; h4; 4; 4; 4;4;4;4;<4;T4;p4;4;4=4>4>4>44>L4>l4?4?4?4?4?4?44?P4?x4?4? 4? 4? 4? 4? 4?$4?D4?\4?l4@4A4B4C4D 4E$4F@4GX4Gl4G4G4G4G4G44Hd4I4J4K4K4K4K4K 4K04KD4L`4N4P4P4P4Q4Q 4R@4SP4Sl4S4T4U4U4U4U4U,4UP4Ux4W4X4Y4Z4Z4Z84ZX4[x4[4[4[4\4\4\4]4]D4]p4]4]4]4]H4]|4]4]4]4]P4]4]4]4]4]H4] 4]!4]"4]#,4]$d4]%4]&4]'4](<4])p4]*4]+4], 4]0H4]14]24]34]404]5h4]64]74]85]9D5]:|5];5]<5]@(5]A\5]B5]C5]D5]E,5]F\5]G5]H5]I5]J5]KH5]Lt5]P5]Q5]R5]SL5]T5]U5]V5]W5]XH5]Yx5]Z5][5]\ 5]`D5]a|5]b5]c5]d5]eP5]f5]g5]h5]i5]jP5]k5]l5]5^ 5^8 5^\ 5^ 5^ 5^A 5^B 5^C 5^E, 5^GH 5`p 5a 5a 5a 5b 5c 5c 5d0 5dL 5e` 5fp 5f 5f 5f 5g 5g, 5g\ 5gt 5g 5g 5g 5g 5g 5g 4 5g T 5h| 5i 5i 5i 5j 5k5k$5k@5l\5mx5n5o5o5o05ol5o5o5q 5r85rP5rx5r5r5r5s(5s<5s`5s5s5s5s5H5P5`5h5t5@455@455(5,585@4@5L5@4T5X5@4@5`5@4@5l5@4@4t5@4|55@455@455@455555@4T55@455 55505585L55T5h5p5@455@455@455@455@455@455@455@45 5@4H5P5@45`5@45p5@455@455@455@45 @4@4@4@4@4@45@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4&5$&5z0&58&5 @&5H&5T&5\&5d&5l&5d&5t&5|&5&5&5@&5&5@&5&5T&5&5&5@3T)5.5%5%5%5l&5T)5&5HT&5T)5'5'5Y4('5T&50'5k4?5`T&5@'5L'5T)5Z4T&5T)5Z4P'5HT`'5T)5GCl'5p'5&5|'5T&5'5 '5'5T&5'5HT'5'5'5@'5T)5Z4P'5 '5'5`CGCZ)IeI'5(54(5ZIZIIIIII0I0PI0d&5<(5I0Ed&5D(5]I0Ed&5D(5PI  IP(5X(5d&5<(5@"`(5l(5&5-/t(5(5t(5(5t(5(5t(5(5t(5(5(5(5t(5)5 ")A )5$)5u E@)5H)5`)55@&o@o @o @  @& 3BI0E@I0EHTI0Ed&5D(5@I0Ed&5D(5I0Ed&5D(5 I@(#0Vwt(5,5t(5,5-5 -5(5$-50-5(5<-5H-5T-5d-5Pttt3V )5t-5d-5V-5T-5d-58V-5-5-5V-5-5-5-5d-5V-5.5-5s.5(.50-5D.5oo PMP.5d.5k&h= = s qPs&! qh.5.5l C.5.5 .5/5a(]//L/(//\/C(.} 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] 3 ["$&'X4gklrdK23<h//0/   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt100U0pV0h080W0X0  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?T0181D11B5B5B5B5B5B5B5C5C5C5$C54C5@C5LC5TC5dC5lC5xC5C5C5XBBp@m@m@m@ f(  pt""(4I@@@@1` #U4QFb '               >@<U1V1^1]1t h1h1n1m1s1s1t1t1      111؅1|1~141܁11abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ  3R3 3]3~3I3D3J3RH373 T3 3 3 3K3$3@#.3$3$3$3 $3$3H@$3 NZ3 _3t33\n3 &3 >3 &3ET3 3m3K3A3[3303 B3R3j`343?T3p11d1D1ܕ1P1x101ܜ1$1(  v      W 1 Q `  \1@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   x1  L+ L ܣ1L2 D   O  {81o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 8б1,111 B  w W  1b0{&"=F@n a-<1$1111<11x1@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 02X2L222V{%1" `s%tL22$2$2$%2l%2L)2P/2A2B2|D2E2$S2S2W2]2@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-MNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$L 2p2282!A  !@@@@2X224_5\2h2d2d_5x_5_5t2242Q`_5P2\2d2_52_53_5x22d2`55`5@2`22 $`5 $`5 $`5 @`5CP\`5CP|`5CP$`5CP`5CP$`5CP$`5CP!$`5CP"$`5CP @`5<22222d2 Da5ÐXa522D222D2a5a5|22d2a5l3x3x3}b5}b5}(b533d2Db5\b5tb533d29b5 32d2 3 3@3c5?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD4.0RAMDISK#78 @(#)OpenBSD 4.0 (RAMDISK) #78: Sun Sep 17 21:26:05 MDT 2006 OpenBSD 4.0 (RAMDISK) #78: Sun Sep 17 21:26:05 MDT 2006 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterdrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) ne2000_attach: setup failed : where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comcomprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocregistersuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,physbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKTHREADIGNEXITRVSOFTDEPPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensorssensors kthreadsigaplpauseissignal coredump%s.corehashinit: bad cntsysctlsysctl_disklockkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleNameSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DIRTY DONE EINTR ERROR GATHEREDINVALLOCKEDNOCACHEPAGETPGINPHYSRAWREADTAPEUAREAWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%x blkno 0x%x dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%zx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSLFSLOFSFDESCPORTALKERNFSPROCFSAFSISOFSADOSFSEXT2FSNCPFSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroute%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_crypt%s: %sassociation failed (reason %d) for %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) %s: received %s from %s rssi %d %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u null node%s: no node for dst %s, discard raw tx frame %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: station %s power save queue overflow of size %d drops %d %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUN0x"NODS %s->%s(%s) type#%d %dM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %uMbshortlong protection enabledAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdkdodzegf2fifrgrgthkhnhrhuidiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamcmkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5Finalmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1pl%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook %s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasd%s: WARNING: unable to establish shutdown hook drive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec total%s: not queued, error %d SCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclock: hz=%d stathz=%d clockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt %s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: couldn't establish interrupt %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info port 0x%lx/%lu: %scan't allocate memory for command queue ,0x%lx/%lu: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedlcdzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s %s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statezssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedraiduse one of: %s[a-p]parsediskrootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d rasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadconfigusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: no report descriptor %s: no memory %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out %s: no union descriptor %s: too many errors, disabling %s: usb error on rx: %s udav, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1000* Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1000S Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s  ad'(p@@ @ @ l043333:433XD53333333 E533333 3,3  $,*&% #! $4]H]<55]$]H5D5t]]<5X5]]|5,5]]|5,5(]<]H5D5D]X]T5H5p]]T5H5]]t5H5]55H5]55H5]5d5H5]]T5H5]<5T5H5]]|505 ]5|545]]|545]d5|545,]@]T5H5d]x]T5H5]]T5H5]]T5H5]]T5H5 ] ]T5H54]]T5H5\]p]T5H5]]|585\^H^5<5p^\^5&5^^5L530Q^<5T5 x3tQ^<5P5 Q^tQ^<5 5!3R^<5 5!3R^5@5/3S^5@5/3$S^<5 5!3LS^<5 5!3`S^<5 5!3S^<5 5!03S^<5 5!3S^<5 5!3W^<5 5!3W^<5 5!3W^<5 5!$3d5<5 5!3HX^<5 5!\X^pX^551X^X^551X^X^551X^X^551X^Y^551$Y^8Y^551LY^`Y^551tY^Y^551Y^Y^551Y^Y^551Y^Z^551Z^(Z^551!l   h L @3J M Q |W U V @ s  ] , G 7nx25THIS is A memory TEST patternL 4%K H4     "!!! ! ! ! !'!'!2!2!X4!!2!2!3!T3!X4!!h3!3! 4!4!X4!!6!7! 8!(8!D4!!\4!4!6!6!D4!!l:!(=!P=!x>!X4!$>! @ @   ).5hA! x_@4p"H4W#|.4#P45T4lM!940Q!\4R!d4hQ!u4LQ!D4tQ!l4Q!w4Q!t4Q!|4R!4$R!4l|!4DR!4Q!4X!HY5T!4T!$4T!4T!4U!4,U!4F4T_!4[!$5[!4La! v4!Xj4!G4!4M!4M!4(5 2)ԋ((((l>)5) 2)ԋ((((5|'ԋ(((('@'t'5p(ԋ((((`(4a455' dXľ5Ⱦ5о5ؾ5̾5}E#(D<8Q @X,55555555ȿ5`55d5h5l5p5t5x55|555552(@AAA==(A* dd%(i @@@@@@@@@55ha|hal5h555 5$5(55$5553333))P_)})؎)@)541%5,)45*`5l*5<*5*5`*5h*<5d *h5)5)5#5L*5T*D5t;*p5/%5D)̯5h*5p*45*`58"*5X&*5t(*5)*5H/*@50%l5T)5)ı5/*5 0*5<)580*H5h1*ܬ5(0*t586*56*̲54_)5|0%jax55%51*5`*5h*<5d *h5p1*51*5D)l5T)5)ı5/*5 0*H5h1*ܬ5(0*ja55%5\4*5`*5h*<5d *h53*54*5D)l5T)5)ı5/*5 0*H5h1*ܬ5(0*5|0%ja85 ... ...;*,<*;*<*;*<*d55l5541%5h*45*`5؝*5l*5*5*5*<5*h5{*5~*5#5L*5T*D50%5*̯5*5t*45*`5*5*5$*5c*5 *@50%l5TU*5*ı5/*5 0*5P*580*H5h1*ܬ5(0*t586*5*5|0%la<55%51*5*5*<5*h5p1*51*5*l5TU*5*ı5/*5 0*H5h1*ܬ5(0*lal55%5\4*5*5*<5*h53*54*5*l5TU*5|*ı5/*5 0*H5h1*ܬ5(0*5|0%la58*T*,**P*D*(*8*x*d* \t5505+`+p++8++X+,+X+(WEVrdroot2.5M@WEV  08HE/<  1E=v@`  /mnt`!\(^(@@<@`bT 081E/<  1E=v@`d]@@<@`bTU FE`  PT`FE((((((((((((1G4p|A 4EFEP6FEP6nlA4E`8Ex:8Ex:(FA 4EO:Ex3:Ex3=4A4EO:E &*:E &*YSA4EO4EO4EOCA4EO4EO4EO`uA4E`E4E`E4E`E@ɧA4E`E4E`E4E`ExɆmA4E`EFExFExMupC4E`E4E`E4E`EfA4E`E4Eۀ4Ev6EA4Eۀ8Ex 8Ex A4Eۀ4Eۀ4Eۀ+.A4Eۀ8Et 8Et ˧&A4Eۀ4Ev4Ev>wA4E:Eh+:Eh+s,A4EE4EE4EvIA4E4E4EEC4Ex@4Ex@4Ex@9_'FA4E4E4EA4E4E4Eq2A4E4E4Eȯ-=`5EP-7E`R7FEP6X`hpxH Rͮn:E8EX18EX1 *!9EHӾ*9EHӾ*9EHӾ*>,!9EHӾ*9EHӾ*9EHӾ*F!9EHӾ*9EHӾ*:EX' nS!9EHӾ*9EHӾ*:E) !9EHӾ*9EHӾ*9EHӾ*tV!9EHӾ*9EHӾ*9EHӾ* !9E`)!-9E`)!-9E`)!-V_!9E`)!-9E`)!-9E`)!-iai!9E`)!-9E`)!-9E`)!-!9E`)!-9E`)!-:EV eF!9E`)!-9E`)!-:EX F!9E`)!-9E`)!-9E`)!-p!9E`)!-9E`)!-9E`)!-Hza9E`)!-9E`)!-:Ep`"!9E`)!-9E`)!-:Ep>La9E`)!-9E`)!-:EpY!9E`)!-9E`)!-:Ep:8a9E`)!-9E`)!-:EpkR!9E࿹-9E࿹-:EpQǯa9E࿹-9E࿹-:Ep!9E࿹-9E࿹-:EpdZfa9E࿹-9E࿹-:Ep4k!9E࿹-9E࿹-:Epda9E࿹-9E࿹-:Ep"W!9E࿹-9E࿹-:Ep'da9E࿹-9E࿹-:EpgWo!9E࿹-9E࿹-:Ep a9E࿹-9E࿹-:Ep؍!9E࿹-9E࿹-:Ep+)a9E࿹-9E࿹-:Epc!9E`VR.9E`VR.:Ep4a9E`VR.9E`VR.:Ep E !9E`VR.9E`VR.:Ep @<a9E`VR.9E`VR.:Ep 2 !9E`VR.9E`VR.:Ep TLWa9E`VR.9E`VR.:Ep A!9E`VR.9E`VR.:Ep 2ŏa9E`VR.9E`VR.:Ep j7!9E`VR.9E`VR.:Ep a9E`VR.9E`VR.:Ep 0 !9E`VR.9E`VR.:Ep 0;a9E`VR.9E`VR.:Ep~!9E.9E.:Epea9E.9E.:EpmȚ!9E.9E.:Ep r;a9E.9E.:Ep隘]!9E.9E.:EpXQa9E.9E.:Epe!9E.9E.:Ep]a9E.9E.:Ep&!9E.9E.:Epխa9E.9E.:EpT!9E.9E.:Ep}a9E.9E.:Ep(s!9E`/9E`/:EpIEa9E`/9E`/:Ep!9E`/9E`/:Epkwa9E`/9E`/:Ep p!9E`/9E`/:Epa9E`/9E`/:EpIB!9E`/9E`/:EpYia9E`/9E`/:Ep;!9E`/9E`/:Epu3a9E`/9E`/:Ep"f!9E`/9E`/:Ep#} a9E`/9E`/:Epm]6!9E09E0:EpL*a9E09E0:EpQPs!9E09E0:Ep ca9E09E0:Ep!9E09E0:Ep6qa9E09E0:Ep*}!9E09E0:EpfQa9E09E0:Ep" !9E09E0:EpUa9E09E0:Ep !9E09E0:Ep):a9E09E0:Epsp!9E`09E`0:Epa9E`09E`0:Epˬ!9E`09E`0:Epa9E`09E`0:E`1!9E`09E`0:E`[M?&a9E`09E`0:E`b!9E`09E`0:E`Ua9E`09E`0:E`!9E`09E`0:E`:=a9E`09E`0:E`'1!9E`09E`0:E`"oa9E`09E`0:E`#L!9EFM19EFM1:E`4 a9EFM19EFM1:E`R!9EFM19EFM1:E`ra9EFM19EFM1:E`}c!9EFM19EFM1:E`a9EFM19EFM1:E` 騫!9EFM19EFM1:E` VTa9EFM19EFM1:E` >!9EFM19EFM1:E` &a9EFM19EFM1:E` ľ!9EFM19EFM1:E` a9EFM19EFM1:E` I 2!9Ex19Ex1:E` a9Ex19Ex1:E` 3!9Ex19Ex1:E` /a9Ex19Ex1:E`!9Ex19Ex1:E`/!a9Ex19Ex1:E`!9Eo~29Eo~2:E`T+!9Eo~29Eo~2:EX SBu!9Eo~29Eo~2:EpC 4QkBua9Eo~29Eo~2:E`b!9Eo~29Eo~2:E`.@a9Eo~29Eo~2:E`R!9Eo~29Eo~2:E`5I!9Eo~29Eo~29Eo~2?9#^!9Eo~29Eo~29Eo~2?8a9Eo~29Eo~2:E`[R !9Eo~29Eo~2:E`a9Eo~29Eo~2:E`*E!9Ex39Ex3:E` a9Ex39Ex3:E`~!9Ex39Ex3:E`?a9Ex39Ex3:E`J!9Ex39Ex3:E`W!9Ex39Ex39Ex3<O49.!9E39E39E3(`S!9Ex3H49Ex3H49Ex3H4( !9Ex3H49Ex3H49Ex3H4(9!9Ex3H49Ex3H49Ex3H4(f!9Ex3H49Ex3H49Ex3H4(]]!9Ex3H49Ex3H49Ex3H4=pF!9E49E49E4"_!9E49E49E4"I;:EzD:E* :E* :E8:E8D5!:E8D5!X ` h p x P~aG):E8qf":EP#:EP#C:EP$:EP$:EP$0:EP%:EP%:EP%/tmp/disktab.shadowtQ:EP!+':EP!+':EP!+'/tmp/fstab.shadowur>D:E(:E(:E(/tmp/resolv.conf.shadowӺ< :E &*:E &*:E &*/tmp/hostsP+z :Eh+EE$*EE$*]}AFExFE0 FEE4JFEFE(:FE(:KZFE&FEFEqazFE08FE!FEE4YFE:_%FE(FEE4  @{rFE+FE3FE3 :-czidbwD? =CA^P6u1s"*~q=MgHv⩺uvEoc YUʒTUHƘ};4Cog.aMcL_TaѪD+zuAYd2lB- U`?F$Tp} E鳜p Y.NNlcSuh:4z n`xJZFH6pwΣh#=Ѯ#vezi3@Y/AfE՛pn-"*^t9*[L-E8 ,uJ;"q8oE( AKr@5;ġX-NJ)-1W}ϭ9K9-#UzFQ݃ϗ]MN5ՎُypnM`՘:m8,ENhox؇3*ʒsq5T~p1i5>sxb&ڑEӽ1o,YL(CtM@s]2fchJWqw1Pmxk#P;8h·rG Nj~zlH0)hKMĬKطQ|w^RKJDJ$!H+? p !Ȉ *XWKϲ]|I#kre[u|O޳Drwd0lr?wd0mr@rwd0mrAwd0nrBrwd0nrCwd0orDrwd0orEwd0prFrwd0prGwd1arHrwd1arIwd1brJrwd1brKwd1crLrwd1crMwd1drNrwd1drOwd1erPrwd1erQwd1frRrwd1frSwd1grTrwd1grUwd1hrVrwd1hrWwd1irXrwd1irYwd1jrZrwd1jr[wd1kr\rwd1kr]wd1lr^rwd1lr_wd1mr`rwd1mrawd1nrbrwd1nrcwd1ordrwd1orewd1prfrwd1prgsd0arhrsd0arisd0brjrsd0brksd0crlrsd0crmsd0drnrsd0drosd0erprsd0erqsd0frrrsd0frssd0grtrsd0grusd0hrvrsd0hrwsd0irxrsd0irysd0jrzrsd0jr{sd0kr|rsd0kr}sd0lr~rsd0lrsd0mrɀrsd0mrɁsd0nrɂrsd0nrɃsd0orɄrsd0orɅsd0prɆrsd0prɇtty00rɈcua00rɉrd0arɊrrd0arɋrd0crɌrrd0crɍwsmousewskbdrɏ st0rst0rɑnst0rɒnrst0rɓest0rɔerst0rɕenst0rɖenrst0ɗttyC0rrandoməsrandomurandomprandomarandomwskbd0ɞ apmapmctl . ..chownpdhclient7 disklabel7dmesgpfdiskpfsck]p fsck_ext2fsfsck_ffs7ifconfig7init]pmknodpmountp mount_cd9660* mount_ext2fs* mount_ffs7 mount_msdos mount_nfs7newfsp newfs_msdosping]pping6preboothalt]prouteprtsolp$umountdhclient-script dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos ARCH=zaurus md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf echo $val " # see ztsscale(8)" >> /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P ELFa(t44 (  hfhfxxxxx$$t 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00`` 0S SX 00-SL@  @1S@DQ@Dt @Dt0x -LM$@0S0Sx -< L04S0 00 h.t r 0S00 -LM`pQ 0S5/p@PPPQ xP Q088 8Q  Ds\s p-PLM@@P` ph 0-@L PP \X  0OSP8  (00SPXds\sT -鸢帒<LMP000圂S0: pP=xw @T` 8KX0  \ , (Ÿ8 $ RŸ8  0 8 =0000S0A  10S000 B #X 1p0S0 Sl+ h10S X1X!0T!0SH!@1  !8 700011000S `R PpU`=0pD @0S 0S  0<7 @0S 0Sl B=%Tu,vHv\v vv<T@vv w(wX -LZ 00 -LO0< -LG P008 -L<0L -0L0000 -0L000 -Lp0  -Lh0 -L<Pw 0-LMK PWp@81 0W  R@ 0b0CS$,,,,,,,,,,,,,,,,,,0D0E0J0AS00 0xS S *S 0S "s, 0 $s<0 n<0̚hw p-LM KP qr1 V PY 0b0CS5t`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "0 0 (;0 ;p̚hw 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0D0 R0  - L ;̚ - L ;̚ - L ;̚ - L ;̚ -LMdd"\a"T ,P00s D@00Cs0 00Cs0c(X8L -8rLP,20  $P ,10S0q QP1000 A0! 1$P0 1!$0P00 tULQPa` \10S 0@P4 $A0P 0P 0PhU0  Rp: P 0 0; S0`@%,"a@0h0Q X:Ph-f4Lww̚w<wwh 0-LM@KCP tU0: S\, KP P0000 0A,pq0S0000̚m@ 0-L1 R 1 0Su*Q  1Q   1A P 0!0  tT lu0 0+8h0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 ?0 0 00(008H̚@ -0LM 0RE0RQ0R_ x00 l@ R R*T bQ R100,00S h@T -`1LMP``p@Q UP@  . 0S@ !T0/T0V000 0T0 0 0 0S00/T 0pd  t9P@0 fR `!* 00 0Rb/0 00w̚Hx(x -pLuM0d yK,0 d 1b1 P a!  B=9! = 1 . 7P@0 r/ p`GPno JP PoOK 0!dPPm0A A R  x1 RtVOKd0`!Z0A .  R ,1,R@Kd0!G0w?KAv?K!00/C#b10  0 됀K p`0d wKP"0뉁 @v?K \%00 ,0SD,-.A?hHxpxxxxxMbxx -LM@N뿁@ -LG[  - L0 P `0@%,"0D*p6q . 2`p0-  0P 0 pWp@0P`l 0S0C0T8P00  Z 8傅 R0Lx̚ -L Mȡ00 `@%,"0)pbq`C 2[ 8c8d0 K00 , EPQ4 `0pSI 0SF ̣PQ4"`0 K03K,` (p  @0 pR' 0S$ :T0`PP  lrR@0 pR<0 0S@0p R 0Sm̚ -GMLM2 `@P d "cp?@E 0P8갞````F-K0 B BJ0 @bTQ7A~K pGpG@ P 4 04 04 =K 0C 0CD $ $d S<Pn0-S Du7 8Q0$(Qzzb yX zz,@@@$00 |t||8|D|T|l|t| -1L4M`, P!10 00 @,0P 1PTBp< AH0`JZ/ 0@K 0@`T9 T7 ( (T) T' ((T T (( 0@K,0<T00 Zj '0 ' ' 0 P@ 0 ? $0PKY@t|||8|| -`L@PP pJ0S p8Pp!̚ -LM`@P0p$ ᜞P@ {0S T 0 $${ } -0L } -qLMʠ`0 P6 \P0d .40( 8%P<(@dl @ed, 0C0  $H0QZ T( Z (D  tTCX} -HL M, 0 [PnP #1RL0S @D@030(&Pp g@&B`@&v#,Pc P 00 0b0  0 0$ D0QZ TR(,Z N(D btSC\} -AMLX6 M L6L@P p`84 , 0&T]ps ?0@8Szꬶĵ D\d 5` YPp0S JP44 R@ 8$ 9P41Ppl4 < @bTQ {T YY [P`) P PP 0SP*0 P9P<40<4 P<$0R0X0S f<P |TTPP B.K B B8P@ 4PB{pEz0S KBK@@+P XP@0DP@Tj_0T@2 R 808P0"8$ 84P084 1 RcBKHH~P] {P5 0P0 , 0  &P 㺼P`| 04D000$ 04~ 04T 0 00TP` 0P` P P P wP`|0 pKX}bT~d~w|yyXl~p~x~\4~~~~~~0p~{L` P [ P<Q P  ,< = =XLP d x=,L P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`Fa2P@ $`CY0S 4: S < CMKHHș@ ( Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l( X00R00S7 P 0@ P 10135:3P 5 X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A Д0AP,  6X@JP dV000TU 3 5#:,P( 0V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   |$X T \% P ؔ PY0 <U U%1 ATE Uc ccbXe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx' <%!q0`J  0 c 5 SP L S3 p0# U Ugg Ug gg X 0H,଄  <Ja ` 04 %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 A4R 00UV `P`s4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,?b&''0@X_L\px0|`aX̚؆d0Pṫ(HlCp LhLTX\dhltxgfffL|Є$@lNK@QNK4@@4  OP  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$Αp ܤ P%0W^  Pd \0#03\030"S3  `QP,<"(PK0d1P ^ U * X  PQ ܤ Bp 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5& !0S66TQ$0 N0o00  e T ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$]$ 0#> 40Q>V>d8U U Uʠ 5u$ V:%V#>U8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 ,PBNK@D@D*59 P  p$ e ,Pa4: S ܤEnK`F `F @P0 F  %#`\d4S: 8j\d4S0 T([44 嬄 D D ~gF -LM@(K7P`5  ]Ppp0W0* R00S 0rS`Fv (P@ DP@Z`F (00T P P (0vj?(0 =(0 T0z#Ĉ~̈ -PL`p@PDP @T:T @2 S#, -LPgM/, `qPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  #00Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,0 {$, u (l oX YeP@ <4o0pedA A@pa0Ldt -LMpnQ5Q/nQ& n,Q0S h>4 0nn`8|@|PPnhn<Q@nLnDn<n4nꬉȉԉ  (0 Q-0L $ Q*  +"8L -LM`@pk $K<P k0S0S 0  "$0 UR#U\ p-LM`PU@ T<PP UTUpTh- 0\ \8 0000ӑS^ 0 ^0p Br0 BS 0r0 -ALM3 0{ 0v8 0q 0l 0g 0tb 0d] 0TX 0DS 04N 0$I 0D 0? 0: 05 00 0+ 0& 0! 0 0 0t0l W|Ȋ$DThxȋ0H`t^ -LM00`Kq@ 00 pPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@l; f; P0 0( dP 0LP;< 0pPPԌ̔$, P-L   Pl 0-LMt@ 0PdlQ uj@]j 80hl0(0 l 0SԌȕ -LM0:(0 P0( 0S(0 0 (K  lPP) 0S& =oP`u 00,pK N0cSb iSI lS> oS& A0S 0S 0S(0SiP0AS, [0 0S0 NSP,00 0oSIP N,0(0=P,0 0 04P,00 0iS*P0 TbN,0$0XP,00 00.(0pЕԌԕܕ -LM `P0p-S000P(K 0(P P@  0S 0 Q (,:{':v , D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 50 0`t -LM@i0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@h0 0 -LM0@S  h: 0 << 0 -LM@f00$08  0 0(0-K 00 $ 0g@+$kꘖ -Lhhjr -LM K00"P 9t - LP8nt  - LP8ot  -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p `h -LMx \, P`p 0LSE,4<D0 Mjg@gT 1  AjW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ U0K0 X"J XK 0SXT1 ,0S ,XKeKeeKea0S @K00!d 0Sqi S  SetplhrI 8 Hh<h0  h$ 8șDTd04@`L(8H`ȗؗTpК\ \tܖԌd(ltĖЖ̖Ưؙ̑ܛ 0-0P@0LS 0@0700 0-|PL0@S d0dg0Y0 0HS@g4g$g0000̚ -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 B\4 -LTM\ X3XSp`| , xp p <R|0d |0@0T #|Fpa@ P,4Tp0| `Kx| Pxt KPJ4K|x P}W D TT|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,x Pg x$Pl4WPP|0 |(1  0P @>dPd0l0  P|0|04.t  Jg~pA|@Px :p7 P4H7TXt@ht@p gtp (@b̚L -0L *\ -qLpM@P`!3EpF@9 -PR`1`00 00Q @` 0T Q" T 1@KFP0: S 0`S  0`SᲟT 8  (3, X\j \D̚ -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R fP1P Tf$0 S $唪=b0SPP BNK@D0 Pc P`1:(b?00 t/fIKA⹄PP0 R4: Sb00+< ̚4< -0L 0D -l6LkM `P`ȑ ̑ , H&Dp ?0@8S񟗏 4HPXt@%0000S 5 0S$00 0S 0S$00 4$$$0S \401 ~\$DDT0P 0 R 001 l$3$$ c$0S #0#SaPa  0R000 U ڌ3 R l3l 0 R @hshßQ 0@BP fz00#0CS<h,U^ P  UQ P 1 UF P@ l2\ tM 1Tj0ES+1 U00R00S  H@PP P  2!i P1 R|q/KP?0ESU4!R,, @e/  P KP} }Ke/ U   *1S> 0S::0*0S'0`1СlFbDpFtFn0nDhFDXnxFDLD|J̚md8 -LM`@PYP@ Qe/z 0S \ 0/S, p 0TpP0S \ 0/S p 0Bp0V$000 0  h2Lp +!$p + DjLD|FX -3LiM@3T,  ` Cn1k1h1f13 ,0S , 3H00 l3 R \Q0 0S  [00RS (0s&0S! CbXpD00CS0X0ӤX0 PpP B00CS00Ӥ0 PpyUYUp20Sh 0SS x2 R@0S 0 S! L q/KiP8D  Q'q/K@ A XP  z20P ,|0S1Q A h20P j_+ 00TK` 0PrbH  !P_0S _0S H  QMKe/T 4!坁41Pe/H~p_l0 R#  PxDxFp LWEVnDLXlFnDmd8|jDfdgdԻ -LM@^00CSp&&&&&&&&&&&&&&&&&&&&0h@0$ b0X̚ p-L M 0@.Q`Q," P*@/@ 0@@dq 2 09R @ ^ 0S0  R@ @ ^ 0S#  R@ @ ^ 0S  R@d0V@    PR@p4/ppP UT -h2LM Rp P2pQ 0S  [00RS P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / RP80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, oF.,0 8Q ] ,008EP,,00* C R +, 000 08@>$ @,0 08$P,,00* C R , 000R,-0R,- ,xn L,T80a ,<]g̿ԿؿC   -LMZ0, #00 00pӑ Y33`  2 Rx3x!t)0d $0P Y ( <, 00 $8  4  <  m+. P@MPtB Z 0 Y  0 Y&. P@9P[B Z 0x $hY (XP2LL"8@To0, 8@T$$$P T  0@ \0 BS@TZ@TP@\ xPU@ d+T0 D 40( lX0 00CS00  ä0P ,L 0S0 MX00 FX0pn4@HT`l|08ll$08 -LM@0p8(0 pP \P@| 0 0!0d|PD cP@\ o_Ke/ P AP`D e/X\ PP3 DA=@M\X`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUd](0 S (+ol TR]pdY4J]T \}<\ DP|JL$,̚ 0-LM$PK@x,@ Np1P h (K`1pH (00 oli% P@X 0#S\(匛0,0 TQN,0S0 (,PKx [p , 0"S SX0S OX0 S4V\0$Z<<D@Ph -LM@Y0S@p -LM@@X000S 00X0Sp -lL M@p` \ |0 0  Rp P00 0 ``p -AML ; MBK@$ I:I8 , 00 8$(P  ᲿP00 PP :P`` R 00L`P1V4k ,(;P` KK0C 0C00 ))P4V4 P 0S44X0PH`0S440044 PV 0S0S440 0S  440@40@4 (P+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB(B~KpG pG <P 8V`VP **LPDPBNK@D@D0 044 S;;S(  04(@40@4 %PBNK@D@D0 044 S,  0i(@@  PBNK@D@D0 044 S8  0\N(@$ @$ LP BNK@D@D0 044 S0P BNK@D@D0 {044 S4P BNK@D@D0 i044 S<P BNK@D@D0 &W044 Sptv8P BNK@D@D0%D044 Spt~P BNK@D@D0p%1044 SptP BNK@D@D0$%044 Spt=`mP BNK@D@D0 044 SPF[P a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S P #@T:q30  00S044 i04S44S J'044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4  <4V TL"D4f<$P' 'V ?PD4` O<4P~ V 0D4 B<$4 <4P m D454 <$0aC1 0 &@@ ]&@$ @$ k,0 @qS t,} d&@40@4 /8&@40@4 &)$ BNK@D@D0 044 STI440CSpבxʑ&@ @ (tx@C$~0$a8L\hxT`|Tp DTt -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY ( PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 %PU%%%< % %8%%x%l%`%T%w%<0d$8h| -0LM pR` 0(WP @0a SPU@W0X0 S000 S S @@  {%p 00  s% |jD  -L3Mp0moKPe/OK 0 e/  KK?KH2 01 2e/$1 (  0S < -d1L(M\@@K @ Dq04Q@K`@@ 0[< 0VC 0Q2 0LH 0G2 0B0. = K G Cc ? ;5 0p$B 0`XX -eHh @(d$\82P *0P ": -MLM N~KpG ) e/9 , aQ   P PX P 4) KA  BA .K B B)   CP@j(K0PS44S nS(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 OSe/뎎KH:  z *P 00CS00  ä0e)(K00qP@ P 0@pSAhV````````````````````````````````````````````````````X````X````````PY``````````Z````````J(U` h  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ P黐A 0hr ((PU2UP 0S S R000(U 88/P0( $$dH -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`%0S@0$$ -RLM0`pl a@QgJ(T` iR 唀R 03P  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i*0 `0T< 0Sh. 80igT (@@AP0\$(Xt p-LMKP@ [PTPT`0 R*0R*0@  [Pkp$$0 P0:00 -a0L0p@TP  O ~P ;P0 S R @000?S T S 0?S h`+> LX0 ` BR X0  äX0 d CL -AML M4 8 , a- MK 3(K 8 BnK`Fs< `F %O  RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D KBK0A0Aq~P@K0"S 04 Rf<4SZ?0 ]MK Z$8+\ 8-Q `@  00* <\' ZP@/48`V%0 LU/ P V  @0aS@ lZ  N ,0 S ,儓  P@<l0 K000@D0} MK4h <0<gbSe4@D( b<$ 00]??A`\4LY@0@D0}( O -K0P kS gS844(V< @DmS/4$(4( Q 0a#5<4 44800(K RK PK( K0?S X0  BR X0`  äX0h 8 -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\y1 ,0S ,岒y 0g g0C B#b"Baa  X8 < MLL!LMH 00 0Y KBKJJX@8<${M;K  ,CoP 0(K;K, S QQa B RR24  !4 mL00CS0X0  äX0 `l08L  -$LkM0Ke/ ,0 04d,M0!PP P@ P' @T`t\MX 0@@ M T8@ 4T00CS00  ä0 wT`@ QPP  P,#3P P@t x3x tR,@0\#\3P Py@t 3  t<0@8 # 3P Pc@t 2 t&8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P@t T1T$ tDh!h1P P@t 0 tTD0 ,0S ,+0  e/0 a00aI h0h@ H0nLLXpL<1aTLt8h($TxT` , -8@TLPp60S S 0 (S"H\T& QP`$ 8@T0S S 0R8#H\T@<0 P @[o%d -LXM|`K@X pPP 0rSP#H |0@Sb00C8SHHkKa嘁@eK T@ p1GT0\0CS0<0  0DD PP 0+P* @%P" @T;K 0@2K T@ 0 T00CS0 7@00T Px0K @1SL8LL<1 -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`m((0 mE$$4$d -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 EP!H0@ 0R!705@20  0 $ $$0@-@000<0\00  [00RS?00 Q 0  <0R 8\ *0 SSP(0\1R:0\ $0@0J<0S00$D$A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q$$ -0LD0C6S[\dlt|Pć̇ԇ܇Hh G@<840,($  FFFFFFFFFFFFFFFFFFFFFF4dhT8XD(\|4h@h H -L`pPAT 1SPUA@@P  % p-LM`P@PQ@TpP Q P pQ -LIM MJ~KpGpGP @ ,  1JnKS`F1A@TP,0 S ,ߍ ;P0rSJ /7KP@ PrU B>K0C0C4 000 !Ps@0@@ 0 嚫PP 4S JnKⴀ`F10 "\a0@|$"Tʄ1SsBKAA  0aXĈ ` -2LMp`@0P0 $ \0 ~ 0 ~ x 0p ^\ :` 0X ^< :, 0t$$< -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S P V 0 SS Px0`000< 0S40H. W8 0Ql$( -2LMpP0 0|0`` `d@t P0P t'T @(D  _( -2LMPQ  0  @ )@t 0& t H0T:`pW; 0 \l< X0 )@ ,0 0TX_ -2LM`px \p0@PP@ @| <0< | DH -2LMP 0 Rp`0 0` `@t 0 tj 0 @ 0`xpx!t<P` @ᰦP @T<F 0 0T @ Q-Lp`( P% P# P! P !@R PP z@T! 0 /\ PGP FP AA4 $00PX%P0S  0 S N -LpMpK`P 0sep @T X 0S@ 0@0PPrdAedA$% -LP\p@` 0B0C3SO괖$$$$$$$$$$$$$$$$$<$$$$$$$$$$$$$$$$$$$$$$$$$$$$$<T <0( ,0P<0( ,048  1hXW <0( ,0P( 0KV ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4P$ o @ 0 P 0Z<0 0Q&2 -LM0U@p 55 u  % 5PDT$4@  $Pp 4Q 0SDP {PpdP(D0: S  S  S0 0sp{ 00 R000Sg RL?;#003 <0S c#?;0P@ ? LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qSA0S0||< KL1Ps1 V@ 00 ~6A!0!t@ 00 o'A0!f@g0*A0d!\@T P!P00p 0Q  A0!A@0 0T P@0 +@0P 0<0  H0D`oԥoXHnn$Xo\oTonddoPnxom@,`t -LMc0Ss0S 3 R S0S3 Rt3 R hCPÓAXP,K C0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP56@2`DBHP(@ 0S 0+20 a000+jP !1aA0 @@AP| r@ 0X$1 v@e0APR0: SN8 @TI0sD@D0 R㬀 00CS00  ä00 ( 5808 $0DoHXԥo\nnإL`oo|oospos(hnXop -?MLMt0t` R   0S P Dp0S?KK@D0P@D?+(bPHPD p- LMP|Ut`0   p@0T Pࠡe? >HTD -\0L RL H0 @R0,0, 0[>0X>Hodoo 0-QLP) 0S-$$$$0  aP@ڸ0 T ;;S0@0T@|0 t>0?\ 0T C>00  aP@0 0PHDdonoL@d -b0LP@@xr PP PX"000SQ(Uڅ;;SNU8U0011 U00R@@T U 1 Q "P=>!0|!=l1 h=\=,>0S >0S >0ES U0P0 0 R0Q/PUa>0 S ]>0S Y>0S U>0S00PXb=00 000PDHTnإL@P -1LM R*ʔa0S& !00CSYxx0Sp1  0SKXXXШ0S0 0  0S==[0ȌlȠ@$ K$ @ P@0 HP U0S \p0 @0T@_0 ;0@TP 0oQ00000nPԥnHn|Dmn -P@LM0 U 5ࠟP.0 R  0=p`W 80 S80S*0S@0$Q=@ <000PPHDn -L M䁟P@P!0SUTj<0000U$ha 0 RQ R 0Q5=!u< 1 R &= T:P0U$`0 u[0 njlȠ( `0P@( Kd$@ P<$0H ;<<TPH@DpLdom -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 PAb0 0PV?KK(@D@D?+I_P`G?+B_P;@@ HP+X@ P00#0 P ,0 S ,фz<0 ;;n< ;h< c<p  ^<` [< ?+^P}PDm@Lx -LMdNK@D0 @Dp (0 Pw P 0 y,NPi,K-*,9,K'$,@ EP, K70h 6+P9T x+Pإoooo`oooo -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 00,P\0` X@0 ;-P+Pإoooho -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S oإ,  -%ML,M%K0(J⒍K JE(H,0 (H %b}K(pG P`$pG; S/R P58,0 S 4,~ KH%0R/S /00H5 0H5` %,K( B:KBP Y:KP fL%$(K0: S 4 S*PsP5.P|4 R ,PsP00'P@40S(40S- :KL5*KP/QH nKLP T5*KP?:KH5P@0S 30S #a=(K0Q|3|#׸*P#P* $P$C0S3 R *KP P0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V  (*A G%K(JPJuP@ "   {50P!4t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X W50l 4o LltoooHooo`oooo -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4'4P 1@  40$P$ 0S U0 R 4P  @0| ,0K8P P+0ST 000 08Pإ oԥ 0 X  `o -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R Hl3HX,@\ӯ [\h @ꨥ oԥ  إ 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P03 83p0jC -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  XPl0(&PC3dAdp@d@000XRP|t0jC -LpPP 0S ,0SP!%0aV 0S P0S$0 0@0S# V %P00 0$ 0 T %P(@/p`P P0000ꀣ=p -LpLPP 0S ,0SP %0aV 0S dP0S$0 0@0S# V 8P00 0$ 0  R%P(@o`PuP0 000ꄣt -LM@(!aMP@ 0S 0 -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 @0 0 0S t0\0 إ< 0A0- SPL@ 0]0S8  R0SZ+ 0U+Hp -a- `L0Q!0p@[ P20P d 0p QL -+4 $$+ PP 0 KS- L0P 0 -PL@LPgb=0  <|1  5d1  .Lq0 '41  1$  1*  00   0A0a-  bam` ; P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞0PPPa=0A 0WPP2 HD 0 P,2 0 P 2  @*$0 S $vs1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0| PLPP00S S S S  Pd0 )@0l A 0O Pv A0q,\ (,$d0 mS- LL0P 00 mS- L=0P 00 ]o -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 y P Vt $04 4`!f0 h L1^  a P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#Ro (,H8$0 |0 o -H$L|M0 ,0 < P $00CS 4   4圐K R 0  & P3=6K 0 P7#00CSDLDDa=0p`P@00S@b-P ``06 u P03 ($3 0 P3 0 P 2 ](2 ,0S ,q2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0C PL [b=0P@06\  03 P 0oq (,$$PqQ-H0 4S Q 0 S  qo -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yo (,$08H P& -%L0M0 (0 H P4H@ AR4  0ASHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 A&S(0 S (vo0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0x (,$ -0` LK$KP P0`P| P&d 0QpL0L {P0, C% o(,$ 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0%\ 00h$40 |000 0 oo ܥ88(, p-LKtM @`KPP   \L0  Fp$p%0 00$`- 0P ) -LpM`@KjPP X0PpWH0P 0R ,0 ^a$Po -LtMpPK@@P1 R* 0R5 0: S, )PP !% 0Q` P X 0x @O$X%0L C$P 0R $oo -MLP4M H4p , t * $00C S t3P3 RIKII 4S+P) $#0@P \ `3 RT3T P00##3 ,0S ,l3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L唺P YP0SBB0S1 R  IKAA<P!0S$\1  !$4t!`#11  BnKP`F`FU!B4: S>Pp@ Pp# 00#00 p,  ,%x "B 5X osoo(,8Pooܥ8s\x0 p-LtM`KPP 0@T0: S ,(Pp#L 0"pzPVp# po -LtM0@/SP @//㚹`@pKT/ `x0SH0S ĵx0\d0SZ0S! *x o -@LpMS` Pp0S 0 R K1P0Sl00d0 Rd00HP#00 W"# 0P"꘣ܥ4` -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HP"00 "" 0"ꨣܥ4` -LM@0Sl`0P "0S "04 !$0 RPsoo -LM@ F0Sl`0иP "0S "04 !$0 RPsoo -LM@M0Sl`0姸P c"0S _"04 !$0 RhPsoo -LM!@bP@" 0h~! -*0LM"*@5P*" 0hh! -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c! 0  !pWdP  0p\ x/0`Q`! 0  oo p-RLM`0 PpA@0T<  P! 0ph ! 긣0 0-0@SLPC 4 0R0a 0h2o8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  CP p R0 RPa- 0S0S 0 Q 0 ,0S ,iK(A4A 0P a=(K0Q p0| 0QX0P!4 0@ Q ! 0$ `H`h` -0 0R00000L R0000 R0@00x0 Rlch0P PP0 RP$oooo oo p-PLM@` 0SpcPP ᶹ@P0/S00H 0 S8 @`0 0 PPPPp ģd0 R00T0T QH0  \80 R,0 P0Rȣoo(ọ 0-0P LRl0@T 0S @T00SU0 ((.P^o} -QLP=aq R1 0S  0S0! @0S00 0 P 0$P 0P  0` K P DPs00꼣 oȣ ooL -$#L M0PS sP 30C S8"<""T""!p"""""""2 R 0, K@00KXP0,0 0y0 \ 0D"00" 0"bMb=0@`l `0 @p 1封 * RY 7 R$00  +P0 `ç 0p!嚵 P;041 P1e 04!  Ra- 00 R0 0 R  R00 R0 00S  0a @0@00PE00P<(ọo`  8 -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p sT phPH P  P@P0  P o -2LtMxŸ@0pŸT S, Pp$T ⇪0 CR 00w2 ,0S ,f0R Y @K1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᓲ:TP 0 0:S l R1 0 LP0>?0C0 h,ob0oX p-LM0@P/!|P00l0t0SP`ph8<i0Sph00phosss -LTMptp % Ap 00@JS񟗈@20303030303030303030303030303030303P203220383T3030303`30303l3t3030303330303333030303030303823 4403$403038403D4P403\4h4403d5l55555503X6p(4qDTA0S`0@0w,0S 3wC̱Pv  4 u}4Po\j43S Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: \2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"4<5<5<55<5<5<5<5<5<5<545<5T5\51` 0S{1P1P1P1P1  &t1p1{1[PzqT1z-L1y*D1y'xP0a,AH0pK @p Ҹ<1P@x  0P@ P➦UH@ 05 0'obho$LoPdooPooooxoooXoooooܥoooooIt\on9L`إhXo 0 ԥBXL0@0t0 X X0 t0SI0S| |0 0S7788p8 0S@0cP0 0S0w 0S @0yP 0$!0S0<1 _P1 RH!d1 p6QM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾0;<;<<D;L;<T;\;<<<<<<<<<9d;<<<<x;;<<;<<;;<<<<<<< <<<<<<<<<<:$<<0<<<<;<<<<x<<<<<<<<<<<<< =vfP040 606666|6T6t&h640Y8  6 86   w4 8\P8  fkV6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P6W44 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0S|=|=|?|?YpP. Yi 80I`0< 80 VL hP\D;P< Pp$P(4 RYPW Ø3 , RPC0S 0S WP 0S,30 ұt~P@\ LȮP R2P 2Pp嵮P `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1ၮP B CP wPtqP1 RY0  8`YZ~P@x )P`MP P0 OBPP;9P `P`P@  ,P).P# \0S Xobxo<HT`lxTooooE\oԥhoooootXL04o`إ -LpM`@pKq@ 00RPP4:P0: SU/00 0D 00S\P  `"̚ -4L$LM4$䄟P4 $4p $p 60@DSpEEEEEEEEEEEEE,EEDEpFEEpFEEhFEEpFEEECEEEEEEFEEEEEEDCFFEFEEFECFFEFFEFCGG$GEEE,G3x3x#000d3+ X3xH3@c@3}P@ P "3 R ) #b尒ŸH0pK  p ʹ2P@l  2叼` @ pp`⚢VH@ L2P值H2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QSdGdGGG H R|PP R0S,1 $\P 0 R _ R 0 PPK oooXoԥoo oإxob4oI0HoE\o@ooФoLotXhdo p-0LM` |@Pߡd0 P0R4BDL S00CS00  0p phEoУ P00 -L0L R0 R  袡 P-L 0SP1 0PS$ p,ὫPp`=ᷫP@ kXP  ppP0VPPS0  U  0S( X  p-LM KP qd R0\4P0 0b0CS#,LdLdLdLdLdLdLdLdLLdLLdLdLdLdLdLdLdLdLdLM`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPzP @"#  0 S R WPP   B'0 0 C 0 0 4o -L 0㖺Q m -L0,㉺Q| -p@LM@ 0\{4 0LvE 0<qB 0,l0$= gQD -MLML0P`(0  0S ,(0 S (\ @Rpx 0\S@ S  R wR 4WPP`  PI000S  \R 0R 0S 'LWP 00@0@0S PS" GS0000S 00P 00PPP%W0 0gS pS00BNK@D@D ;D 0 Wz(v ̥Х 4` -@TpL 0S V`PUP Pݬ@@0`S 0 p`PPP Pĥȥ 0-\0P@LT 0 @T0U$ 刟Pĥ} -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00tV 0 pc}Pp  R/00`X @0/S`0 0@4R R/00pĥoo $  p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 Rp嵚PT @`H0@PpUP00ĥoo p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQo@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00 0 <0C<`0S.000SlS 0/S 000 00C0 ̥o D  -ML M\\1 `P$ ^KPE840,0S/0SỪ0 S0 K0S( .S @ Wp ᾧ P;0W$0 S x$Yd0 K@TTfHbo   ! u!8!X! !!! p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 01! -LcMZK MpKK K(@DKK( @DN*K", 8$KWLK KPH0`K: bK(J,J 0| P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,YT *0S 0TP*0S0T0* K\ 0 1(K R K(m0(K RK*K:K(夦ZKX:KZK(8T0S  KP KZK(8TxKQ :K(0n̥ T\!!""8" -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp㔰1PU|夹PP 0S`QP@ 0 S/R< R4aP2 T,/00 1  bPP 0S$bb,b4bLb00 R,0 h@T0 0S/S @ ,DoT"\"ooԥo\od"""X0X P -88L(0 RLoo"#o p-L,M(@KоP ˾P ƾP Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 僽PV }PF wP6 qP& kP0  40 cP ]PpX!Wp@0S KP@0S AP@0S 7P@0S -P@P $P 0K  赾 0K  设w 0K  觾k 0K  蠾_#Poob$# -x0LM @R`0 R P0 RP PaP p-PLM@3 R0 (a0S= 0#S4 \S. @PP$ 0"C12d1@cP 0S PEQP P0! 0pxu  `o 0#S@ 0P,P  />3D#h#=#X0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ f0"C12d1@cP 0S PPP P0! 0px  ` 0#S@ P,剳P  />3##=$X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /SPPp0 S 00C S0u 0S_PP@j U 0SE00<0S1W 0S !0 0P!10@ @@P000 RH 0h bP, a [P\ P 00000 0S MS CS000 0S 07 cS mS00dv,QW0p0@ .QT@}  ( <$T$x$$$$%<%@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R H -LMP0pS@ q 20  00S| 0S T`q @ᤥP_0 1 !.B=R pGV0G SRpLpoLpoLpxoLpTpLp,o 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R  p010!.CDR Pk?C@.PT @}p 0-LPL@DT  0ȱ0S0 !  `% -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00jN0hgN0$qv -dpL0S ` AT@0`V01P@PHNFNU p-LMP@T0 pְ0Sx`t 0 h0haմX0P0 00 H 0 Go%o%% -ML0M (R04 ,0  2 ,0S ,7S4! /!8 0AT ~KpGR0pG8 @TMP@, Q0 ^0Q  P D! TM4a=  8,1008 A   /0`PS 0S0-0S  2PT 4a=0 S0ńn 8  h $  &G&8&X&|&& 0-LPL@DT  00S0 ^ & -8L@T`M !0pAT kPP! @T LP@ +tP &tP 0! 0AMMh T  AP M tP  & '4' -@L0`SpP` 10AT P @T P:0G0 0-LPL@DT  0m0S0  =P' -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q TLP@ 0`0 10 A/>3' -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S KP 00 0 0   )&0, PhPP 0p p00  ` WPP 0X0@ KP 00  '' 0-LPL@DT  0釮0S0  =( p-LML`0S P0AT  0r@TPOUp  -LM䀟pPP, / 0"c12f1`cAT 0S @TcKP@ rP pP ,000! 0AK(o0ST  />3L( 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00PKNK0 />3 0-TPL@ T0 04 @00K0S00708o( -LMP0@SȠp  0S P@r0BS` x0 (00 徐 L 000o&K`V$ 0`008o( -`L0S$ PPUJp0"S@0S w 0RH Q zJPUZJ000oܥ p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BS(000L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRx00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  0S 3@T0   0Po -LMP@ PpP \ 00CSP0 @ ($ 0((ԥLo)()X) -LMP, P, 4#, ,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  oo -3LCM |3 B, RЍčЍЍ83 R  3 ,0S ,MBP0SPdU <"K d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP RP@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0he`0S  ` P`p$ --0P|0  QLl@ 0S \0\ X巌 H-%@ 40審$ |00oooo , -0-0P L0  \P@ 0Sx0x t剌 d$TڦT H~@ N080z$ G00oooo ,r -5LaMO?(PK5@(K, p@ tA LP Lh ۣp0 !(5! e ! %p| D0@3SLLLLPLL LLLLLDPLLLLLLLLLLLLLLLLLHLLlLxLT` D1 [K/jTl!R0 0; 0,4 P(@K P 0 0SK aP 0<RP X+ 0 *,Cˌ0 [Kil! R00@0P000!cd ö딒2/ P@;P!#. ;P/ ;P / ;P00yP 㐋 0:~PA1 [Kil! R0d00g0`!00 00\00Y,AL1 [KP @sil!P1R 0B@ˌ0 [_KP^il!O?(KR0,0<-|@1 [_KPFil!0R 0p*A?{Gz?{,0,b,-$-L̚8-\-t---@-X8Dqq-,r@qq-q-rD.`.dl.. 0p rq.'../$/@/`/t/@qrq/.A0 pbW0`0ppp|0 ᎁh O 蟁 P 0 p p0 pp m`PP Hq00St~ xQ1 01 nAP 0 0 R* 0 R :d0 1  0<2S!000 0 0p1!@  @@WP` hB@vj ^  0<2S";0000 B>BS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A bPdC000 (3>K NPVXCX_K#^?K@|A 塡PHx!1RS@$0.P0;CS040@4Q0S|  `!d㰛l㭛A 姛!r 10C1 =At0\ T0 02@P@T00< KcK0 ! 兯`VKe/K:1 : < K eK2 R x0S:@ A :~ 0S Y5  1 刡 ܫ 00Ì bK 0\Pʱݩ 0<~D$&r464\&=K@匩PpOd&Y?KP0C P~P Y?KP0C PpPw-F]?K [0(PK0@00  O? K ^ 300 0p1  000+]?K5 W ]?K+ 7 ]?K! ~C P@ 00 OOK,@@H 0-LP:㚚0^  x0\*#P0\@ PL0@ D薓@P@4{  rDqrq@L  -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 ܧ1  Q P1@ԡ`0 810 @@k0P0?P P$JKx!(@D@D0h!`Pg< T0P ,0 Q  ,pD A`8#8P#$0$ @JK(@D @DXK<:(<2: !<(K0<:(<2:(LL!<  030r@q(Tqr,qrqq//5/@q -L4MD 0K`!D 0P@K0 Z L7  ;  ,LD h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $0 0c@BHX@000CS00  ä07 S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<|PEU, pH'W 00CS00  ä0f`PHpWp!pW T0W6 'W00,NP|0 ă ā Ă< 4 <( "4\,<<pW0 PH 'U00CS00  ä0@$ pD 0T Phß0 0p@gU0#DHL6$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/fPKP@0/̒0 \ 8K⬣48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  : pq/@qqr(Tqq40L0080D0X0p\0pd0t0|00,00000T\DL0MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004{K(IITK(JJT$0 t弧 * ᔅ0# ᳧* ዅ#0S`V* X.wVP@(wX0 0| - A|P@wV0 N}8#0 偧 *Y *UQ 2 R G  _,0 S ,A2@2@P0 Ÿp`0 6@PK0L X0/0)K@ B0/g0/P@@0/P@@W0/0/P@ @GK0LP@0/@я)K0 BP@0/@5KP@P!<0 @ *؄ ~{i z{W v{P@M  f   *㼄3K (JJ0 ֦ *㮄 0RK(II l*㡄Y@ALr 1q(1q@1LrxT\DLT111q11 -L0 K M00, 000K 0 U p/? 0@ @ _` Q @0 RQ   -LM@T (0PЖ0PD5q -LM@Qs||||$,4<`hQTxh80S #!Q 8dltp9`XPLHDh84<0#$(,"(h0S S0Swusqo0("#122@2`22222233$3L3t333334 444D4`4p444445(5H5l5555 66(6<6P6h6 p-L M0@0aP0 !P))y 0t 娣o壣tjVP`F `00CS00  0p phn(UV`F6666 7L7 -0L M0 K0 P@ m0888 (b0 q,p7̚ -LM@0 01R4 R(  0 $h$7P7 -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K0S jP^ 0 qPV 0 UP@ x0SJ GP @0S? b<4I 0S t 9Tt9~9Ph9999l9,$4:u<:T:h:L:::: -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3x -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,:E.K B B0h$ !1`$ (@K  d 8 X \ @&?ʌ hBNK@D@D 0 P h F0D_0 Rp` "p~:w -LM r`p&备 PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S73P@N &k,0SA&`$400,0S0 00 M0 R @@P0, P( ,P6  c Ɨ@0 S/0,0C0K30 (0埖-wp:~:: -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  ҙ0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QPw4, -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,h7 0@89P @" Q 70$ :  0mPPd 0hƑ(0CC1/|vx0Pw00S  n Q<;P9w;;;;L -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 Y p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,6 4 0 |00S00YX   D0TPDHNPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:086|0 @P0088  <  +`w ;;;;L<~ -0LM PU@p$`<` #T*U0 R  0喃" l`▂#0U<0 R 0 0喃" Hw~$<8<T<l< -0P0 P00LMS0 P,܀ R0 P.:p$60PP5`@2:(P`@,F0Bʘ$ؘ|P0 R0`@004$FȘ00$Ი@0 p~<rw -!LM0\00 \pG\(:`(P``ᖘ,F0B$厘0 ƚ \|Pt0t0l h d@d0 H0(0000`whp~r<tTlXd\w - 6 8`0(@ 0L 0SĠP`E묀pp/P3@00 00`PS P@0Ss0Sx/P,Ywphr`ldtX\T< -LM@P00/\ -LM@&B ?Z Pa(E/PUp* 0Аؗ0 T00P00@ 000p@0 (($`喕d0 dS D 0 Q00r/P ww0www< -P0LM@ᙗ<0 P 0S P 0w= p-LM``0S TPT 01@CT*//000p /0T*www 0   -LM`P@aUpᰀ 0SP 0S 00C0$d \0 iDX80  \0   >~@,=~4~44= 9T 0-(0@ LRP 0 ,, 00 0-(0P@LT ,ǁP  T00T0S 0 T @0~ 0-LM@0T0 T00S0 T0P7@Hg0S|tp0 Rd T0K0 b 8 (@=~H=P=T=~`=l= , -0LM@ 0h f\ 00CS  00 00  =4= -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`%P( 00@$Kr$ @0 0 /&`$ 000H0G  W00 R4~w~0~ 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ѓ$0$  00C00$4~4~ -LM@Pr0 `0"pM b0@SB<PX1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P 0 R T@D\  0;T@DlӇzX T0 R '(~~=bn~=~\l=~XLL=x p-L@M P`KQ0S 0S   p > -LM`t`ğ QS, @ Dd^ 0S 0S p P0S 3 ,0S ,1 0ṢģL0SD P!먓0S 0S 0\CS 0S ?0S 0S , @C 4>wP>,~t>~~>~Hw D<4,L`">\}>>~?D?L?t?|?????@(@H@\@t@M -0L Rt%@ -,L4M6`V j ,6 &,0 R:(6@TԢpP2,& 00 0# (6@T,&B2 S:x 020,&0 R:H 020L0Sg d0d Vb0SQ zVV1W V!bT SQRV V@ ?>1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎw< ~~ -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD K 0 0P 0  㓐Ta D0S Y U`4&B ?PPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aᔒPP@T1X@QcT P #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S h J0@$00 Pq p2l2    1)P x2 d` P~ 2 RA @>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/i (K0 ]@0 ,N0S 0Su P 00M(< gP0S &X^ P D u6C tt4@w~@,=4~@~~,0~ r$r@Aw$A@ALAdA|AAA\~A}C -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*(P (@ R00  0R 0S R0R0S P 0 R 1P` _X0 S00Dō<<<<~PE$r ,~A@AA~BR r B}C -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  w,~(r 4 -LM`VPڴp崀K@PT 0S  0T @T R 0S `FVP 0  0P 00(r PE -ML M0,0   BR xt P d$PTDT$E>K0C4  L44 ;$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:W$3 ,0S <,, 0S 0 S s S # P"   00C0 " P  000 00C0  LR0S-@<2Vᴏ@Y P  呒2(KWKK@$ (@d0\4  X$ kEQ& B0O0  0l{ 6`X!0SV Eo0 }5@"%$1 Rz0 P P& Pd P <0:90|s4BBww@,BBBuBCwDC~D989}C8BXB9@ApBB -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKy0((K0Q 0@^^>KMK ឌ~ P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dX X (,0 S <,r+00 00CS񟗳||<<$0S&&L0S6 `03  00C SKlDlLlTl\ldlt 0S 00C S' 444$4,4<00&[ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00p PS L0S|3(K4!  `0A?( K A?(K KK Lx$\0 0 Q0hNK0ᴀ$00$03  0`0C0 s@@Q @T; Q 0S+ 0 SP $00$0P "00C0"l>KMK ( PH"\D000.S "P tiP00L Rm `0j 0Sg 4\@P^>KMK @d$00$0@1  0`0C0 崀=@?PwP( w50.SR 00Ph L0S# `0 0S 0<0P$0 DCwDB~4PC`ChCtC0~C,CC~CCCCDuBD@DtDDDDE E ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000ww40P, 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.HH 0QP 0S P0  00#dHK HKlHK4 00  F@$4,wd9@ELE E -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00U#T<,~~ -LuM膟0,0 # p! #1PW1 1 1  6 \ᔦP  (` ,6&=Pz !,6"! 0&1& o&k rKg f?K^4 Z(@1^*P P ?> P  RN/ 0`F<0^:6^  ^Lş 0P<,5% \ ?>1/1L.QAN 0 40\1弤 01 0S  1, 0 S  0l` K_KL$1῍,6 1R rK P0S$1ᫍ& ᝄPl0SV1#ᜍ&ᎄP<6 P90S 0S ) d1 0S HrKr P S" Q"ß,0 S ,'C1! 0 000S  ReKL P !&d001&<P hTeK+ P & C!00! &Pq 1{ ve,6KQ01,&K `,6|AQ000L0SD1 S@D0S!1 S*0\!5 2! 5:? >PN0ׇ? >0N0CS!!&&&!101 ,6 0x ,6!q pX@0 H;w~<TEEEEE8F\F~dFpFxFF4F -PULp`:4@$@TPZ 㞱U:FF 0 HP0H0L --L T p-PLM@P`l0l R `T D0 Rp80h a 0  _-P ,HF --L  --L  -LM@i h7 --L  p-LtM/P@TK pP0: S p0`rSv Ҋ 0-/L@tPU+D0 00s/00(+i+i00,rF -LUMpPKP3P@lK8,0S-0: S  SU nP U@P P@0 R000K@P h1: S@ c$^L`"FG G P-L " P 宮0G -QLM@ t P T 坮C @G -L8GP 叮PG -kMLM7 6@, @6K0A䆟 A 6 PP6: S 1PK }&P0S| |6 Rq 0 S i\80Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S ,%L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6(P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@؁3PL ΁x3PTChG ÁT3P= ⻁P03$- 6SR ,@!0@T00 "2 㙁B00㓁0"S P x2|lPP\Hd,(PPO@pYT J/ ^Xr1  LPP>, Z^&R0S%"0!S$ ͮpu|PL~syg ,kqg 뚙?Aw(~`G@Aw~~GDP~wG8~~GGGGH!@\1 00CPp010  pH<~ -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH kT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f f~Cn`` }~/00f V:TPU L0L X0 0 TP z U \K`"L4a|u -L s 0-LMMpPANK@D0@D` 0 2n 80 r 0S =0TNxN -LM0@rr@ -LM0@S NxNpNxN00S lh0 R \P0008K3c̚~NNN -L`PY똡嘁q@!Ŷpb@1 PPOtOtO\OtOtOtOtOtOtOtOtOlOtOtOtOtOOOOO@@1@@@0 I`007@0 0QQ0 R|0 R 0 R|0 RP0 R XvmP L堥H0JCNNLXw -0`P0@LpP |SjPlP 00UDm0S8A:PP$ 0 40̚ -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rۦp0 CR 0@0R P0Rp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rp0 R T 0 R2 0T0Q0S* Dl ^0@" eX`l@0]Lp̚Nw -0p`0P@LP iP@ 000T0S ]sP@ 0 40̚ -LpM` 0Rp䠟%  =p@ PP  ¥PP p @TPl0ld0 KგPL, P 3OP$Lw̚0p -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?XYXYYYYYYYYYXYYYYYYYYYYYYYYYYYYYXYYYYYXYYYYYX0,0  `  L4H4 0`00 ( p0SV PEU@ hP PEU@ȃc0S #hPPE@ $0S33 |3 00S UD30 0 %Y U Z U  ,  gU "0p0t0 ڴgPPUU|gP\PUSPb0S gP 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q dQPE@< 000PEU@ 00S1Q 00S  Ig0 nP 01S00S00S @ 0g|0 nPphTZtSYOZZZ\)ZZ 0-TPL0@S s<0  0P@0000 p-1LM0`@PP! mPUP  mPPp mPx0l mP`P0X00 DmP< 000p{i zi [i [~i 8 -L,MD0P`K@p,0 ($ ~ f ]mp X0S T0S P0S%@PuP<   @mp㤡<@TU  @00PEU00Sp<9,0 S,ti$ [,[ [ p-L,M`0P@@K0 +$ v~ .f`0` m0sHDd F,8C = 0S Bpi$T<[L[d[ -L8M0@(0 LKPp`$ @~ eU0 @ PK9P @Rpˆ0h-S`@deP8@ D0D lp0 (0S (x[[i$[[ -PL` M0 p 9P`  h0 Sr200000S0p,K8P dܠ,PU V 0 Sr,200000S eP m WPh0 r1000P^ 00S .}  AR #  }  tAR #~x dVe Re 00S ZP2  p,Z  UeP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU{,8VW<<( Z [p[\ltS[ -L0 ,d(0( kp( 鬃zi [ -4L ,d(0( kp 鬃yi [ p-L M$@K DQ}8 kp$ $cP`  $0 0 ` kp 0$ PS 0@UU0  CR 0 R00h 0PU@H00CS00  ä0 Zp阃xi \(\P\L̚ -P0LMH@D0  \ (0$0  锃 -0L0 锃 -0L0 锃 -<0<L00, k0Sh 阃i l\ -80L4000 0j0Sh阃Ci l\ -L% 0000 0頃 -0LM0@S/ h00S00S P00  w,0T, @00 0 0 0鐃>|\ -$$ 0L00  鐃 -L(Mp0@PK` @ 0 z% j0S c3[x DT 0 T KjjP@Ξ 0S, i [i \\ Qd0d0A00d0YY -L M Kp0,` Q7$P@\  02Tt0p00dS X&Xc0SHD p@h Mc$ P0t@l0@B\Y\Y p-0LM0`0S P rP!K5PN@T 00S cP 0S 00S` @TV8ԃ06p锃\ ][$] -PLM`@Kp| `$b1 @`6@0 DP 00 ,(0i0Si L]\] -PLM`@Kp| `$b1 @`6@0 DP 00 ,x(0ii0Spi l]x] p-L,M`0@PK@$ 0 z tb0S Te P0r00000Sp  ,K^bPX P<H0-ip8 0S(vpp]i$]]] p-L,M`0@PK@$ 0 wz /b0S e P0r00000Sp  ,KbPX PH0hp8M 0S(1pp]i$$^H^X^ -LM@0Pp`P  R0@r1000xSY@Qg W aPY r10000D0S  rt10000D0SX0UYDD&Y 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S oaP@00 `hV fy``ph^^^ p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  phF8@CT$@=Tp`p^^7 0-L0MP@0K; K @ h@0S`  @0[<0K`H0H <0K0gP0 0S 0i ^^ 0-L MP0Q 0 @!K  z0Sp : Ks0@KL `@0@ gp0 0S 0^i^^ -LM䁟0\pK@8 P`K$0 x@ x0tL0 H0 0L0 Q -P L0H K2lpK1p`K01@Tژ2 ~epdTQtPP@1@SPTUpPl rp200000S 0:SP P8l +PPU t@T0, CR 0 R00ꘛp0K1STU@ Tڴ1S0Spj\X1PT![ L_0D eP 1S  0 CR 0R00[l000CS00  ä0 \K00S),0 S,1i i8iiii_L__`i|`CB`$`,`p_<`@`\`Cd`i p`` ->MLDM1圑0 ,   >KK(@DD@D dv` ]P dP` 0S;,,8>{KL@K(pG $pG>[u u 8P 4p ] zdP@ <0S  <0TP( 0 0CS00ä0<0@T|PZP ,0S<,餃[i `i|```L`` -x0L`! @ T @ 0 CR 0R00ꃚjx0 vvt]SpRW` LDLDTP@cFPDF$iF]Bd0S >B0S 0B5 0 CR 0R00<505P d 0 CR 0R00%x07< h`L`a aaCB a(a4a8aa 0-0L0MP0@@K( 0 u \|0| cP0SX0 P0 H00<$ } 0S(0錃6i(aPaa 0-t0tP0Lh@h  \0\00 00\@08 UcP$0錃PX5i a p-LM@`00X`PD 8<}@P$NP^Pp錃Pb,bXb -Lqd0d0`pT }0@#nPp@@Np0 } 0錃Pbb -LM@KD004 (| 00錃bbP -LM@-D004 (| 00錃 cLcPX -L M0p$0  @pp`0h\|$KP`@/$0@@S |錃Pxccc40S 0S0SSh-L0S 00  S\0S(Th 0-@PL0 Np0 a|0(Th 0-@PL0 9p0 L|0h -LpC/PP`@l嘖d0p0`@0 @-|8zg@T( '[hN(W p-LM0@S`P 00  S*(Pp@0Sp -QLMPp W@1cX0$( # A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H H00p@0S% 4ii iC(WNi$i -LBM MLCNK@DP0 @D/㋏KKoK,0 PPr Z1 laPp2(K 0Sc 0( K @<PP@"mP,zZ(0K 0(K 0QpRKH K <P@P mPP,bZ 0D ,0S4, KiC4iL<P Pdw2/ )0 ,0S,- {C k"i ,k@k%i Hk\kIi lkkkkkkkQi kk ̚kkl\ -0LMaQ00p00Pi"0S @T 0 iz0S K  d 00 wDZ p-L MK,` 0 AP*0S ||wV0000 P00P0S 00p0P@0P0P0 `20pDl p-LMR@!X` 0S   TZ p@0< CR 0R00ꌓ0S7 0CU3* V ,0 CR 0R00t` \0 CR 0 R \ 00^ \0 S0 S0SD>0 CR 0R00pphAp l(lL Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00 ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0SL` p-L$M08@K`  Qm4 <0K 0 I P ^ 0zv<0S  lqvh0S 00S Q0S 1#$0$ < pT Z -LMK,p0 Q`W) 0@S =vW0000T00TQP  m mT@D0T0T0 d20Tl@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  J0l -L(M@q0D@K$ ,a 0 /m$ T [p0S3 0S/ 4P%adP0   [p0@`TUTPPE Vt` h@00U00SV ʑ 0S, i$llll - @LM0 l0j 0-Ln@TlPll 0h{T 00@404 G[0S 0hL0li lDDuTD0DpT0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p2f P8 %00XoP5帕 P@ %< 唟p< 10@GS񟗤XXXXXXXXXXXXXXXXXX8XXXXX@XXXXXLT\XXXXXXXXXXXXdXlXXܭ (4<LXXhD4T$P@@H4@@$4P($4@ $P@@@ 4333 3#P@3#3330ă80 ;0u3h#@t3P@@`#`3P@#@@x3,#PP@d3`3\3X#PWP3#00Q 3#< e<J2"P2@@@#0Sq`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0SX2 R 80S(Y 0/;40 "0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   y11 S41 R!1 Rt!t!p! 0S ST!S0 RSd  000 OP0-S 3Li 0R@@@ "S P [v w ?0 R0 0p Q0 R ED `勋\0 ]Ud<DHm0jhPm0`T -LP# \ \ P  \  Ph P 3S40 RP \ 0T@, 0-@LTP 0S@T0  , 0 0CS00ä0L -L,M , 3S 2 R2 R 2@dt幼pQ[ @K 0ST T2@` R42 Rs z,@ 0  $   嘼1 RY0: S SK 0SC (080c!0脼1 R 1 R0(D1 R&t1 R# : S : S L00CS00  ä0 pW ,0S ,Z e80(T "88 #$; 6X@ 0B ?O@0 `&{  P!rd|mmCXmtPlLdmpm|mmm 0-0P R 0L0x0 R00d0 RX0 R H0 @T1d-d00阄dl@ -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4c8 4cP80080 3S 1 R1 R 01@c嗻80 R< ;aPQ 0 D2 < 0S+ ,00 R 0 0C0 S00  ä04 00@000 0 ,0RP@ ` 0 CR 00T@PU0l0CS00  0 @ 0 R( ꠄd|mL -1LM R 0`1@ PR00l1 RT\q+ Tq 0S$ U0, CR (A00(P!000S$:00CS00  ä0P  tP@T00CS00  0 i騉 h奉0  CR H00P0R0RꘄdL@:  S-L0 % S I *0 CR 000Rnp|0 CR 000R] S  S=@/L -MLM@pA^K PEPE\D0 D` ! dNK @D@D $b r 00D 0S h 鼵A 0HHAA^K PEPE0$ `c̚mmm< -h0LM$pK\P@`  I>0s,  ظ0 Ҹhmm p-LM@`0S Pq00  00S|0 R?0X CR 00`0Sp0R P屈Lpx -0L %A]m -LMp W@P< ! l` g0STR `Q0SK R pG;< 0xntsssss(tPt|tttt0 8 -L(Mlq0@PKda @ 0 ́H KPD3[1 ,,!0zP"P  0 S  00 0 x 0x 3KKP:8T 0ꆮ:8 0i nt uu0u@uLui tuu -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LS0S 0' ; 0PP 0x 00P 00鍬88H 0ꃬ8$ n0G0 dvr -!LWM0,0  pPUaKJ/ Zd BT XIP=WoK0PS @W 0]KS  @P U00R00Sh0 ,0S , \\ K.0 X0 O \ 8D0D < 8 0$ 3tvJi(xvnvvr -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ KRXl`K@ V0 0p P ,0S X, U@ᚫ70 ov0vTs -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' 喍p/ H0@/S ,xd 4@0:;;@00S lVA0C2SE0<00S|090;0:0;j0:080gş80:( 8 07aFKL L4EG.Kx t :  B0p l wP 0 S5 * 098I@ a0:;8ꈪ TNKA a|@ }0S 0 R 4%RQ #NKA TD4P|ß0 R 4 R Xh 0@0WlP00<0 I,0, "NKA &2\3 R 4 R0 S  "NKAl2`P0S2 4 R.". DP"*@'0 ,y/ ,*T 2P00({10 \kP 5T kPp!NKA P L0 R 4 Rk (`r˩X@@ a080 00|V00NKA 1Pڠ0 R 4 R Pø;d0 0:;7+/0<0:;:?.AT<xb8xdxxxLxxx'y',y8-HydyyyXyج{yyz,0zPzHlz zzzzzphl{ {({` 0{L{h{{{x'u{{{{|0|P|̚ܫh|L||Ԭ|D-||1 bZ eZZ0% 1PJFKL@ L@@@@@@paG~K@pGx t : 0p l P0 R11 P0Q4  ;R2|@P80 ,%R0 KL@ L@@@@@N>K@0C, @:0C D P$0S `0 0 )TP@ "0  NNKL2@D@DP)` 0T `TPH2) 0`TPpj Lp H 0S Qx0S 33  0 0> 5 @P$  0 @T @%@T  3XPTT$0 00000000@S@T`@0D @ED4 @0R4 1 @P ,O>K)0C* hTp s $KNK@D04% R44:0  4 4: 0 ETPPh0 8EP00 0 s0% 0% 05S8%R 454 00) 0x0   ,0S  < 4 (%R C<5P(%p2 0s 400) 0   0Q4 ZQʨ&0) %R 0S`\KPE'p@0@SP 6&0@SP6ONK@DP) 0 PSP6) 0PSP(@ @廪  嵪 L p A %r3E0E0@ 8x00MKBKK PhPK@ALI @A L 0ID L H PUd@T]0SV0 NP@0 5 @YP> D%804 =KH0Cˠ 4 $5 4 DL5 D 4 ]P H%$Gp  R 0S:HPڠ0   50S Rܦ0S v @P-$D,:0=KEK0CL0C 0 0.S\: Rhfp 循;x 廪/x Ax0 S X*N>K0Cɠ@ 0Cp* @R .x05 yPP:`@+0V@0  )0 RPX%JXPtO.K B< B%cPc4}DP4  `J@TO^KPEPE 0 P@540S {tDP0vT4DP~ XjD`l<Pt` |04 -<@O>K0C)0C D QRP [KNK@D nTO>K)0C K0C 0C4 -RD-D00.% t` uw$l=l ʦP| % 1 PP` JCP 0 U bD,%0\-PP0  P$ 000P hl -LM8P |0 R 0 l00 I(L )t&P 00 @4 @ @ @ \C K Q@@ī$<00    0 ᔬ -3L$M R 0SS@@@@@@@@@pp3  P\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p V0P0?@ P`2 X0B0P 8 x,@K<<@@<4 Ġ̌(<"4!Č ̌$1 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K ㏼P,00CS 9|99999@@TT(00T (00 -LM@ KPP"6p` 0 pB0s 0H @0P* B$k붝LWܬ<H0p -T0LML @K0*0$B000 60s 閝ܬLW< -LM@ 8|0 Fp jlP -L8 -PLdM96Px|l9PPXhKPd0K@ h@ d Ep  7`@@jCo?@{Gz?~@Xdtlx;pܬVRP? O [( O X ST \h0h8P XT`0ԚP@p`h -0L H# -LM`0X"XB00P0H0PPE 0S00(2(- rP000?b22 .0S ;,9,7,5,P u@a-0SPE %,U 0+S-S0S.P-P .U@PE P`U`@PE0SmPfP wPr P ~00S 00SQ1 ()k<;IPBPcj_H``DtdLltx|x0 p-LM@/P `,p -LMP<@T00.0鸆0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SA/;cllL -L0MԂԢ 0Pp(0 PTPK 2b?0S @@PH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T KVhp (0S4(録la| p-LMP`0,@KHP 0 + |!G 0Sp$ -LM@P  00R0R  00Sh 阱 -LM@P h00Sh 阱 0-LP@P $00S0h  0阱 -L M K2P@![A[R0 ʐP x0td P00TT0@LP 400 PP00ht@x08m< -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 8pP@us*`0A>@t 0 001 0*l (pP|R*?T A.0O0P000B>0,10S 4PU/0K000 q*;040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0頱̚h -pLM@ 00s)0@锲@-`@? 0"00\ 0S0S000\蠱 -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$頱h -x0LM@ 4 BN@Ap@0t hz 00Np頱h 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0頱(00S00B>0@-(0A> 0$Đ6I 蠱 -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 頱 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc꠱5=?0/9P6 0S000ᘲ p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0x6pqph(p頱( -LM}3Px 404@0  0000 0 00 0 0 00  0?\00꠱ -LMX@ 0S 00 0 @0S0 04h꠱ -LM@0 6pq @ -LM̀p`P@TC@! 3A>B.A 0 0$D4 dD P  40 40 4stod 0-tP@0L 4@ 4@I 40 04T&0@0h0頱d00 ᠱpD0 00000Sp00000S pp0 000 p -p000L00 0S0  Pt t;P@ qL0 0000 0S8 0(0$ : pܐ8<@(0 $ 00 0 ἳ -L 00 0鬳 p-LMP%%$`$@000%000p鬳%ꬱ -`Lp00S 0P@w%x 0 0S %l%0 0 00(`S@0S0S鴳 0-L@LP 0LR0 0CS00 00 00鬳 -鐠p0 刀0b? |`PUL@0S 2$%0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U u$0 @0b?TU,0@ 00c0m^ -PL0`0pS @$ 0 R $ 0 0CR00S 000$$000鴳 p-LM|` x0RR@$`0`P0 0R00C0$00`00S c0Sp鴳 0-p@LP$`0P0z$D P:00@P*0P0鬱 0-t@tP0LS 0S 0S0800 P0S00鴳 - 0L00S W鴳 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0鴳 -LML@00 S00 S S 00 SS鴳 -H0LM0@S ,0@$ 0@]00鬱 00ᨲ 0-L@dPxxww(xw0y yxxyy8y8y8y8y8y8yy8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y8y0y0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&|̉lȑ܌ H40D(8ܓ0,p`܎0ȋčpDH 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S   -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S [,UVP i; R R E20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S5 00S 00S,pWZ00S0   ,0S 00p 000 00SYk 0 o~ xXXh -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 x -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0x -LMp`pP@uV iE 0S<00S,00S 0 0S00Cስ'xI P000Pꐵ -P0Q0L00 00 000鐵 - L00 00C0鸵 p-LMP`(*@0  000p P0-L@P@ 0T庼0h鷼0d0PPᐵ0PPᐵ -LM@0S00ḵ p-DPLM@`T Pp@Tp鐵 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+hp@ UP@< P00 P8p0t T =  P 0`V00S:00 P``V$0P@` P@@P$@Fx00S00 S 0 P@ P pCP@ĵh, -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P k @0Q P 0Px00Sl00 @,@ @0PU`XW,x  ĵh, p-pLM`Pv cP;p P P@0P`40`.@0P`p P P0`ppx -L0SH hp0 s 0 0  Bhx -LMp`pP@u P |00Sh0 tW V P@(0 f K!$8\ -L M@Kq O p-LM`pP@uxEpP@uPph UT0 ph| p-LM`P@P  P psP@$00S/ ph$ -L M`P, , SP,0@cT A dxuP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@鴋x$ -hL6` 0S 0 0S<0040   0+0 ؋x8[ĵ -p嬀0L`gPPጠ _@T0 W0P0G  c$  bz$P@`ĵL0 0DS@0 80 40 00 ,0 00 0 dTX\`lh -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 $1P a,1UP0!c0@P#P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(TpxXĵmd p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 XdT@P D<P`X$0 000@P $0 000p p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp露T -@LM80 00 B0 @00`0TX -T0LM0@SJ@000S P @TZT -0LA Px -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000Ph4XĵT -0LM00@0T0p` Pcڴ10U 010`@P`  TJ1U RZT010Pe0 DPPE0 0U00XHdȵLT -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c lpHXT P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P 0 @@0@0@0TP 0 PX 000P 0 yP  000HT\P4X 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000lpX4ThP00S 00<0< 80Q0(000000`L0 0 ` p-pLM@0`t lPPCp@ p.,@0t T T000CUP800@&P@0 V000pĵ -@0LMTpP-P $@0ꌀ0P0PE( P@ p U `ZP @0<0Pf(0PE0@W0000ĵ@-p@T* R  :P0b0D 6@0@@0@0 蠴|< @-P 0S 00Q | -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 | -L^ 0 T -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   |hT -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp4P(0`ZGYE $1p0 00px  0@0P`Z,Y)p P ` V U x0p0 00px  0@0P` V U0 |h -LM P@p` P@t0u00X00S T00XtuP@tTU@0x -L M0-S eGEC^,  g*`P ^LPp% 0S" 0SIPP` @@@HP 0`U0S%Pe* % *Y L `40 , otL+Њw 400S Aa0@S<0 -A @L2$0R20, -'PLM! $P .P ^P@0 00 `P|@000C 0`@`000T@P@ 0s0s(xd<@ -LP 0-LM@ PKT 00000d -L M@K0,sώ0s 00@3d -L M^@K |0^0s 0s\0000 H00 0400 S P <d -LZP ,0, 0S dP@-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  0lX P-L0 h~X`" 0-PLM@Y P 0P[0=0C:SG0LLLLLLLLLLLLLLL(LLLLLLLLLLLLLLLLLLLLLLLLLL8LLLL LLLLLLLL@lPhPdP`P\PXP@8PD040K 0(10 e0\`dԻػܻ̚PPP0PPP= -@LMTd ThL0 !@<840,h鐌l0h -LMЁ0P@$0 * TTbA`? 00B S10 0C00B S0hQQ@`,0,SVVE1C B(1`$1 <qK 0S#T`VPK K@0@1` 0`V@K0@ `PK@P0@`0P KHP  $0S4$̵ȵHLN\4̚č -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e餲̍ -l0LM@QT T@ hN$0  hl0 R008x -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RVhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhXXXXXXXXXX$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[_X$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4|0 W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHTX` -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSWLDDDDUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  @XtpQ PP -LMJ@0 `L -LP0 0S00 -LP  0   0PT -LM0K0 = -0L0hT -`LPp@`0PSE 0$S T; P80 0C$S'p||||||||||||||||||||||p|||p||||||||p00@f ; 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X` -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ Rdd(ė\0S R 0 R000000ӑS$0SdpA0@Sa @0R0-P00 p-LM@P` ᛊX0@0P SP000000STg0Sp -LMK -LMpg`@@@, 0P` -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) q0 K4\0d 0\ b0 K^00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS   00CS HPXd`@T U7`KPP0DS  0@phX p-LMD`DP0@S 00P!:P0  Pp霻Xl 0-@ L08PS@00' 0R+0@00TW -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hp`0Z-00hH  ,0 S ,ܗ -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hgp`0Z-00hH  ,0 S , p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a f 0Spgfff 0-LM@P0$@K 0 O2 0S s0 0-L M@P0@K 0 }7 0S [0 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@f T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShL D000@000T(0 hPlL 0-L@Psj 0 0鴻T p-LM`0PS@ t00SX 0@S  @00ScH(0 0S0 >plLpT00C p p000C 000C?001xл0@-H 0\8001000\0 010xл0@-<00 CR,0010 BR0 000xл0@-8 0R (0P@0100 R0xл p-L MP` 0@R$K0S ]0 /00$0s 0s 0 01$ KpxXл0@-P 0S0S0X@0^! 00S 0SN00^0лx 0AxP<00 r0s  Pл@-p@0\`0 0r0s 00000\0 xл 0P PPB@x -LM\X@TLD@0 840 ,(0\@ԻػLܻ p-LM@/@`P8 0S BPl   70  p$$ -0LMK0K00K 0-L M8P0@K 0 . 0S D0 0-L M8P0@K 0 N 0S .0 0-LM8P0(@K 0 n 0S 0(a -LM@u q0r00T00S 800T@qr x -LMB@6P񟗓, ,,,,,,, ,,,,,,,,,,,,,,,,,,,,,,,,L`,h,,,,,,t1 p1RDT10SD1@18B01$1@0S, upq' P0mp@q aQP@@ T0 SPO@@Fp q  (0\P$\d0h p-LMB@6Pddddddddddd\ddd4dddddddddddddPp|dXdddddtddddddd<pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?n@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@~t0 u SR?P@09 ep0 s2  0 _0 S*P(Rph=Op0 s ph| |0S0S S00CS00S S p@,0RP phph-pxd$\2 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf0B0C2S=xph0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g$\C0Ի -D0L<080`00 ,0b A0 \h(0$0 0b0c0A}ܻ -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00p`\00SH00S800SSS00S<H40S r0000000S0Sp000  $00S00SD -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp(tx -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CVptxx -LU0S, ,h0S000hV(0 -PlpL† @430SX L0Sh=@0S⋢0PPD -LM@PQ=0  p-LMP `@ (0K l0 0"T\XPP (0 00 pD 0-DPLP @:T000  004,@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Qpx(@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@螡@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R_@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 T@< -LM@K=0s0s n0 c -Lr 0 0S0 h( -LM@P  pP@umP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u @x -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THh -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P 0D`(@< -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0,4ĵp@-`^@P  \\ 0S 0\ 0SP@Up^p 000h 000h 000h -@LMTP oDl< gdah]5(5@5 -81LMXH @@ K|C@ [:nT0  @`Pp%0S0S 0 0?00`0  X 0S L0DS$0   ih(5xPT -LM0$ KK 0 0 P$ - L P00+l -LML0K Ap@T0[S00KT[l -FML M7GNK, t7t@D @D0`PXX sD'X<p 20@FS99????????????????8????:??8???8?p:?::???????????:8;L;X;????d;??p;??|;??==>??`>>6 R5 5 R0%<0uKA $P00Q0S Q0(8luKA $P00Q0S 4; 5p$5 k5 gtKA s$?Q0S 08:$000N000;0@008`4 R$ = KJ p pGJ HL$ 0 Ps /P* P P $0004SP0;000@P P3 R3 aP3  080@0 P8  Pd3    P43    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA $P00Q0S  n0$000qKA $P00Q0S U0,0|qKA $P00Q0S l?0 0$qKA $P00Q0S )0001 `bVQ$B~KpGpG`\P  2P $0HP cX0-S jx )t',pbК 4LdXt0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX k&>opn00@X$`pZ p-LM&> @`@KS NP PU$@p@ -LĠ[D 0Pp`W , nrp  P O00 -LĠ[D 0\Pp`W,  "p  P( O00sd -GMLM 0`p,0 CMK@D@D 0PX0 )K /oO~@0  pX `V@$p,0 S ,巗T -LMO뜐0,0 so P 0  @lP@R,0\ E0[S ,0 R,00ZP`p,0  |"`Мd8 - 0 S[RМ` -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@X0S o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Op -LPE@c@@4@Pc.@Pc@@  -LM✀oK@pP, k @<L#NP@Pw0N,0 S ,˕ 0L -LM`p R0 @ˠ p P̠ 0Xp  @? 04p  Tl| -L,M|10  00S ⴮PPkP@0 @PP `DpKAA0N0PDK0000 8PpȾ -LM@|30 ` 0p0S. `PfM1 SB  N! 0@r!0!! PpR \!!!!!!!!! O,P) 0 !\!  0  ` S ! 1 R !!PP @ @ PE0Nd0 , P@! ^,!00p@ ^0 0p@  ^0pP@ ^, 0p@ ^0 0tp@0^ p p0\cx0tlؿ4H p-L MPq00  0`0S AOpိ@11Tl^L t @@o! 00@!0!P`p0\cx -LM`|0@ 0 0p0S$ G11.QQQt@0SPU`BLPNHN@ ?_0Np0p\ 0-@LPNs0騺 -LM␠@0`(0 N`oKp_90 p`` (0S (奓 -Lc 0-@L0S P0  PN0S0 -0LM@ r &> KU -`q00 L 0p0S2 @ᚬ P%P#Uw 11>p EN11>.QQ$ D2N<}K Dzp$Np,T\t 0-LM Pv R|@|K  0S@ pX K@0TD  <"L弍 0 L p-MLM`@0 0 P`p* AK@@+0zTP! T*AKAA 0r00000S  r\00000S 0S@\:۰0 SppĊ-Q* rh000000S  r@00000S0S QQ:p p-PLMU`x x0]d XX 0@04PP0P"0p8 p-LM 0@Px50`0X0S 00 0 0,@P @ p̚8 -0 SL0S S h0 hr -0LS S h饯 h -LM0@S S   h鯌 -0L w㯆 -QLM,  10S 1 0 RA000x,  00S Sp1I0S; `10S7T1,@<T@@@@ ! 0Pp`SO1 0p^UPP$X U`00Q` e Xp, hP PP `pchP`0`@"H0 , j,0 0!0 0 000|hCl6y 0-LPnP @Te0h` p-LM`)P@P 0 SP UT0  IKP00@  6p̚ -9LMܩ 000`fS0  eS gS )))000P@00GS񟗰``````````8Dd `````````````````<`(`L`````Ȅ`dЄ؄````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````dPT u6 0 00 R5 5 5R95 ! 0 B 5E ,K喯0, R( P00R0S p AW\5 \EPD%00@%6 ,Ky0, R P00R0Sp44r44  44 4 D$4 4:$$000htt0 0 0% X4ZTT 0+@4P<4N4:N830000E3 3<3   83 33/3)3 3$3"3 3330CJP<3hBP P;P <43 R$3P0@S@# 30!)pp8P20 P2U0!0 `c TPV20S* 0S00`F00  10hS"@0003@2 0T03 0 h1R0S040  008P \1 .P !p  00 0 -LM@h@- 0@R:T 0 S* 0R S R  :0 0b0000@ 00 0DH -@L0P00   T00 0D S0<PP4 0 0PS0hDHLT8 4R00C0 R0 DLH -LM@T- -LP p-0LM0Q 0R0SP  *P`3S S S4 085 P+P@p -PLM`bPP20StI  P X20SC<<"0@S@00K 0` <@ @@ 00K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SJq0S 00S0G GP0SX,E@X00 R00S!EX 0S0S0SL 0Y0 R00S <00SDG ̚xTPxT`x -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0=P10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR kD0 0R00\h0 : -00C0`htdxxTPXx -@L`P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Qp` -LM@P[pt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S P0@ P00C0044 P  0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, ̅P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4Spp` -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,p -L׃Pe 0p -L.P[ Tr0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0p-\0Q 0\ a p-1LM0`S@PP10S U t0 CR 0R0 S 0@00,CP$10S U 0 CR 0R0 S 0@00CPU 0 CR 0R0 S 0@0TL@0 (00CS0 ph0  0pL\4Pm -LM@PJ@`p!j"pF@K 0PD4||||||||||||||||||||||||||,||||@|P|||||||||||`|` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$b$X~{ p-LMK/P @P`J011QhTZ MP@Tj_EZpD]P TP``" -LKM MCNK@D0@D,0 pCKKPPPM.KAAbP@4: S  S \H,0 S <,备mK`F`F P@ PP  P@h 2 R_2 R BPO P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K KKNN( 0<K @$P`! 04 1D MNK !0P o0 0xB{p B@P p @0MD@0 0Pd :P $$  pM:0P 0 2P T]] (P@T Ph5mK`F`F P8~̚ -LMp(KPP3 @T `W@ W Tjo(TPZ ( D (00(PZ ( D (00T>B~ 0-x0L0PS0@Q  P 0S(0 R00 R0$ P-L` 0S nS 0@ ,P@ǀl0PP@p` ,Pp@0oS` >{$ p-PLM@ PPpP .P 00P @Q T`ܠP. P 00РP 0Sp -L 0KM#+O -L 0iz 8T -OML Mh3PJK@@| ,  K 0CP<P P| <0$\-PPL 0<1 ybxX$Xh<y -LM`P%P( @(K,pK 0  (0@Sk  -L M0@p00 0Sf &?PP 0S nSW =P0`0@Q  P QIQG  0V0P . 0' Y0  0000V 0`0 ,Kᛣ, ?R0S@p @;0"Sl 0Y000 LPH00D 0oSP Nzzzzz -L$M<@K`PPD  P40K>PsC圃 -0,0K * K#pr ?0L:Slꬵ dDdXd0000S  @@K,p| @ ?@ ~兜2000,K +K.0Se D 00|!0`VQF `Fv  P?Pp   0z`Fv P@ pP P P pP@D0S  Dp\0l 0 a>#40K` XbXĈwyl~0G{ -LM0@S\ PH P8PP wyl~ -ML M0ß0`@( ,0 @q3P`d088 B~KpGpGP"04 0X T048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0>=08@Tn 4 p@` P- U|4|X@ 1 ,0S ,(KAA =P<8#4P   \T P=0WT ,  "4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P `y^y\y  0,<P%p  0 9, 8 R" 0PU 0S  0 U  0PPU8>84P00`XKc9LL%L`t4C<1L @ -LP@P : q00  R.@P*`p@T  }P0 R @Tj@0 0 000< @0@000eP`*p 0-T0LPU @8 @T ,8@T PU0 -LPp @`T P @T@74 100 00 @@m p-LM @`P 0PP ,0 R Cp 000p -`LMP@(P$1$fPp` !T0s ?S mS 0Pp) x0 PbQ VU UWtV fr0 pR0`0sCbX -LM0@0cSZ bSZ4 `K  0pR R   0 P `V | $40"WĂ,(0 ("4S @ %P $@`̚ p-LM@PP`pP$0S`~8̚ -PLM808 4 $@, D @xq P-L 0,0, (+$9 0^q`t -Pp@LP;`"dpT@6 "P/@@@@@@@@@@@@@@@(@@@@@@@@@ @@0@@8@H1`1 11111a Q@b11 RQ ||10sM P % @+P9x00]pp000xbX{ -43L$M `R@P#TTP0-S  @P񟗩8@HHP 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@PPDPn@0S_V V@ *0SR 20S@T:7v1LP0S   RR 1 R001 6pP%|1 R\!0S0  DE60S0C00 :636+6r30 R 6uP` 0  @@]PD0l$ ^ \L X@|   8Pt0p -LMA%QCd|@xx0  Q d\0S P 0R 0000$@[0,8 -@6L M P0R@`,P 0 4P { 0gS 5@DT%U0-S 50 , K P5 RPP |||%U500@DTd5d%0Q4  S4  040 5 s 54 PppRp@100 QPP 103S 10S4 R0S ,Q  0S ,0@  0gS 144` R4@4P<$ 40040SU V V4U7V  4U00T00S 3 R340@S (3 R 0k`4\ 2 b0 0, K4 [0@-SB(($8L\ltl((((((<D0 0@2 z|@T , KO4 0 @T  B@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T ^cyyph0$ @T {|mC T(|oЊ|,L -PLM@0!P@- 0-S ,@Pt080hz0000 -P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S  0-LM@0 S  0S 0S0S0SP 00 S 0 S |Bx00 K 0 (0 $0 0 PDPU <P , 000i \) -L$M şPpP5 d E0@00R0TH4P @ PU U ğ 000U000DS񟗽 \\\\\\\\\\\\\\4L\\\\hHKLK`d 0D@ H @ <` 8` 4` 0` ,` zP5L R-0S  *LȐ R R H0S U 00S0S 1#$0$0 0 00Sh P 0H` yP Z00U @ NP a=P Z0 1`V@ 0I P P 0 ( "# xP P41 R 8  $00`%R U 0Sw0S s0 000l\`\@TL|D Z<(L`|x -LMP@00S p SpBT  0ϒ005Q^` ^ T0 U   VJdxxL$,8Ld p-LMHPH`@D-$ q0-  k L@phL@ Q-L`pX0L0CS00  ä0(mC  A -!A00CS00  ä0/ P@ WT% T# 0B00RPP@ P@ W T T JTs- 0B00RPP@pp xL Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh10 R \(0R \ 0 S0 S 0-,@LP0S P@0t 0-LBMQ0 0C @S`888888888888888$8888tMM ,x^ 0S dq0 L ~ 4F/K< L -0`PL@ p 00B S0B a0BSWBA0BS7BR@Pxt` `Q:0e0b``` -L@LM "005P 0;0T -L M0 K@ 0R -L`,MDKHKP@  0D @ ,@ <` 8P 4 0` ``lPpmHP k`Pd   0ppWPYH0pN)V V@ *UL0T 0SQ 0@T:k`0U0U@@T P  0@ 8 DP < 0@ 4@ @@$p) HPV )V@*0S 0AT:kGkP` 0  @@pH0p8Z(0*S  r0HX`p -PL$M6 P- P$ P0 P0   @0@v+0 R0 R00x0 R"`0 R"LLL@ H,0D@R+,x@-@T<0 1  0B0R \ p-LDMa0L@0  PRJ 0S ~ X KX@PT9 0S0N j0TS0@  b$H D*(AQ   *$0  B LR 00,K*00CS00  ä0 0S op d0R PDP0 R0080 R0"0<DLPX0`hx 0-LM@0PS3 @K bD0TS  c@0PS  YLQH 0  x0D0 R " ,0 R " 000x0@ S)@ttttttttttttt\ttttttdlttttt|<0S88>*,0(0$000tm p-QLMP@" 0S S Ul0 R \0ph*0 @` *p0ph* "48<#hx̚ p-LM@ `P)T=  0K0ES0px)00CSHPX`h) R| Rttph)lhd`\XTP(D@)$08@LPXP 0-L\P@ "10Q0S aT0 R 0h)0 0h|)0hx)Q R R  00S "48<#800000Sx|m`̚ p-L,M` 0@@KR0 P !KT*00 R ^:006) 0S 6nph p-L$MPŸPb0 S @0x Rp 0S$  \                       r0 S mp"R 0tt!d` 㾻T 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`偻dP0P 00|.jP ,mrpy|Dy 0-PLM @ @T T ,|Rt0d0 RK 4PP .6P@  QP@Dyxy -T0 ML\@4 <@P , xy0 p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U (!P`V ,pU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HP$<< (PP`xDy -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <P0,(!p[1 ,0S ,pl M0 S- ʀS S `V0 00S SpppS SpS SppppDxy0 -LM0@0CSDXXXXXXXXXXXXXXXPXXXXhh0 h!h#y0@-d Q00XB.P@0L#"\ 00  P0S:00A04 -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!,@K P qZA <4(<"4(< p@{*4@8 <#8  p bPp p+[*[)@[(P['`[,0[p P@ P`Y00S W*00SW:$2Vd`  -0LS00S< 0S S hFh0 %(y-^𝔰1S00CS$,4<DL0 `R$0SDHLPTX, p-PLMP@a@A 8刮00!S 0 倮0!S0 偮P0 p 0 p@0S ¸P 0S0Sx0 W R 0S l`P 4凸 @0 <0 p$d<)( d -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8@,<P@`()  00VDL 00ND 00FD - 0 Lҭ0 $L( - 0 L­0 $hp( - 0 L岭0 $( -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1傭$0P_5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0b $0$0QR  0v$0Tpd$( # -CML M% P` , \ EK@A@%f3P`4 55 T`4 |5 t5 d d垾`50S y R<5 t 050Sp `4k4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S : 040S 4$4Q T30Sc0 0S30S S0@04P0@00` 3P@~d}43@\4XT30SD30S `43P 20S`4 `4 20S l 2@`4"2Q\20S@Xb0 v0Svh20Sr TR0@P0L3P0@00eENK@D, `4 0fPX4S`4MHTUH 0SE 10S< `43P6 p10S T10S <14!41Q ^@10S@p0 0S00S `0@0K3P0@00P 0SEK@\4XLd@0  ,0 Sh,+h $(%##)p`# X#8HPH0 `- 0 @ 0^ 0`  -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"1P 04S44 2Y4443PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAAV P44#"/K0 P 4463p 4SP44  RQ  0|@h0 Xa0 ,0S@,.gd$()p`# -LJ7@00CS00  ä0 0S t00S h@h0hP`0Xp01P@`p`p0$0$#X8# -ML M" P4 , 0 ʂK@ A@"0P 48 2V2 48K t2@ l2@@@#PP H;8 @лp R 2 k 20Sg KAA3P1 '[481PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S t ,10S  Q10 S`0 pp0S00S @PpB1P0P0004 K0P@8㻻80@ ,0 Sd,'f$(%#)p`#X #8#0 Sᴾ -LMHCD\ <<3|8#0 ,僩 利30So$0S 2 pu`$2r20 \0Y2 RŸŸ"2I2x2`l2P`2@ L03<242@ 0 '2 21@{ 010S !1 10S !11`X1@T10 |p1pqHh \1AT1T \|00<ը0S(ب0@T Q ƨ0@TP0 $C 4#Dl#\h<)X,T) )x(#$#$#@` ( p-PLM@P`0S00P xP00 \P L0 D^pV 0 Rp鴾$ -0L 0( - 0L0 0 (# -0L 0`( 0-PLM@ !0S000.P 1 VP QP0 K1 5\0 0  |0 0T0 HPH@DX ާ0S40 8ק0ݧ $#($<P -0L ? 0T( -0L 3 0d( -0L ' 0|( -0L  0X( 0-PLM@P\1 T劧 NP@!0S000!P ~P  ~P0 T嗅0P @,㧱0@0 @0S 00S 0Sh0W00`0@0 P\04@;0 00 0$,#( -0L 0( -0L 0( 0-PLM@(1 %M~P1  # E~P K1 +\ 0 0 00 0S000hPt 0@S00000.,0 D0Ʀ0( S0000$0X(t -PL M   KK,P 0S0 0埦0 0P|@0}S t00S\0h0\P H0R@0 P,0  $(&# -MLMp0P 0 00P0P 0 Y`7.P0 Pq ANK @D@DP X0 \9P^ 80 V^] 0S( b$(0< -PLMd   KKW,P 0@S 8080 (0 0>@$H( -PL M0 , ,K0K0!2,P 00  11 00 1 0 Է4 i$ R0  0S 00;-0S 0S0@0S 0P0'-P0P000 1,P0`@4㠷@$(%#@#X8` -PLM   KK+P 0| SKK+P 0\S T0T0 tD0 00S$0 ht|$( -P0LM0P01@0P1 J夯p 0\``P -P0 PጯP 00|S  -P ,Pp0  X0,0P=\U h8\0$(  -PL$M0 , ,K0K!7+P ,0S ,K0K!.+P00 1, 001 4  4@ 3P 400|S 4K,P 4\<,PP1 00@ <1 41 嵶< $J1p0S. ,00CW*Ww0a050K00`!50K4b0pS0@0S 0P000,P0P00h00S ,00CW<{4@0 P,0 [$0(%##X8 -ML Mq0$0 X`TPP@P@@,TFC|PP 0S`Q/P@Lq@BnK-0 K@`F4!0r 凮P+0 K0 10S A' X00  00  `000SP0S0q0#00p`11`CP 0S 10SX1P1 1h10S ,A0 0 0 4 04 h 010U PUC5S 4Z3,0 SX, X\$(p)4t -0LM2 L?@0P,0 B tQ  xA "  yB$ϟP PB B F  rPp  rP@p  rP"Pp"wU`/ュP` 0STlPV 0STH2Sp1 p p1S p10ST B0T00* Cyt t1S t yrPt1p t qrPt1pW 0St /F3P 0S00bU ᡯx x1s  xKp=n/K=00p3P<0|1  p,僯| |1S|0 1 YP㼬<P@8= 0! pǏ $ QP E=b  |!p` P 10`S1  <0S, <0S(,0S!0S:|<# 0C\0\00;$0 pÏR0S*<lx*1P (;0S3 ;0S/˟P*0S':0/P0S*p;#0 CR 0R000; 00CS00ä0;,ATH x#:0S: %B 0[S ]P 0:SSPp :P0@090S L:p 0`[_K  xt9T0}Kh1 0d1 \9  0Xp890X L@K $)P0( 0XP  ~LQ0Ux1 G SOK <垶P,90S 9 xx x1s`ȟ $ x 嘿P 0S x1@o  0@x1  L@K0@hPPU'ox1S Ux婧 H  0S8"ftQU 0S7d"\XǟX'0 80<'  :㈣P rwP@   %}PP &0gP &0X 劣P0& 6& 60S6  Q p\ ~/K P  !R B00S S S R B0! 0!R0 0S S S 50S 6" 'P` ` 㵔P  㯔P 5  R  hŭ` 㞔PLO\5 ~/K\P  !R[ 00S S S  B0! 0!R0M 0S S S 1SF <40S4" pP":N0`0K  v1Sd4 i2S 0 oP<4B0 `S,4 q RU ĥx1sxDtOO" Sp嶢P20|1  p"| |1Sp`,01 ٩P 1S( 9$(52P@3 0! pǏ!ZO OP0 1 K": " b0@PP | Up` P PU10S, 10S(H"0S!0S:42# 0C\0\00f810 pÏR0S*1ڴ1S00S} 00SyxPt0Sq00/P\0SY*<1#0 CR 0RM00J 8\0L\)t#\4@L{{̚\`p|* $,(HLh|t$ `x,0 00CS00ä0X0U1S- p0s 1S 0S 0R 00S 0;00S03#PR  Hp(D0 \ jx1sx:Nt8N6Nx!,0 S,pS -LM$@#吨$\) -LM$@#~$\) -ML M60H ,0 0L P$ D4 _P@ 60S'D4㸨 㵨x僴PX  0SX TyP\  0 S \$ D4H`D SpD4L$:נPi D4LT t P `   mP   mP5\P$   mP @gX$R P$ p/+@/ᢠ:Pហ@pᚠPW3 W1*P0#03U0S* TD @@ᇠ`@ ႠPVV*4 T4S 0S Y 0SD4L$ttT.T +T :^/`ZVP P`3V U  R0305`1:` :EPT 0S U ppU 0S /PpP30S t3tT$ 0PP 30SD@3 0V@4 10S 1U! 0nV BNK@D@D0!嶷x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 hLD4`$0RD4 D4HSD0`$0Sr` ,0 S,Q" ,$(TxԆ#C|<X(Q P-L`7 KP@u 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gpp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@p -LMl @k0SX  k0S<  k0S$ 0P 0  -LMP0  w0 -PL 0 V  -P- L0  ,0 -$LYM0@,0 4p@` [K寶 ᫶p4Kl  0h d `A SpP4"0L@KiP dP $LK 0ZP#LK P0IL0[S LK 0RPU u  ᦦ 3 p1Q,,d\pAP#P3T N p10S S_K <奰P,2 峓P`آ* ᤹PP0S U 0S S_K <zP`,ҝT Pc<P`@TV  1 p %icQ ذ0pt1 @i]/KpA EP J0S x ^?K 嵳Pz ሡxA00pႡ0dQS PP H10S 08 04PPㅠP | _?K,倳P00SA p0\0 0 ,0S,yO#,\4(0$L{@{̚\*{|+ 1 /0 -LMd@ 0 0CS00ä0Rӯ((0 0 S g$x* --p1pq0LS00`& TAT庒H P8 4 wP娒 +00CS00  ä0 呯P@T=0  !| @*偒y0 |͜P0PST^$8@HT\1h( -LAM M8B>K0C0C0 +, ɴ %@$ 7 p< 8 4 BK J4`J U'0@S񟗾$$HHDP 0tDPp 0Pu04S440S (D($ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 ͑X30 CR 0R0 S 0P0:Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4Aa PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0B4$RB>K 0C c R+#$y8Q 00 S Y44044 1V 0  < 0 YR# 00S <$`0RR0F<,0 S x,vM< 0 X(1$4)TpW|+- -LM00 (@(0 ٭t$+ -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$TU< <@T $d t< p<RY`<` D D D D 4 P`# <<0S $$<0SLPJ004Sb4S ]4SX;Q04 L04 娚PL; 4 R`T0|S 7$0@D4 M 4S$ V& *0S:`4 2zj 4S  ? d:IK4 4AA(P4: S 0:$pLHE>K0C 0C)00P 4S ۡ4 S9T 9Pz hPpI 0SG &P !P=D9`0S 0CS0Wj` 4@90gpq `v  4S8P@80<HP 4TSd8P- 84 $R P& ur4DS7@$P da4TS7P Y4S 4  4S  Fd7 0S k0CSh\ppS7/4 yPp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00K.K 6 B B Ɵ0O4Sʸ4S 4S5BNK4@D@D+%P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R0004 00CS00ä0%4奫VW0 S|4 VOh4#0 CR 0R00(4K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00<3P@ 0 CR 0R0 S 0`02P@ "p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00y2 00CS00ä0n140@ 40@ 0 S1 +4$St1 4#wŸ㿟4S2  㹟.㵟㲟4DS0@ 10S$1 "@P~004SG4 S0  4S4T 0S0S ,0 S,I#$$0#d +0̚<(T`@`h -LM00 (@(0 OG$t, -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` tPH H0S > 0RS ,0S X,00-S X>, PQ<>@ 4>0S H0S , .0 80 R@0  D0 H0 S  L mP! =0S =0SNP00@0S@<0S<(= p (=p.H㮞@0@0 婞< X,PS ,00|SO ,ķP@/,n@0S 0 S , @ㅞ<ゞ< T00,0Tx  T,l 㝷T/0p0WL<0S 0 S,P<0S z0 S ;0S ,o , ,0S HQ;0S  ; ;RN<;PH ɝPH0S X 0S D fP 0S  $ ] YP@ 4 40S pW%,hP:00 h:p) ,00|S D ,0 00S,x  *0S:`: ,Bf0 00S@:, N80 00KP0S;0 Y0 SIBBP0`0 `.0: S )0S009 H9@T 0DS0 0S 000WQppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST7?4077 !P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00`6 00CS00ä0w46V 0 S5 W W,`V 0S 0 fPPU 0p P@0S@0 fP,80pS,5p05 080 VP00P0  V[5#0 CR 0R004囧4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 l P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0<3P@ 42p`P0S CP *|0d30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00~P2 00CS00ä0s$2400@ 0 Sp1 000@ ,/80 S1p 1p080@Ǜ<ěD0SD 4m@ RH0S R0S10S 8 d1Rp ~00 0,K0 `p{K"s: 0$, 厉D0S`0d0D ~{l00S70 @ q<n#$$0# ),X0`"DdT@̚L 040p0(P4 0@P@@80S 00S08040S4l 0S0SJ@< -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP .HP < >¹00= =0 >K 5P 0S S0 L<0S$ L0S la < X}P(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 r!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p㡷 P1S00 0Sd >KP@0S S >K  P >K ) PLC P030 >K ئPxXC0r/K1 MP@S㉨PQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@PP 0iP R `2 0S82  <2D& QA Q^ ^ 8 0@X@B)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  P X@匶0P00  ,0 S,B\*\\,{#(gfff$ XH\,}~8,{Hd-{  -0L,MP؀0p0U$0 D @KD K `ڨ@T{-00'?[\H0K @H 垥P<cq $0S $A\\*,4 -LM@4 0S@0SA3@ -L 000 -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,&BΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 ێ ׎ Ҏ ͎0+11b0Ďb+ +⻎+嶎 j0S00 \#8,\*|+1d)(#$ -LM`@00CS00  ä0 >, 0$0000Е$x+x* -DL$M0D ,0 H 00 @ zP4@ 3#3Q040 3@T 30S 30S@@S0S;P 3t30S \3dT3 0S44P(nPP7Еc0@H ,0 P@ ,Õ00000 4D P`B000^Z,㥕82`D H0P堃㘕4"0@0P 20S @P10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 K>Pe00S0  ?00S" 0,0S@0   d )$@x(Xx*p@#|+'x+ 0-h0LM0 0PK!K0  @T0(0 T0|+( -/L`PPU1 1UU/0p0W 0˂@+.0PW0PdZ 9X0l000ͭPp 0X0U.S100E 00EPEW `"D$H -LBMAq0 S P 610S1  RAnK `F`F0X!P0 0cP0, ab10U B>K 0C0$  0 K(4 0BK @@ GPʰn00S0  HU 0K0 +PP@00S 0S8 >1x+(|+' -BMLM07,',70 $'$7$ H , ̟'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@堟P@ 0S )PP t"P \PP HPPP4g060 P5  t&P 0S50U0S 50@TI@]PP@ 0S P P ۋPP|ESt5P 5  `5X HP U P e40NBS񟗕8@Ltdl `l  4K#00#0H3=0 0 0 =l343 5,3 <3033 SP#h3% '2 2\3 2L30 rH300000S 3V 3 3  l2 0"Hp]2202 2l0 2H H P ZȶտP BNK@D@D+T2@ D咒04SBH4 P 10H P4P@ 1v sH@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 ay0S 1 (P@@T B ?@)#X\)#xiPy#Cd\dl#$b0pp`X# )" -L 嗑" p-LM P0` 0S @0S a700@PW岰00000S T@0S E00$0 $ 00`p14) p-PLM 200CS00  ä0 10S A喜AQ WP ᲌P^ @0 SP00U1P`1t0X!0CS00Ӥ0# PB p?0a0S Q00Np@ P 0S 00S0T0  00S 0S d00 CR 0R00 \0R T L ph$#)4Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^pppT p-d d0LM\` X0X PPP0@T000p)1p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p1yt -PLMp(M1@ 1QQ! a1~0p2V*Q 0S 0S H0`2V:6 iYP@U@p`0` l P \<~0< }PEU#$8[@Tp -,0ML  0}/ -MLM , % 5 嘛P@ " 0S  P:?} |oB^KPEPE0d%T XP5P0S4<RNK@D@D\SP,KR5( K·.χP褟 P P  QC Pd TP TTP .㰇P@ TP  `TP00c0S .㛇P@ TP@i  TP0S0@S񟗻XP %Pf[5"啇P P t匇P L3YK0AAGP5?P %0SB[52YK0AA/P5?P{ 0Sw*[r20S} P Plpp00 P  RqXr0So Lb11@P@U pP ` 2000 pX 0 P0 1pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1p+ 0 S0TS 00@T1T?GP PP6@P20Љ0w| <0徉0 ,0St,8H̚CL#p4T$ p-LM a00` 3p 0@ PS,P ppP"P@@\P0 p "P\P0 p P P P,P00Ppp8@0S WP 0S pHL -LM 2@TP 00002Pb 0-0 L0C@R P3PJ 0 Q000 P0-L@ 0S Q 0PU*020PU:20h20 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2{2 B0S22R(00S(0 2P 0Sp另,P 0S (0PP@20S 202 O{@ @厅2 @刅2 @傅1 @|1 u1P0S1@1P(0 z1d0S0`0XPV  OP@pl HP@ 0T.S@DpP0@4!zTp,, vP 10S11  V  `0 z R00 V   vP0z `$|()#$h02#P%)<)Ld-8-T#) ht -LM,Qp" ,   /K?KKP2  2S 2S&20S" *NK"__K,ŪP 뢹Px202 -P2X"廜L2WB 2  @22 2S&P`y놹P`V   0Lz1Hz|@KP!O|PKRiP@|0[S@TB rP@2S卯 |fP@ 2SX倯 PY@TXQ $OP ¿W00S&p0P  ?0 0A` 0@P0 PCP@P 0T,0 St,I6(!$x#) -`LMpPۆ0@T0y0 y 00@dP QP @T0P S00@@0 800P00$0) -AML83M4ß@0T,0 p0 3 0S 3@ SP @0S 0S 00@T@0SP@ 0SBi00SP/S  0 S R?VyDiBnK`F`F+l00S/S/00P+ebP?P1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@D1S00q0SX000x |P "QP@@ P0@0x0 ,0Sh,5T"\"8\l# 0(Q-$ -MLMpp0 S( P`L Tq0SHHA0 @txuBK@@$!PP9 1$K R01000ӑa0CS'0t0Ex 0 \05x;x(0 S4(4X$` 8\ 0-0L0M0@PKS@,  0 J0S\@0S嵽ֱ 00#VPz ʱ 0P -LMp0 SԀ0@0P`P P (KiV(0`P R rp000000S`P T 0S8@,w ㆽd-p$ -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p LsP \1\}w000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 :epP X0S 0h 1 P@@PR50S1:P~P@ ~K Ol0 @KIl k5i 1@o0ef2f2c BDLP I0Ϡ#PE0l 2lADd`0 @c@K70 S00J<@,0 Sh,n0.A>P?Cų$ -LM0`V *00`YV@: H1 zPUP@b`VA0S,0 :p0AT0s 0S :000CS00  ä0#  ǀ P@| 0 @0 C\0\00 T,0p0S,0 `V8)$ -L MD00 K4@剄p( P0 1[SP00~@$ht@8) -0L M@K 0 K  ޓ -@4L0H 00L 0 b@ X@  4     @@@  0 < H \ d x+ 0@   @ 0  `"   ,̚0@ -,0LM$@ Wn]n (  p-LMH P0S 000` ph`H@堍,H0LH0000 H04 H 0 &080H0<`ph@ -LMH0@H XD0,0H00H 00(0 H04 H0 &080h@ -PLH0`@T Vp,<l  0S`0 $W@H 0V0H 00h1HS@`H 0 = 00H0 00}=0H0  00'<0 0H 00h|00H 00 H04 HD0 &080H D0,0h]'P \ @ 0-LM(PH0 ,0@S 0R⻆PzH00SS S Sq$0L+P 0hH0 xH0@Pl100 H0 0S10H0 0;S<00H0@2S0?00 H0@ 2S  0/"/0B1 0H0 000H0 0S10H0 000H0 0S10H0 00 0H0  0S1 00h0d t +@ -LMH0@<0 ,H0HP  P !1P0,'H0Q 0SH0H0QH0P H0 H00H0 0H00 0 H0 H0 0@ cH 00h       p@  0-H0LPH D0,0H00AT 00߉H0@80H 040H$0 &080H 000h7@ -LM0p0S"(0H0 &|0PU  `$@0@ P 00+$hPUhF0  -LM0pS S S 鬀嬠ꨀ娠꤀夠(0H0 &0PU  `$@0@P 00 @ m~PU  &  0  -LM(`PH"2PppQ, 0R 0RP@$0 4GH 6;0S &0;0100 S+h10SH0@T 0S PhB@TfP@lh1S00000H0L<0,08KH,1 &P 40PP^p _  ẄPH000H0@H00S 000SP00H 0S@  0S 0S@h0 0bSpWhI@ 8hd8  D P h t | \ @' -L"PP!婍1`0 pR "P@8R 40 y0 804 0 P@H Z0 0d1S 100,0S A!P@$# @ ,N$ 0@0$ P@$4$"$@1S 100l0S !P@( \ D< l( 004     4  0-LM(@H0 ,0PS/0 S (P $H00SS S S$qXH0P0S0hH 00(H 000hN0\ l + -LMHD @24 0bXP@m0S 20S H <0S0@<0H<0S 6!@0 <0H0<H0<jPTH@ 80S 6!0 H0 8ḉ80080H`Tq 68 0RڣOH0  6@禉@8@80S 6!080H0 &804 0 S0l080X8#8#$H@0$ ࣸ$H0`$p#及 !4H88<#8hcH\0%0@@8H0804 m@   @ @' p-LMH0@P>H 0S 0SDH0a 0S6 0 (H00,H0gH0QbPH0  S00H0 0XbH0 0@X000<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPS|H0QT{H 00H0P & 0D00 ph @   p8Tx 0 -L M00PH$c(0 04 SSpb  6#0WH 00840S<0S 0,Q Z5PH0 , < H@0S 0 0RpGH0dH0QPD:H0Q,H 00u80S 6"0 5H0 8]80080H`! 680QڣO$H0 8M@@8@H0S d1 80 0S0`0808K /H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHL$H 0H0%@H 40880 8 (0S8($@+     p-L MX`0P#DHL$H 0,H$0%0@@p@@ -L~KM pGMpG`P@+@K娊H!@⣊H0Kt6 xF 6U 0e O 0 v>  0eO 0 v>  0`eTei鿂1@ h|T8` p- LM0Qq`P$0  r$ 0 0 r$0000  K@ $K $ Rr(K0 (0 (  0p@ -p`0LH@d0&PR6W0Sx6 pC6 6T0Sx &00 << U $(  h@CsT \  -ML M P, ß  < 0BS8@<K⅂<0@pK@0 @G 00T`K0`T0 S" D 1 S@KHK0hPK0{h0 S X ( R $ R pzl` Pg '@H &PR 40S0@P 18SK===8>8@4DH0 &0@冡< 40!1ZsNK@D0 @D4 H08 6 64 1d1Z`P1\!sNK@D @D8'H04 &0!0 04 R8@Z ZK'P  0S '7` 0V' P7 {NK@D @D0h ᥆  T,0 S@, @H4T$4\4HP -LM( 0R@40 ,0 00  Rq, $P Mq0 X Hq4 , K 04 (pK0!=0 ( $0  `40`V0 Z_0  _P t p,K l(, h0K d$0 `4K \4 X`4 S84 O`V@Z0a@4@ -LM_0 @ 0$0 @ tp$`KP /E0 0 $0 k$4Q 0( S (K_(@@l -LMt_0p 0H0 &f@ p $@ BPP(p  (K>P00P@@TP @(@ $K ڏ ([@@$ -1L M0H`p6p0@S 6  _P610=S 6p1S&P h0AW2PP@ZFFLFV6 1 VHp@ Ep0@Ap@@61S2 @0@$S `S(+p0T` : $p@ !p0@p6@@ 0 <@,T 0-T0P0LH@60S 6&016P1S060@-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@wpT 0s YVSj00p@\ -LM⁁@P4 8 0a 4 8`@UXKJXKJJJJJJJJJ$KXKXK$KJXKXKXKXKXKXKXKXKXKXKXKJXKXKXKXKXKXKXKXKXKXKXK$KJJXKJJXKXKJXKXKXKXKXKJXKXKXKXKXKXKXK`K`K`K`K`K`K`K`K`K`K`K`K`K`K`KXK`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`KXK^@Th00pW 0< 084p000d -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$opV @p 0-LM@P@ .R r0\00000S0S0 S0 S K6PP 0p -PLMpQi@0T1* Rr000000S  0RQ 0 P`F0'S"S $S `S \S`F\000`F0@0T:V001pH}04i p-L M`PFp P 10p 0@ۂ<96MK PK0  ` 1Kdp@~0DST 0 7pH`" @T` -1L M0!H0 Fy <00  0< P1<  0041   001 1K/ P!1`P ̌0\000p``| 000 000 h0[:P@ ,PK 0s ? DmD0P@$ (@ -LMp@ d+:P@ K r 40R ,m l -LMb0PH0 pK F  @@%P񟗊hSXTXTXTXTXTXTXTXT0TXTXTR|SSSSST$TXTXTXTXTXTRPSXT!9pXlP,g0 ̱ -2LM@pT @pTP` @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^ ᛀp 0#S 0SoVjV@T P0  0Q0  d0RT0SL00S@PT,0 @@@ȱ ,g̱ -AMLMPzK @(pGK0C 0C1 BS 1S @T0 ,0S,=P0-H0@0 80840400,0 @t2@x21@#2@@ -0 0CS00LӤ0Ta ^00# P 0 000t0 00p PPQ8 00C 000021@x2@#2t2 p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00px2t2p@@12 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 0002@2|2@@@2 -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(0002@@|22@@2 -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0p(2@2 -pL`P@xP000PP px0000D0SCX0 L0@T<0T49@D0  02p2l2 -pLPBo@P -P_P p0 00000S 0 pt0 000D\0Q`T0@TH0T@@D0  , 0h 2p2 t27) -LM$@" 0cPD --LM @0| Mxp :10S \^T H <*10S ,,Q$nl<l8̚Lx --Ll i0T TMLD 1D080S ^$ И ̘l<l8̚L --Ll C0T T}MLD 0D080S ^$ 㪘 㦘l<l8̚L --Ll 0T TWMLD 0D080S l^$ ㄘ 〘l<l8̚L -L`@PH pR %R0mSEQ0L osp` PD"@`PT@D ń R00̚ --L@ 0C<0 ;/P@XG4P@`<?T!0@@0 (/P@4! P@-T!0D0 P@"T!0H0 :P@P@T!0L0 :P@ hP@ L;TT!`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @D/d/l|//// 0$0P0 0-LPleP@4 0S0 P0l0 p-RLMP@` 0S(0 h000p|0 p-LM`@ 0 cᩒPPh u 0 0bU *H{p0#S l0S uo wpht000 -Lp`P P@HY tT<U;t I0S E0#S hH001 -MLM$0KA ,0 `hQR Q Q d8 S)KAA ld8 S:qXlPP dPP0 l(KA Al K+B 0d(0Rp8:spP@ dP@ p(O>K0C0C`#8 =md8! SD5;<#iKA Act(d8!M@S:rtP gdP t( JKA Exd(0@R:q|xP IdPT x( ,KA A&|(d8@S:r|Pp +dPpz |(PゎKd8H@ HS( l;KA A01(81(Rd8@ST:rVc0P1(M (PUڈ< 8 I GEP(1S>K0C=PU!d8PS*g 0 ( hX d8 [P@t KA kKA A e{4 0 ,0S ,R 14l0<1`1 1 P-L`( 1ȁ 0@Qd 01 00c$PVq` Qxh!0 PTP Q@ 0O  Q0 Q@L00P 0@0CS0@0 0xQ 00CS0p@0 0bQ< 0RAAAA|p1%1 -LMPAPpC 0@ S 0 S`ev 0S쀟쐟0 !cPP 'Qi U`0$0O` $P@00Q(Q C 1AAA11% 0-DP@L,000 @@0 0 0 0 DBd0 S- L 0S S 0SP S  A1 p-xQxALM00P06T1 P!Q[UA -LMHH P@000 00@@TBA$Ap@-@@`@Q 0PA0UPEp$A\ X X0-0PPL0000000000@g@T0$B,B 0-T@TP0 SL@R00 00000 4B 0-`@ 0PSLLH  0S0, Pç000w 004B 0-lP@0 SLXT  0DS \P00U 004B p-L M|P0x0 |@0$`KS 0S @p i0 0 $0  2,2 P-L he?EG0@6PZ (8HXhxееQQQQQQ Q Q  Q  Q  Q Q QQ -LM `0RP  㰍0XSxS00@PGK GKk0p1h@  T00R00ST01@T@FK!1 020@T0 90R0BSbS0@PGK GK40p1@  T00R00S?T01@?T@0! P @T820S l3 d3P`4X3=0D#S4,#=ubB0 W0S2 2PR0 W0S 2 x2Ptl2= E0P`00@iL2 0R Sy 84"P0`00[ B=Z[0ST !=O!00,Q 00 Q,0S< h1 xlW00 Q 01 R.c+p009P 00P 00 !Q 00 G0 RMOKoqP0: S  0Y 00G00 <6=n뼊DD4bX(C44`BxB D4D4CH}(4dB 3L@4P -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00p DlBhBBtB -LMtD`ğ0 q00  R 0  R3 P 0EUSH Hpppppppppp0<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u <pP ^U-U```\kP 0  P`P 0.U001``P  pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U00 DtBp41BlBB -`OLMp0 q00  R 0  R?0P E0pR|tT00$h ,d0  ͟ 0nS` lS0 P 0 R0= R =y P W`0pS`0= = P@=  P<= R8ʚPp̟0 0nS` #lS0 P 0 R0W0L ]< R 刯L⃯ `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1e*P+P&\!\\: R \t P Md:)9@ {  yD k`0pS`0 ] Y9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S 9 .`0pS`0"8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'A PPaT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SPALy`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E 1C*`0pS`0p4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+M|`0pS`0r0 PR0& 0nS` lS0 P 0 R0T^ PS`0pS`0@G1P* 0nS` lS0 P 0 R0 1  P``0pS`0ptBpBtrH}Db5$528541T5xBl5pBB0 `B55lBtB55q DhB0?PR$dPPI\0 RA pW0 RX W, 0nS` lS0 P 0 R0 41 R PBd(`0pS`0|1P( 0nS` lS0 P 0 R0 1$" ; P@_`0pS`0H2Pp( 0nS` lS0 P 0 R0 2"  P ,`0pS`0,3 R4$ 0nS lS00P 0 R0 3 R 3 RqU ``pS0q40  00S[ 4 RD4D$Pp8L 0nS` ?lS09 P 0 R0-4 R' D0S!\  @\0S 5\PH 05 P C 05 @<^@`0pS`0U 0gS S 00C S =pP 4 6 p W 0 Rd6 R d6   0 S 0 S W0006P  PP &U P6 P7 00CS0W0vqW8f '0S00000Y00#000# 00 0nSK ClS ; X L7pPt. 0nS` !lS0 P 0 R0(0S 08(8 P`0pS`00 00pS0 000ܨ p P 0ꀇ9q00CS08I00p |  9  W- ` ppS rS0p00p0p9PJYPA9 R9 pW0: Rd ^ 0nS` lS0 P 0 R0 : R JP ;`0pS`0 /; R# 0nS` lS0 P 0 R0Pt  `0pS`0 +pWE;UP=GUgU>P3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  j>\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< xpP0000  tBBB54 -`0` LRTLL0<SS,0 0Qڄ0lBhBB1B -LMܠPp@* W* 0 0S@@T0TbW`BPP l0 R   0 P 0#T 0EE@ DB5|B -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00P 0@0CS0@0 $0:00CS0@0 0`00P @@0@tBp@4%5pB -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 }O5 P %Q00!Q`uTş0 R`l00QP 0 0CS`0e0 |809"00CS0D0e!0 0 Pdt Q`l000P 0$0C`$S0d0 =|00S? h@>3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000P 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000P 0@"0Cp8"S08r0 0*9l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000NP 0!0C@!S0A0 x40800CS0u`匐0 QP\00!P 0T0CSP0PP0z Lw06tBDpBB%5 3 -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00 DdBxBtB`B -43L M0 00,  R W,T P@` ;PpX آ 0S2oM0@` T QڐR2 Q@L000HP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S P@` @@ sP|0p p0Q @3T},@P0$ tBpH'%D62 -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| I `1 @ RD1 0o(0 Q`l00P 0`0CS0`0 0g300CS0@000 SH@P@(tBxt|B%X6p6 ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 p00 PP 0P0 P tB4D -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000P 0,"0C@$"S0B0 0v200CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000P 0 B0R@ q@0k ho02lY00CS0@8h0SL(@00Pi0FtBD$DD%xBdB85 -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0hBB D5D -LM " P2 P@" " q ğ0S   ?KPW"R 20R2 84bPU$0S4 F"0S \ 2 1    ?K͖P 3 `d 0Q,V,K 0S 2Pß0SH# dF030 ]F\ 0 0%rŸ0 QP\00-P 0"0CP"S0R0 W00P00CS00B0 B0 0o࡟0 Up|00P 0!0Cp!S0Uq0O L0}0X00CS0$b"P U" 0S  E0 K9P0x 0uꬠ0 Up|000P 0d 0Cp\ S0Xp0 0" 0M|B DDL6% -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000DP 0t#0C@d#S0\C0 n*0/(00CS0C0W0Ȃ T`l000 P 0"0C`"S0xb0 30/<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000P 0\!0CL!S0D0 0L/00CS0x0 `@0 dQ T2, 0@TP(꘠ Q000P 0` 0CP S0H0 e0 D$DD D% -LMؐԀdP`01 ^, p@PHP@ @q0@0 A0@0,A0 00.(@@% -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0SD678800 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G DB`BxB6 -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@T DB -LM@`먃0#sP 1 0#{pP H0@*SH:@;@;@;:@;@;@;:@;:@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;;@;@;;@;@;@;@;@;@;4;@;H;  0 1 "P00Pp2=B00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY V[1 x1@DxQq+l/ PP*M20S0E= 0 0!Kлpp-/0S?T%w  rA!0S 0S  BK⳻1: S 0S 0S BK [x0: S.  0 0 `Pf HO <SjC??>??>00 $ jj00S3 3S0S$   ` .P$ $ ` 0 pi/S @ 0T/S/0000a`0 Si ]Z`Kp 3S @0 Sm 0: S 0: S  0: S9 ( S  S QP00{L2 R QPq Q2 R Q S  S S-mQT1 R1 R 0S 0: SA 00XD!Gi8FP40ki J 0S ^i@ 00 0: S 0: S0 R0S @0j@P!3S0@0lꛗ0S~<hCmuT7x78DLD̚77PDW6 1 R,0  !0S SSPH4pKVP  0R1 !VP p PSSؚp|ӚSSX0U0x@=0Sa  (D,$幚JK(@D@DP zK0(pG(KpG 0p7P@ ?hZKK0T(PE(LPEL #% *01Z7P@0C0*K( B BS1`@ 10DESNNNNNNNNNPPPPPPPPPPPPPPPPPPPPOPPPPOPPPPPPPPPPPPPNNO(OP0O8OPPPPdOPOOPOpPPHPPhPK@ @*0 D$-fpJKW(@D@D w:KH00Sb KKL Z&P&N|K@ @* KH KƟ@0 0 0 > 6,6BK@@+~* P#%^*,6 (UKJKL(@DL@D0.S 0.  0 l ba*00d5   %%000`%`5\vp@.D50Xa4(K0SjK(`F5`FZ 40XS4̔ 0X0Q000 0SJP$0s@400 yPMe pKlp$L003P0C SWQ0S0S S0StU S0S0S(R30S [e {0S50-S 0S0Z0S000C.c:K(0C0CP KAA)P NK@DK@DLL`#0A P *@)P@00: SP Wp e@00: S S0S2"2P 0B0S 20SP dhZ+D20S BK@X+@t) 0BK@S@ +P10SOdGNK@D!@D0@eA P! !%*xA0S ڌ10SL10S  0@BK1PAKx AH0 P P 10S0S00S}P 0SWppyP`\00S HHC9CECDdD0DbTDHpHHlDtHHD@9X0DxHDHD4EC\CtCwCCCV`VC - LCd$E -LMK :P @0S  [0R 0[S 0S9 -MLMh% dR pK9K, $ >  3P@50S"rğ0S ;P 40SK KP 40ScO[K0+K(PE`0PE,0BK` 0T  P 40S6N `V  K,0PS +B(3`30S`G30S e> K(AAᣴP3t(K0 : SKR SGPN@ 2P`20SK  0v dP 20SٕIK(@D@D9K) 4P Uʥ?Y00S 420S 0SD  ,>c뤑0SKK(@D @DK 0P Y10S$c0S1 R 1(K0SKh1 (0,  0$  Y9K$Y v ,NP Y00SnY$10S (K0SK(K(00)K 00S +K( B0 0C00(K B0  K4Y00S ,0 SP,~HtH̚H@EpEHxHHxEpHE p-PLM`P@S L10SO@10SK410S p 0@mpp00 0vP 0S0;0TPLQ ᗑPߔ00S$, p0Ϡ/ (@@#bCl(K( $ @  >P,ŔpxHHH EEEHMbE 0-@LPd9P!  PD|00CS00Ӥ00* Pp@ 0@ 0CS00Ӥ0"* PpyT07 -pLQ  ,P@ XP0@S &P`PD1SQE -Lp@`PU 0 p&0f0@L&0Sr00a000 x&Pr0000D0EE -L$MB0, S`20S||x嵐0, P P2c 0S ]0 S0 00000 O0<0 <0  P0K y&m/ 0 c&Pj& @0 ?@_&0 0 ,P@0K040 p0 0@<0@ 0@0S(R&SŤŒˬ0000P!&T zP@&0 0P@ @0pВY@lDtHELFLF\FTD\DdD|FF M-LM01, 0p`S  oM00S P% 9P@ %0 G,0 tx'p `0pS  0S P@P@0 ,0oY@HFHFHF - 0LM@ 5G -`QLMY0rSwS ?RPPU X00G 4P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` H0090Ď`0wS  0  P  0 @X@H@L@P@T@`G -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  ]V0K`-K}T@H@P@L@ -LM 0K# aP p-LMD0@S PH`U HP)ݰP0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0P9H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ &0000 T  <K0 0 pS L@hG -LMD0PSp NRL @T Q@H@)P0D0@ P`.  gsp0P 1 00P ( 00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@$.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000SR9pD -0L0SpD p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#ppDQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phꄒ0%0 0X00L0 0T00P0`9`A -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b3(0,0000004PcUP!f 3`V 4f 3(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 2+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K ^1+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  ?1/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 0+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  0/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#u.4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK0.x0 00(.P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K -U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K - G0B @T0D```Vx010 6@t@BB`G 0`4Cz -L -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&epH0@ 0S񟗇LXdp|```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0T@0S0 t,0 R0 X@ 4@ PL hPP `iP@ 30C S44d4444H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L0P D嬆`0S @0SD UP Z 0S0SPQ TX a2P ZTX >@0<7 Rjt l`T0Sh <`S0SP 0!R0P0Ss S4K8 K0KY1P0 #80@ 080 Y`V+ `000CS3,K@ P@*0S ,0 R D@ @ = P *9@ S"006P< @@ +0S :&@P` _X 2T .P@ 'pT IX 0S0S0L04]@8CHHHHHXH̚K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S , 0 P  `0S@.{P1)O  0 Ppz@0 `( B0B!O{0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0ShO;;;;O -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0  \2R_ Q0 -LMh@ PX  P D P80S PX}yw -LMؕş QS, @i0S 0S]p P0S l5 ,0S `,TL%0@D%S001 0ş0S 0S5 R u0DS F0S  0S  0S E 弄0帤`8 pb# $0(@2fP1\4/ 0A!b!L@ w#0S ğ$00`0Q0S #P 0,0b$@0@@40@@@80#c!00acQDß0SdS0S|X3 #@P@@@p0Si43 R b0S  P,0Tp0 0@"d0 #: P,0Uh"0rSX00R@bն@Ҷ@϶@P! 0S( 0S1 R8HtP (uK3P!0S s4t( =K8 @ < q/P &t`1 GP00v@T v@T Fthv@T Pv@T Fa4vZP`$v4ss ss|0vPss0OO$>4>hxNNN(@t>hOXO O$Pgfff@PdOOpNOON,OOOOO>`">X}>?D?L?t?|?????@\@P>H@t@< -80LM, ,0  @3!PhOHpP -L8M聟 `,0V!0 00!V0@@T Q?>1 D@!T  `,0V04 @@VT Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pC뜠0 0P,0`U0@T UP@XKP 0 T `,0V00ohOO  OXOHd -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0gP 46 ,0S <,兺0 ,  u pu4 0S R1 < 8 0 B ? `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tPP`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pPd4d$00i4 00$4040$0h Rf   #0S 2r 0p$0h0fPR <0 00x3t3   RP 3 l hP3 R! Ht2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.}P^1 R  p (Ph0<0 0<  0 0PBt,1 R 0t8tlP  0p4< <0/410r($0 P X P0S 0S 4 hP P0  } D K j hOOOO@,=PN@0OXOON(OHH@ApN$A@ALAdAO|NP|AANNAP̚C -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*$P ,@ R0 0  0R 0S R0R0S RP  0 R pPd ]\0 S00Hō<<? O OPEHONA@AA0OBRH B̚C -80LM, ,0  @PhOHP -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S S NHhOd\HO -LM`VPڴp崀.@PT 0S  0T @T R 0S `FVP 0  0P 00HOPE -LM$$ @0 @zPHHP -LM88 00 @g0Sh8HHQ -MLMTTE0,0   BR$ Xh 8P % P80  4EKI I4zZ0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:MP,0 S |,0S 0 P00S 0 S s S $#P # 2  00C0 "P  000 00C0  SV;;S T"9(K00MKA@AKK@ $@0 \4  X$ iBNK @D@D0>1 R" 0̠  A0S0?0?00 R=P0 @`n0̠ L8{ 8I  0 0` PPR PP 0:0 ) g OBBNPlHHd,OBBBuBDN(Q90OD989PQC̚C8BXB9@ApBB -ML08M (8Rp, (`  Q 8 Q753 575$\C0S P W0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK rP$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍PP$0SX ,0 S ,,d00  & Y05 R E0 S %G 00P%00C0 @0S$ $\NK @D@D0@S^K PE0$0%B5 R ZmP $\00$0S0 R$ 4 R4 R$ hP 0: S0   4$00^$\OR$ 0.SH00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 @@\+0SP $00$0P l"00C0x"f>KMK Y6P8"V4v00@;P \ 3P !?^0l!00S 0S ,0D0P>KMK Pe$00$0 1  0`0C0 ,崀t$/v@P_ %l0S 0x0 P\0 R\ 0SY <00M0 (OdONDDCOBPCOhCtC`CCOCC0OxQCNCCDuBD@DtDDDDE E $$0c -LM$$ @0 @PPHQ -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPy`@uPl000`0  00C0`0 0@0  PNdHO,POO -LM$$ @0 @POHQ -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6\\ 0QP 0S P0@T000  00奭xTK /TK% 0STK@ <0 ,Od`dHOOpNd9@ELE E -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00ETON O -LM$$ @0 @XPHHQ -MLM0,0 K0 HK0?(@DD@K8K @nK ? x_R@X\$UUd?(K1 U5U3HHKKQ, P0@@?|\ ``N A$e @e?AV@0p`Y/110S(K6$ULqf QKPTPK XP58K1\@@?NA`@ 0|0l(K0(?K!d $5dKS@B@h@$5A@l@0` |  ?KAd@KK\ d0Tb 8KKP=aHK0(K( B@B8KA =K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX dL?>1 H!X 4,(<(,$<HK ,0PKK K K!(K!40(K18K1T@8KAHK@HK K˟HK0 0 (K 0! 8 @˟0 S 3 S (K8 QHK@K0 $08KAK KP HK,0\K0CQK8KK1Ab KK e$5S8A(K!pK 8K0K $  K,(00@S0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !L5KsHKɟAÄpX3L Ϡ0.0CSP K000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^$ ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0K f(KHKA8K$P @$(0K 8K1HK$A (K(K0(K0(0K HKKAP3P B P5 R9 K8K DK,0QKR$PPL5Ks8K0@P5 m P|,0 S ,劯(K P K40PP0K(K8K K PHKAXğ0 S(K!KT0K0(SHK@TT08K 1 P HKAh P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK XDBQKK\0$2RKHK\0@8K  P' HKA4B P K0S(K K\00SHKA\08K pRKK0?\0<000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1 hO4ONQ:Q(OOHHldOO\FQNR R@R4OdRU RRhO0ORR\ORFK8K(K =HK@T0\ S(K KT00TSHKA(KT08K @$(K P0@@fK@000| T(K!p0!SKKT000T  000| $@P:0 0` PE,(K!0 SHKA2X0000000$%R8(K!?l>1 @  KK 0h2RK`00 ?> 00c# 8cW!(K!0K"0#>PK1(KTHK 0AO K0@ P54C0SPXPr 0S 8KpP0@@?|`N A@?$%ARP `A?AP=L0@Po4D P  ;T3$5SDD0S Pf0S`P Kt4 $ X\0  0 \d0\0` --L ԡ p-PLM@P`l0l R T D0 Rp80g 7 0  g㭡d ,\F --L  --L  -LM@rdx h7 --L ~ p-LtM/Pj@TK P0: S p0`rSS R 0-/L@iPU+D0 00Y/00(+=+900HF -LUMpPKP峆P@lK8ᬆ0S-0: S  SU P U@P P@0 R000K@ሆP h1: S@ /gc$^qd``"FG G P-L P .50G -QLM@ P T 5æ@G -LP 5PG -^MLM= =@, @= _K A=A`P+P^5: S  PP PDx-0S< l= R0 X 0S4= &D f40S 0-@,=@(-(@@@ @@.0 0*0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,}(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; Efd5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S Dc0*0S2 P. 0$J QQ\  000S 0 )c)0S P  00H0cQ  000cH0t)0S c\0S P  40L0cQ  400cL00S ` b(0SX P X,5S05S. S ( 0S>0S b(0SbP 0(<Q  <0(5<(0S b$0SKP{  hH080@_Qn d H0S.0O 0S b'0SV+PR  gL0@0@_QE p L0-0O@'0S b(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @vP `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@B\6PPF 6E646P(@ ,6P6 $P5& 0%@U5 @E00 0%S P 4|5    dd L``P` `$h x (4La(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@ ?$%AR㰠 `A ?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0c[ 3t0Pc4`: d|c,`2 Htc <<`N,OO`G@A|N0O`OGOO PhOGOO$OGGGGS1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! {0!S 3S 0^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^4OhOOOU O O -L8M0@K00 , ~ -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018ĠlLL800CSl? ? X? ? X? X? X? X? 0S0 #Q00 #LQ0 R0S800CS,@ H@ @ d@ @ @ @ @ 000 10B0  2 R0  00800CS@ @ @ A @ @ @ @ 000 10B0  2 R0  00800CStA A `A A `A `A `A `A 0S1 S20#B1  0S 00 -LDM@PP @ <P (  P0P fY sY !1 1 !9p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL    0P ,P 4`  00UVVW W(W@W$H 40XWX\WE F V Y -p-L M$`K 0P$0 P @ P00 0 P MPp -0-L0PS @ CQ0 1Ñ0V000S0 --L IQ --L =E --L M((K0(K BV0 R 8 -LM@XxW -LM   K 0KK >p@VW -LM @ \K0   KpyV0 W -L -LM@@0S  hC -LM@Wp$ SpQWX -LMM B~KpGnK0pG`F+`F(0 T+PrPÏ˿ PP"KAA NK@D,X  4h 0X !VLX|,`4 0X DX`L$BpDa008 =YP6KAA 4Yp@U0S' T 880S@VT 0S 0@T8800 |  Spl\T(0 SH((uhh,XȩhX4XXX0J Y0l0SKt00S0ڐ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0Qp P!4  O$PK^  X<NK@D@D0%   OjK ,H `0V00S00  0 PM KA P0S\K|Y XKK t | SKDR 0P \şU00  xş4T, @P`0 3( / =00r01 S90OKt(0 S;30> :K0  0K l \bP rP"M(  ,~M   oFjKPt Ktp *KP|:A}K(pGpGP`)   P `V:JP @`0Sr0@0 0S P  T N0`Vj?0ZL  AL  9!1KAOop !h1p PNK@D@De/ K>K| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , QHQd\\Xp\VR\\ ]Q<Q8]L`"@]|]]]]^ ^\^^^LĈ̈^^R ^,^(_RQ_$V,,_P_QQd_0|_R__4_8_ R`8`QL` ``QdDn.($x` `HR`Q`X}R a$abQHa`aaa^KPEPE!07BNKK@D@DP(!01+K1NP!P1!*K'Np  UP>K0C0C``11 K00aY1P=@1!TaI2P xa@02P<a6P2P\"000pa&2Pb2Pլ(b2PչLb 2Pհpb2Pէb3P՞b,3P8bH3PTՌcެd3PcPb|0S @3#?UXcwP#000IlP3#@ =c尬3Pn40c奬4P Jd圬04P<A,4DAPP Pd劬l4Px/td偬4P&du4PոW 0  00- L@PpP`0 `R\ 000yDP@< 0-N(DPedA$VRdLL p-d0LM0`S@P p84 0SNphRgdaa -0-LPP@㑇$0 Ե ʵҵ 0-PL0@S00  ; xl0$ R 0TST 0S S 0S #ZQd eLe  -LMPp`p@? P. $PK` fMp $0 P   0$0 $#40S$0 ld cU PD.LP$ Mdepe̚ -LtMK@rlPx0  P P P 1 xee -L2LM<2< 1  424p, 1   p `PPR K Z C/K iU@= W3T#1 ,0S ,Ȍ 0eP|M`P㕆TMUP 0,w sM EP  kM ?P bMꈠKZ 5@Kl p0  ` &P @ W !P 0hL?M P 47MseeDeDleeeeX}f -LkMl0`d$0 PP@ 0S@AsK P $A1" P 6^K2P@ P1*$0 S $3  P*0 S/R ` d P*P< ',T"\"Lf`"f4f@f\flfxf -LMp0PK 0 Ht0t `h ,@0X @ H` 0S  ܐVVVff -LM T` , p(4 P  ?P>P >P NK0S h_.0AUwʤ> >pf  7 h> d>R`.`pT $0 ,50(5P ( 1D= @ M^00 00 Rڨ R= =$ $RӜշڰ$Rӌղڈ000 0400 B`40AP HL0Q 0 R$:R8R0H0400cL0 H0S.0O L00O PP00Z0\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڜʠ Z`00`0| P80S0P5 00#1t0`+003x0@4|0d0 |Z;ʠ Zd00d0JT;\` 4@8@帊@Л0P4@8@@00" 8 000P|0@8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ P00 )1 @@ T` TBP K0|00  0  X@< @7 0 H 0S S0$5P㸀 0P @@ ?|`N A @?$%ARp0`A?A@T0 S< R{`P0@@?|pN A@00$/>AQ@0P[`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RK 80080 `00C`040040 |00|0l0 0 E0 PKOP? UpxP开 0Eo0 50 0ЄD5P0`x@!@@b^Y l 80 Si  Vg  \TbN0$I<4@ ɐ00 000@80080 `00C`060 PP0@ @?|`N A @"?$%ARp0` A?A@TLßPp @ PK0?P_xP0Eo0 W500 0000000 x@43!R@@ऀXPʸPB B0HHP帀PP2 @B 0 P <3 RRR0S mH聟 @ @0 R0dŸ  Dp@ PK0?PxxP0Eo0 5P0P10`x@!@@@Tڴ00i 0p@PK 0?PP0 @?|pN A @\?$%AR㰀` AO?A@Th0 Sd` R`ڣ?/0 0 VV (VVQQQRVVfRQff48g0gdggggh<RVUUU@hdhhhhhhi R8i`iQQiiiijQ0jQVhjtjjjjkLkQ0 ,RR$VNHQQTQ@kVkV̚Lh~ Vk\k(`P0@@?|pN A@00$/>AQ@0P`?P0@ @ 0P0i0p圁PK0 P?xP0Eo0 50D@ 0|0@ `|nP00 T DHR0S T0T p 0@TG0G0S0p P0@@?|PN A@J?$%AR㰀 `A=?A=`L0`d 0S2$0@$ |0&P| $ Q0°0Pè Ű R>3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X3/ X#0|`0Pŕ V>T5 @T50 \X5 =L 0OOT0T$0 $F0 X3$@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  PcUcP#u  R  D YYP@ u:  9 +B6+$0| $ D@$2P4/룿/ X0,0p`!P4뒿/ G 0p Dd`Ÿ`0d |P  B 80lcD80|00L8P@@d D0!{DI~ S|0` 2Q@500h0TXdh0 0Q 0hh\D0`40 SHHQD@!@LD8ID0S nWrP T?/0 0 Wq0h0 ,5<0 k@0 00Ϡ΃4 `>l@lVQLllllm(mHmhmm RmhmmHn -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|/`010Ch0 h000h0h0$%10l0 @0`|/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQhW%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  P`0 0p Pe<@6Pp Ri  00050 80 Y0 (00(0%540( 0l ( 048@Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8y@4 R`0 \0$%R L$?>l 1 D, 4$0000| Qß3 RT000T000@|0嬠  !P`70 0p Pe)PT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU yX@@@V pX@@@ 0|e/`01d0@?]%VVVU (V\n -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400ptQ,VR4VVVA -0`A VLP|`A@00000 0`VpcPBO ` p    V -L M0 d@Π , ` t3 R =@T 0X3 _R`0@P08 P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| [D2<2 RT000T00C0@|0 4 40 *P`@0  0p Pe2P1 pRU 04)00C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04X@@@ <VVU |nnVn -LMpnQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**q0 0 0$@Vxd`0d C0XKB$PE 0xF 00 6)  VVU Vno -0LM`pQ  X0X07!h<0@ L 0PP " QQQV8o -0LM`\0p l0 P X0XN0PP ,0007 h $ QQQVQXo -8L0@S%  T , T T T ܳ 0S0 #Q00 L0 R0S  xo -8L0@S!Ĵ 000 10B0  2 R0  00 o -8L0@S!ꌵ ĵ 000 10B0  2 R0  00 o -L M@H K0s4 A[TeP C@TP@ht@m -LMP@ȿp1儑儡`px!pP@4 "P-t h | 0`0``p0 PbUA40Sh0nw X0W 0 RgCVVVoVXVV -,bp0LS2 R 2 pRpW PPs ء P@c #0B SP$ $ $ ` $  $ $ P   0t 0S@ dP ! 0S P  |  0S R R 0 R P U>P 0S=90S0S@ $P #W90Sm#   VVVVV̚ CR 000Ri 0 Rd \ 0R  R R0R  l(lL -40L R(0$0$   $sVqq -L <0 R4   0 WV| V[ - L|q -Lq -LMhq0S \\嗚PPL @!PD 4a@P!@0P P00FP@ @3 0 0@@MPp@K;0$!  P 0P 0;C 0 0d@d @ˠ$0K $ @8r8r V4rV@r -0LS \|0H0  00S_\-\0S pPr p-LCM``GOK0PL  r80 Y 0S }phrpr -LM$@0 S A00,xr 0-D0L R 4410P@@T00|rZ 0-LBMdP0FOK\0 P 0#4 0S 5}0rrr p-LM`@,0 PUphV p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x>;K30 S X|pCNK@D@D 0)<0[FS 0  rr -$0LM K WP [V p-QLMP`@00H@ph0PE S U@00prs -LM`Pqဋᨋh!vpXq mP pP P@(@ >w!0AT3 T`7 ?@P0/S Z  1P0S@!`P X:p`8  @@P0/S Q@  qCsbX̚p -LpM`@pK4@3 00RPPeVP0: SU/00 ¿ XO30S U P 30S  7`"̚ -0L zps -\@LM80(0( 0mmmmm -LM` 2P( S l  Q Qq00  R( \ 0S#S 0P00 `  (0^pPpp(Ȉ0S 0H00S (S 0S(0 t0W0 S񟗮X P t   (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;S`( \ oSf  ,da(0\(   Q Qq00  R( 0\S  G(\(   Q Qq00  R( 0S: * D((0\(   Q Qq00  R( (0`S0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00u#(vpn1޽( 0phe`d(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S /.(|)(0 ( P(   Q Qq00  R( 0;S S ( pIQD>(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z l[psssst4tDt~LtXthtm tttttuLu`u 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0up6u@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 ex muu -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 P \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0m cu$v0vLv -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A 8pP@P@(S S (0(8 0 S  ~w;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 0PU ( p . 0tydu00U0P0h(pxvvvvm w -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(v8,wpDwPw|ww -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,cv 0S Spw 0-LM0@9SP$0S$S /S  0P@  00Dt 000 K \S@wx R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ \20pS S 8p0 0 0 S S00p0x p-PLM@P& `0a0CS  000@Tp 0S0 C0S40 Yp mDx - P LR` 2P R 01@pT 0S @Tm0@00` 00 TP  k\x p-LM PR` 2P RT0 AT 0S @Tp0 +P0 0p k -\pL`AT 0S<P oU@`V0 ` ktx - rLMP@`!p?@H /P<D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D  D D D  4 D D D D D D D ` 1`1`^ 0Ci00 0AQ0S 0S|0jpPM,SP n@bxmmxmXmL,y -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha  P@  00 @ 0Q 0#S0nS0@0 P0 @0  | d0P@ 0X 00h+圷0 0%mm8mm mmm8y -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 +70S 00,K50@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$gԀ0S P R" 0pW ` 0@ ,0 S0 ,o&0SŲ P&PJK(@DP@D *00\ 40 qؿ0immLmy,y -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@F&0SI ;& \0R0R P(0\ CR #00;P 0 C0 b\ 00`0\ PgM)`0R]t&`vdP fL$ KP2[S<00ZLp,yyzzmht@ -PLM؀`pP@) T 0 S R@D @00U00  0 GP P #D <0S1mmmuz -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   y000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@mp -LM@P P`p W00  0 0  N P0-L@P 0wS! sS @T0 p P 0 0$Ұ0 d[{Sp zP00$幰 0Cb00 0-PLP @gT000 0-LPjgP@0 0R0 @@0#H 0-SL@p  P`gP@4 U@@V@H hP @\0000Q00bg -L,MS @D ||#lp LP ?PPP4#0SA $GH L Q 0S 0S"0S P0 "PPe2p D 2`b`" B@ =82@ 5$2$ ; 00 , G00 080 4 嶈ȉ >(>DP  0p00  00S& @wPp6 P`7dEP`2 dhxr}, gfff0 ԋpx 0-@0PTL 0Qfc@@0̓, -XRLMP"@ac?P 0A`V PU / 0S x0S >1 LPl 0S0@  $0 S  1SqQ0S 1女0Sl= @P@c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00O0@ ;0 QB KȀ0P@@ RV  0徂 㲀 @, 0岂0=(̓4X,`t -PL@p` bp lP ?PmPp`t 0P0 PP =*0P0 0PPS0fP p-0LM` P@yb?P 0AT K0/3\0 S0 1 !0l p$0=p+=꼓$8 -LM0@P,0 #Dbp ?P SPP,0 S ,a3 AT #0 P 00LS!00LS0B \L < p \ p]  Qf` ᐯXIP@PR  Q8 儯P3 0X0C S4< t; t; t; t; t; t; t; t; t; t; t; t; t; t; D< t; t; t; t; t; t; t; L< t; t; ,< t; t; T< t; \< << PI PQP'SP0-V +V ,Q@ >P \ \ =V1h0l+P 0a0CSd= = = = = = p= = = = = = = = |= = = = = = = Ispmk@hjphU @@K`Pp 0 0=00 b200P B\,0000D<ں<34H<PT`lt|} p-(QLM !@5a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpsy P;P< (;php,T 0-PLM @`?P 0PPKPK@P 0@0 SR R 0 -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKJ=PX Lp;sP uP`PX  L K<PX L <Z;0T0 0P0 0!R40*X;$Xd?@P` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHKh[pP800c R8K^[`Y U u P2 P$ R X; P PX2 RP0\U00Su US 0"0  40VG 0S 006|0`71 R,4 }P# 0S!eT0S Xu XuX<<\00 000D8D<e  0d U0S4V  V 00S`FV 0V0 R efPF\`0  @0 < Y@0p0H0 D 4:؈< ,T̚ 0-lPLh @e_0?S L0M0< 1 00S(0( 0hW0,P p-ALM!P?_?P4 0P@ P 0SPU @Zp: _:sP``V 0-S PpsP@P At0S,9p0S`0 p-ALM P^?P`p0AT K7\P 0 ! 0 rR @0S MXWc@P00`h0 R 00C8S` RV 0  |9P8 p-@AL M8!P^?P`E 0AT00  K\P: Q40 R 08SS#  R 08SQ 0S 000 0 at:90bPW L0/9pQ 0`0049pԍZ p-LM 0S@`)p KZP'0S !0P@PB LY0S0eC10C0@0S0$0 R0pp鼓z, -LM`p  ^p fP ?PvPpp 0AT W @zP0 [ yQ~@T 8)P -LM\` PW  u`ONFd`@ePX OD%BddW_N( FVe $P @ehC -LPM@lPK`ᄀdK 0hp 0| 0 0鴑dL -LM`SK@P /lK]KZ0S@ #3````0SS?KS?K0C0C0`~#S?K0C`VK@ K;QK8m 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@l6bhX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C  ?BL$ -LM] mm n -D0D L0\0 P E mm n P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` x00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0U nmmmnnn -L -L -LZ 00m -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0Stmm np -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0*mm np p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0Tmnm -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00p -hP@L` P Lp0T*0V  0S 0T*0V mm - PLM@ pH 0 0  R ^T@?hhp -D0D 0L0Q0 P`0Tvmm n -D0D 0L0S0 P0<^mm n -p0 @L 5`P00Cs0 U0 T  @R 00Cs0(0壚P@,mm nm 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00m nmm - L 0   m -$0L; l -0L?$ -0L6 - 0L0@* nn - 0L0 nn -D0L R80000 ,00@n$T n -0P LU:0` pUh0P0@  ` p0 ՜` `0. 0Rh?$ $mmnmmnm-000 0 0 bL1C 00NTnn000 0Q 0 R Lmmn -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$KU 00eU@    (nm -pQL@@0 @dT` :%PP 0@DT*d0 XD0@ @0@^S@D} n$m 0- L^RP@ |P00d0 ፊP0 -p0xP @L@b\`00YD0 <0 40,0 !mmmmnm n -0L,m -0L#m -L -lpLMP\r\`  P0 0Rs 4"42@PT  0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00꼓p\0 T 00 0S< ^00,P@0 ?00 00pmm P0-L@P T Z$|0 0h S`0 ! XT0hH$H0<B$40 ;$Д(n},n}ؔ̚ -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lH#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P UP SC@, < ,Pd00@TTPUX~WT$ "(n}},n0nm p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPUdP@ DyP80  p,pPmn(n,n[,@-?>,1@LQ 000n(n -LM@Q  Q Q Q Q$ h0 m n p-LMP` R @0@0R@PcPbV6@pt nm -L0Qh0 < nm - LM0 0 p` P0@@cP0 PPᣗt 00p 0L0L H0@ @0@p`E⍗T TmmmmmL -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @T$0$0P 0S@@TPphmmm  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 MB0S0,0KpC-P00T0S`T XU U 04 -P00  0R/S \P(0.00( , PFmmm -\0\X0X T0L0 L08\000 5 hnmnmmmn0 -T L0LS00P0 S  0S0n p- P PP0PLM`0 0@R 0 R R00CRphp0DS    00C000nnm p-LM@,`PP 0S 0U pm 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @Ppn n -LMPp0` ` K"`@T 0 0@0@ )T i`mmmmm p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@\@pfP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S 2Pn nULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs05000 r0 0  R Q Dmm npp` -LMtQlh0h @ PT *Tp0Q`LTP*0U@00nmmmn -tt`0@0LpB2@@PPm+ P4p0mM꼓T` -LM0@S`p P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` | $ ( 꼓 p-L Ml`0P0@T0 $K 0 $0 9$ K 0B #1P Pzp鼓 p-L M`0@0P1 0$K0 $ $ K 0B C1<@ S@  @ Np鼓 -PL`M@ ` `   /0S 0S0S @0  00 , 00p(0p 80 4 P@ Lp p p p  `K 800c R8K=>PW񟗩꘷ , p | (  , ` V񟗜  , H  < P \ < 4 P ` `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , n004 080 PL=@` DA wA0@0@0@0T * 00   < @`DA VA0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh L L L L L L L L ̼ L L L L L L L L L L L L L L L L ̼ L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L $   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ]P 0 UPuX p=40UbP  @0T*  0@8@` DA KA0@0@hb0`0  `   $00(   0 S 8  b R8Kr<P00 0S )00 HKPp 嬎  000  $00(   0S 8  b R8K><P00 0S )006 0 | dK@K 0p000 <^0@S 8  b R8K<0P00S00  00@0 I KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S- 00 ?00A `@0  (CXUl4*p-Z C0  0A 0  00#0CSO  l 00)  000p 40Pj]  H R000 0p 40Ps"@ 0 ]E]0p00 0 40@U S d  Xq 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D gD3[Sp<0DWF `A 1F`pN 40 U B GH0`VH0 `Pク ,M ,C4DH@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lY@-X=X ?X @4R44@T0@@Z0=X['P 0@S*S0]S =X Z[@00  #0HS 2- 0,0 0 4 RbZP 0/Z40 0`CA 2020@S@@F^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 o[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[qP 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080Z[l0`P`.@aYL0 0`S`Z Z ,l -`1LM`p+@Q``@NP`@ 0S $Kn $A@4P P   坱2@#00@0 R0PU 0S 00S 00`AP@P,0 U꼓T -L@PἊ@%Tp? #T U@` :P`T`T TU@ :P@T0e  m&8P@:p`p k:P`DT*P@: ^:P@DT*꼓 p-LM 0CP`CA)P @0T *00C TpX0 @`DA A0@@0@`Adph><D  -0LMpH`C 8 @1Sx7<,8K]wK9RXz P뀓P,  H T ĕ̚ -L,MH, \00 p4 L H  0S 0@S \ |<V zT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0u>0 0 R^ D 0`;VL@Q D0@ 0J 0!RPU7 ,0S 6 R /σP0H, , 00CS 4 4 ,4 0044 |6 D/, 0@3,0 R,0 R @ ,0y00 ~040 0,0 0-PLH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00yP@> @48|$,,#0< <00, 0< S 0DS  H  H H , , H 44 4 c/ 0\.a,0 , 00, 000,,0 1P,00 3@  00 0@(x, 0T F,0  ,0 R  : ,0x.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0TN:NQ`R$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` i0S00p000 PU  , ,0S,P |1,x@P <l\̓hPn,̚T `R  ,ؖ p-LMP`PQP@ 0ST 0S`@0 0@ w0 $ 0 0@h, 0-L@F 0FPP$ 0h 5ꐓ  -0LMp@`T P FP L 0V0R00S@R F 0 0 鼓 -LPp`CF  @0;` 000W DM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p鐓 -LM`pE2/&PP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(.0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 ㊡P 00000 0 PP 0`BOTPX0P 0 c0 E@R,,o ` p-L M PK`pEEP@  V 0 /R 0(00 0p餓  -LpMPK`@ PpP@U WV 0Sp : S  S pp@Ip -SLM0@< /0P < P  H1  000 , 900PT080 4 4 :4@pW7 `eW 80 0c S8Kډ-@ @/0080  cR8KPw-@  <4 zP 0SPU4,44`,  阂p꼓 -x0tp00lL @`0PPt60D01 @G70000Ԓh -LM0X pP `ጣ $ Q uP0,K  | 㦂P[X`A00 R  0S AQJP ,K {Gb X 8>b 0,1!w0  ,K{ &b0 h 0 } _0< Y}9K,K {lc,K {T00 !HPxo`oT|o`|ȝН| 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@Xoȓ,(Ct| 0-LMPK@ :{80@0S 0@S -{0Xo -L M,K`PD p{V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  z z000!(@Xo| -LM pK` z@T P0S 0@  00CS0<0@T@T 0 H@T0" zXo, -LM@K 8z00 \000yz 0`odo -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$`oholodoXo4~00 000S  0S$4 0S000[poȓ -LMP00좟000 SQr`Q0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @B%PY 0SN P 0S? "a 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  | 0  <|_0 `0P0h;0l`0P@j 0`00@0000@00Za Q_M,|xo|o 8 -LM0` V 2 0S{ `VpK뼠K  PPhڸpK`V 0@T 0S @T`VH |V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H b|00 0S0 0SS0000000 Xoȓ?Bpo p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  Cz 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$ph,to`oho`l -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S`X PZ Z Z lK@ ThV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,O"0 SVt  V  PU 0S0 S t\h10t"x 0P@LDTi"l0[S (!T100l Kx` \" W" p0Q"V 0SlK~ lK@ N"{0l0Kx @VT0 SS 02f 0lK2a R4P x X""Xo̞̚Ԟ r -8#0L` %^0?Sa\ 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] 4] \ 4] 4] 4] 4] 4] \ 4] \ 4] 4] \ \ \ \ \ \ \ \ \ \ 4] 4] 4] 4] 4] ] 2P Z0010S P 21 @T 0S @Tjp1@PT 0 XPX@TX Z 001@T 0PU pjXP XPU@TZ 00Q00I2p @T 40S 0S @T@T 0S S @TZ0Xo -p LP00 X R 0S R 0SRloXo  -L,,0@ S00 Ы o 0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00Xo oȓhoo\o`o- RR  RRR00Q00Q <R 0S  R 0S Xo p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 4|20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RK:p Vc f m s t \t t u v tw w x y = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 KBP; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKep P\P ʟ 0S  00   00X    20c RK<p00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKcpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 00$7P )K P 0@S " b RKp  00 R<4✨n0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x=)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`ྦྷ|q0FSGLAz@T *Xl (Q dzX0A0EA0US2 " / AE'2`A2&  ]'P@ 0 0S 0S <0S 0( @ 0, <0唧 `T,p$pT\ oo@(AE 'P@  P0R }R\ f 300T*X 0S0 0 0U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x&l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S t u pu u u (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P aw000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:갓 -LM 0, !B0001 < 40 0 408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<KW @P`S UU( P\P 0P 0R0 P U<K U$ <  b R1 @P<00c R( @P8 0 08 @@0 `ʤ0 00C00,oToT --hLM 00CS0< 00CS0$@@ QT p-LM@@`w0DSp0P B    $ < (`8 , 0 4 p<408`\400, p-LM0`0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 z(1  )tX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 sa,(Tؒ 0-0LPp@OP0@0t -0@L MTP@ T A,S-0<,N- 0, 000 C d@TP0H , N 0 0ؒx| -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,.@!P@ 8!mK `F0`F(0 i_XPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄\ Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј T Ј Ј x Ј Ј Ј H Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј Ј d Ј Ј Ј Ј ̊  Ј Ј Ј  Ј Ј , P Ј Ј | Ј Ј ԋ Ј  Ј @ Ј h Č ، , B^KPEpPE0K,0A+K0+0BC_`XP@p86B^K PE0PE0&\tp6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%8tplMll;B^KPEPEl%073lMl_;B^KPEPE<%`}\ P00{RPPU B^KPEPE0$ t~KpGpG+[}[PPlMl4;B^KPEPE0 2}[@p}B^KPEPES'lnMl;B^KPEPE0$B^KPEPE +[wy*+?sB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDl ?U< [U) ]U" |U )UX IyWpGY00X00S |OP X pX Y X R0!S@ R0]S@꼕 -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  NP``Fv꼕1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PM 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh DMPc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P# 0?-00P000:S00P 0T HD0L0-SX^U0 00 CD` 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0he4aP^P0̚5C -LMh4 4  , 00 @媑4q8 aPPP@aTX` U`V`P40cap0S0W<0 ^ ~,@\8   00@T pWP8o饑, 4 0, T < 0꼓8@ -QLM@ $_Pp `PP*PU e*0S _0S0@e PbUp:0h0 -L`p PPPZ 0#S0@Pʤ@ -LM @mP 00 mP00 p-@LMTP`  TP pU NP0  P000[Ȑ` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ U^ 0 SP/R/00040  N @0 bRP =^8 R00 4M0 cR@P ,&^,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` }MP0 Ulp ]T X0T L0hPӏ0P@@ꌓܒ  -LM@OM|0     埏00 K 0  P 0P/0000 `ࠏ鼓 -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /"JP`dU VO V> 0/ c 0 0c RPBNK ` P@D0]@D` 3`P0`(K P/R P PP X@,0 S ,0S 0.S0.S U0u/S U0.SL`0/S D -LM@p|0`00 0,0< (p0P TP@20 P00S 0`` S`` og kp$pW@,鼓 -PLM`lp@82 T& V`0 0,0$ (` p ` P zkꘀ[⍎x0\ⅎ00@0P _kP PP PPPP꼓T -pPLM`l@*$ T P (0S0W< 00$  `  k\l kP P PPpPPPt -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pkpl@꼓 0- 0PSL@FP (oPP0 , 0, 0- 0PSL@ +P o 0P 0 P0 0-0L@P  0S0 0  00 0,Ǎ 0- L @ 0  0 0S[ :Q0a0 /Z0 P0    0h $0 0 ̤ -@L P 0 Sw p   0:0@ #  = S , E@0  d0d@0 0 90   0p``V  ˄Pp``V@ 90 00ꋱ0S@ ;0傱 0W$ 0  ^000@p$00 @ -LM @   0S9 / &:0  P J0S0 0S0:00;060 00$ 0:p  "$00  -LMP `p* V# @T T@ OZ0 `d d0V0 pX f0;p @T  -P Lp7 WpG2 @Tdp) @T!  ZP @0a@T@` ZpW00 V dP  X@90 -LM @T 0S  0C 0 P 0S D 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S \ p-LM @`A v" + 0`KS" PK  ?P P0S   ;00 $0p  $0 0\  R 0 B `0p   t P0-L@P H 0h0 -LMP `pZ XS@T 0PI T@ Y0 0 d0 `dpV&p" VQ@ [@`T`d  Pp@`TV  X 0 0f0 遯0S 0 ;0x 00$ 0X ꠥ --LM 2 -p-PQ LP@4MH`KH 0 0  @p̥ --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,M@T 0DLS                                                                       @TYT A0DS 0@%0DSSk T D D D @ x D D 0 <0<00 <0 d0D,pK< S/ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< .F08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C 0-0@ LP0 SlPl0  R0S RR 010000 T pp$p -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P p$p -LPP`p 0S0@0 p0T d0T 0P <T2Pg@X p$p -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @ p$pT p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EP p$pTԒ -LML0@S 80  Q 0P p$p -LM$`Kp@H P 0b -(L  P 00DS t" " # # # # T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P ꨨ`ĨȨ `0-0L@P^$,@0h'S^$!? -LP`p@ TP$ @$ T$ $ $ 4% H% X% % % % % W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S' & & & & & & & & & & & & & & & & & & ' & & & <( T( l( & & & & & & & & & & & & & & ' ( & & & & & & & & & & & & & & ( & ( p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G ay p 0 S P 00P @0S`Hy@PP200P @0S`4y@PP00 P0 00000SP p-LM`P@ex phF p-LM@`P0 Sl+ t+ t+ H+ H+ + + |+ + + + + 0S Tdp@P0SVU@ PEP0TVU S̨ 0-L0MDPK@ B 0 PL, <, <, X, , + + , @- P- h- , 0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjEx0@S P q q ! -PLM@ 0T0   R0 0Q [R P@-0S00 0\00 Q\0[S 0S0 [S ]SQ -LM@P0 0S00 -LM@P  0S 0=S   -1L M 5q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 %q0@` DA qA@,@ 0 4  xL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Y0<0 꼓 0 RVC -LM@8 $P 0 `p -LM@$ P h`p -LM@@P:L L `M `M `M M HM `M `M `M `M `M `M `M dM 0<00<00 b0 <00 <00S B>@0T <00< <040 0<0lp̓ēpp p-LtMPy@P $N hN N N N N O O HO dO tO O O O O O xP BPt^00ipXPpp@ 42 p0<0a@ "@`@0<0p0<0y}pyp0<00<0xB!0<0]pY~p<B0 ! P 0Ӫ0p p0  0 S0`P50@/SIKPKֶP0: S`pLo000<0yD0 b< @0<0k, lp(Xpp -LM@@P-PQ Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q @P000h革told0 hh*<@P po00h, X -LM` p,0 :0W0 PU 0SPU 0SU 0S  o@  )0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@)0Sd 0  h꼓 -LMpP-0`KW1S} @1Sm댪 -LM Q#p롅`a0S  @T 0 S p@t 1 R Q 0T2 0T/ 0T! :P{ { yut @ XQ @ 0  0 0  R X0 Q\@XP Tx0,lx -|XL0@ S@V Y Y Z \Z |V |V |V Z Z h^ 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iPLW W \W V p7 R cQsQ CQ  P  700BPLW W \W dW 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @&+   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 0&00_,ptp؀xpL`"apphl܀wp, p-|0LM@`@P፰\\0P P0D D0< <0@#ph,؀ Ԁ($ЀP0 0 .PP h p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c 5= 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-a b b b b a a b b b a b b a b b b b b b b b b b b b b b pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c< 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l l<0 0d c 00dR0c00P@$h@0S\0PpH0P0  cH<0  A Plx؀xЀԀ,x -LMPP`0  @P0 04? R 0LyS{@h Lg f f @h0 Ru M00 pW-00Ĵp k  0pWurLx@<`, p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPuv0S00<@ -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0,0 +{0S @TYP p300(Q 0pppx$(4  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @0yPs Ve `FVV80S940qI`@M,03,0!0zP00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y02P PU48 ^v4fy540P``p;yx0 @ x00qQk D0@@ P[  00px4 $( -L$MK0 K @KK @xP@ vy6 0 RPP, -T0LM @R 8 TT^htt@@$t@,0P00 ͽDH -Ltht -LM,@0(S]00000  -LMp@PZ` !bdp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K%P 0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S C Xpgfff -0L  Ⱦ -LF -GML M<2 88@Pp`, $"cp fPp` iPp` 1 @bTQo:*1IKaAAPp4: S Tc녾iBKHH+ P: Lf8d0Y/S/00@Tt p/P`` 0SP :0/S$ V:0/S `FV:0/S`90 SR0@T4 P  ,.P40`FV:0/S DLvXH -LjM M(kKH0 H`p,0 BP;2Q 7P2 R2 RVᡆP,0 S ,*Ӏ0S  |ل6: S" KA ABP L6: S ?P $6: S V /MK@D @D&P1RuK@PKP$R7P KA AP]NK@D @DLA D>= P@n=1( K ! Q@10 `E P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`E7PRL 8 ̚DLH<DTdxMCd@p7 -0L$M@  H0 < H@PPD@ <_@- Pp ePbt0Sp h ᐢ@T SP 4@@nP<<@a<D0SFHP=00LጀP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , Z-Pt<P @@廃<1P$<岃@孃0-S @奃L0S @坃H@@ 0 R@參@勃0;0<`H0P0JPrzkH D a@p}<@̚MbDЫ -LM0 4 P; ,K 㔂p# ,0.#4 P ,K あp ,0 #4 PPlx,l@ll 00廀\!8,$@4,4 00媀 (Tt4u|̚ 0-,@,PL $     -LM@P 0DP 0-@LPU 0S1P000 -LM0@S hp@-0PS00p-\@@T \ P`r00 P 0 R0ATapp -LM0@SK P  00 -LM@08SK  !p 00  O\4 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  P4P eTPXЬ -L5 0-XPL0S S 0@ S0 00XP -LOM\0X,0 0P S ,0 S ,,)OKKK`VT oQP W?K+TwPW?K \!QH1SD1 L1@[0P S Tb818S <{/ 4XC̚ -Lp`@T TT#6P0S! P T0  0S T (@T TT (]4X  -Lp`PU U @0S P U0 0 00b0bPU U +4X  -L MP`p@T T T TT T$KPKP@ (KFP; 0D S갭 ȭ | $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S꘮ | Ȯ )Pppý)Ppp ))pPp)PppӤ(pX p-LM^`P0S p.T@0S 0S uP0S X p-LM``@0S pP0S {@0S tX 0-@LP|UTp0 \0@ R0S<i6|SPPCTXrx -@L8Mp` M\l2` N\X2@ L")^p5&LKTpK`H P K0T L` {(P@P00P0 孾PP2 P 9*0H P0 T @@^(P |'M<K %P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \C0[SD[0 CR 0R P 00xNl~0 pW@X D00CS00  ä0 Nb08PxL̚ -0L 7o p-0LAM @P` v]p sP` /0 @bTQ!P <PpCGOKPP V{.6PP{LX -0L ȭ -LMnQ@0,T  hoz00000 0 000ᐵ  -LM0p (0 dP@/UoKK/ZPKU  S?K\ k0SKK,L1 H1 D1 @1 <1 81 41 01 ),KeL0=# MX7(0 S ( -LaMb>K0C 0Cp( @Pv$6: Sg  SPW(0 S (KBnK`F`F|!|1(b0S^@aDPP$[NK@D@D  AP62W>C R0 RW W6/~ z0S )@PPW d~BnK`F`F+M0)0KW ^ĈedA$H̚ -LM@X 0s ]]]T06at -SL Mp@Py00!1/P`!  SVx y0S@ 0P' P* <W@y?00 \@a` X0P' P* "W@y?00C\Ĉd -LM@ K K 0K @@&P -LM8 < @ P`pm 4K=P@h 4 0R SB  P`Z 4 "40@#[P0PS ,KL PP 0 P@ U10 v |PP 00S0 K^P 0 R ;;S fPP 8@P ZPP 0< @0T NPP#V pĈ| -ML M0$ , p P`:x?000!1 ,0S ,AP@ KP 0 4P x0S08x0S !0BKHH F!0@CcPP- ᎛0@S" 0S 0S+ 00L \ 0$ 0:ex?000, 0jc$pЮDu -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/w "00Z w 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUw"00 P pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 Wq0K J40K5 B"0@Z$$ `JPU *0 K0 ZP00KU:@ K00K ,@ {V`})V`p ` -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sw"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0% 0d|8^,Q@00 K00cPE: UcU pP/`aagfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  RpaLa -LMp`#0P@ r c\P \0 P@l -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 `Px 0 aP0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 ? -L Mp`@P@<K4K0H0S񟗦  4 T D l $ h D 4 h T  X p 4 H  T <  4 T D l $ h D 4 h T  X p 4 H  T < 8D3#cX Q0@ 0 KD0  DK5P0S Pq!000PKp qDEq!00CP3L#cX Q0@ 0 KD0  DKP0S +q!00 ND"q!002cX" 00D0 ?0PKQ@  DKP0S q!00h )Dp!00ŸH2D"cX 0QD0 @ 0 KH0S DKPp"00p"0020K00!1cX! 0QD0 @ >0PKA0S DKPpp"00lp"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLp"00Hp"00D00K000 0cX @ 0Q@D0 00K DK\P,zp"00(vp"00$GL̯ԯܯ (0(8@DH\`dxl@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R 6p!00 YC-p!000g00KP0 cX 0QD0 @ O0 KA0S DKP01 R p!00l +Co!00x1900KQ1!cX 0QD0 @ kO0 KA0S DKP1 R o!00 Bo!0002 00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R o!00Z Bo!00Q2ݫ00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R ~o!00, Buo!00#3诫00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R Po!00 sBGo!002聫00KR2"cX 0QD0 @ 0 K0S DKP&o"00"o"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R n!00 !Bn!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R n!00 An"00v000KP0 cX 0QD0 @ 0 K@0S DKPY0 R n!00QL An!00HD0Ԫ00Kxİذ(l@H?G?m!00 a@5m!00?0PKh2d"cX 0QD0 @ / @Pځ?0KtB0S DKPm"00 m"00o?Ÿg/ 0 P0 K05P@Q1!cX 0QD0 @ K0 K0S DKP1 R l!00 ?l!00{S?0PK,0 cX 0QD0 @ 0KP0S DKPa0 R l!00Yp ?l!00P 0@K GLH@hȱб$,D\dll@D$@h0l cX Q4O0@ 0 KD0  DK?P0S Zl!00 }?Ql!00@0 cX QO0@ 0 KD0  DKP0S 7l!00H Z?.l!00 >xk"00&D4$cX Q0@ 0 KD0  DKCP0S ^k"00 @ >  }>Qk"004C3"cX Q0@ 0 KD0  DKP0S 7k"00@ Z> V>*k"00Bl2h"cX Q 0@ 0 KD0  DKP0S k"00@ 3> />k"00A1!cX Qi0@ 0 KD0  DKP0S j"00@ >L >j"00`AD1@!cX QB0@ 0 KD0  DKPw0S j"00p@ = =j"00c0 0cX 0QD0 @ @00K0@0S DK|PLj"00Hj"00DD00 K\`Ȳl@HG?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R \j!00  =Sj!0000K000 0cX qQ00KD0 @  O 0@K DKP3j!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 0 10 46@ d,0 "&`'@0@p 00 `P@0,!O3\ \0 uL03  1S@ܲRp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@L1h Q\ Np`'T<  0 p`@A 0-L LP@^\4 *0%0A -LMO@i0S  0-H LP@K0S0hOp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&xO@[(8!8HT*@@*TI2@0@b8PD8@8#8XU*P@*U@2 ȀP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0 5 -L MQ@0K00#  0 0T0P00S00#0 -LM K K!P -LM K K!P -L 0KM#*$ -@@L0MP0  0 L0  00S00 K( KGP(b00a -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S ࠹   0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P   ( 0 8 @ H P X ` h p  plhd`\XTPLHD@<8 @ XtĴDl 0- LM@P K0  0 p0*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J       ( 8 H  X h x                   X \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s p p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @`p -@TL P`p T0g0 0l 0 e@DT * -ML M<$08,0  ,PP^ 'P@cBnK`F`F sP 0#S   P< qP  kP33p 0PP( BNK@D @D 44S ?R0Sp  iPP  44S ?R0SpO/2 ,0S ,>BnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 44S ?R0Sp  PP  44S ?R0Sp BNK@D@D +< PP A0S  PP0SU|0S  0S  0Sp 0ST P@008  @pNyl~w -40L R4P P00鬦 0-LP$P P$@ \P00鰦 0-LPP P$@ GP00鰦 -LtM@0SK k0錀P H K 0S x0L: S< ]O00]0P0ꬦ@ -LM@0S00ꬦ -h0L,M80 \0 00 T0@4 , (0 $@ 00 8K 0  #鼵@L ̦P0@-@P  0S ^ 0S^0 @0S SS00@00P0!* -QLM@,0 pR ;P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4 @,0PP`@,0PP`\0 0** --L]M qPM?KC/`KK \1 4Q 0Q .  =K0K0㑟0S cK|1 1  x p@ 1P|ޟP 0S L |1S00\ 00꟟0|1 B 3*y0* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !o Q *v* -LMP -LMl"  2 ,  " !H p ]0P2 0PP 0SC P P 0S  $481!`)!<[0`X0 `-0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ  . .OK @D. |}P-?(K R!  q}0S -?(K R2S "RםK d{K\ǝZ0 4  MK0iPMK* P+ 1dMK  PZ ib Z0S }Z L[* 41`BnZtLD - hbZ0#S ^Zd < R@]K 0@,q"|@B"2@@P 0S"2P8 L\4$4`tȶCĵصЦ -L,Mp`@ KD0K< 8 @ 4 0 , ( $ ҤPDP@  0`4PP @TD}Dy  -LMp@P `p08K8 (P , 4` p7K0 8K (0S ( -MLM Z,   4 `a V $ 0P@Q X1X1 - Q#Pp' B^KPEPE0$!@|ÿ`|V INK@D@D~P 4: S  R 0 0 ,0S ,嵡aPt $R 0R\ 4 L 8凿`p a<H`t -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $n -LEM@pKK, 4! <K081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,宠0S @S P K?KN)`0S @S K?K@)0SP @S  4.P`8~ 81S  K?K() 4t8 0SP @S 8~ 81S  K?K) 4\8 p` -LM8KKPp <, PP `P@ ,0 S ,4P/K%>KH D LB @B з  -LM✑圁`KK <, ````p@\PPB <PPOP@EP/K%>KH L @B 0S J "00V:`P@ `8%0==0` 0ɍ @ a0AS"v v v v v v v v v v v v v v v v v v v v { @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖w y y y y y y y y y y y y y y (x y y y y y y y (x y y w w x (x y z z IPI< @\  @ R  @0<@0 X V:H   ₑ H lP@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H FP@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 +P@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 ឌI 0@'͌@ I p@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!* --LM p-P0LM@`P8 4T  4m  , - 0p@L` GPP0S @TP@ -L 0Sa 0-0@SPL((ٮ 00 00 $ 0-0PS@L喋PP咋 PP0P -LM0`Sp (KWPP (QC 0#S@ S> 0 S RA(  #P0e(0 (⌋P@} ( (0PPP@ P0 S S0 S S  P0P0,K ,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @̯P@ (PP 000  bG0@NG0@00㮊P0 P 0Vp$a0a -L>0Sa\_*;\* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ b -p`LFPP wP @P oP 0S0S b 0-@P@0LS00f$ 0000ᕫȻb -LM(@0S0 G00Ȼb -LM0St (K Q@`Tg ( 0 S RL0L(  S *5(0#` @Rq PU`@0S0T`Å᪬PP `0 S S0 S S ᛬P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\nPP 00PP@Ņ,,ǪPȻ̻пph@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0Lp** -PLM`p D000@,K0K 0 , ( @@p0 WV0000ɆPP0  0 @@p  C0@C0@* 0-! L0TTc!P@CT @@ T 0C0 0tl -LMp`PB@匀T ^=0S0d0 @ȥX00U@ <:((%""Cpt -LM@(@T0 @ p   B00! RA R0000000000000000Z* * ?0-1pQ LR@` 0S 4P @@ CZ0@< H0k000S@ ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@ 0-LM 0x`r.0l@hZPTUX0 RP 0 PP@ D0 p-LM@hP`3\ 0 @4)Tp`0@ R 0-@LP 00,@r.0  0h -rSLM"0@P` :\Bp 0P QB0pLB p-LM@hP`M \0 @4Tp`0@ Rm 0-@LP 00,@r.0  0h -rSLM"0@P` :Bp 0P A0pA p-LM\@0PSP`PP \@0PPPpPp 0-LP(bP0@P @[0 p-LMDP0@S8`p$0P@@@깄 -@LM5h2 -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KD\d QR dPPDDDPP XK 5X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,jUT@PPh@T P@K0h LK@&Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @zPULD0LP 0H3LK2 P@K@P`֤P: h0S@- ƒh@ )R P  T P@ 00CS0 0Ӥ0 P p )0+S:P P P ㅤP TKC\ d0@RSA00~h PlP \QP!00 DQ0SG d0S7 d,0d LKP@K@sPPP L<LWP0T@KPT sCoCkCPP d@T XK X 0SpR`@@K` `0Q&H0 /P  ]**$* -LMğ !  \ ,    !4@R@ `h4@K K 0  K K ,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  &bPP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00W?L0@X XKK, }PGK K K K ~K zK vK rK nK jV0S x!@l0S3 0CS/?u@41 ,0S 4,^ KOp>0S   WKP7KXKL00L0 60[S0X K60K#:>00Hfp`> 0H p`pL+ 00 -L0Mp0P 0 `@ LKL@KD00D0 Q Q >00 0 S 8 ݆, Qt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0d*K**%*o* *R0S 0S0S0  R00 -MLM00  0PP `P@T T 0T,S 0S P rr  0PU  0PP  0PPP| p-LMP0 S0 `@0 P P0Syr0X S0L@0Sp00hr er br -L MpȀ@0`SP(@ &\0  7P 10$ KvP(KF4P  (,D0  $*r|L@-0S@ @ 0 0 0  -LM`Q ^( @`p$ 4 0PB ( K10"P; (P6V00T00S(0V0T00SW ̘P P0 $&@6$ 02P $ 03q$Kⶒ --LM -L@`p.`0 XXPbT  8R8 $0Ey  Qk ,} --L 0-<0@ PL,,8T R 0h , 0-0L@P 0S&P0 CR 0P0 00R P". 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``|hp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' -p"00@40S\00pgS \,00E0XSxS@`Pp -PL4MPL p` 0 S@P X 0 S @P L0@KᲶP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\)p{} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 up -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h P & P0S1*8  P+ 8000p -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi P0S PP PP  000   PP0S ?0PSp -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , rP0 R 0S@px0   0 R PX 00p , 00  RP p`p p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4 p p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Si( 0 0 0   T` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S  -LM P p0 0@W` 1R VNg@0S P0 Dg0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ tgP@ 0^?>1  ^06g0@WgP@ 0@0'gp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p嗼0 00R0XfPU@  P g i霹 0S  Pi}ff- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!A000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 e0S @ 00h 0-0P0@L e0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P05eP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheeeddeE -LuMp0 (, 1 dP`` dPPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 励uK %P? 1 p~dP@ oK 0 ,0S ,i0 ]10Sdd H0 @Jd 0Ab@ -LbM⸠0JK(0 p @)@KkpcZ_K`\!P TjKjK11 P 0S(0 S (i4 -$0L!00  -LMpj1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ṲdP`a\ h000X0 WpGk 0002XpGHpp|H`\ -LM0  Q -L M@ 0@AR*Z* -QLM  0K  0   0-LP@p P<p U T 0\ żpP U㺺`" -LKC/JK X1 0Q ,Q _?K A xA tD0 bKd1 t DQ + 0S bp7|{** -LM@`p(]PP: 0@0@@@@@@@@@0$` $0 P oP@0 hP' 03`P,YZ#| WP ` 03$0  < ᖺP$00$0e]]]  `0S $ )@TD0 003$  3S03Y`` 0SV,0`@,@ ,@ 00|0 0CD -LM( Dp$ ` /WPP P Pᣲ@ (@00 00 0S p-LMP`P 3@S0S0@\3S\P(P#x\$0 #10#0V@@Tk\0pf\R0`\P` $0E`U\ -@LT` $0* 0QP3 Q# R 0PU@G 3\3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` ᏹP3ա 03š0 #0$0@P$0 :.$0P[3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P o 0@i@$0 @2 u[ @@_Q $@ 0 0R 3 P0 3L00 <P  *PP$0   30P0K0 8PZ3 03 PU 0  PU:$000# 0B8S 3S  $0H ɸP3ԡ 03ġ(0 #0 Du R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h qPp P600D -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z }:PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT Z0{ 40$0:$0?00puP  W $0 P T 0phTPY0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03p00 <0 |@h400420#4 0 BH  L ,0S V4 #Q400u -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00` Pp` p h 0 0pP 00 -0LRP@` V P  0V @T` 0@T000(00XPpPppX -LM$0HPPp`XP@ 0 $ 0I00D @0(`޾0 -PLM@ @XT 0-00L@ :0S00r?0 00X0XPP 0S PoX R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0;0UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@p  ፵PP p-LM` PP p 0@0W WWP -LtM_p`  KPP0: S w0 0 p( 4WP@# $0 0P $PP 0 Pʼ;#;S + mWPp  P`P*7 WD @ -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T.4 , d/'  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPTTTPP\zT ;T`@L  0%0D+TPc`H0S[ZTXT`@0\ jPPBp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ?P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|p -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0gp -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hpG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp2OP$ 0 0( 0 0, 00 000  4 ᭺ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$NNNTPPYN$N iNd@L  0'0DYNP^dH0SVNN$Nd@0\ PPnp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  kP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|p -LMp, 00 Q,(P4 0 8 0 Y=0000AϠ0 P0P 4 < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8寱0 4媱0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0Xp -LMp, 00 Q4(P4 0 8 0 YU00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< 孬P ,Y 0 8°0 4彰0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YpG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1* -<5L|MHK0 @K0PuAe/ᙴ@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄLFPX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80p408 h0l K@<0vp6[>lp K@4np7[0Pt K@4fp7[04x K@4^p7[0| K@4Vp|00 K@P0Np00 K@T0Fp0: K@0>p0,K: 0墛 0K➛ 4K⚛d>F`DX8FL^d3FKD޿L^*FEDԿL(Rh@0AZ0\<(^\2:FPX' D帿%P@@`H PL\ T D P( )ED塿^KHPEPE0!  P@*|1 R H dPD %X(L  P 0忇Pp KAA CXPX E0帛`@EPP  0P@( @<8PFPy`` _EP  ̫00`HH L h -LM@p$ u$`K ,PK 0 p P , 0S0$ 0C0 00 R0S   \ 0 S @0:SS |S0:S|S S  0-L@P0h -LM<@0S00( (0H00 -ML$M0cßS0 S, 8 < rP "0S0@05 KAAgP@R 08 0 C0\  ||20  00S X0 S\R000:S #S $Ÿ ^0 S\R00KHHpP0 :R0h;cp0 \ B*K08AWAP=|gP08@0pC0@.š 81 p p@qBNK@D@D0 08 0KA8<(0 A@;0S@ 0 ,0S ,I:80@ @00P dgPP!0<{gPCp -Lp= P@ dCP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`8DP`V DPfd,DP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?꼞ȞО؞ȞО؞00:00 0 0 00T 00S:S00ov -Lp= P@/ dLCPP! 0d:SS 0`e\d@ 0:SS00e\@APCPPUaCCPd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0N@0- 0 Sn@Sb -LM K"vtO*$* -LM0`=S`pP,KRP@; U P:0P00@S=S 0S=Sg! P,@BP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QBP@ 0 0S Ш0 @0@, 0` p-L@`M@PKP 0! 0S0 p` 0-L M@kH0P (0 $ 00K K(0@  0  ,P 9P 0LL B*A`*#* 0-L@@-@0S  S 0Sd@(Τ*(Ȥ*Q0 {b 0wb$h﹤*$%ﳤ* -LM< 08 rSwS@T 00  A, ,0SZ 4KߝPTpPH P < 0rS <0@4喻,0@, P,00,  4@00@T 0}@T< 0rS 0t4P 80MKM4d0@4`T B4W0U,A,Ahw8 -LM☀@`T 0S `@TT $pK pPj0S V0000sAu$ -0-LMP0 S@   R1 00 cQ  R!,0 偶 0S ~F0` -0-LMP0 S@   R1 00 cQ  R! L 0S IF0 -0-LMP0 S@   R1 00 cQ  R! 0S F0  -0L ` -BMLMh#0P,0 0L4  0S 00,3 ,0S ,E/㵓PL$H$ K>2P@@ᖖ00 cBK J JH 妓MK@DPpP 0Sr|`0CK0A S A P2D4 H2@ K0C0C0  A  ᐵ>00C=S񟗗(0((((0 S  1S!00 c0T p7C0L4 dPnL$R 060S3/ȩ,XD(`wh@-@^  0 S SS00N0 --L !L 0-LM@P᳓0S 0X0S Q0S  K\ 0 @@P  -LM@`POP pWW0S `U @YT :0S c?000@0PTP:@T TW ?PP  㙪 0< -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`T < 4 000 㣡ׇ ph鮇 ,}P 0000ӑp p-LM(0`S/   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L '* -2MLM#0@,0 k0/S  P BKAA g+ }p Y W3*WY 0P/S00@83 ,0S $,C/ YP<P"P@aTnK`F`F v0Z0pd  1 0 S/R  Rm/0 0 x2(K RW\IP LDP@ Y 0C/0h@+!PBKAAP@L<: S< S0< ?nK`F`F!+PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +Ɔ Pp* +Րp?00^ 0@C/Z0@h>00SZ I, D\+㰐>00S8 B>K0C0C+< 塐!XDu p-Q00P00LMSP@`P 0s pg=p[(=P@`I00p 0S S* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0걓P %T 0S 0S0 0C` 8,0 S |,/BᓓP 8P@pzT|\ PP(DPPPXpiz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 P MT갼`\Z  @ T *000ɒP d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `ꌒP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 bP XZ @&43@4 0qL9  00S 0Z0C0   0S;P 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSappp pppppppppppppppppppppppp(ppppppppppppppppppppppppp(<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXoRP  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SF@00CS0000?Z  /@xeTET& 3NK0d@3K) =K43@ 4C  43 43 K83083 43@-x4# 4# @x3KXx3.KXᗐP    9 S9ᅐP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@opdt @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ @000媏P`dp@V 0 0 f0 0  f] -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 蒌<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S NO"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`Ip -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 㶎@K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `p -LM0 @0pP `冀7PP @ ᔝ00@P0  7PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0ʜP0000";f 0-P@LT a DA0DSR0D@TP0 \(ˉP.T.Q0 -EMLM@H$ 0r/, -'H4 YL h Pl4 Y t7 ,0S p,;!4 $Tǟ8(<,"(S\$ D ` 0 l OPpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l NPpXD(PR `V)*WP` VX !*OP`V H*HP`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$H܋D4p cWHD4 0D$ YYX^ X$ YR X Q V@ Vp XVp0% H$] Y\ YY d^`` DUPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 ZJ`D40D4 D40hD40D4 <K 㞛<0S80S40s?2 D4%]8YDlkUP%D4|H$D 0 l MPpDcPdd ``QD4!0 2P^D45p#04P 5wy DpCNK@D@D 0MPp:Pd40d4 D4` cpWwD0l D4 D1PP*CNK@D0@D 0MPpPd$ d$ D4P0P ֊D4`p0D4 ϊD4p cWdd Ų߇D$H0D4 D弊D$p0D4 0H$ VY|jf fhl 0-0L@r/t'PN0s 0  0S 00|jf -L Mr/0PNp X X0c. 0qP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn I,0[S6 `S@ 0fS+ "bS @TV0S 3P Ƞ 0]EP 0S` 4ySX`{ ,0[q0@T t1  0 D0S:R .R 0P.S  SP,h!hh1H @0 p@@81  :ƆPz0P.Sl  RPp,ἆ < 00 @p@0 0x@v+h0K ^EPP'\0 s/00c0[|jfphf -BMLM3@0r/, 8 Mp XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn H2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,F82P< Ƞ@ <4CPP&@$< 09Pp Q<2  G!0X0P 1 8$0  0 0 <2ySX p  b0 υ@tP. K`g0 , !НP@p PPUZ.0K g嵅p00 0  0 @ 寝\v/00L00SS (  h|jfhf| 0-8P@0LS((U0@0U  0-,PLP 0@T 0o@ -L M0r/븢4 0S ,K UP@ ,0 S R@0@,  S*h Y,0`` @#R ##P`,VPP r` IQP], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`VPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4tVPP @, PPn4 0 ,  P H0 DDTP W|jfphf  -pL` 3P@ 0SQP PP QP 0S t0 -pL `P P@ 0S 0S 0P -鬁L0M 0嘡0 0` px1Z>*pUP@P7 P O0 S S0 S S UP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4UP@ PP $0W`4h`p -L(Mp젟0 S( PQP 0@`8PK P@˛P00囆XΞ    t@@0p!lL0\S@0 !$ 0^A((((,(((hG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ(h(@(`(0((( -LM`0(K\p@P.  r($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ Ks -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ <~@a 01S @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( X%X@ phl -LMp0@P 0 0`K 08#HT UPUP#08  0 S  /ϒt -BMLMr0D`K@P ,0 02S0$S aS@ l,0 S \,/@0$SHP 0KY @] P TKDSAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 "TK  tK @TK  T:m0l(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` tH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, z iP 00 0S$S 00R5:0PK c z z K z  z 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,(4 0-PL@U !", 1#80!"$ 11PX 0h銎0 -LDM@@ hKa p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#* -L P @ 0T `  p0S# @T 0R 000 00 @0po P 0p 0 0R @ Q-L@ 0Q`Q p 0R /0媅0 0 0R P  0R0Q 0-LP@0T000@T0  R 00d0R00 R 0 00  0wP@0 -0PSL`p  |P@ @P@  jT0000S ]?*0<* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'/0$0(0P04040/<0P0P0P0/0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 30 SP:00Tt -LM0@S 0ہ000 -WMLM0@P=KC/NK, h5 @A (K  2@2  0IZS5SS5SSSSSS56S 77S8888888888SSSSSSSSSS8NSNSSSSpHSSHSSSSS(K *Y 00I SP100PC0 I R$Y 0U@@22R SK).K?K .  00A SPڅ 10 A0 R0PC$^ 2S12 2P  0U@@" B\ R \ 2PB K).K?K 202 P100PC0 I R$YR   } 2S"12 2`202 VgTB   00\0S㬀K& Q; ':Q <r`>(K VR  "202 @"PaUU&0 "2 0RPEK2 " pUʄ6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTp PfUUhE00@ "2 0RPEK2 " pSU0 "2 0R2 " p@ʬ" n` "2 0R2 " p\ʬ" "2PcUUş00 "2 0RPEK2 " p=U! "2 0R2 " +ʰ2"R2 S0K 2 K7P P ?KP Q02 0@,0 S ,o!KP PK KPKeYU K/ PQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCUoU C00@ "2 0RPEK2 " pU0 "2 0PPK BKPKKP{K"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 p1 0 2Q02  KhP0KcPK )AKZP"K20 "2 0R2 " p!ʴ0 0 20Q2  p K 0C0K@ "2 0K*PKK#PKD  0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q_KPKPK \AKPKKP~K2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0 KzPBK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " TPK $CKKPK00 " 2R0K8PK3PK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pkڠKPKdPK lDKPKTQ K00$0(0K0 "2 0R2 " ?KPK'PK % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 q0h0 p`PV P00 U- >(K Pu`  2"S 12 2`0" 2 ~ 2S12 2  Po " l2 "  2S 12 2 Po  W"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 )   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@y 2S"1 -K2 2202 -K/P K/ 뤃P- >(K ` -K-Px2KL -K<KK 2  GYgY|\ggYEeeY"fY \  ``y?(K R- >(K {\0l``\`T ` 0`L K -2 S``2 2 KS12 2  @]"*" l\2 0 z Q 2S12 2  2 @ 2 KS P12 2 202   2 KS"P12 2 202 y   2S"12 2 202 c  2S"12 22 /202 N8<|2S 12 2 2  092LS1x2 2  P`" 0" 2 x 2S12 2"0X T "  |P `hV`xl`",9D $Y K >(K`2S0 2 KRP 2;&KHPK0S"O7 00 -LMĉp㴐K @4KP  , 0 4pK3pK2pK1pK0pK/pK.pK-pK僁`9K  0Pڸ0@%SP@D @ 0AZSX\\X\\\\\\VX\XXW\XXXXXXXXXX\\\\\\\\\\LXZ\Z\\\\Y\\Y\\\\\Y\\Y\\\\\\\\\\\YPXZZZ [PX\\$[\@[Yl\\\\\Y\\Y\ ^ 00B S`ԅ100C0 A R$Q 0Z0 W pKK0̠ P0 @ W p ̠pKK*Q 00A Sh00A Sc 00B S`ԅ100C0 A R$Q0Р P0 @ W p РBKK <100C0 A R$Q 2/  0Z 0 W p KKk 9  0Z KK^  0Z KKS 0Z KKH@ 0Z0 W pKK80Z KK/0Z KK&   0Z KK   0Z KK   0Z KK 0Z KK@ 0Z wKK0Z nKK 0Z cKK0Z ZKK hR @y lR t r  0Z BKK 0Z 7KK@ 0Z ,KK  0Z !KK  0Z KK  0Z KK}0Z KKt0Z KKk 0Z KK` QW?P$0Q0S]]]]]]]]]]l]l]]l]l]]]]]]]]p]p]]PP^ 4 K^ 000 x,0 S l,)PȀ<0  yĐp @ -LM`PQp0 @  xp@   }彣@  b~p x0s 0 r( -LM @`PfT40 p ETeTpG/  P090 ,K0K0RugTGTp400  fT@ J P0@ 0 R*00SC 00 0:0 g 00S 0@8 b P0h0c -0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  =gfffT 0-L@!0RP0L1 0 000 0P 10 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ xp -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@:00@ -LMp`PW, `pP 00 R!0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1pq -LM0b 0PUp@ڂ Uk R0  R00@ d 040 Q2 :RP 0E0d0Q0: P!0 <01R\3# -L@PP`9 @P`` p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@A 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :CQ -L\M8 4 ] 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D EJZD0 SD@00 HLYO2JVP@ 0 $OWl aD@@0dPU 0 8OPV MU-L"00p0lP dvhtprlptn8QT  P0 SrpN`||@??ER$ U@ L`@P 0 NU`ʄ5I1 0 Na&j0jV0Vἐ5XH 0_l ll0h  ! 2u , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O aNP@<p`Pp`zP/O %Np`*3 Z] Z/O pP3.O N=LI<p`\p` x0 %N 0 Ma&jjZ dghepcta<LH0 MP@<PX46S / FP/ 0P - 7P`K5I /0 M 0 M1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYl"0y\0zi/ P . MP@F[O0<0S, 4`!6S \ <@T 0 hMJ/ P@PH  0 DM>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|@`AMPe ,  :NP@ ERUlU@ p`@P 0 MU`ʨ 1 K 0 M`K O P`` K@K0 L0 L.O P@P5 P@P Pg@0QtA 0 @ n@ L0 @AL 0 @qt@  L M}/O LP@[/O LBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 ptP8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l jK. {KW/ PKP@ QFR/ qK0 DKpI P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%xx@ H?aCoc?`(?yPD? `S񟗹ꌟ@T@@@@@@@ğ@@@̟@ԟ@ܟ@@@@@@@@@@@@@@@@@@@@ @(@0@@@@@8@X000@ 0S`VLB0S<2  02 P@0h2p' 2. 2Ύ 000 0 00S 00 6 0upPPl1 ,0S ,|g 0000T1LQ:0@1 14101,1(10p0p0000000PpPt p~lpK? lP@`&yV0@  Pqpi@nxldp`lxb -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  {nZ&fQ *6 p,K(2,  R 2P8k@0T1 *0kP,0@ 0, PT1:0S  kP,0 0, P11 0F0 Q 000S P!0S0 0 mP  , R0000@ 0f00  j R,  0#P R,  0#PR 0#P LN0 0 0 ,0 `|dph0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0_m8jcjP`VP@@`@PWPx - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S   mXJꖾP 00Tyc` -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K2,P UP2 2pi\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 cl0GP@ 0 ZR Z 10 % `g s :#:S `riP PU,P xi @$ET P, UU` !@Xi1SRipWPU,P  Wi @$ETP,p U0 00 SR0 :JR|0 R0P@  f c`tdhp@\t p- 1LM PR  1 R/0 R *0"*RPb%6 ` V+0 V`pK0@ T@0 0@h!R tl@0S p $0`tdhp  -X L0PS HH 00CQ03 00k00\8 p-LM`0PS@'00 S0:0 0CR@0l T00\Q00Sp 00kpkH% p-PLMpPp`@ 0S0X0T S0 ph60 0CR0pphskqkX -pL0@S`.P0 0S0"T )0 0CR@0x T00Q00SLH똼 00 P|jff -pP@L`r/0W@e T@@)0@"p0V`@ h0 2 `@\0@#$0$ ("("4 400g@I|jf -(!XL"x H` P iT hdTU H -L'T!!Q#7011A!1 ȠT0!90T0A0 !0xp00 cd1(0000 c( S0! (a c0#7%c!c1c X@0 T08 #HT 0 @00׊ 0  S0 900T| ?A7c%c!c1cW XEنpb`dhyf&,jDtFl -@pL᠊ 0R 0SZ`0 P@0E.>? B7c011N0 d 0!T 0 L0L " tD/ul`fhdEنjbF! !U0X0\P 0-0PLr/8V4@0, ,VB@0S0|jffh fH -0PL4r/uV0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S LPp 0@W0 0 R@ 0TP 0P|jf -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,u P4 -AMLM,$p(. , "h  V, 4  P 0 ,0S ,qP`F%BKHH 040PSP=@:H $H( 0"(lP0P`F SH -LMH L p r/0, yUH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢 H )TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 yPk00D"DXPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑp` -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ` -OMLM@ 0r/ , ,Q05 - 0$QUT U U U 0R>*l= K AAT !p: To!4oS- I>K0C 0C000S000@S0005\ =000@Q KY/0`00n0`A ` g8"P@ h lxPpd  TY8P< (K OKAPPI $< @REnK`F`F fK4@@ ;P@(K R  )P&+(K0 S S %R0P S S \ \ \00\``V`@,88 P`e $ )P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|zH Y)PW$*(PK0 S SQ\k0P S S \ \ \00\@@TY`, 7 7P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  (Px((@K0 S SrUUo 0 P S S \ \ PP P 0X r0 0  R  0SMKL LL@K '50  :ON.K B0 B0C P0S  R4E7J4 R2% % P lJT ,8O |(P&(@K0 S S U UP 1115  \ \ \ \ 0 SSz ;S`w 0 SP 6P ;Q Qq 6  0P NKJ J  GPE %4!@% h1 6P`3  Q;Q Qq00  RP 00  !PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώlO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  BPx 'Pd#(K0 S SLY?P  E "  9`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D5PPV:00占P0:0 000,0 S @,4DIPP $ENK@D@D,P.5P ,`5*IP= `p,5`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0S&1S|jffh fdp̱"pl -0LMP0r/M0pSD Y@ S S@0TP S S  &P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S a&P  [&P0:0t Q&P0; X I&P0; < A&P01|jfpX|Z<4<("4 <1QS0 W 0-L@PP@sT0o 0-LM@ P K 0K  P @@Jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S 8))))*^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PPp P-L \hBꞝ/00h -LMP@`T,`K,pK 3P 010jP VX`@TX ,K F0V0.T00S` X  -"L$M0K 0CPcT RL K0 A ,P@)t W~ { 0  y4P`K> @)>K 0C1Kc@@2AlA H D< L @L D7PÓ07S K A 0P@07S  0\KclA18 A 4< 0 < 7mQ T00%Q00S  `@Dvr `W!X< APPD@`PeX } 0PC 0 AP PJ `81 K@@ 0| P PJ ` 1 K@@#@ h ̚hL ,4@ -LM0@s O0000 -LtMp0|@ $0 " 0jP`KS  $0S $cyAth KPK叀K/) DpPOPfp AK|hx -PLM@R  ?  000 -LM@O 0 0 0P0 -LM5 -LMp@`P0T@$K P,0 P00g Z@ܐ -L\M `\, l Pt 0%S U 000S,0 S ,@zT@YWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWHYWWWWWWWWWWWWWWWWWWWWWpYYYYDWY[YZWWWHZWDWWWTZ\ZhZpZ[ZZZ [WWWWWW@[]\[[[W[]W]^^4^D^WL^Wl^t^^^^^^D_`_`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdKt !0 >hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1Atal8|*,$IQnmL\40 -LMTp,@KP` 0  ]>  0S pQ *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q0 S0 R -LMP LL1R00 mm@ `  0@T1@0pT mmP ` 0@11 T!@ 0T p`P%P_00 0@T0@Tlpk0@Pw(0SHp0T%P00L4'| -#ML M$0PP,0 ` *P 0:S /S .[%P PU  0:S0/S TtW :(@7(@@ T*BNK@D@D+G% +-+).3%PP FP/p@ #\K(PE PE#ᙱKP741 0-$0)(0% 2R,p\ \^3^P2P ZZ0Y0 YQ001001 0 e b 0RQ @Xp@X L0 0 QsX Xp@pL0SP7d0T7 @S^ XX 0X0 1QuM@p0Xp@ X ZX 0SX7. X X  Y\ 0S\70X 00CX 1 RXl0 ,0S t, XPU/D$P8P0`"rLu0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDMP\ ` /\0<S \0@0cd0 0S TKP@ IP00 `R <R `@ ~`@a0S,S ;S XKP@s 0V0R00S D ;Q,Qh Qd@Q` 0011P'RL7`c \\%0011P'R\\ds01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 PhY 00 0 0 SmM @ \B"d Y0@ `7"@<KnP@ 0,SPKeP@ ^d TX0]~h al0 0`p LP7`Tdh 0< KhX0@hP KT0@000@000 L1`"`!!X1X1 !h0 "b"b3h0 0XTڄT0>CX0 &@>`@ 0@>S``@ T00c  L7PTdg\ >0@>S\ @ bd  s$<0\@ R !`0@d T0 Q, -@LM$0S h -@ 0LS0 00Php^ -@LM9h9x^ 0-L4P@8 P0Sl!P. 5$PP!\ 0m ,TǃPǃLǃ ;!0hP 0:S H HP 0 ,$!00hp^p] -@LM9h9x^ -LM`\p  0P"P7 S@ u RA @0S@AL0 Kp ] P` T70m= 01(0 R0P R0  A p-Y -LM@  -LM(@, 08P h^ ^H0 - /2bL"ρL1c#bQ00Q -LM8 ^4  EJ1\u@u 0 PP&^@DLZ,5$e BXa02c2c@0` U0` $22a11V3a11V4!U$$0CaQ@aU(K` 7P,@@0@,K 0C,`!11@`Pc0` Pd``}/ u 340 BXai02c2c@ pJ3XHHXpWC |#2a11V3a11V1W ,#22a11V3a11V2!0KpbP0` `P`0R{N@@D/0C!b!b@p@b0@@`@@4? B1c1c0cS000P20 `2`2c4"H0a"a80!H   !22a11\3a11\ 0"00W0  1paW40 0 $0@KeP0`1Ϡ&2l1!3l1V1V 1pJNXpG>0``0^80 ``V0u 8 ^N 0 0R 0 0R80L080 A 0V?HE.²Q,ScQ$Ių -Lh -L,M@<K0 Q 0 Q  -@p0T`LP40c0h 4 -@p0T`LP30c0h3 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK?L@K< PhHK Pb@P儀KDK P PY}PTH^DńPڜ4^$ڔ4\  “Ϡ2l1Q`3l1R1R`@4!bH XP/H4^DńPDP$O2d1ap3d1U1UpW 00# 0A0d^ \D H0 0D0 )PH d!PT0;Q@0 v>8# 0ST Ŝ ŏP@@TPZ@ကK?0/0S0 P S@ ňK   P0SÈ0S S UP@P0CS0 @0S0 PʷTKP4\>`0 S; (("(Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7  S K`VPE4UZLǕ0 00n0  0STK P` 40R00 ? \0#S gK    P00:TKwPT;0 T0 f QuPLDP0\  “2a1H`3a1R1R@0!^H PPKTK< YP 'lnQ,u> -LMp@P`\ 0 ~ -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0u> 0-4PL@4  Z@40x^u0 0 L,w 0 0F,w@0  R J1u  0Q R@Z -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS AR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `0hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh0` 0 Q 2RhF0P13P1 <2 -(0(   1P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP -P`LV@gp0S  SP@D RCA 0\R#R! B -L M@KZPT `0 -L"ɠ2l3c13@"c1MP 1K0  9 C -L^M⸠p`OKPC/MK@( h < 8 i&Vat0V$KOK`?cKpG 0@FfKq q A A D1 (0S (2 -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @$"(0K!48<#8 S*S 0H T H0L P J I@  Lh@hA Hp\ ᭸0p4Slgp PBNK@D@DhL!L1#p@) V$pPvu0#SEKEKALK 0 LAIP4 \ X T $X4P$0P 2hP22p$RhPV00HXlTd@,t -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000hXl -LM$@0 S η0^ -LMPp`P@b ,K0,px!0#p  P @\T`E,0S XXX<<XXXXXXXXXX( 0"00,(0 $" "p P@T` (pP0P (0L 0 "(0 @LPd}pI -Lh\P0 -L  hB} -LM`TPpP 0 S S 0d z" 0 0 @0$ i"@5b -LhP0  --LM q -LM@$  0$0KQ \  0  K 1S01 -@LM z^ 0-LBP|@ 0S L| 0SPeT 0S \00LS `000 0 -LDM@ d ᒶP d㍶P`} 0Sh 0S0J0@ @@`KULpP dP00 H XP L T@ fXKP0SVX =0P0P0H0STTA 0@81H  FP 1%P0@ 00Ks00p0d  N X%4 40JH  `0X@\ 00*s00 00(@, 00s00b -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0 0-0 0 0LS@P 00S 0S 0S  0S 0hPd@lt|000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @  @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 (<4(<"4!<0  -LM0@SK C < 4 D -k 0 0 p-LPd p`0@,$,!$#,B V 0? !<4<("4!<0cS @` V @ P,$,< $,4.l$<("4%<A0 V 0? !@<4<("4!< 0cS @` V<4, <$!4 , (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0P 0S( P0U(1( a0 0,1 -LM(0 p7b00VP(pVAv %P! @A@P 1!0 1!( 0P1D!D, W00  ,0i -L`p@<PP  n djP -0LM@ ,0( P00 0-@LPP UQ0P Q0!311Qa0@"a@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < a X0` 0n0C 00,`0 0X00 00C8#Ƞ APp@00 0E8X#X4  R 0("X0e8#h 8 0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h<  `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S  1 0]0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 A  ,]0 0  pP!P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"ᬟP 0 P 0, S 0   \0 0 ğ0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 10 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<R PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 F P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0> P 00 `3 P@ *PP  "P@  1S0C1N00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT ^ 0 P @-0@0 @0!00  RCA 0\R! BQ'  0R!H6666x6l6`6T6 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0SO f[I  E \[00 \mh10*2 b 0-PU@L P :PP  01Z 0 0 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000vP P*0P` 0PU:⸜P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^%P], P 0 0e 0  y000P E  bP0g0,0 Y 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 000001f p-L M0K K@C 00p!`嘛PUhC 0 SP P000pkP` 0 0 p鄾 p-LtM@PP`KP0@: S  Q  SL  p( 40R p; 0p0+ 0 p@C -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P \ml -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 .p@ 0E#1, 0@S\ml 0-LTPM@KT 0K  0  @@Wp_ -LM`@ 0pP`O -LM@5zPP/0:0 p-LMP `@0 : 0ph* -LM@pP  0:0q0:0! -LMp` \0 P@ P@  0-L0MpP0 @0 0SDK@ 0S ,|00@@ t,@ P-L 0 h W 00h*E p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`R @0S R@- Mp-LM0`0 @`Ip Mp-LM0`0 @`6pP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10` -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*U00 0P0XR00S @ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@Fh\T -LM@\Pp` h^\QU0SD R 0S=W00  00CSTpTTTTTTTTTTTTTTTTTT0 0%S00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, ,X@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a d0K?aK@D 0KQ |A Q A u1` 0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR2**x *J *** -p@L00l8#hP M08#x `0 0c8#h@08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o# -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , M@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# asL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0pPX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40Poq P0 00S"P@ 0S 0 00S 0pP  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \@NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0PNp  P MO0 0B@0@0< J PpBJ@ 2@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` ~0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1  L001  Ld@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 [MANK0AnK @D `FS@D `F) \0 0 AK A0A $4 0s1 P   0 pS $ 嗔T"\ -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 100 0c8#Ƞ 0 &밀,000 0Pc PEP00@ -LM1@QPap ώ0 Rp8! ,5P8q8pR0-P@ 0bR03 B0 -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnamevv p v8@@[Xvv vЉ $ @@$vcbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zeroseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputyywyyyyyyyyyuserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseyywyyyyyyyyymount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track dl txؘ    .4Ĕ:ĖȖ̖ЖԖܖ  #3$#,342<3D3L#T@\@@6@d@lt|ȗЗؗ  @@ (08@ḦPX`hpx  |ȘԘ$0<DLT\@d@p@x@    șЙؙ@@  $C$CC$ C(4@LX`hpx  Ț@К@ؚdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.14 2006/04/25 04:38:26 deraadt Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.98 2006/07/01 16:50:33 krw Exp $w888$$Ppt\{sƑOJ˻qKIc%*d'`wX\+5/`IIljwt9{~q߽x'yt^d(1<;A9`J;?~]8 PMhumn;^^mMy۶4>dN>`6bh,{sV'2:^ ̋Uo`U;|ب^La5þz( ,:jT^L f`FCn,/sKi;Lun٘n0[fjO/iܺ-X|2g, kJ O Vz+Wm];G)# ĬWm;ءWL1UָjK8F(6.- v0<$L+Ȝto׽ڒ4fxu !0c2b;kOi'єuVkGQN \JDE3v%nNZK6Ap>o`NGLcS̰xR[e9"-פ,<(G~^7f*tN,m0W hHkTz$s2{|c( ڞf>_v~j8󫳫eJՒvg3vK $vT/\Pa e0v S8%jFS0 ~ YiPhla % / *JtW/庹3}lPTotwf$7ш1&jahVKŗ'9c7CQN6$aێ57 J&Z9X\p$w6oُI I ބ䃫U5:jvPAjBb00&b9zen)` ̫THy(5`, \0Vf`@dQ>6k-Lwƚ^ո^邻ZmӸ"}m -cKVbm85-퓔w#(b?yצ)unnWrekRZ8¸Ť8z:pSԃI<|4 2谁-Xdv;n5TZb&3CC_6WE!QPt!N'G9 (Bc i՝/..CEe@Vld3h-By,g-L y.[כOyY-V(LUTXo>Q/^o);vhR0S#KdezaH rX7?($Q3OQKCC悯 ijnB06lMaLQnUEHGHxR6X.4grozYΡ}i$ppuJA`y@ ĘS gY_.N" $&WmjЧOVg0H:@lP7ÐTG<4E _kOҏh) /"X?14]d`SzlXq[rV|N|%!N9e`"GP| Cjڶ`E35b%Gp.FiS^cI6۵Gc]~.qt8!”KCq4 nWLjNٯ ]Ȉ16{e`f|*(b~M0B^hq"k[0*Xk9ނ6&7\n=LFh&9` Nv J/񚄦7`KflC+XsgT*fn=RjXu'3k_Y Yz<ߎǖ sZ5.fK3 q:n8;'909^`0.0BJ3u"Eoh ۍ >}X,UAox>Ks#qB$ms ?0ױQ^2RO+h:I<=!4m-,=az Ugv(PO)pf- Ԥ:Мu$OaC&PAZPSKh`%g7Qt=NHXh~HC2p(: 2d#.5c$a毜TN gKxz hM°B!,~s8G{ WqC @[YNߎ oQU@_Bֵm\mq[ynhZ*Pu`Ѽ6:eb=@SjȍܬiX7,\=9[3|eN8z.geT 2?p -yzn~pIY8Qp3lfhc0P+̹|qx޷9> EKH{0`9DN;ye M7vfFqAH]F9"^~ }9[OQ6͕$fq;7`gAFZ"vXA3Ҳ䰉@Kz@0zpFji~8 _n40O*SDS,.h4SH"r4KlXxP@>Ռ8JSovtHW!\j)&t]* pQ)ynr6oF V;{( 4IU8Dт:Q=Zz#e@vפ~J.l)%驨WϷ=aLx\ɞB̨QڝlL nK~6bD%D»- +ކQmD״'oX_)b:U#N;Wj1WEF!AK550`8l*+s2 7~&堘p`^c t7RXz'*l'OnUjGM.WF}l>L\5d҂Dav&Bw|5>hIm`ޥGy)UOJcqd@W&,T#E`|Za@T8"W(:ds#ŻB]@܂)-Oti E˼áZ\:[(bC rUynvn#y.j g:э~< 6IV*TzJ󐯳s-v'v6)Jqul|$ Lj ID[.pr :sYo`~NGeݠ*9i쯒8^r8L܀jM-On&kN*K:&/Ĩ, H ",4*8 &~D?(S3Z%> S=w殽Z4&NYcڲ*udާR}.&I3#v̿MAL@/4l9 MbcGl$ZQ^ϜH[:B:_NBhvӎuIcCL# 0}1n1^h/XC?\g+0&I=.,0)]^˥5s{& S"1Z5eK>Sc]KGBr#>s{i[cv nb ~؇3{u9("tvݙ77è//D8^2Cp [T41A#l}vyi>ȵROP’dZ{lǓ|SN4n}t~\ơJU/T.A*ukT@!,A \KWIM(c׸ߞ=W1)Xkʱu[`ށGEy!Jv*inW+ޙA[y v&ѩNi3&#OɤPYp,§cN0uBhdUށj݈uqZ͢l7?k"7cN/Mgh$Vz؂@iAKrcNtraMmK>4 iiVpm *4 TQݵI=.p {gZR6]m )|;Ze{i|o"c(}zzu.KФ\}ьܬsf8(7un.=.C.)q7S9R]z,)-_4a\:u_&܊ CUY XxetHHjMcV# rL4zZCB4߈>)>Z0>P| $'QdlMBpq I#I1R$~shɂOPcdẸÖ /e q{PWܱ=(_JquWߙf3y_π-=1Ny8RL $s0O:ُz`-OƯpeXn|ʡKZ8= :9Sp|J J3X `c֝W0rK1kS;kqA EI4ݤI~}{]|}'DS=O|:VJc'mO&4|3KqnK]}fљB™l髹 o΄"Q#C w]a4YjUВkgi@>Gś[~/LYoMvpӊ=&p VG}N/PsyՐbA> [*XS+ϼޣY>1hݍf挒6<̡(]k MO,jrs/\2=n?X$o)yI>ڒ }Gn3d60YmP- 7k5؋&z:5G:k b֋ QtϠ@澌 ejڱ5.L"ޡy4 ӪŔuNCsPvG7xw< /ch8]!OHx`t@,;>8jPF< >S4FiS{FGr7;,U Qxm(M!E^QjLHA ;Kfz2{o"-x,u}7JRa%qWlm[L/ %>,C?Юεrhf L䩏rz@2γiؑ똂Mo[ JÊ^ ,0Omz >#@nZ2.{&;)䴔Kx`#p2$77@\rT]ZnܺbCyJ]qQZ5 &o?p%ϥ[v=///߇^b0~ĝa]g\̜pNY۠ž.YD7t8K(5}k#,vRbh1?ߟO([ CFTa2J-s uE::gϾ*(?t!5IܪCyʒtG'pbBB3ނa_>&Hݱd2!${HCb32/uQo̊kI"IxP${W&NܨUv[7Ad`UlG*=<29C%%`=WB$er9U;xGty9n&+g(6{t$"<-yv=noѱ=!/VL>Bb!nWe]c-,RjD([p0'l.jӺC京9(}Ѹ߻~Ӷ9NXU3|@,[é6vOъ ͳ5rEm[Dt!=<tgh&K^O'#١e1؜?9iPfadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABEL/usr/mdec/unknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelabelErase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)can't read master boot recordwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFONONEbootstraps: xxboot = %s, bootxx = %s%sboot%s%s%sbootBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dboot overlaps used partition %cmarked as FS_BOOTwarning, boot overlaps partition %c, %scannot install boot programcmplabel [-b boot1] [-s boot2]usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.30 2006/07/21 22:56:58 ray Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.64 2006/04/09 03:35:34 jaredy Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.77 2006/04/13 00:49:15 deraadt Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d [j jXjXjXjXjXjXjliXiXiXoYpYhY%d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_aliasprefix %s: %s%s=%o%s=%xusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%lld%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host kernvmnethwmachdepddbvfsbooted_devicebooted_kernelconsole_deviceallowapertureapmwarnkbdresetztsrawmodemaxspeedlidsuspendioctl SMODEmmapsysctl/dev/ttyC0open /dev/ttyC0/dev/wsmouse%s.%s=%d,%d,%d,%d open /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offyywyyyyyyyyd~ys,80< D@PX $ d@ltbgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s۸~eWjlO6U$sΞJd$(RKv__7$s˪|I Xt>*/Pq'SToL:[*Ow{w"؋Z/b+".,Je*ͳe.7?goonw?ɯ' JƗμ̼x3/yj3O Yy+ Y=6hۘ_̼16ofޜ.6VP߄[a:8n p~]@ = DFϩ(VJăX4r!p*,\BH1ϲB%V2D!)u!,-WV5 Hx ;:Nb(tgh+R Eb9;_^FǧB<(twC̬%${QbXDyDDSH[pUk-i U֧;4^~I&#R="xdKO<<>+C"XsS-w̉,dq CnR(H K]o,J||avi/㯇n/lrRnc#D0*XL^ykȳ AR@zJD J>pn g C8}sF3xqk֑!˼a!ΖOfcļg"+VvK+N 7F|}7<Af?hOC̄.bUAD.a)#EЎSBT*/bv ./چꥂB?u2 ~0=+V?/ZM-N*/{UV.m.ܤ_.Dїk~ddW;N =1xo8|6/ ,jQR4&nr_>cG.9ߑu GK7.@La#_XVHD結F.#d4' e5Ae=-`4:nysnn!ƃWYb܆PvbA?26$Hbl(u+I*Siݤr[d[q_jDN센 'DKțQ8pSRDa@FS R eE9R_Xϼ_$dh6- -dڛK0$1K&vA!@ BKdT.1t&X(i%`RTUNX5&EnPS3AkAJ}G 㱰\n`\HaS!)R;KSlC)h(@Uw6>{K+Kf&2/'fzeAa΢v9Qj<XX2-8ϰdCq!t75ML+j̋*ۧvsk*D'!hV)ݵZwW E`qQ&TݤJAY{DPWծ ()Ůh6 ~27[WdOFVbx'8e MS,y+۰?@[6 G}A߳܊ݏ:#z^ fs-.0r25]|2T?o;N6+z;)?mzÐ|2;MAgAKD|:*z+y?}v>o>>4XыۅB]@P'~Gz?0Ī |,ߖV]~DgD7١7 @ǵl|ҟ}`: 3Zf|Q/C9qbE<7HR D?t("Eg+jG W(75gfWf.Y3_)g_?D7j fb6㯈:l%΀ޜy`Znհ&mk#ʙ-+=Oml}oG d¨ K g!{L,,P`%- Nnp"e :/0^զRekЧuY \Amk @bB EFB{EM$zGNPpo5Չ XDj]abUjQ&sȗTg-Tq.CUZ89]k74Os+S{Kbu?=fCz"^Yq]yw.n<w@6f4/U((fjqRYjհmuLGPƤ 9>WQq¼P}b{aRxdKn_ZSG)uWG~Qˍ^`]i5pЧMu~֮yP\S m1Eg6`YD|LgEc$JgJL: H\Ie vl%0l>l Xa7jKl}5J QVɽخN ۚ]vc_q˲؛[*eVtݾOLPMC4jmڡo^EUKI"fv$lII0zf1!U!;&7p~і5!FdGJ~txԲ޸zUrI{o$yh>$W:ek$$/zRi(wO9ȮySzjQvj7@mҊ"7I0zKK7.sϻ)a آD`9OuԼfTIM:ɑ\&Q5c#W(5:gVQwL|w#;&1DD֞?yŸ̴ m`;d U ()wVE'ׇ9BqyXVxXdSG>udk'C@p+Dϱ-RwׅvqcNBmo>`BV'{.| n6*8S-dol!ZGg E/NR(dB$)h껳WzaMvsO)FsRt8OXK.ڜL&}ソn?zK77 6\V0ՀM`q4v%\n e+zߑ,[smX1/ue xwp/C% a.AWrVyNND;A)0S]} jQO鏫 xA)bQAy/kΜLt Lrg"X O}_y!ɠ'? Rߕs-Lusage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]yywyyyyyyyyyGsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, table %u, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] yywyyyyyyyy4~@syd~~reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node l"D %H4 sg & ZT  #t$T$,4< L X!dl -C||o   0 < L h xt 4 x x | x x ̱ ̱  !4! (!X@!X!\!4l!̱!|!̱!̱!̱!|! !̱"X("̱@" P"Xh"̱"x"""d""" #x# #4#|L#X\# t# #|###x#4#X#X$x($d@$dL$dX$xh$x$x$x$$$$$$$%%<%xH%dT%d`%dl%dx%d%d%d%%d%d%d%d%d%d%d&d &d&d$&d0&d<&dH&dT&d`&dl&dx&d&d&d&d&d&d&d&d&d&d&d&d'd'd 'd,'d8'dD'dP'd\'dh'dt'd'd'd'd'd'd'd'd'd'd'd'd(d(d(d((d4(d@(dL(dX(dd(dp(d|(d(d(d(d(d(d(d(d(d(d(d)d )d)d$)d0)d<)dH)dT)d`)dl)dx)d)d)d)d)d)d)d)d)d)d)d)d*d*d *d,*d8*dD*dP*d\*dh*dt*d*d*d*d*d*d*d*d*d*d*d*d+d+d+d(+d4+d@+dL+dX+dd+dp+d|+d+d+d+d+d+d+d+d+d+d+d,d ,d,d$,d0,d<,dH,dT,d`,dl,dx,d,d,d,d,d,d,d,d,d,d,d,d-d-d -d,-d8-dD-dP-d\-dh-dt-d-d-d-wmediumreason/etc/dhclient.confFAILalias_routehandlerc:dl:quifi callocifi->client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")setresgidsetgroupsusage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.can't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal bufferbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervallink-timeoutprependrebindrenewrequireretryscriptselect-timeoutserver-namesupersedetimeouttoken-ringexiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory CCCdk0mf `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@GGCtGGGGGGC%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.27 2006/04/17 09:34:16 moritz Exp $$OpenBSD: pass1.c,v 1.20 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass1b.c,v 1.13 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass2.c,v 1.25 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.15 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass5.c,v 1.24 2006/04/27 02:40:03 pedro Exp $$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $$OpenBSD: setup.c,v 1.24 2006/04/17 19:18:08 deraadt Exp $$OpenBSD: utilities.c,v 1.30 2006/04/17 19:33:54 deraadt Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKcatchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)and ntrak File system performance may be impaired. rotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyT'   |    5 Ȍ. Ќ81 ،d. (   ܌  ,  / / -T8 v0Ўp> Ԏ<9 ؎T ܎H T H E `R xG <9 xG (J 0T9 8L @HF H? Ph@ XT `<9 hd p$: x K tS -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$\<t@tTfdcxdslmn\px d `   ̑ ؑh p Ј ̕ 0 < D,   Tԝ E d$ t       ĒК В ܒ   x  ( 8 H Pt `X t |l l 8  Г h   \ T   0@ @ L| \t l x hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDȗ< ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }ܟȗȩt@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $ĢaТܢcdei02k l(X4hm4C}n@fHPbXu`ltp̖rw4shTvlxletvx  , 0d  .{}tĦȦ̦H ||&&!()]]<>m xȩT"P  <  ĩЩة@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s \xResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u  $,08<DdLPX`hpx|0Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2w8lxȼԼܼnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemt| ,8D\p|4H\tt| ,8D\p|4H\tHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanfb0b1ncdtscilcshssbpxbxfxoxtxdxsimulatedgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Pad__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a@  48@D X\ hp x|  w$8<HPd`hp@H_d2~ @H!hl"d$eDHf`d#|INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/0"<"too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log48<@DHLPTX\`dlxD  ,8DTX\JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding4Dh0Lh0Lh; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH 8Ld|  $ 8 \ l |        , D  T x      , @ ` x      , L \ t      ( L p       ,@X|@XlUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typet| ,8D\p|4H\txdr_bytes: out of memory xdr_string: out of memory %$sniglet^&isatty ((((( AAAAAABBBBBB arc4_stirsnprintfHASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_tempCspssPss0sLsssHspspsp[t|tNt|W0< t,(t0t7~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg `}XXăԃTY 0t$0"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)a\@$Hb\@hB\Џc\(Hd\A0pe\Ԑf\  F\(Tg\xđh\HA8Li\hj\ȒؒJ\!lHL\ 4Tm\l|n\"ēp\HP\q\Dr\"4X|s\!S\!,(u\"H8dV\w\"$x\((4X\A<@hy\z\8Ėܖ"\~\!,?\#\DL`.\AX (press RETURN)... (interrupt to abort)L381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUt8dujĶp$\k $m<Tt\y`t0dqDlз(r8s,t4shsĺd̺Ժ`9@HA B%CwDE,F<GLUTVwa\bpche2fph|iLlnqqrsvwx u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.17 2006/06/29 12:51:26 jmc Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $,(@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.14 2006/04/08 23:51:33 dhill Exp $ht|X     o 4stZ|Z~@4hYY !"#$%&'( )(*,+8,@-L.T/Cl0Xx <\ pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL`"aL||VX)CtP ?yP]PJPPP/LPPIPMԆP5$PxVtPTH,PDJ PMXPd4XP08P0;4PDJ@P/,PIHPP,P<"PPP2XP4`P 0PhP\IP<P6?@[\(\8]P^\^p_|_`{{|}}~X\8@?C$(08@HPX`hptxйعlY\}p CCCCCCCX} CC zCCC\}CCV  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef 0000000000000000}$CB@CBbLCB@CBc CB@CBdH`h  $(h \ @h\ h<8p$@W6$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt r $DsDƞ%df+tt5xx>xxxCx JxQxZt _fq44~m a  on}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  g 1 g nobody*Unprivileged user/nonexistent/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=40 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="0123456789abcdef]),W,X, ,])$&),,)1)],8((@) )p()]{-؁--(--]:_,؁--(--xY,,x,]<I,]+,],K,])1)؁-(--l>)]1)؁-(--]{-؁-(--{-4]]'@., /,@2X Xd$`P]T]p]t]x]|]]d]`]]|]]] ʚ;5ym8@ E82(@AAA==(A*]] ]]]<] ]$](],]]0]4]]]]Q ]] 44a4a<4a@4 aD4$aH4(aL4,aP40aT44aX48a\4$- -(-(--# $-##D++########### >$#>$##############t##l##؏#r"############# $####### $####### $####### $# P X  x >$#>$############## $####### $#/@/d//@/# $####### $#\@!@!@!(A!B!# $####### $####### $####### $#܄&H&&&܉&#&#Ȓ&###### $#,..H..ȿ.# $####### $#@...4..# $####################### $####### $####### $####### $##########/T/##/###/################################ $####### $#!!!!!#!#8!###### $####### $####### $####### $####### $####################### $####### $############### $####### $####### $######## >$#>$###### $####### $####################### $#0<00 00*00 >$$'0(000D0#̒0#0#0з0x0#0#0#000#0#0# 1 1## 1#X1#u1v1x1y1|1#0}1#L~1###### $################ >$#>$######################## $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####### $####################### $#adG\b@%K@p0A @ 0,@P44444444(484D4T4d4t4444<>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy>50000,0@0000L0,000????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 t^wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp8^t$^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްpK^pL^2qL^)L^aL^-M^?M^M^M^N^N^ N^0N^@N^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N^oO^P^ P^0P^@P^PN^&PP^! Q^P4?5?5@5@5@51\1F5<U1V1^1]1  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  hH5I5}1,~1}1y"3I50K5*O5R5# # T5T5`V50w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- W5{{W5X5x2y2|2 2H2222 22H22X5Y5$2P222,_5x2222X_52222_5l2222_52222`52222`52|222`5,2222(5(.\^\>4\^\> I9\>D\>9A\>KD^>h  4?=  5\^\^  5X D$4p$/T"8:/EpaR!]1$f+Dp2 255<-~%E/' !pH0) ]5lx+tB#,J<2L^{#lq-4~D,' (+]55`831",5P##2d2]:C$C$hR5h5wR'\, `-l5#\p !2$5 !2P(!'p38%D(%18,dHP[#XXܕ5_$.Twu#xpapX^x3T2.5D-!/ hn2HMd1Z C1$o5y q2Hb201'Lhb0  |"$`D(.X.DP+'@54"$=D1TL4-XZp +j$>1w 0&d&lu"l%5 #tL}`3P%-\lap(+%@6/$Gf!U4]bXaq,-3C`!8|2(.1'5L10`Z^ 5H+(x":@00J1bdas`-1 |#T20$x)<'T@U"\x|`D`")`$%t0P`@?."pSĂ*c,"PpH.H x"3P/8!5'|"5&5.  E.@05(, T4PB/hA$`P`P^.Tq~`z52/P55-D`,X. *L)5>(!,%+x-@`#O5V$`a,h& n Y&}<#lP.H3 08a +dq`\2+@&TL1&<ha0$0K`0t5;S2\ET5O8B3W!xcaz0"l.0@Y+x`T"$22Ԕ-4/`t1@] 8!/Q^:Y^C z"N"WH!c_#m"{5P0<#h`#t]0(3,(3q$(4K``"$+@'4-|#Ao.DPT_!TK1pkЙ0}a)3Va]TG3x_ Ԩ0 )L%Te0,22l% &(87Ġ'8MLv"(]x5 dH+.x&3h(T)lh`3ؾ5T/x5$)1LW0(T!p2t!j( +(&4h/<@5O`2`#j/dtB/&h#w$ D'#!!8-Xd14&#|+`45 8K`$ Р!+ 59 D&3K T* T N1Pg p/.dx d}& $3.t (1L ` $F% `% 4] !` #`  -! *!&!ܕ12! `?!3 M!]b!]q!*!HX^!(2`!(`!3!-!! !H2d!(5!"P!d'x"p(1()"P,l9"(I"B0Y"P+i"(w"h3!4"`0T"8 %"D[^"5" c-<"!"U%" "x1#S$#d5 #a4#L2?#%'U#44%L]#2`j#-u#pa#',#]# #82`#]#2#P/8#.L#5 $0%("$/-$p$8$ #D$"O$!Z$+l$3s$?",$sa$*$ԕ5$<1 $h-p$V)$0$l;3%8!%"8+%Z+l9%t&TG%}&V%w`^%4%.k%t]%"\%H(p%2e5x4+w50L5]`5 5H!$5pG35>15.5%5?2 5"5H5$6(656 H$63x06؍!4C6W.\M6&H]6 0q6TX#x6X26 56$1L65H60h"6@_6Y^6p5 6 I!6o$|6x 68]7,*73 )7`a47/*=7 |E7%P7X2]7x#k7"\s7b2x7,07LY%7S087@/7*72`,9@1X49[)|E90'h_9`"i9U&P~96%X9w`9tS^ 9@19<(9 L393 9^9+9/9,$#9@#:\<":2p,:4=/LC:'TZ:5e: !p:x`w:n1:V$:s!0:5:4_@:!:E.:1x:DU!:8#:0`:=1pN=|%Y=5y=pM!L=$(=#=V"8=\a=ȿ.`=D_=X"`=p3%=1=2=, >*>p`'>?!.>\K`:>,) E><)`N>05Z>]e>4@2y>,$>5> >$> &>l#l>">Ho.P> V!x>h p>85?# ?$3(?<]-?A% HA5OA0ZA$/,lAX^xAhg0Ad',A,( ATq3A"hA"Ab0tA#A$`BP/BD-%B,5-B3.BB&OBl!xbB/pBa}Bu"\B|#B"B| BX)Bl2hBK/(Bl$'B]CU'C`#$C1x+Ca84CUa=C!<DC]JCĴ% WC<3`CL3nCa}CY#PC/dC93C(*2C!C'C,`CT ! CP_D2lD-"Dx$+D"t7Dę.XFD5ZD,`hDt /TpD4#$D#HDx1lD+hD*\D` -DL"D -D|aD R&D%"lE',Ea'E!t;EX$FE!4QEa&_E&3qEX1{E5"E/E'E$E`"TE/lG%4G&G 2tGT*Gd93 H<"(Hp*!H#(/H\"`=Hx2HHY3RH5 _H$"LkH2dvH!<H,!!8H2xH܅3H%H4`xH|-H$Ht$H%H|2 IX5I`%@I]d?I3(JI+@`I$S^iIb%pIX5}I5I!,$I)`I5IP.I\/It0lIaI,s18J"( J|.(+J5;JP]MJd5eJ&mJZ!LJ\/3Jd"LJ_J|(Jr1JD0pJ'@Jx!<J)XJh"K@k%K'0d"K !h.Ko38K.AK]PK PlK )<{K:1KU0K(KdaK)$K$R! K8"HKp"KtD.L3 L@a6L/', CL4'HNLD5$`L"lL.<L5L5Lx0 L/DLH]Lľ5LT-(XLW&8 M$`M].M\v+9M/`OM$ ]Md#\gM0$}M'M(M+MK"M|%&Md!.M&LM1tM,/N+N$tN#D/NXaANP#ON|",]N!\tN`5Nl0N@30N`NУaN" N'NDaN1$OT-OH$0O@}`"O؏#l.O#+AOR!UO#d]O!XrOd+O4]OT) O"OJ"OD"OL.O0&`O1O0Ox/XP%-0 P5*P,i$/PD`[r`J[X0l_[W^ g[*Xt[45[% [5[`$@[l%D[4pa[ .[ -[\a[p5[/<\dL`\X* \8./\^.pB\K"W\]j\PS!8s\0 \p-\+\|_3\w.\Xc"\/0\0@\P5\5]$\]0,`(]!/]Z.|D]l2hS]!8d]$5m]2y]IJ5] 5]A/,]D`]+<]0]@ ]X5]T0 ]D!4 ^a#^&+^!5^T2B^00U^50^^{`j^H0Xx^ &H^3!p^5$^ Q ^~*^D;%|^$3^x5^X2_da(_|1x_]*_a>_8"K_]U_|1@r_|Y2\_%1(_|o%d_ _a_%@_ $_._x%_k2_/_)`5 `g!,-`\->`]M`8(`X`$4a`(i` %u`x<2 `Ĕ&d`@ `]d`N/P` "``[^`]`f%@`1$a%0a)aT%X'aG$t.ax`7at-FaE*LUa*)`aPV"na5(a.0aXaa%a`i-a)ta1\a$`aS3(aaa ]b, bP+$bl/-bY0Cbp!4Qbh(Dab0vbԜ/bة5bS.b , b`. b$2tb. b5$b"b8. c 8c %c],cI*$=c`!\Jc [c"3kc-cD'(c5c s c[^c04cp"c5@c5c[%d dtv"8d &dz14dtuaAd(g3MdC.Xd4!od$` wd8`dp]d4ad -d&d{`d)dt$d5$d@/d3eȁ. e)`e1p0e5He#Xe,!(ee$Xxe $`e8" e4s`e33eN3pe)`e xe93e*e"f5@fc.!fX,.f\&L9f<5$JfJ!$bfh/mfT3 wfx+,f/xf.(fC1fX1f`fėafh3f<&f81g|j%g**gXq$1g-1Ag Gg^_g3qg0*D|g %@gF)g\00g)`g1(g"XgQ!gx= gW%xg?!@gK3g'\h0 h &0*h`(&;h,xEhT"Uh"3dhu#0nh/h5h!!hp5h(-|h 0h,q3hL1hHH10h(0\idF-i*-i01@i*0Ni01diD \ri<1%i$i\X^iD 3i#i$`iU1@iD]i(<i#i*Pj[# j.$!j-.j+=j2%tJj#Sj0 D[jأakj$q3rj}1hj8U%j.j'j!hjp#Lj$>!j63j2@jR&j4%j4` k(= Pk-$k&(0k|O-=k_1lMkx5Yk/0qk+zk/k5k0/Hk('<k.k@$kH k&k"@k*3l&.PlT*3)l5Bll+Mlacl5jl "~l8]PlT50llK1 l/l*&l($l /#|l3 l8/ lȼ$m+m!xmП%8%mL/H/ms`8m|#8Em3Pm5`md5xmT:3m@`m='mM#,m@`md%mt]m`2lm>1mX#m`"(n!\ny1|nȗa%n,l1nn3InP=!`nQ^mn(Lxn#Dny2n[0n / nh.n(+n4*lnx3XnH$"@o! o2,oP+&o@.T-ox);oX^Go\14Wo]_oW^fo3 uo؏0do,"8oL;3o41o&&Dolao4-'loP>#to0o(p`:3p$18(pY^2p 'l;p@#`Ep Tp+lbpp"op!p&xp&pHO#pT1p&p,.Dp|&8pw$q1q/(qsa3q"T?q(A!@Gq `Sq05\q$gq@24uq<0Xq3.|q!\q4q3q&xqE3q(',q s`q$9!HqX/r8 r@"@rh.!r!2r 1<?rȕ5HrE2 Ur@04gr\4*urB#|rT"8r4/rG3r5r`5 r'4rhQ! r@ Hs#s" s*'\&s05(3sܪ5;s%DDsD Nsܣahs -`ssdQ1@sxg.s(Z^s*|s`s _s2s2sH/*t\@! t=&t& tl -H0t`+XGtT*Vt$y-mtH`(vtP"xts`t"t#t<*(ty-t\F!dtH/,tprat#3u(-u@)hu2"u+4u#{h2K{ |%e{1{8#3{x`{T5{&{[^{ja{P${`I3{.8{/.{1|T>."|̾51|8&F|, 1TS|*T`|5h|$%r|\2~|#|>1|&|]|8*||#d|M!||)|8(0|P2}-}<0)}0p5}V* C}](Q}< )`} Hp}14~}h)l}<&}\&}8%@}X#t}I!}S'\}s1}#~8x"~#~$%(~4_)8~!D~%`K~1_~\.o~M/~5~ܣ#t~@34~&~\%L~.H~ .8~p5T~0'~,5" hA!w$ 4G0h4E3?5S&<Y|1\g xM22\%<%'H/$h&A2hȒ%h4^]4ĺ2-,"$/8+XIX0[Е#o5PzO'HT'2`T!,/ր8_W5w`* @5$`',L/8%\F`(Q'<e!DyL2@Tia!l+{!ā4'$с5ځ %R0x` DF0l<355=/I$S2l]0j5$qp}`{h[^'@2 u(P&TJ"Xw)@"p tt0`Ύ0U%Վ&l!t>2h7,p^.<4|E`;|haI̲5$^̯5$n4.@v 55e#\a$ (O1/hՏ+Ua$U)`43x1$T939l_A3 M3 YXe3a5u2@H` ]1X$%1dӐK3`&Р#,<%p$+53x0J#,Xtz+ld*oT#{l>)\+3%X't"Dˑ< PڑԴ#$[1&tQ ax.|j<2x1/l.@0X%$$!˘X^0ט,0 $dо55"1'C,X5)`B 2P8/`[+(jq`r!~/$/(="47.$_1ܾ֙*l̤5C.1`h5|!4#]08]7<*+J`U(%0_"3s%L|<3@( ^=0PLG3P .X՚5015$M!`) p%+Xr.9H'HG.LPP`Z!0fha4n .z|2. <1&l3  D1,˛#$ӛ$%ڛ(8ha_3$X,<&X>3t'l!P&+!? 0O"8[$ k !, y5$ 21\(`%L\aǜԗa֜)Dߜ)%D 1.  0"@l,1'3"L80>'F0%W(_b *s5{]<+d25x* ǝ_30ѝ%$ޝ1t5h%H#(,4]C2\M.\DF`gб1\q\+1p(x-$$?#"8/ўH:3l|``d0, .4!`!T({$3|63:,.,E(5R`#\@#0h"4tL t[$B2x0(0XџX+32LȾ/-p_ p1H-!5:& E<5Md2XO%ta O04y;*L<%x$̦0d+p}&̠`%,֠(8`5d&`#"]"p",L];H*Na\Xn%Lfd1t.p']\$#aΡ$' dp#D", 1"*|4*8B)hNZ^XS1h<]xxD&(/0".$>3TT1Ѣ&٢}`^#( \ 3  R^P0L"d'`*}08D53>T Fܻ$lR.Hbt 'mav`5.l/\1)t5(ƣ4`3$ϣx2,ݣl5T05b#` 0#(2<hI`Il"RTc#`^ȷ-q|,"1H-4p.|W-hǤe)Ԥ(3G$X3 2,L'$(f3d,1Hl}&U $ ]av&L)p`$,HL *ı$3Ա@'%HD"p5.*d/@1`9"D5P4X^Z$(cA/\qܗar`!5p0Ͳ85` <@5x3 &P%%@"31* =aP92[%j#lr %x1/8(H,T"4L(3̳ ]Գ_3س\0`Ȕ1(>!P$1l~.,$1=(pJ(_&|WQ!k u 8}p1T'0X`3з0p5ôtm2Ѵ1ܴ 1-\Ԇ"l,(0%(*4H)'`C@5O $Y ja0]($31/_-$ʵI,Dٵ50\)1P ]12&)35Hh2Q<10ef38l0~U&"5/ 5$Ѷ\!8ܶ5{!4 55 $`-@+^%04܋#A'DV"H]L`jН2\x@/a@н%X2Pt,t·P%#,з[#0۷L7.T}`T ` p|`t*  -8 B.A V \R't_x`g/\n+@y 3d/$03,!p^2(PZ^ɸ!/8޸\Q/a8. ,`5$(%D1#,`HL*R})D_`i8"t/J"W^*1\p)˹T$(ҹ]0(%58+h(XH,02H>T1$G8.H[5`5pc!(x[. -T~` "<) Y^ź5Ӻ/ hG3- (5$"$2&>l,(Nм3Y)g.`y_$X&d$5$+($@ǻ|$@һja +Ⱦ5x% 3d*B#d$ 28_1 a '!\!X/P/<5$L2ta(oavHK!pQ$\'$Л'80%0d000Tt/D] $<3'+.\1X&*;,2F'ZxQ3^ar93,p#4`10Ya @/v1X5 $d<++0)p'0C1P7`G`S?2Hcp*Hl̞%wM!l&T82@_/P#,<Z^_3.d%@X..\ ] aLJ' /^0<+LKH P`=3kla|0%@)1P +8.,m$X5)Y $8%D "$4 3 2 t^+!L'*"d85Ah5OZ2p_ Lt|5~l) L05 ',Xx+hL24hv.xlv#l05x_'`&'`5 @|`O5$^t1g`5{'3Լ2hT% @2 P2 3x(/d)l#4<3Y!p2)%̓!: Ax XOh%[|%#,j̕5:3"1\@$+<5$5$A.@/' h2x+"<6aU5 kD)Hsp`v-`da,34T" 0'TQ^\/(W,L84+@ 8]\]$4#H._X' odp&}" m1h0H]dv.-5 5$t2  |.DxN30#X3</'L:%.$G 2Wae *3xL`.1`_(U"F!0l2`l1pZ%x X0 /<885CH"Q0/\bt*hl.,x|20/D+@hQ^g-t8.0%%@`~`!Xh* X&t*$?3*/%=d!!@O%<Z1 j'L|h' #L5* `281Td.B$8 !Pc2^ :]Do"K45$[ dܜ1Tt`)d&|U"4p2D]@(]$+D1%X/< /H"438/d@#LD/Lc5vh/$H. /l.LL-\00X*2lģa/"  x!@P&|(d+`/"?p3It <U-,8bl'q1{1̥'lL$pl*43.\t"1\1X0T̷5(S^HQ"-!5_$?aOac$`k(/u 0/%t*8п5.&'/80$\u1h |a <0"HQ'<9X^B`*.YU)e )Lp `y.,)`&(d34TU*,%< `L&4#̺$ ܁/,%X)-5 e0HT*]%`nlR!~2 3ax%Dhf")`e3 $ X&* /DS"%$!t't,-d6,,l>^2K(1,` t~+5V.$ 0*"3@).)`2!0o2m1x}0,^K!0Q! #",5*LF`2<]9l:3Mؼ [z+\ht$^<u0hxh+/@.P3-$r#%d`L6/0&'hw%#4 ]'32d.K+0Y6!p3x+'D00@P0\50L. 8!'0t$/5H.\Ba.S]b|5q,5L'$0Q%t1$&) O#(-@Y#ti.P0--,4})C6!4]]d<3ql1T{X'1l' )`- ,T Z^2T C.`#3`5D~%'*,&H=p/lNx5l|5sh$T|3t15/5*PL#<5(J#f1 H"' 0>)>/PL,p]3 iW'@'$#2$0LXy/h#$0t|.4\&#3"$+$10E0%<YD-taG2kHQ^{$\,?"r!L/.l3%30!(`x.D5̿5%`  L2($`/L`6 #? 2Sx1<d+ptT5~x*(ȿ58^$xI'x3̵/@(Dka|'x'Pw+8~&$ 5<]I!{\^|D2>$$$!$t(@1% al.Tȱ## r#'R)4x\.?3H`S``c`Va(n+~aH*"<+P#@aH$Le1!X!$pV0,'8`3 $<pl$DGq%Q)`]da l1\0</1($y+@/\X.@*,0t/d5x|+|&d$%P5"< #hEv"$Qh"`$$j.y& %l5,#1,,- `($|?1a#81d * 5##a+59/ HĜ"$QP3WL'1j$r]421 # ]ؕ5 a .D#$1t(3  %<*t]$85>|`F`#@ax]o!O/$]"38L!0L`493!40l=a H3H\5k(`r/H$5/HB&|_ a؝*|5$M!$p/r%|TF`G`;3)t565CT6.N\!Z 0tl1\)p0Lt#T3 $3- ^3$-<0p 85# %1 ,/= 0dI 2V *0 e ,#t / 0 83  l 5 0$ (2 21h 4/ J3  a !'!L`%!5.;!*DO!\4"a!`M n!)w!HB3!0%!!D!n34!%!$!"!p5$!D]!1d!a "."&""+4/""l:".D")M"'V"(/g"jat"m%x"&"|/"ha"D`"%p5D%R+Y%#(e%܋`i% |%/P%@~&%R#\%2H%n0%V't%&H%D%h&4+& 1&x *&{*6&$$X?&0\M&2`X&Lw#d&G`p&f3(w&X_10&Y.&-&g!&^0&8-$&<5@&<"#h&054&"3'%'d/ H'a+'L'I'T]\'$k'#u'H30'5$'t5('0h'83'+'(#3'G) ', (<%3 (5 4( `?((HQ(Ԁ(t\(&(e(5r(/((&(3(@2(3,(ua(L! (/(0#3(0h )\sa)'+)#6) ="H)\*(0Z)H^g)&s)L%@~)<()')5)5)+|)K5)I0*+|*xZ^ *(.*',:*$%@C*%TM*P`U*|/f*"p*/* p**x*L]*J 0*%D*D*L*(|*0/*\++X#+2H"+"5+T"@+aO+5[+$Td+K+s+)+Q#D+1\+&0+Ե.+'t+Z!+2+p40h+8-T+1x,45,X.,a ",,q#;,.HG,L>3S,T%$@],l5k,@g+|u,xl1`,5, a,5,8- ,ܻ5,sa,_2 ,3-/-h"$-2p--%T9-x`A-#dN--h-t3r-$#(-y!p-x.-p~`-T0x-0%1-9,\-Va-Y^-X(08 .)3.^+.&+P9.!M.][.)`c.1~.0̍.,F0-S0)-X^00# l0s`u0 I#0D4!0<50/`00@0h*0%000`02 1@01h+@,1X&X81'1XF10%Y1([+h1\''pu1`'1-'10& 1ؘ/1l01P(1`l151v$15$2c0,"2 "22 D2&(Q2,']2L]g2\]n2`*y2|G,h2&82P&L21h2t% 2(d2q32'l2$82%,35$3@!3,313DR-(D3,5Z3-m3'p3U&T3*33d&h3'43]3"L3ı5$367*<H6#S63@`6H`l60_x6]6@$\6&H6Q"616%6H26.6"P6psa7w`(7@a8#7p$L.7!@?7-O7 D3`7<`1Dm7Y&}74J!h7$7P`7 07P&|7a(7T3(7P"7:!t8$2,8`N2'8\E3C8,"Q8"Z8ak8\u&{8t%8T18/H8/P8!$8,` 8g38d184 D8l3  9v2|93#9,`19!@9 U#J9 0<Z95r9[^y9Ty#9̲/9$H9)L9.@97! 9]9T]9D3(9^:#$:$#t!:|G3,:l+d<:G3H:d;"lX:3`:/`p:0]:4#: #:T%x:*0:;":s1:/:l*:p$:@"h;@5% ;m$8;2%;0L3;d"8;] 8A;0/DM;8/X;'s; /;+ ;#p; |.;!D;|";|1t;a;$;ș- <)L<+2'<t13<%3H<Dn$T<;2b<8^<p<%}<Va<< $<`U0@<]<8w3<-0<LS^<`"<X^<85spec_vnodeop_opv_descwi_set_nwkeypfslowtimonanouptimezkbd_poweruvm_map_callrandomreadaxe_tickuvm_page_lookup_freelisteephy_mii_phy_autolongjmpwi_usb_rx_list_initffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodepcmcia_printarpresolvedp8390_readchange_displayparamchrtoblktblsys_minheritputcharural_update_promiscbufq_default_allocchild_returnrtlabel_unrefne2000_write_mbufuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregsys_getgidext2fs_vnodeopv_descsdofilewritevwi_inquire_usbdumpmagttyflushsys_setsockoptvop_lookup_vp_offsetscomdefaultrateieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswpowerhook_establishohci_powerwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpxa2x0_gpio_intr_stringdisk_finduvm_maxkaddrnsphy_cdicsphy_resetrlphyattachpxa2x0_gpio_intr_establishipmforwardingmainbusprintohci_waitintrzssp_read_max1111sys_closeusbd_do_request_flagsrtflushclone1in6_purgemkludgeffs_inode_allocsys_setsidieee80211_encapax88190_init_cardusbd_intr_transferzaurusmod__ashldi3vn_statvop_getattr_descunp_detachnd6_nud_hintether_ip6multicast_minusbd_submatch__mainwdc_ioctl_getaue_stopufs_quota_deletehardclockwi_read_data_iomyip_ifpwdc_reset_channelin6_domifdetachvtagswskbd_cndetachdb_get_variablecd9660_vgetieee80211_inputgeneric_armv4_bs_wm_2if_group_routechangewsdisplay_burnerpxa2x0_apm_sleepfiq_claimohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addrfilt_seltruecomspeedlogusbkqfiltervn_writechkin_ifscrubarmv4_tlb_flushIdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execwskbd_cdsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszdb_force_whitespaceieee80211_ifattachmmmmapieee80211_clean_nodessensor_getuvm_map_spacefitssetjmpprefetch_abort_handler_addresswdc_disable_intrwsdisplay_switchurlphy_funcsuvm_deviceopslogread_filtopsrasops_cursorvndxfer_poolfilt_fifowriteffs_specop_ptcp6_mtudisc_callbackcopyoutstrext2fs_fifoop_opv_descpte_l2_s_prot_uuvm_swapinieee80211_countrycode2regdomainusb_transfer_completelxtphy_serviceapm_suspendtcp_attachwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writesensors_countsystempagem_zeroural_alloc_tx_listffs_specop_entriesunp_gcingbdevswbaddynamicportsohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnamelockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterVOP_LEASEwi_headttyunblockremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetach__divdi3sys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnamesdisk_busydb_breakpoint_alloctcp_pulloutofbandevcount_sysctlsqphy_statussddetachmouse_copy_extend_linezapm_power_infoarprequestsiginitvn_default_errorusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stalldb_vnode_print_cmdsetdisklabelknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocroutedomainhid_locateicmp6_errorVOP_MKDIRrtl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddloguvm_page_physgetmsdosfs_syncscoop_pcic_attachscsi_mode_senseip_savecontrolstackgap_randomfiq_setregsffs_clrblockusbd_set_hub_featurebpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremque__adddi3uvm_map_inheritfifo_printinfoapmopencd9660_syncin6_ifawithscopevop_inactive_descuvm_schedulerzts_pollsync_printnchashvnopsieee80211_rssadapt_inputpool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnwi_get_idzeroin_addrbmtphy_cdwdc_set_driveuvm_map_protectusbd_get_xfer_statuswsfont_enumprintfpxa2x0_splraisein6addr_nodelocal_allnodessched_lockcdce_devsrandomwritepxa2x0_cpu_suspendprelist_updateip6_protoxsys_recvfromttrstrtsys_sbrkwskbd_mux_openrandomsysctl_doprockcopyzts_sync_sendwsdisplayopenext2fs_initrtfreecd9660_linkwsdisplay_emul_detachhostnamelenupl_cdcd9660_specop_entriesusb_needs_reattachm_tag_freezkbd_cnpollcxscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohnd6_ioctlzssp_ic_stoplcd_set_brightness_internalphyslockaxe_miibus_statchgpte_l1_s_protousbd_get_stringipsec_exp_allocationsbpfcloseusbd_probe_and_attachsys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrwsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultipxa2x0_init_interrupt_maskspmap_procwruvm_forkvfs_op_descsuid_findumass_activatend6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromfifo_ioctlttydefcharssigexithidirtypagesin6mask128dead_lookupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPpxa2x0_lcd_powerdb_shift_exprapm_pxaip_caphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputacphy_cdvop_rename_vp_offsetssys_ovadviselockmgr_printinfowsmux_attach_scusbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initbufq_default_freewsdisplay_kbdholdscreenufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesocket_poolpgrphashsys_setpgidprofhzcache_enterdb_watch_tableexec_elf32_makecmdsext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1pxa2x0_lcd_suspenddb_traptcp_do_rfc3390ieee80211_req2nodesys_setresuidsimple_lock_debuggerrn_deletedp8390_debugsd_get_parmsiskmemdevstat_rush_requestswi_watchdogpcmcia_poweripsec_def_compfc_lmdistancepxa2x0_intr_stringnch_poolsomaxconnural_readpxapcic_socket_enableipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduihashtblscsi_get_xsamap_initffs_flushfilesetherip_allowicmp_sysctlsys_lseekmainbus_bs_subregionpool_cache_getnprocsllinfo_arpmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicewsevent_finiip6statuvm_pageboot_allocconfig_pendingmii_phy_updateswwriteether_crc32_leaue_csr_write_1rn_searchipipstatsecureleveldb_consoleurl_matcharpt_keepsavectxdb_printsympte_l2_l_cache_mode_ptsys_seteuidpxa2x0_bs_allocwskbdpolluvm_map_checkprotmax_protohdrsensor_addcdce_activateural_rf_writedb_access_irq_spzapm_poweroffumass_scsi_attachbufpagesrandomkqfilterusbrev_strrlphy_cdsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopsrasops_rotate_fontsysctl_sensorskern_sysctlnd6_delayin_pcbinitsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTscsi_user_doneuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortvop_pathconf_vp_offsetsrt_mpath_matchgatecdce_startsensor_task_scheduleapmioctluvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstatwddkdrivera4x_bs_r_2db_break_tablefillmapentrytcp_timer_persistrelookupwsemul_vt100_output_esc_hashudav_newbufsys_umasksyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupmemmoveicmp_rediracceptapmclosevop_reclaim_descusbd_get_hub_statuswsemul_vt100_detachdb_boot_halt_cmdural_attachip_outputbpf_mtapfindblknamenkmempages_maxkue_rx_list_initpool_initlcd_ioctlpcmcia_card_attachbpfreadpool_putm_copym2sysctl_structohci_hash_rem_tdpmap_pinitaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimefiforead_filtopssysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapusbd_get_device_statusspec_vnodeop_plookupnchinitexec_mapdb_qualifysnprintfcomcngetcsyscallext2fs_readlinkether_ioctlumass_bbb_transferrnd_attachedtqphy_servicescoop_pcic_functionsip6_forwardinganon_swap_offural_cdkue_resetarp_allocatedrasops_isgray_bus_dmamap_load_mbufwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallmouse_copy_worduvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreenincoreurlphy_cdhzdefrouter_resetcd9660_ihashinscheckaliasdl10019_mediachangecue_activatettyretypestartuphook_listpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzapm_enable_chargingsdclosevop_poll_vp_offsetsvop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuiddb_set_cmduvm_unlock_fpageqcpuidsexec_setup_stackpager_map_wanted_lockuao_createdb_free_watchpointsaue_lock_miiidentify_arm_cpuffs_realloccgwskbd_load_keymapxscale_cache_cleanD_rngcd9660_bufatoffgroupmemberuvmspace_initether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbackssys_forkip_setmoptions__qdivrempxagpio_reg_readspec_openpmap_vac_me_kpmapfilt_bpfreaddb_watchpoint_freeaue_shutdownwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstacksi_freevm_nphyssegip6_randomidproc_filtopsfiq_nullhandleruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesfiledescopensys_vforkpmap_vac_me_uservop_reclaim_vp_offsetscomcnspeeduvm_pager_initcpufuncsCopybufferwinChkNamepxaip_matchdvd_read_copyrightvmi_list_slockdb_history_prevmyip_initializedpxapcic_scoop_casync_vnodeop_psys_mkdirdl10019_media_finiuao_reference_lockedpmap_devmap_tableufs_fhtovpwskbd_translatedumppcbrttrashohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessys_socketdead_vnodeop_opv_descohci_shutdownwi_init_usbzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimeufsspec_writedead_vnodeop_entrieslxtphy_caiso_disklabelspoofpcmcia_cafifo_badopfdfreetty_countraw_disconnectipsec_ipcomp_default_levelsensor_task_registerKERNEL_BASE_virtremove_coproc_handlerumass_polled_transferbrelvpwdc_loggpio_strobe_pins_c3000msdosfs_mountfswi_stopip6_sprintfzts_ioctlsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmuserconf_parseural_tx_bcnip6_keepfaithext2fs_alloczapm_ac_onwskbd_deliver_eventdb_eregscom_fifo_probefdcopypxapcic_event_processb_to_qbus_space_read_raw_multi_2pxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacescoop_gpio_pin_readifg_headvfs_rootmountalloccue_tx_list_initnetintrbs_notimpl_bs_sr_2rw_initcd9660_openwsemul_vt100_output_dcsuvmcnt_dumpglass_consoleohci_root_ctrl_startcmask_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_lineuhidkqfilterVOP_ISLOCKEDsys_kqueueieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipein6_addrscopeieee80211_ifdetachdb_searchapm_get_eventbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockraw_usrreqnblkdevbs_notimpl_bs_wm_2uhidev_detachscancttyinput__stack_smash_handlerukbd_consopsbiodoneural_activatedb_set_breakpointwi_usb_txfrmmaxslpext2fs_makeinodecue_startaue_csr_read_2usb_eventsufsread_filtopsufs_symlinkufs_mkdirvfs_getcwd_getcacheusbd_get_no_altsin_iawithaddr__anddi3rt_missmsgdofilereadVOP_BMAPip_dooptionsvn_lockcue_tick_taskrip6_ctlinputcdce_cawsemul_vt100_handle_csiumass_cbi_adscsbdropmsgbufphysscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocsys_setegidwdc_wait_for_statusbus_space_write_raw_multi_4rn_matchfifo_readcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoreceivepool_getuextralocsharp_zaurus_C3000db_show_radix_noderootfsudav_csr_read1ohci_root_intr_startrip6_outputscsibus_cdndflushcompose_tab_cmppxa2x0_lcd_start_dmarn_insertspec_pollfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defer_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventbsearchif_attachlcd_get_brightnessm_reclaimnameibs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_pollvn_accesstqphy_funcsversionwihap_init_bus_dmamap_synckqueue_initaxe_rx_list_initata_dmaerruvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcbs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputudav_initVOP_REVOKEconfig_deactivatescsi_probe_bussesclallocipsec_esp_trans_default_levelbiowaitfilt_ufsreadunixswsccsdb_stop_at_pctqphy_cawsdisplaymmapccpupmap_updateuvm_map_replacepxa2x0_gpio_intr_maskgeneric_bs_sr_1boothowtofdinitarc4randomnsphy_funcstcp_delack_ticksupl_stopttopenata_get_paramsether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2namescsidebug_lunsuao_dropswapenxiosys___getcwdusb_cdrnd_event_headwsdisplay_switchtoconsolein6_maxmtupmap_enteramphy_funcsundefined_handler_addresssys_setreuidusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecomcnattachdb_var_rw_inta4x_bs_w_2usbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanvop_print_desctcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockdl10019_mediastatuswdog_registerkue_attachif_indexlimusbd_free_xferdb_varsfallocbufferslxtphy_cddeadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapuvm_anon_removeumass_bbb_methodssoft_intrqufs_lockcomintrsys_accessnsphy_statususerconf_initkillpg1url_tx_list_initwsmouse_mux_openvputonfreelistmouse_removewdioctlext2fs_mountrootregyearurl_ioctlpage0setrunnablepool_do_putpxa2x0_pi2c_closewi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinksensor_delcue_attachpxa2x0_stray_interruptosversionelf32_read_fromhid_is_collectionnsgphy_statuswi_usb_tx_list_initapm_power_infotvtohzvmi_listudp6_usrreqratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controllmaxrlphy_funcswsmux_srcopsuvm_pagecopyzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDrddkdriverohci_freemmbstatuhidev_intrttyinfodb_flush_lexttyinramdisk_devsohci_root_ctrl_donegetnulldevusb_get_next_eventdb_dmesg_cmdextent_destroydb_lpip6_forward_srcrtif_group_egress_buildzapm_pollloop_clonerwhichqsgetcttsetwaterfilt_apmrdetachdb_last_addrural_update_slotmouse_copy_startpmap_enter_pvmsgbufenabledunp_disconnectufsfifo_writesys_listensys_mountpgsignalfirstcdb_read_bytestcp_rndiss_inituhub_detachuvm_page_rehashvop_getattr_vp_offsetsvop_islocked_vp_offsetsne_pcmcia_enableffs_fsyncwsmux_mux_openrasops8_putchar12wsdisplay_consinetdomainwsfont_findmemcpywdc_enable_intrkthread_exitaxe_activatecue_newbufsi_getdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrreqfilt_usbrdetachspec_writeipsec_esp_network_default_leveldb_map_equalin_broadcastpool_page_free_oldnointrfd_getfilemsgbufaddrsdioctlutsnameexit2__hex2asciiaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdatecurpriorityrddumpcpu_setperfufs_lookupufs_bmapdoasyncfreepxagpio_cdudav_miibus_readregip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createsi_finddb_elf_sym_initwdc_default_read_raw_multi_2ffs_fifoop_entrieslogclosegeneric_bs_wr_4nbufpcmcia_submatchinstall_coproc_handlerohci_rhscudav_detachufs_strategyohci_device_requestkue_watchdogphysical_freeendbounds_check_with_labelether_input_mbufif_qflusharc4_timeoutext2fs_checkpathsocantrcvmorefile_filtopsmsdosfs_renamesysctl_proc_argsext2fsfifo_reclaimpipe_wfiltops__lshldi3cd_load_unloadpxa2x0_rtc_getsecspmap_activatebmtphy_resetvop_create_vp_offsetsconfig_make_softcunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofswap_syscall_lockufs_kqfilterscsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutesnsphyter_cdwsemul_vt100_output_csiin6_are_prefix_equalin6_controlleapyearsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96trapsignalcurprocpxaohci_enablemainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterfdcloseexecevcount_attachlimcopywi_do_hostencrypttcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initnd6_useloopbackieee80211_next_modeputsaxe_tx_list_initrip6stattcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsrv_ipohci_add_edwdc_xfer_poolcdce_newbufbus_space_copy_2soacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsdb_call_depthlcdintrpool_page_alloc_kmemdb_printfuhidreadin6_ifaddloopufs_creatend6_optionscd9660_seeknd6_llinfo_settimerfreqmsdosfs_unmountelf32_load_psectionrn_mpath_nextarm_pcache_unifieddb_add_symbol_tablem_tag_nextohci_intr1msdosfs_writebs_notimpl_bs_w_1cue_resetexec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootdb_unaryiophyattachzts_readposne_pcmcia_get_enaddrselrecordpxaudc_caffs_validatecomstopaxe_ax88772_initrip_outputext2fs_accessmld6_fasttimeokthread_qimaxwsmouse_matchvop_unlock_vp_offsetsohci_free_seduserconf_pdevuvm_object_printitclock_secs_to_ymdhmsmbpooltcp_canceltimerstqphymatchrip_recvspaceroute_initdb_store_countlink_rtrequestwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdspec_lookuppipe_createfifowrite_filtopssysctl_vnodend6_sysctlpxa2x0_setperfvn_openif_clone_createcdce_tx_list_inituao_detachcpufunc_controlmallocamap_pp_adjrefin_pcbrtentryknote_dequeuewi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1umass_cdvcountrd_root_sizevm_page_zero_enablein6_delmultistathzwdog_ctl_cbpxagpio_dispatchwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportsys_getloginpxa2x0_gpio_intr_disestablishbuckstring_initicmp6_rediracceptext2fs_vnodeop_opv_descdetruncdb_elf_symbol_valuescopyoutpfindcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallwsdisplaypollohci_allocxcopyrightsdattachxscale_optionswdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpwsemul_vt100_cnattachtcp_mss_updatefree_pagesffsfifo_reclaimdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufgpio_sense_pins_c3000ip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidpxa2x0_gpio_set_functionhostzeroisbroadcastdb_output_positionrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodcd9660_specop_pip6_defmcasthlimsys_munmappxa2x0_lcd_initializefilt_solistenvsnprintfwsemuldisplaydevprintarplookupuvm_map_pageableproftimer_trampolinechainallocpmap_copy_page_xscaleifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmdtcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablewsemul_vt100_scrolldownwsdisplay_getc_dummybpf_iflistPaste_availwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbufnd6_rs_inputsoabortunp_inologkqfilteruvm_tree_RB_INSERTdb_extent_print_cmduprintfdb_clear_single_stepuvm_page_printitmainbus_casoftdep_flushworklistsys_issetugidinitclockscd9660_mmapsd_reassign_blocksif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolext2fs_specop_opv_descunp_connectuvm_pagermapinif_detached_startpool_serialxscale_cache_flushD_SEirq_entryaue_ioctlvfs_mountedondb_expressioncputypepmap_deactivatert_lookupfc_lookup__bss_start__if_downndqbfilt_rndreadallocsysVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1uvm_km_pages_headwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headertcp6_usrreqdb_historyeephy_cdinphy_cdukbd_parse_descttytstamptcp_rndiss_cntural_set_txantennaieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirehw_seriallcd_pxaip_caapm_thread_createuvm_unmap_pcdattachuserconf_devicein_localaddrsys_sigaltstacksoisdisconnectingwi_media_changesyn_hash2rttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectuvm_map_printitdb_read_variablensgphy_casoftintr_initdb_regsdb_stack_dumpttymodemdb_lbuf_endwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitallcftablesuhub_activateax88190_mii_bitbang_opsin6_ifattach_linklocalVOP_REALLOCBLKSsys_setresgidmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctlwsdisplay_clearoncloseudp6_recvspaceuvm_km_freesys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirinsw16rt_setmetricssys_getegiddb_set_single_stepumass_init_insystemdirchkexphy_resetipip_outputpipecloseext2fs_fifoop_entriesVOP_REMOVEwi_usb_activateconsiniturlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrminidatacleanrt_timer_queue_destroyzkbd_syncwi_cdsd_cdicmp_mtudiscipport_hifirstautosys_fstatlcd_show_screenuserconf_enableukbd_sunlayoutext2fs_vinitdb_endlpumass_bbb_resetgeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinituvm_km_vallocieee80211_send_mgmtcue_getmacieee80211_dump_pktsys_unmountbootdvapmkqfiltermainbus_bs_tagelf32_probesin6ifa_ifpwithaddrvgonelsofreeeephyattachinphyattachctrl_eventcomsiraddrdb_del_symbol_tabledb_add_exprpmap_removebpf_mtap_aficmp6_fasttimoext2fs_removeif_clone_destroywdccommandpxaintc_attachmyipbpf_setfuserconf_historyuvm_page_unbusytk_noutext2fs_mountpmap_collectukbd_enabledb_symformat_elfgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstampip_randomidaue_tx_list_initnosuidcoredumpukphyattachvop_poll_desccddumpdb_search_cmdpxa2x0_lcd_alloc_screenasttcp_disconnectvop_open_vp_offsetsuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborwsemul_vt100_output_normalunp_rightshostnamedb_print_llinfowsdisplay_emulbellupl_outputext2fs_bmapuvmexpufs_diremptyreinsertfinishdupukphy_serviceqsphy_resetpool_destroylogwakeupdl10019_mii_readregshutdownhook_listip_dosourceroutesoread_filtopsieee80211_media2ratecpu_swapoutbdevsw_lookupdisk_changewsemul_vt100_resetopsc_devsamap_lookupsdoreallocblkscache_revlookupbpfread_filtopssoinitVOP_MKNODuvmpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometryhw_uuidext2fs_truncatecd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorax88190_media_finiprefetch_abort_handleruvm_km_threadlminscsi_probe_bussys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopenscsi_test_unit_readyural_set_bssidarc4random_bytesnmbclustural_get_rfvop_reallocblks_vp_offsetssominconnpcmcia_matchnchashtbluvm_vnp_syncwsmux_set_displaywihap_assoc_reqarpt_downwsmoused_wakeuprdgetdisklabelarm_pdcache_line_sizebpf_tapdb_lookupmii_phy_autorasops15_putchar12wsmousedmax_datalenwsfont_rotatemsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioext2fs_writelf_clearlockgeneric_armv4_bs_wr_2db_lastsymurl_memip_srcrouteuhidioctlip6_accept_rtadvpte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1usbd_dopollvinvalbufmii_bitbang_writeregzts_rawmodesys_ftruncatem_splitsoftintr_disestablishfifo_pollurl_stopzts_irqtcp_timer_initdb_tab_stop_widthdb_putncharsmainbus_bs_unmapnd6_maxnudhinttcp6_inputsosetopttcp_msscache_purgeudav_stop_taskbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0pcmcia_intr_disestablishfork1curpcbdb_activevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriespxaintc_matchtcp_rndiss_msbsys_chmodprelist_removeffs_vgetaxe_encapinitproc__umoddi3arm_dcache_alignip6_log_intervalwihap_auth_requvm_page_physdumprootconfwsemul_vt100_nextlineX_db_sym_initsyn_cache_timervt100_initchartableslcd_paramsolisten_filtopsprocess_kernel_argsin6_update_ifa__wdcerrorcdce_detachpxa2x0_intr_disestablishvop_bmap_descsuser_ucredsd_shutdowncom_is_consolewi_shutdownmem_noext2fs_buf_allocdp8390_startwihap_sta_deletemainbus_bs_rm_2pmap_free_l2_bucketrevarprequestkernel_mapwi_init_iodumpdevwsmouseioctlcd9660_lockieee80211_mgt_subtype_namedb_not_taken_bkptvfs_mount_foreach_vnodekqueue_kqfilterwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmpcpu_swapinohci_device_bulk_start__guardin_ifaddrzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readm_freevop_default_descne_pcmcia_dl10019_get_enaddrurlphy_attachscsi_inqmatchfdesc_poolusbd_add_drv_eventvop_strategy_vp_offsetspool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollpool_head_slockbadaddr_read_4bzerotickfixintervalmii_bitbang_syncarmv4_drain_writebufufs_closefixjobcdb_show_all_cmdsscsi_execute_xsin6_addmultirn_newpairvop_setattr_descdb_find_breakpoint_herezts_enable__udivdi3sys_obreakpxapcic_attach_cardpxa2x0_gpio_set_intr_levelusbd_set_config_nousbpolllastddatepmap_curmaxkvaddrin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinitusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdamap_allocVOP_LOCKMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internaldb_page_print_cmdwi_intrvgetrd_attachpxa27x_cpu_speed_91ieee80211_create_ibsswsmouseopenwinChksumfreeclusterchainmld6_initrw_test_and_setmainbus_bs_w_4disk_initpxapcic_intr_establishcd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsrip6_ctloutputwdcrestartnetioaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createusbd_bulk_transfer_cbwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_cabmtphyattachsysctl_dopoolcd9660_fifoop_puhub_matchpmtu_expiretcp_respondsys_readvamap_cow_nowroundrobinsa11x0_intr_establishbadaddr_readuvm_map_createvfs_opv_initissignalwdprintCopybuffer_sizenetclsfilt_uhidrdetachcdevvp_setsoftintrigmp_joingrouprandompolluiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_allocdb_loop_countwi_intr_ackfiq_releasebpf_reset_dnd6_dad_stophid_start_parseuseloopbackscoop_pcic_socket_setupuvm_waitfilt_apmreadnexecszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgloioctlrw_exit_writebs_notimpl_bs_wr_8pmap_bootstrapbs_notimpl_bs_wr_2ipsec_auth_default_levelsys_mqueryarm_picache_line_sizebigadjkmeminit_nkmempagesspeedtablesspec_vnodeop_entriesusbd_new_devicewi_pcmcia_detachfillinusemaprecvitfill_kproc2bmtphy_funcsscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blanklog_openevcount_initfragtbl124userconf_totdevvop_inactive_vp_offsetsxscale_cache_flushIDrt_tablesrt_ifmsgrealitexpireipstatunix2dostimescsibus_caurl_newbufusbd_delay_mspool_page_free_kmemcrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrdl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_swap_getext2fs_reloadurlphy_matchelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemurl_cdnsgphy_servicewskbd_holdscreeninferiorxscale_cache_purgeD_Eukbd_attachclusterallocext2fs_fifoop_prt_if_remove_rtdeleteltsleepwskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_cartalloc2endtsleepwihap_check_txuvm_pageratopsigactssharedb_set_watchpointbpfattachif_detach_queuesitimerdecrusb_create_event_threadether_outputpmap_bootstrap_pv_page_freebpfilter_lookupm_copym0axe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriternd_timeouticmpmaskpipe_ioctlural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootnetlckbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrpxapcic_attachcomprobe1getphysbufcdsizedb_symbol_valuesumass_lookupdb_evarsupl_activatewsmouse_mux_closeufsfifo_closewakeupgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2tcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2iduvm_vnodeopsvfsconfVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesmsdosfs_vnodeop_pcomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopendoscheckpathpcbmapnd6_option_inituvm_km_alloc_poolpage1ext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfilt_ufswritert6_flushrd_ioctl_serverpxapcic_io_freeuvm_mlk_callgeneric_bs_r_4mmrwffs_bufatoffwi_usb_rridrespuvm_errno2vmerrordohooksieee80211_rssadapt_chooseukbd_activateaue_setmultiif_detached_ioctllocnampvop_close_descwi_usb_causerconf_showip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodespeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachsysctl_emulsys_sigprocmaskdb_commandin6_if_upfilt_pipereadskip_spc_rightpxa2x0_intr_establishsoreservepidtakendb_formatconsoleuvm_mmapusb_activatepxaost_attachscsi_report_lunsufs_quotactlaroundin6_pcbnotifystrrchrusbd_clear_endpoint_togglegetdevvpdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangetickdeltaisodirinodb_strlcpycfrootsscsiprintwsmousepolllease_checkchrtoblkuserconf_pdevnamminphysukbd_matchurl_tickztsavgloadedrtalloc_noclonetimeout_mutexcd9660_specop_opv_descether_addmultivop_mknod_desccdce_cdip6qffs_vptofhifunitvfs_isbusyirqstackbawritetputcharwskbd_detachpmap_postinitpool_print_pagelistffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowndb_breakpoint_cmdcd_powerhookvwaitforiopxagpio_camii_phy_tickcd_read_subchannelextendfilelortrequesticmp6_inputwsemul_vt100_outputuserconf_addohci_device_intr_methodswi_func_iocreatedesbreleasedb_history_sizemsdosfs_islockedmax_linkhdrumass_attachwsdisplayioctludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetssqphy_serviceuserconf_hist_eocext2fs_getattrrtlabel_id2namesbdroprecorduvm_coredumppxaip_searchwdsizeacphy_statusip6_sysctlsuserdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opsclusterfreerootdevufs_ihash_slockm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptordumpsysicmptstampreplif_detached_watchdogusbd_ar_pipeext2fs_fsyncdoforcesys_fsyncwi_usb_stopuserconf_add_readusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configdb_map_currenttcp_rndiss_nexttcp_outputnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachupdate_ledsext2fs_updatepxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodeif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppfifo_lookupffs_reallocblksrandomcloserootvpaxe_miibus_writeregpxagpio_intrlowpcmcia_intr_establishuserconf_maxlocnamespool_reclaimusb_quirksbpf_sysctlvflushcddetachpmap_clear_modifytcpctl_varsarptimertcp_reass_limitruaddrdstrategym_copymmouse_copy_extend_charbcopy_pagedb_free_breakpointsif_upwsfont_getflgne2000_ring_copyupl_intrural_matchVOP_BWRITErt_timer_queue_createwddonemsdosfs_ioctlupl_matchsys_openrasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangepgdeletepxapcic_intr_stringuvm_pageidlezerowskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabsieee80211_media_changeraw_attachural_set_rxantennadb_boot_sync_cmdmax1111_adc_value_avgastpendingether_ip6multicast_maxpipe_pooluao_initvop_abortop_descifa_ifwithroutescoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolrandomattachsys_sstkdb_print_positionrtflushclonedb_radixgetblkmouse_pastedead_vnodeop_pdl10019_stop_cardmouse_copy_endxscale_cache_flushD_rngmaxsmapwdc_ata_biosoconnectural_initwskbd_repeatvtypesnobuffersdata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrtcp_identtcp_rst_ppslimrtrequestifinitcd_load_tocunpst_recvspacene_pcmcia_attachkue_initxscale_cache_purgeIDraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachnd6_ifattachunpdg_recvspaceoutswm8pipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathpmap_pte_init_xscalepfxlist_onlink_checkdb_elf_lookupm_tag_findinittodrvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizecd9660_setattrusbd_get_configufs_quota_initkqread_filtopsusbd_setup_pipexscale_setttbxscale_cache_cleanIDaue_csr_read_1pcmcia_check_cis_quirksieee80211_beacon_allocbioopscpu_classesbpf_setdltmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocpcmcia_card_gettypepxa2x0_clkman_iohufs_ihashinsin_setpeeraddrwdcactivateeephymatchinphymatchpxa2x0_a4x_bs_tagdb_readlinewsdisplay_delscreenether_ifdetachvop_fsync_vp_offsetsuhidev_get_report_descuserconf_histcurrndstatsmsdosfs_inactivecurrent_intr_depthpanicstrwsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeunpdg_sendspacesession0viscpywsmouse_do_ioctlhw_vercopyin__umodsi3comparamural_stopudav_sendcd9660_defattrohci_device_bulk_closertalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetne2000_read_hdrsigacts0findblkmajorpager_mapntohlsorflushiophy_funcslcd_matchttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelaywi_usb_infofrmffs_mountwsmux_mux_closeext2fs_specop_entriesicmp6errppslimbadaddr_read_2usb_desc_iter_initusb_neventspool_inactive_timedp8390_mediachangeconfig_process_deferred_childrenohci_ifcdwsdisplaywritepool_cache_reclaimxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootmii_bitbang_sendbitstqphyattachusbd_finishsoftnet_intrhandbpf_getdltlistm_tag_getsb_lockohci_root_intr_abortrt_labelsupl_watchdogsuid_clearttwriteswapdev_vpdp8390_resetpxa2x0_bs_mapdead_readpxapcic_socket_disableufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutvop_symlink_vp_offsetsunputcendpcmcia_verboseVOP_CREATEprobe_switchcdce_stopvop_readlink_descrasops_copycharuvm_map_referencespec_ebadfphtree_SPLAYnd6_recalc_reachtm_intervalin_ifinitfifo_closeohci_device_ctrl_closerasops15_makestampwi_pcmcia_activatein_pcbhashlookupapmread_filtopsmainbus_bs_mmapural_writecd9660_vnodeop_opv_descVOP_ABORTOPsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_poolwi_inquiretcp_rst_ppslim_countukbd_detachif_clone_listsys_futimessdgetdisklabelwi_do_hostdecryptinternal_commandin_losingVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchvn_ioctlwi_usb_ctl_lockufsspec_readdb_show_calloutaxe_cdpipespacefiqvectorohci_alloc_stdip6_sendredirectsddb_sysctlukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsaxe_setmultisyn_cache_countieee80211_add_xratesnd6_timer_chne_pcmcia_ax88190_set_iobasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachwsmouse_add_muxbdevvpifa_ifwithdstaddrdb_watchpoint_allocudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pageuihashtcp_keepintvlvop_reallocblks_descvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchzts_sampleswihap_sta_findusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocwrite_multi_1aue_tick_taskcpufunc_faultaddressdb_preveephy_funcsinphy_funcsbswap32ipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreepool_prime_pagesys_chownuvm_pagewirevop_lease_vp_offsetsrasops_putchar_rotatedin6_joingroupsys_munlockuvm_anfreedofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlemclpoolscoopmatchvfs_getcwd_commonset_cpufuncscttyioctlffs_vnodeop_psys_lstatfilt_rndwritescoop_gpio_pin_ctlohci_timeout_taskohci_hash_add_tdiso_uiodirurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapfifo_vnoperatedisknamesumass_quirksdumplomsdosfs_mountacphy_funcsnullcnpollcuvm_km_initbzero_pageffs_sbupdateudp_sysctlax88190_mii_bitbang_readbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolnkmempages_minvop_mkdir_descukbd_accessopspxapcic_io_allocusbcloseudav_matchcdce_get_descpxauart_matchvector_pagesys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbllcd_set_brightnessetextifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskpxa2x0_bs_unmapscsi_mode_sense_pageboot_argsvt100_selectattributeumass_scsi_setupproc_poolaue_intrmainbus_bs_wm_1udp6_inputsys_writemap_forwmergedb_get_valueural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immed__bss_end__wsdisplay_maxscreenidxcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2db_inst_countdb_read_linewdc_ioctl_findwsdisplay_switch1wd_get_paramssys_readlinkext2fs_sizecpufunc_faultstatus__ashrdi3bs_notimpl_bs_mmapohci_intrxscale_cache_flushI_SEwsdisplay_burnpmap_dump_ncpgip6_auto_flowlabellf_splitifafreeVOP_STRATEGYtzxscale_cache_syncIrip_sendspacexscale_cache_cleanID_rnguhidev_writeamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcsoftclock_siwi_usb_threadzkbd_ioctlin6_pcbsetportalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnpmap_dumpcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufaxe_rxstartdehashtblsocketopsX_db_sym_numargsnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readfiq_nullhandler_endunp_markacphyattachicmp_mtudisc_timeoutnwsmuxskip_char_righta4x_bs_r_1pmap_zero_page_xscalettyread_filtopsusbd_bulk_transfervop_lookup_descdb_map_addrgetinoquotafifo_ebadfscsi_do_ioctlrtable_existscd_resettimedeltaX_db_foralludpstatcd_read_tocural_amrr_updatecdioctlcue_stopifmedia_addlxtphy_funcsusbd_set_config_indexlogopenbreadntcp_hdrsztcbtable__xordi3frag6_draindosdiremptyidleigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharfork_returnsys_getsocknamecd9660_lookupvop_fsync_descwi_usb_intrusbd_alloc_buffermask_rnheadproc_isundersi_headpte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRusbreadpmap_kremovesigactsinitusbd_set_reportexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttywdc_pcmcia_cauvm_pagealloc_stratural_bbp_readusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discoip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoltcp_drainpmap_l2dtable_ctorm_pullupbpendtsleepenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEMPFailwsemul_vt100_output_string_escpxa2x0_rtc_getalarmcnbellm_copydatainswm8cd_setchanuvm_cnt_headmtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctldb_nextumass_matchsendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlvfs_busymouse_copy_extend_afterfilt_ufsdetachlf_getlocksolistenwskbd_compose_valueip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupuserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachpxaost_matchieee80211_ibss_mergeboot_filefilt_sordetachpsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadamap_pp_establishuvm_anon_initffs_reclaimbmtphy_causb_free_devicexscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spacepage0_endusb_disconnect_portbpfpollnumemptybufsupdatepriohci_activatebmtphy_serviceuhid_cdwskbd_cnbellruntimevt100_decmodeoutswwi_seekfilt_soreadpmap_remove_allrtable_addzeropageipsec_def_encpool_logsizesoftintr_establishpxaudc_detachip4_input6pdevinit__iordi3nsphytermatchinetctlerrmapffs_specop_opv_descresetpriorityrasops4_putchar16enoioctlwi_usb_start_threadsigacts_poolexecsigsconfig_initcpufunc_null_fixupicmp6_redirect_inputrw_enteraue_read_macdb_access_abt_spscsistrategynd6_ra_inputffs1_blkprefin6addr_loopbackttypendin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyieee80211_wep_cryptX_db_symbol_valuesusbd_reload_device_descext2fs_advlockknote_fdclosevop_lease_descif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpvfs_opv_numopsvfs_shutdowngetsockbs_notimpl_bs_c_4upl_startmouse_hidezssp_matchin_interfacessyn_cache_respondpxa2x0_gpio_set_dirllinfo_nd6sbcheckreserveuvm_iopreemptieee80211_begin_scanunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatnsgphy_cdsyn_hash1ulminwihap_data_inputpxa2x0_lcd_free_screendb_last_symtabproc0paddrrn_addmaskusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_poll_randseedrtafidx_maxsig_filtopsohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocations_bus_dmamem_mapnet_sysctlcom_cdxscale_cache_cleanD_Ewskbd_do_ioctldead_ioctlfill_eprocaue_initusb_match__wdccommand_startsysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputdb_stack_trace_cmdusb_allocmemufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputvop_ioctl_vp_offsetskmemusagezapm_suspendlf_getblockusbd_add_dev_eventtcp_rttdfltcleanerprocfifo_reclaimsbappendstreamm_tag_copy_chainusbd_intr_transfer_cbusb_event_threadsowrite_filtopsstrncpyrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipeupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastusbd_set_port_featurebpfilter_createsysctl_lockax88190_mii_writereglockfpoolwihap_disassoc_reqrasops_copycols_rotatedcpu_switchtoieee80211_find_nodehtonluvm_km_kmemallocusb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactiondeupdatzapm_get_event__negdi2in6_purgeaddrcpu_modelarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagdl10019_init_cardbmtphy_statusdisk_unbusysysctl_filesoisconnectedurlphydebugamap_clean_worksusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modexscale_cpwaitvattr_nullsys_getsockoptuhidev_attachfrag6_nfragpacketspxapcic_pcmcia_functionsdb_linewildcardin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKumass_cbi_methodspxa2x0_intr_bootstrapdb_ed_styleufs_seeknsphyter_funcsmii_submatchuvmexp_printohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelpxa2x0_setsoftintrbpf_m_xhalfaverunnablecd9660_getattrttyfreettysleeplcd_cddp8390_initzapm_bcintrunp_disposerd_open_hookscsi_inquireufs_getattrieee80211_mhz2ieeevfs_exportuvm_km_pgremoveramdisk_ndevsex_region_plfscaleip_optcopyvfs_registerieee80211_proto_attachsys_dupmcllowatmii_printbpfilterattachtimeout_tododb_lccpu_read_cache_configrasops8_putchar8wsemul_vt100_scrollupzkbdsleeptvpanicget_pc_str_offsetL_cksumdataural_rxeofcue_rxeofmsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordsoftdep_initializencvhashtblunp_shutdownwi_resetext2fs_sysctlgeneric_bs_wm_4cluster_callbackkthread_run_deferred_queuevop_lock_vp_offsetspxa2x0_gpio_bootstrapwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpcmcia_attachpte_l2_s_cache_mode_ptdeferred_config_queuedp8390_getmcafipport_lastautowsmux_detach_sccd9660_fifoop_entriescom_raisedtrdb_last_commandicsphy_statuswinSlotCntvn_kqfilterfiq_getregsext2fs_syncpte_l2_s_prot_maskudav_ioctlcache_purgevfspostsigsys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdmaxrasops_reconfigumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templatemsdosfs_readdb_object_print_cmdohci_initcomopenusbd_setup_xferieee80211_tree_RB_MINMAXbcopywsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physwsemul_vt100_output_scs94scoop_cageneric_bs_rr_1axe_resetlcd_get_backlightdefrouter_addreqin6_clearscopefifo_vnodeop_entriesusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaitmemcmpwskbd_init_keymapmsdosfs_createcd9660_startdb_output_linezkbd_hingecomstartpool_allocator_kmemdb_examinecfroots_sizedb_end_linetickadjvop_rmdir_vp_offsetssbreserveundefined_initvrecycleextent_printieee80211_alloc_nodecrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listip6_setpktoptionssysctl_stringsys_rebootpmap_dump_allbufpooldl10019_mii_bitbang_writeMCFailwdccommandext_bus_dmamap_load_buffercpu_forkwi_write_data_iodb_print_ifattylistwdopenuvm_vslock__bin2bcdttyoutputkue_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configpcmcia_scan_cispxa2x0_memctl_iohclockintrrn_mkfreelistvop_bwrite_descVOP_READin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimesys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureufs_quota_free_blocks2senditlcd_bpp16_screencluster_writernd_event_tailuvm_setpagesizetcp_xmit_timerin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bittickmclpool_warnmsgdb_termscsi_preventmmclosenumfreepagescd9660_accessffs_statfswdcprobeiophy_cdudp_recvspacewdc_ioctl_strategya4x_bs_w_1bus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputstuck_keysufs_dirremovepxagpio_reg_writecinitif_attachsetuppipe_writevop_symlink_descin_pcblookup_listensbappendm_copybacknextgennumberuvm_swap_puticmpbmcastechofifo_advlockevcnt_attachdb_continue_cmdconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitpmap_copy_page_funcpxa2x0_lcd_attach_subripsrciso_nchstatskue_txeofural_amrr_startscsidebug_targetsnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_alloc__wdccommand_doneumass_adjust_transfersignal_initnsphyter_serviceffs_updatedb_print_formatwsmuxclosedp8390_getunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopip6_ecn_ingressusb_discovercomdiagextralocunsleepwdprobeX_db_lookupmtdphy_funcsohci_alloc_std_chainipintrgetnanouptimeudav_activatemaxdmapural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolq_to_bmountrootsyn_cache_resetdb_inputcharuhidev_opendb_boot_cmdsundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportsysctl_rdintural_eeprom_readpxagpio_matchlodirtypagesfindwin95VOP_WRITEsys_nanosleepstart_init_execifa_ifwithaddrclock_ymdhms_to_secsdb_write_cmdif_clone_attachwsmoused_releasesys_getfsstatohci_abort_xferbpfopencdstrategykmemstatsnd6_slowtimo_chuvm_km_valloc_aligndb_max_widthmntvnode_slockcomwritemouse_copy_selectionVOP_RENAMEcdclosesys_fchdirgreen_onsysctl_ifqalleventspxapcic_mem_freerandompidwd_cdurl_initfilt_ttyrdetacharp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswdog_timeoutwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strsusbd_sync_transferffs_vnodeop_entriesamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initsync_vnodeop_entriesproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildpxa2x0_gpio_clear_intrbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctlsys_xfspioctlif_free_sadldb_dotieee80211_node_joinfilt_bpfrdetachwsdisplay_emul_capxa2x0_clkman_configicmp6_initrasops15_putchar16disassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrrandom_statebpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_poollastpiduvm_page_physloadreset_entrywdc_exec_xferwdcresetipintrqsensor_task_createohci_noopmaxprocusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizeip6_nexthdrrtdeletemsg__bss_startkue_rxeofrasops4_putchar12VOP_KQFILTERukphy_funcssys_msyncvop_rmdir_descwskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachconfig_activatememsetpipe_free_kmempxa2x0_splxufs_getlbnsohci_strphysiopcmcia_3cxem556_func0_cfe0in6_selecthlimupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncpxauart_attachicmp_mtudisc_cloneclass_cmp_spllowersodisconnectpool_allocator_oldnointrsys_setgroupsmainaue_csr_write_2lxtphy971_funcsthreads_pendingohci_device_bulk_doneusbd_initmtdphymatchrasops_init_devcmapural_set_basicratesip_flushkue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1icmp_errorinpcb_pool_initalizeddb_hangmanukbd_delayed_decodewsmuxdevspxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbadkqueueopsvholddb_help_cmdrt_if_removeusbd_no_quirkm_adjmld6_stop_listeningpmap_map_chunkppsratecheckscsi_free_xskmemlimitlcd_poweramap_copyphysical_enduvm_rb_spaceuhidpollieee80211_ieee2mhzieee80211_dup_bsslf_findoverlaplf_wakelockdb_sym_numargskue_attachhookdumpconfwi_rxeoffilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badopcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closestrlcatwsdisplaystoppte_l2_s_cache_modeifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8cdce_matchsoftintr_dispatchdisk_unlockufs_ihashremcttywrite_bus_dmamap_createurl_stop_tasksdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumberudav_attachusbd_get_hid_descriptorrt_ifannouncemsgsoo_readscoop_resumeufs_openpmap_modify_pvm_catsplxpxa2x0_rtc_setalarmrtinittqphy_statuscluster_collectbufswi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initunp_gcsys_clock_gettimeip6_hdrnestlimitpool_catchupxscale_cache_syncI_rngfrag6_initbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msftimeout_setrdread__subdi3wsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelrw_exitdupfdopenifmedia_list_addpidhashvfs_mountrootpxaohci_detachxscale_context_switchuvm_totalencdebugdb_unread_chartimedl10019_mii_bitbang_opsstart_initelf32_olf_check_headeruhub_attachtcp_mssdfltuvm_swap_freetcp_rndiss_sboxdata_abort_handlerbs_notimpl_bs_r_1axe_initrnd_wseldb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updcd_sizettycheckoutqread_multi_1icmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachaue_carnd_event_spacepmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabip_forwardextent_createrdclosebpf_freeddisklistsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblockuvm_map_lookup_entryhztoicsphymatchvop_pathconf_descbs_notimpl_bs_w_4m_pullup2dead_strategyswi_handlerspec_fsync__wdcwait_resetcom_pxaip_caip6_optlenuvm_map_deallocateicmp_reflectzkbd_attachmii_phy_activateext2fs_reclaimffs_ballocsys_getgroupsieee80211_node_attachuhub_cduvm_km_pages_freewi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8uvn_sync_locksysctl_initpcmcia_function_enableurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donedoclockintrspec_closecd9660_closepxaost_casys_shutdowncngetczkbd_cdrnd_statesm_gethdrconfig_rootfoundcue_cdputcsysctl_rdstruct__divsi3uhidev_cdumass_scsi_devwsmousereadxscale_minidata_clean_sizeschedcpuurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1wihap_sta_timeoutsoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlusbd_interface2device_handleapm_matchipforwardingdb_lexohci_device_isoc_transferusbd_open_pipe_ivalbufhashtblpxa2x0_wakeup_statussyn_cache_lookuparc4random_stateprtactiveksym_upcaseufs_makeinoderasops_copyrowsip6_process_hopoptsufsfifo_readusbd_find_edescwsdisplay_set_cons_kbdfifo_writefilt_ttyreadsys_getpgidcom_common_putccache_lookuprdioctlin6_purgeifdb_boot_crash_cmdurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbdp8390_intrrasops_do_cursorwsemul_vt100_handle_dcsin6_ifawithifpieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizeukbd_keydesctabirda_onextent_freeuvm_aiodone_daemonusb_cookie_noaddupc_tasksched_syncusbd_clear_hub_featuresc_err1db_mount_print_cmdcomclosepcmcia_print_cissetsigvecsys_sendmsguhidopenvn_marktextstrcmpsys_quotactluhidev_matchvop_close_vp_offsetsrndread_filtopstcp_mtudisc_increaseulmaxin6_pcbconnectdehashkue_cdhook_disestablishexphy_funcsbpf_catchpacketffs_isblockdb_stack_trace_printpxaip_cdzaurus_startusbd_find_quirkuvm_aobj_pooldb_show_frame_cmdsys_adjfreqmouse_copy_extenddb_examine_cmdqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initdp8390_detachata_set_modevop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedwsemul_vt100_output_stringwsscreen_attachzts_powerbufcachepercentm_pulldownlcd_screen_listpmap_initufs_rmdirrlphymatchieee80211_next_scanminpmap_zero_page_funcarmv4_tlb_flushD_SEip6_initconfig_detach_childrenrawcbukbd_cngetctcpcb_poolmii_bitbang_readregpxa2x0_cpuspeeduhidcloseipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configvnode_hold_listlastdosdateudav_unlock_miiufs_linksys_mkfifodb_cmd_searchifa_ifwithafural_read_eeprompcmcia_parse_cis_tuplein6_leavegroupsqphy_caiminsddumpsys_chflagsdelaysdstartdb_machine_command_tableddb_regsieee80211_media_initvt100_outputuvm_km_putpagecom_enable_debugportpage0_dataext2fs_vnodeop_pvn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultififo_opencd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregdb_maxoffffs_oldfscompatwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlncpusdb_cmd_loop_donearptfreeipq_lockeddb_show_arptabcom_detachfifo_vnodeop_pvop_write_descaxe_stopvop_read_vp_offsetsbs_notimpl_bs_w_2ural_set_macaddrdead_printeephy_serviceinphy_servicemii_media_tablewdstrategytcp_rndiss_encryptttyprintfsigcodedb_elf_search_symbolipip_inputdb_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringdb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachuvm_tree_RB_INSERT_COLORpool_allocator_nointrvop_unlock_descsys_sysarchpxaohci_powerigmp_initmii_phy_add_mediaputphysbufcpu_reset_needs_v4_MMU_disablevop_remove_vp_offsetsMD5Initqsbus_space_write_raw_multi_2cpu_info_storeffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputusb_dev_openlcd_burnerfrag6_slowtimouvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorphtree_SPLAY_REMOVEpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initscsidebug_busesscsibusactivatend6_timertcp_do_ecncomcnpollcvop_open_descqsphy_servicepxaip_attach__cmpdi2cd_patternsraw_detachpmap_get_pdeural_read_multibooted_kernelbs_notimpl_bs_wr_1domainnamelenusbd_get_report_descriptorip_rtaddrfiledesc_initrd_server_loopurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consoleprtrealloccheck_consoleapm_record_eventamap_freein6_domifattachwsdisplay_cnputczapm_restartswreadusb_blk_nfreend6_prefix_lookupcddonesync_inactivespec_printlocleanpagesarc4_stirext2fs_lookupmsdosfs_openext2fs_linkcpu_switchvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachtcp_do_sackext2fs_renameipsec_def_authmii_activateusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_desccomioctlumass_cbi_resetsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagip6_dad_countuvm_pager_dropclusterfilt_generic_detachzssp_powerhookpxa2x0_lcd_mmapsensor_task_unregisterzssp_ic_sendpool_print1pcmcia_card_deactivatedb_breakpoint_listwi_pcmcia_matchcd_get_parmszkbd_cngetcpmap_extractnd6_ifptomacwsmousedoioctlamap_unaddural_watchdogbooted_devicelcd_cnattachcd9660_printohci_rhsc_enableif_congestionnfilescd9660_islocked__bcd2binatapi_printin6if_do_dadrevarpwhoarewecue_txeofaue_detachieee80211_iserp_stapipe_kqfilterext2fs_openpmap_devmap_find_pausb_insert_transferaxe_matchrasops4_copycolsmsdosfs_vnodeop_entriesukbd_keymapdatastopprofclockdb_hangnullioctlukbd_is_consolepte_l2_l_cache_modeisohashparsediskwi_set_debugzkbd_onbreadamap_lookupipctl_varspmap_page_removert_timer_remove_allzkbd_irqwskbddevprintuhid_intrwdc_output_byteszkbd_modstatewsdisplay_closescreenieee80211_media_statusiophy_capmap_set_pt_cache_modemichael_keytcp_usrreqdb_playssd_interpret_senseudp_usrreqifmedia_initext2fs_vfsopsext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilterne_pcmcia_disablefifo_pathconfcpu_startupwsemul_vt100_output_dcs_dollaramap_reffilt_fifordetachdb_command_loopwdc_ioctlamphyattachapm_suspendsfilt_fiforeadfdexpandtickssrandomwdc_ata_presentmsdosfs_closeext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrurl_setmultiusbd_get_device_descwdc_default_write_raw_multi_2uvm_pagedeactivatevop_write_vp_offsetsearly_clkmanufs_unlockmainbus_bs_r_2tcp_ctloutputpxa2x0_turbo_modemono_timeukphy_statusMD5Updateblktochrvop_create_descifmedia_setpcmcia_function_initpmap_createuvm_map_extractnd6_prelist_addufs_removeboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputunpst_sendspacewsemul_vt100_output_escieee80211_add_ratesrasops8_makestamppxapcic_mem_maptcp_rscalettwakeupuvmspace_freeext2fs_inode_poolswbufffs_ino_poolpmap_pageidlezeromii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsVOP_PRINTfdsharebuficmpv6ctl_varsinverse_regioncdstartfilt_generic_readwriteuserconf_disablespechash_slockusb_detachipforward_rtdb_elf_forallohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimoderasops_lmaskdb_set_temp_breakpointdb_buf_print_cmdsys_nosysat_pollallproccdevswxscale_cache_flushDne2000_attachsys_mlockallgallant12x22wskbdcloseuvm_sysctlpxaudc_powerstatintrgetsn_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolpxa2x0_pi2c_readrt_timer_countvfs_buf_printpowerhook_disestablishzssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putohci_device_bulk_abortudav_caip6_ecn_egressin_canforwardrasops_unpack_attrremove_selectionwsdisplay_shutdownhookpxa2x0_bs_subregionohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyscsi_mode_selectkernel_pt_listpowerhook_listetherbroadcastaddrieee80211_rssadapt_updatestatsrasops4_makestampvfs_getnewfsidaue_rxeofudp6_ctlinputitimerroundarm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrrtioctlkue_ctlieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputicsphy_cdwi_usb_cmdresppagemovegeneric_armv4_bs_rm_2route_srcspeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_cauhid_activateufsvnode_filtopsscoop_pcic_set_powerreadbuffersuvm_fault_unwireuserconf_common_attr_valext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartetherip_inputcpu_configureip6_freemoptionssqphy_funcsieee80211_amrr_chooseieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchpool_page_alloc_oldnointrwsfont_rotate_internalpmap_fault_fixuprn_refinesgeneric_bs_rm_4sockargswsdisplay_getactivescreenvop_generic_abortopsetregsupl_rxeofusbread_filtopssobindvmcmd_map_zerodb_read_charzkbd_pollpxagpio_intr1vfsinitupl_cacnclosedb_tok_numbersddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutipqmaxlenext2fs_vptofhip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectmsdosfs_reallocblksvop_readlink_vp_offsetswi_pcmcia_cadequeue_randomnesscue_casyncer_maxdelaywsdisplay_getscreendeadprocstart_reaperuvmspace_unsharesys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createuvm_map_cleanicmp_redirtimeoutttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctldisk_resetstaticmp6_nodeinfomaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheural_write_multicpu_initclockscue_sendwskbdioctlmii_downrn_mpath_hashkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miiwsdisplay_switch3ttyoutdevice_lookupuvm_map_pDebuggerwdc_pcmcia_prwi_usb_txeofcdminphysnumcleanpagesschedhzurlphy_carip6_inputuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baselooutputtasklistcue_setmultisoisdisconnectedcpu_coredumppxa2x0_bs_barrierxscale_cache_clean_addrrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitclrbitsdb_boot_dump_cmdxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetscsidebug_levelgeneric_armv4_bs_r_2pxaic_basesocloseinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcrd_sleep_pridb_leohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8vop_read_descswitch_exitboard_startupcluster_newbufsys_socketpaircnreadudp6_sendspacedounmountuvm_swap_allockthread_create_nowwskbd_pickfreekbd_resettcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizepool_cache_destroyttspeedtabkqueue_readcd9660_mountuserconf_maxdevcue_initfork_tfmratelxtphymatchpv_sizensgphymatchzkbdhalttvwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevpxaudc_matchupl_inputvop_advlock_vp_offsetsumass_cageneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthif_attachdomain1ieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printdb_machine_commands_installieee80211_state_namesys_preadne_pcmcia_activatewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachaxe_startsoqinsquediskstatscdce_attachavail_endudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrufs_readdirgeneric_softclocksys_flockarc4random_initializedpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdxscale_controlcd9660_quotactlicmp_sendcdce_watchdogpxagpio_intrNvop_bwrite_vp_offsetswdc_ata_errtime_uptimefilt_uhidreadsowakeupinsidepxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4db_putstringprefetch_abort_entrymouse_copy_linesigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachttkqfilterm_tag_deletecd9660_ihashremip_fragmentusbd_endpoint_countsys_statfsrawin6pcbtablepmap_protectpool_cache_invalidatekprintfdevice_unrefrc4_keysetupscsi_startin_cksumvnode_poolvnode_free_listtcp_savetiuvm_pagereallocapm_battlowuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printit_endsogetopthid_report_sizearc4maybeinitdb_deletewatch_cmdwsemul_vt100_attacharp_intimerpollscandomaininitvflushbuftime_secondip6_forward_rtusbd_get_interfacewskbd_get_mapentryusbd_read_report_descsbcreatecontrolsys_mlockpxa2x0_maxspeeddvd_read_structvdevgonehtonsdb_show_callout_bucketkqueue_writesys_syncbucketieee80211_reset_scancominitmb_mapenodevffs_mountfsin_delayed_cksumin6_is_addr_deprecatedwsemul_vt100_edicmperrppslim_lastrtstatttvtimeoutabtstackspeclisthbdwriteversion_to_spcVOP_INACTIVEzkbd_cawsmux_do_closepte_l1_c_prototcp_syn_cachewsemul_vt100_translatehalteephy_cainphy_cawihap_sta_is_assockputcharbootargssys_getsiddb_trace_until_call_cmdwi_write_record_usbcue_csr_read_2rasops15_putchar8wdc_pcmcia_disk_device_interfacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollural_startrotatedfontssys_swapctlpxaohci_matchbd_reqpxa2x0_probe_sdrambs_notimpl_bs_rm_2rasops4_initin_selectsrcmsgscpu_exitzapm_batt_lifewsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamernd_rselusbd_nbusesfrag6_nfragsip6_log_timeeephy_statusinphy_statusrtalloc_mpathxscale_cache_purgeDdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnlid_suspendsbflushipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsysctl_intrcntaxe_tick_taskvn_readbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachwihap_sta_allocxscale_setupwsfont_locktcp_timer_funcsipqent_poolpxaip_attach_criticalbufq_default_addif_attachdomainicmp_ratelimitieee80211_rssadapt_raise_rateinvalhashuvm_km_page_initrttimer_poolieee80211_regdomain2flagax88190_mii_readregusbd_get_config_descpxa2x0_gpio_set_bitsosenddosetrlimitpxa2x0_pi2c_getvoltagern_initbufq_default_getloopattachusb_match_devicedp8390_watchdogural_rxratewdc_input_bytesdb_listwatch_cmdusbd_do_request_flags_pipeprocess_read_regschainlengthural_disable_rf_tunern_lookupuvm_map_reserveallocate_copybufferuserconf_show_attrsys_execvefdallocwsdisplayreadscsi_donechkvnlockhw_sysctldb_siftingdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitconsintrnumvnodescomreaduvm_pagefreeukbd_decodeext2fs_inode_allocwsdisplay_switch2scoop_check_mcrdb_examine_formatin6_pcbbindcluster_rbuildreapercoredumpfilt_kqueuemalloc_rounduppipe_readpxa2x0_bs_freeifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateusbd_find_idescpmap_cache_stateureadcaue_startufs_setattrieee80211com_headlogprimemhookdoclusterreadzapm_batt_voltsys_exitsbtryusb_desc_iter_nextm_applyxscale_maxspeedudav_startaxe_lock_miiwdc_exec_commandpxaohci_cadb_watchpoint_listwdcintrusb_seleventcd_playsys_clock_getresaxe_attachsyn_cache_insertnsgphy_funcsspec_bmapttystats_initne_cdncvhashpool_cache_destruct_objectnd6_umaxtriesohci_device_intr_donepcmcia_intr_stringnd6_debugmainbus_bs_r_4db_delete_temp_breakpointcpu_cpuspeedcpufunc_idget_random_bytesurl_csr_write_1esymfiqhandler_stackosreleaseVOP_RECLAIMwsmux_evsrc_set_display__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdogwihap_timeoutuserconf_changepxa2x0_lcd_new_screenmakefstypedb_paniccddkdriveruvm_anon_adduserconf_helpufs_advlockicmp_initmouse_movereluvm_growvfinddevif_detached_initdopowerhooksapm_handle_eventether_delmultivfs_op_initdb_history_currmainbusattachrn_mpath_initheadexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleaniophy_servicerasops8_putchar16cd_getvolsplassert_ctlsys_getresuidsys_fhopenzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsys_fchmodvop_strategy_descuvm_unmap_detachvop_islocked_descupl_initwskbd_srcopsuserconf_common_devvfs_mount_printpxa2x0_irq_handlerstartusbd_devinfoskip_spc_leftvn_isdisksys_selectscoop_charge_batterybadaddr_read_1vnode_free_list_slockzombprocdb_branch_takenlogreadrn_mpath_capabledead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixwsemul_vt100_resetext2fs_specop_pvfs_unregistervt100_setnrcselwakeupffs_reloaddb_set_watchpointscnwriteumass_bbb_get_max_lunzkbd_keymapdatadb_show_panic_cmduipc_usrreqnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodefilt_rndrdetachwsmouse_activatescsi_scsi_cmdrip6_usrreqin6mask96colddb_clear_watchpointsbutton_eventunp_scansbappendaddrbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactivene2000_detachsys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocrevarpinputcd_pausehashinitttstartumass_setup_transferrd_ioctl_kallocwdwriteipsec_keep_invaliduao_detach_lockedsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openkue_setworddb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullexphy_cdreadeplxtphy_resettcp_slowtimoamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsys_fhstatfself32_load_filesys_getpeernamepxapcic_io_mapdb_taken_bkptdb_eqnamescsi_strvisbpfwritedoingcachesys_getrusageapm_threadrasops_initmainbus_bs_mapaue_reset_pegasus_IInd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachttylclosemd_diskconfpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipewsdisplay_cfg_ioctlffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreedb_show_regs__wdccommand_intretherip_outputuvm_km_free_wakeuprootvnodeifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modify__one_cmpldi2wi_usb_rxeofcpufunc_nullopcd9660_ihashgetmii_phy_detach__muldi3wskbd_add_muxmbtypesdb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesamphy_capxaudc_attachbufinitinswskip_char_leftbootconfigscsi_quirk_patternsuserconf_lineslimit0lcd_set_backlightpxa2x0_pi2c_openuniqdosnamedb_recoverusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdwdc_pcmcia_activatebgetvppgrp_poolucred_poolxscale_cache_purgeD_rngarp_maxtriessensors_listpmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordufs_dirbadentryrasops4_erasecolslogioctlicsphy_funcsgeneric_bs_wr_1_bus_dmamap_load_uiostrlendb_machine_initrasops15_putcharvop_abortop_vp_offsetsfifo_kqfilterzkbd_enablewsfont_initkue_activatewsdisplayparampool_page_freewdactivatewsmouse_inputcopystrwdc_do_resetwdog_ctl_cb_argsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initproc_trampolinesys_rmdirdp8390_disablecd9660_vfsopsallocbufsocantsendmoreproc_zapvop_revoke_descpxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateether_inputuvm_vsunlocklockstatus_splraisequotaoffarpioctlpxa2x0_read_ccntffs_fifoop_pfs_posix_sysctlif_slowtimowd_shutdownudbtabledb_load_countwi_setdefwdcattachufs_printfatentrywi_update_statsusbd_printBCDntp_tick_accsys_statin_baddynamiclineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenbus_space_copy_4dp8390_ioctl__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0udp6_outputcn_devvpcom_activatewi_get_debugmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsets_bus_dmamap_load_rawffs_mountrootrd_cduvm_map_pageable_alldofilewriteipqdl10019_media_initpxa2x0_lcd_show_screenmsdosfs_strategytimeout_delural_media_changewsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufdisk_detachrusage_poolstrchrhid_clear_localscsi_sizemainbus_bs_barrierdb_deletegenericconfget_bootconf_optioniftovt_tabsysctl_int_lowertcp_backoffmainbus_bs_w_2sys_chrootwdc_ioctl_freeavail_startieee80211_rssadapt_lower_rateicmp6_redirtimeoutsoisconnectingmtx_init1wsdisplay_pollcvop_link_descaobj_pagerrasops4_putchar8zaurus_battery_c3000uvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2vop_link_vp_offsetsbpf_d_listsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapifmedia_delete_instanceurl_caudav_miibus_writeregacphymatchicmp6statdb_single_stepzssp_write_lz9jg18generic_bs_w_4wsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKsyn_cache_initieee80211_find_txnodevop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressether_ipmulticast_maxmouse_copy_extend_worduvm_init_limitsukphy_cdin_pcbconnectokaytocloneVOP_POLLVOP_IOCTLsafepripxapcic_io_unmapsys_rforkpxaohci_disablewdc_default_read_raw_multi_4uao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatepool_cache_putwi_usb_rxfrmsensor_task_threadsys_getpidnd6_defifindexipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatedb_print_sadb_elf_sym_numargsural_detachwsscrollbackdb_trapperukbd_cnpollcshmsegdvd_read_manufactundstackconfig_activate_childrenpxaip_printremrunqueuesoo_closetcp_recvspaceuvm_meteruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimnd6_lookupieee80211_cache_sizepager_map_wantedurl_openpipesukbd_countrylayoutzts_matchsys_getppidmii_anarVOP_READDIRdomainssys___sysctlarm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharpxauart_powerneedbufferwsemul_pickusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsuvm_rb_removeohci_root_intr_doneip6_multipathtickfixusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedatamichael_initipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesm_tag_unlinkohci_softintrbufhashmsdosfs_lookupspec_pathconfmountroothook_listhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptymotion_eventuserconf_cntmouse_zaxisext2fs_inode_freepxaip_capcmcia_ccr_writedb_find_variableapm_cdxscale_cache_clean_sizepxaintc_cdip6_rr_prunesbcompressmsf2lbapmap_free_l1nd6_outputcdevsw_lookuplogsoftcsys_adjtimeohci_device_clear_togglevop_kqfilter_vp_offsetswdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opennclruheadural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockuvmspace_sharert_timer_addieee80211_print_essidroute_usrreqdeextendpxapcic_event_threadrasops_erasecolstcp_dropicmpstatudpctl_varsm_prependvop_advlock_descwsemul_vt100_output_scs96_percentcd9660_pathconfax88190_stop_cardin_pcbrehashin_arpinputzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlunix2winfnwsfont_unlockreassignbufip_freemoptionsnetconieee80211_release_nodesohasoutofbandspec_vnoperatevop_ioctl_descddb_initbs_notimpl_bs_c_2nd6_dad_duplicatedfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4ether_crc32_beieee80211_add_ssidcpu_reset_addresspgfindvop_lock_descsoftint_pendingtcp_ackdrop_ppslim_lastrqinitloadfirmwarerasops_cmapcd9660_ihash_slockip4_inputtcp_inputsysctl_dumpentrydkcksumwsdisplay_cnattachnd6_gctimerurl_csr_write_2cd_switchiptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spaceusbd_get_endpoint_descriptorudp_ctlinputmii_detachudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdevice_refrd_root_imageffs_syncuvm_map_submapcnioctlufs_vinitpool_primensgphyattachpgrphashtblcomconsinitsddkdriversys_getpeereidifmedia_matchstatclockaue_activategetnewbufwi_read_data_usbdvd_read_physicalrw_enter_writeuvm_mlk_hintuserconf_argbufpxa2x0_lcd_consolem_tag_copydb_value_of_namepmap_l2ptp_ctordata_abort_entryhid_get_itemmsdosfs_getattrdb_find_breakpointm_devgetntp_tick_permanentwritedisklabelmsdosfs_printkernel_pmap_storewsemul_vt100_opsstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysmsdosfs_readdirdead_ebadfusbd_interface_countpxaudc_enablewddetachsoo_ioctlforkstatwi_card_identaue_miibus_writeregdl10019_mii_statchgicsphy_servicewi_send_packetin6mask64db_lbuf_startohci_rhsc_ablesoftclockupdate_modifierdb_breakpoints_insertedswdevtdisk_lockscoop_pcic_readsbwaitufs_reclaimsdwriteohci_device_intr_startxscale_minidata_clean_addrkernel_debuglcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2vmcmdset_extendural_cazapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsuhid_attachzkbd_matchufs_mknodsbinsertoobknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreewi_ioctlzts_disablelcd_attachieee80211_compute_durationpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintrtl80x9_init_cardsys_getpgrpukbd_ioctlwsemul_vt100_console_emuldatasonewconndb_fetch_regufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1cluster_readtcp_saveti6wdctimeoutwsemul_vt100_initnchrdevieee80211_merge_print_intvlundefinedinstructionaue_cdaf2rtafidxqsphy_cashmmaxpgs