ELFa( 4>4 (  66((>^^S_DO! "&@00Q_: 0/>\@/ XX@0 6QQO @@( @0 <  B00 R2Р -L e^0c^main() returnedl c   ),@@(LQ 0/p^!c - 0LP@pq`ic`VZ -LM`P@pR@D0D 00``C<6@ -LM`p@P 0 0 0 000  P@XP 0@TZX 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PGU@ PU*00 ,*00" 4 x0,\ \0@D P gp00 ] P 6 6 6 6 6 -4!L01 M, P@0 ~00eS4 Z0p , 0 Z 1!R,00 )  ,P,00  @0S0 0@` V |H0P$ 0lP, 0 04: 6 6 6 6 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `}pQP* 0 P(U:p p-QLM0@`  `}pQP* 0PXU:p p-QLM0@`  `}pQP* 0P\U:p p-QLM0@`  `}pQP* 0 P,U:p -QLM@'0 "f4f4 -QLM@ f4f4 -(L  -(L  0-" _  P0L @ 00hD p-LM@ P` 000PY YR` cUpp p-LMP@`V0 pdp0H@ 0S' 000K  c 0H@ 0?' p-LM@` P}?XP 0s UP(0Sp(00PS 0U 0 0 P0P 0UPp -LM0pS 0S 00 87 *0`%`K% [)0S ) %0K ~ 0@P&PK& [)0S ) &0K g0VS UR Z   Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU00000ݾI 6 p-LM@`ԾP>;p -2LM PR|2   Jh0S`2`h0 @0SL200l0S 2 2  EB^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ*00,0K,pK!0(@ *pK+KV 0< P202 202" (P2$00$0h0 ``A000P wQ^| 6  6j 60 f4ta p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@P`'@׽p 0-LPн@0hɽ p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L     (  6jf4p+5f4f4 0-L@LP 0( 0( 0h' -0LM@p 00 ` 00 PZpd3 <# R00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWa0++'0K 'K$0 Q0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PLa4p`V 4hV$0( 00$ 0  $00 $00 DPT$0 0$0m4>5g4g4g4,g4 S 00p000 d%`p 0 00  (000C0 g4g4h4 -LM0`10#0P8pKP@0 00 0000  0 0, 0 004 P;`0 0@ 0 0 @08 @0  @$ & ' Th4 -LM0p ` P_0ST  0 PE0 @ @00$00$0 00/A#bJii { i* t 0 P(0 0S  0 Ph ,000i? PGMb6 -LM0` @2c1RP,p 00 P 00 0 (0000  ~dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph,000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,`a\h4 M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K~ 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,>`ahh4 p-LMP0K`Pc @7_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@P(@T` %0ta p-LM @00P $0`0$0 @R 0$ 0 00  0 phη\ta -LM4@0S @440S -L M$X @R0  l0@ $@K hExh4h4 - L  -LM P@Eシ 0S@0 @yta -LM@p R000 hhˤ 0-LP_,0@T 0U @TS0ta -L MPP@`x 4K5 05KP4[S09009  ,<9s $Tml5%#K #K<KP5  [5\# P6K 00 Q0N@P%P5g 0l 0g0) 4 4 w4 N4 y*~ rᕫ09$0090|嬷3t$e 0+ 00&0)   0 0 00) 00) 0 00)  l0 0T0) 0<0) 0ۭ 0֭0) v 0ʭp 0ĭ0) 0彭0) 0ᶭ 0b㱭0) M 0ᥭG 0D埭0) 0,嘭0)  0ᑭ/ 0"㋭0)& 0ㄭ0)10 1@ \`00)09Ŵ1\09009Ť1Q101 P00)09t1 P09009T1 <10)H1@ Q@1}>8910) 2R $1R0) 0) < 090090 Q09 ;`ah j4j4j4j4%5h4+ D > F H B J N R V T Z L TX ċ p+5 %6` X_e< Na'(j) -0)8 L#8 $ɐ R2 d X\ -0)8 L#8 $ɐ R4 h X\ -LM09`0 5Rɖ R2 d 0X IR4 h 2Xxrɐ R2 d 0X 9R0 ` (ɖ 0R4 h  X2Xo_  9R" D ( ɖR@4 h 0XH(9$HT@ 0  `1ɖ R4 h :X41ɖ R2 d $1X1S0ɖ R4 h 0X"0ɖ R4 h 0X ɖR4 h 0X  ɖR4 h 0X\p -40Lɐ 0R ( \ -LLMT 0 `@6 0pR,6 R @PP  !1 01$0  1 U @$۲$ R 1 0 +10 ,( 0@  DP 8 4>  D0 tu$[Q>K  8K  *K  0 0D Pl00l0 # R간[>0S6[¸ D lK0 <0 < P  8 \.<00 0lK Nh < H bbbk48k4> hk4k4k4$l405;505t0p000t0p0 p-0LM`a <0@5K pJL0,0P@@<T  ph6h Dl4 -LMA0P 00K  00"[80 41R; R 3[pCX#smW$`0ɕ   20K!0ɕ R8 p (K#[0 R3K#[101pW0,0 80xL@H0[W= 0   h \, -8IL@DtpP ɗ (0  @DRtTeaɗ 8R  #8X IR8  #8X 0YR8  #8Xɗ 8#8 XA ɗR0 ` (0P@DtT8< 0  9R  (ɗ 0R4 h  X0X  8 \`l4l4 p-0L M PR`0 PEu @0@0 0S PEuU09009d`01K02K01K80 K p,p09PTh l4 0-0L PR 9$)$@ ɕ<<$)0T} ɕ@$)0T0hr0T -2L M @RP 2R 2R 200!P 80Plr9 R8 p (0 hVu 9R8 p (0 Pe`\0  R L8 p [l0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0AS0P

< #(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂ɖ R8 p 0X IR08 p X0\  R L8 p kP2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&:U?G  K5K0 Pp@W 0"K0C "K ST T $T (S ,T 4T L0,PK0K2KT \h !(T > #< 6S-L@p6 8S `,Pɔ0S8 #8X0ɔS8  #8X|Pt0ɔ R (0  PE⓴uU<  `\l4 p-LM@80PP`0 (  R8 p jp\ -LMPp60 P a 0?  R6 l j ɕR6 l 0X IR6 l 0X 60mP@ 9R6 l (P0 S 9R6 l ( 0 S\4xV -|1LMp00  @PHQJDaɔ R0 ` (0PEuU4 9R" D (  ɔR4 h 0X 60Po?PPl0ɔ R6 l 0XP?U<  h \l4 -LdM⌐Kd 108K0p8K05 -BTP @ 00`W 0S P Tp`@00X 8K0 5<5 d0 h p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@q @@0  1R 1R 1R111R 1R -11q /1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u p 0r D 0v 0 H L B F R N -%*T C> J V Z m4D  -LLM]p@\ ګ` 09h l  0` \0募P`ƫx=T (l=Td=T*\=T IP=T H=T h\ lQ  `填!P \ hP\1S p Nhh Ch ?0\ hP5 (=  0<T> (<T 2 = S! =@S <  8C84949  d< R ; 2KK"Kp<0K 49 < R `;2K03KK@ K 505\ 0S ;  x;  \oh啡Pi \ r \4P^5@Y \kd:T )X:T P:T;hnPB  嬗h \0*hKP' hA "\ 9. @RA\0S\$9T2 $9TCP: R,\09!  d)000?K2K 9"K 0K$9TP \" hP@ | Qth F\0d)hPh \ 8P* Y8PP  P  P I 0hP hP5 0 h0 &w7P7 Q7 P! 7R 7R 7R 7R 7R\09 } 09 y 09u 09@q 09m h7f7P 7P 66P h7Pp7 RR\7 R T7  h!87 @&0<hnPB6 R> 52: 6 R8  堖h h6)00 0 6  hP5K`@U` A0%0 ?A1c バბ :0 2c0x%`Q%08% @5Te85T]*05TV $$5T 5T \ h \ITh >h4,0@5  hP\0h 4T& 4Th (h \$hP5@ 4 R hQ P\ hd$0k. \0{ \ \ %3T 3Te *3Tr3 R{\09 u ߕh h <03 hPTh2 R \ 101K2TG5 2 R( 巕 h h2,02  hP,h0 S( !㟕!l hl  \ l! \q ! *hCP !さ\0l l! "Pl  Q10Slq@% q]P  @X`K@&@U@d1@5KEK A%K RK 5 0 lq@ FPl0  0T C0T&Xai2i 1i iii i i i i i i i i8-%C6q gfff 8171< ,Th D0Tq`ᣞPwh0 R  Tݔ\h 0h,0|0  R 0  hPNh0SK >\0 d  h00iZ@\0|S<:Vp h  pPf @|0 p0  p 0@R0S@00  %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p Px00x0\d | P\ 000hd0 |0 iZd0  |0R*V  |?`Bh0 W  0h20k \h ,'4h \0D#hPh0 Sh3 RM  R 3R 3  hh 3 ᳠ᴠh s $T ]h0+4R%  4R ᦝP hDr hD Dd4Rd4 R|Dh W 80h04h 峠0㴠0h0$0h0S00h 巓h h5,05  hPh0\0) 'צ 0-M0LM PcR  0 R 09AKA A 8 q0  00 \|0|@x0 Kp ̠0KPT0K  R<0< Ca!0TDm4h 6gfff -LQM09 `! 0zd 5@87য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK `7 0%K5K?5KTK 474'5K K%K\K  7 '6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK09 @texvPK@&@@qmT6@`@K KK;KK$ 0@T 5 R- 0S R' UAoK@@@&@@K  .@` 04@K3K0O 0K  4K84 R 5 pp4( K-K00QK3 09Fe%=PCP 0nK0  P+`!0()  P09`! ,)/dA5 @05%p3+%<a÷<0((3( K$S0BSKR/K00"2(K UK >K 0 2"r#00  2P 0S P W_KVoK l2 0d0`2(K!0p<2<"Q1 "W_K(KVoK01( KOKN/K00 0JPK&@y@,1@K@ =KMKK 0`10K8KKK 0010!8K 0(K8K 0K09|10/K7K'K 0|K09lB h > J D H F N R NoL -: 6dm4m4 TT *X!Z -V  -LGMA0Sp!, 000Y 1 Rx10 S<0K 8K 18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9 0K 5K >N0 B@$[H4[Q04KD 0  0000 <  N@ B0 DPp 0 P0 0C0 0 c0 R 0 R 5[ n4h @n4\n4 -LHM`09@hKp PD, ZK ,I>0ED 3K  %K#[ 0"K 0E00< 0PH 0S( h n4 p-LM@0P09 `<p鏴%=000` 5e=5h 0-@LP,` 0 t00t00n4h -LM8@@ 09 $00 Rh` %6 -L\M4@KP F03K2K [ R 0 S  R R2  2  | pb0S  \23K@2K 2[[3K2[K3K  2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@["[2[ ! 1QQd@K&0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0h 3Tn4 XQhn4%5n4 o4v'N$ -LM9`P(0Bp S?Њ 0H S$ | d |  000NP@(>P ᗙl0l 㳀pT0 R   > H J p-LM@!0! 1P` 1 R x1  , RT BRP1   R p41 00S ꜌  , 8 0 8 0 \ 0 dp0 ^0 V0 t0 h0 \0  R  R40  R09 0 0 > J H Th 0-MLM@P800000|1 R9  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽0 @ L X 000000000H > h D -ML M09BKI0 I| 000CSur  D 0T p0S^XPpڴ8! #  1  P`C |P`=04H8( K81BNK0!@@D(0K 1  P`# \P`8 0(K 0$!  0  P`   CP` 8L0  @ T ^P`@ h p-LM09r̀@ ( 0 P `  000L 0S`V@PpR 0 SP pppXa -<0(,0L0 N R h 0 0  N R p-QLMPC  R09`:09 09-:09`000 0P@ V p-0S`+s է 00b=C4`#ht0  1> 0P@8p-0 $09 `ph 8Do4 0-LM09@+P"0 00> Ph0ɔ R  ( P 0,0B=C109 0000-0h \ R-L , 0 0C SEЕ   H p | 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40B D F H J L N P R T V X Z \ 0-LM0@PShꄗ x Ę Ę Ę Ę ȗ З ؗ Ę  $ Ę Ę ̘ h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @PB h D F H J L N P R T V X Z \ p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L 00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 妱0`aXo4 0-8uMLP @Xt0 R 0s? X0  @0p  R0Z0x0 20h $> `, do4 -8Nn(P኏L@`p""`0     밠 %ro4 -8Nn(P኏L@`p"`0  X  T P밠 Co4 -LM8up {s/000, ⾮`V( ⹮8c@0S91!@P@dDFA 02 S&h1b1 R0``00`֛Y `009,o˛@ R }2c@TZ! @ @dP峛DFA@04 Sʄ1d|A R@0 @000@0 @ᘛ@,<  7~a aaD96o4o4 -LMu]} P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  oIխ00 1+ 8`  1R010000 0 !0*0!00 0@@" ੭`> 8` 101! R00:` 6o4(p4 p-LM0@u] PR0000 0` !*!0S00@@@P2 phʚ0 CaR6gfff -LMC0ID`u}@Ds pD20u? @$ R00000   R 0 0 0 @0S(("@P唚@dDFA@04 S1d1 R0``00`|10C1܇ꔀ匠@@dPnDFA@04 Sʄ1dXA R@0 @000@0 @ S@㶇 aaa -LMp0! 1?2c!c2c8p@umP0 `P0L +UF D @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101  LtH0– sD 㦆P~Ha| 6-0  t0 a1a2cP  0Q P 0S!0S~H -SLMu]` 0 P ʴ8ďE0N0  0A 0  pK0K@K @y0 SK 0K@oPZ Pp 3• P P; (3 p,^P3   O}  y u. 0Z $ Ӳpڨ K0 KS&  (2 R RF R (pZ (p@\ 0  @K!1@RTں1H"01@<2P @dDFA@04 Sʄ1dA R@0 @000@0 @0@0(p}@@@0S @G@00K@Tڴ( To(@AP0S@000 ᵘ@0S  w@0 R~Q1ᴠ01(s? ( p9!0R ʴ8 㐘 @?pመW(p$X- ᥎ 08$Xp46p4p4T a aap4ap4q4 -LDM`uMS, P` d0 @+ھ00 S0 Lh `0 d dpK [K!`K 0>P\K`K  80K3Pp 8\0[ R 82 ,0S ,%q͆ 0\[ q P:PP 1 8K cPrh  p0S#< 8 /N@1Ά _`    `0h `K `0`0 p` 0`0 1岐`00`0 p& hp8 <j01 R' h0 h  0S !ᴓ 8 0 12 28pJ!8 8 h 8pp28⪍X+IRO0 B`0 d )`aNHq4Xq4q4X q46q4r4@r4tr4r4 0-S@Pu L 0P 8 {0r4 0-S@Pu L 0lP 1 08 X0r4 -8L`@P80  Pp@K "Pp㭕P@ 1  T  1PpĀK PpㄕP@p !P3R pô%+[03!"@ 3Qk a:3Qsp^@TP 0|S:?0 K| K~ Kz 2&K0 6K34K3U K#4V0K3f K4K:00 f0Ke K:0 f0[h K0  f0K:0 f0[h K0  f0K:0 f0[h K0  f0KK| PpL0|P00@TE  |0R*@s?K p{Pp K `Pps =[ 0 K QPp10 ڔ@TP! 0S:`K 3HQ@Q Np 0p0 R, 0 0 H0S H00 lK H @TP0 @TT000 T0   0T0Hp0ۗH`a06u4 N -LM@p0  0p0  p-L M@0pPt`x0p0t0880V @U 0@@鞴p\5%5\u4 -PLM@D 0R@ 8p݈P堀`U UJ +<W0  p0 oĈ0 0& ἈU*嬠`0 x p0 0RTp0x 00 h `P"U:@0a'0400 TL6@(66 -L M`84PP㈠ $8 ,    $g  $@\  p $0  ,pZ@;0  , 0-  , p0 0p0| R,0H, h0@"20S  $ 0  `0`S  0Th0!20, h0!,2P0 000 Tlp @0 0SA 0  $ 0@.0T:x t0 0Rt0x  $@l0Tab0T, 0 0 000 TD0 R 4000 0pp0 岇@(66&6 -LP `᥇0piP $  $ @$ቇ@ 0Tua -LMP`pv}N $0 @T ,P80 T00 0 }N $0 @T  P|@ m; $0@@T ҍ 0T 0Tua N -LMP `p@ 0Tc@0DD @T0 T 0T 0T @0T0 T $iۆ p-L M0 K `0  PP pX@ T \0\@PU HPH0 0Q S00 4 0ua\o^ua\^p p-LMt`t0lP P0P@HH D0 0S0b$0@puauauaua D6uau4 -LM℠Pp@0 `V 0 =8808 40P( (0pual6auauauaH6 0 uaua0 0 uaua(0 R 0 Ruaua 0-@L "04 00P0 T0h -0删S@04p@@00  LT5 Qb  $  0P T  0T0  T 0Td~ R$ R  0 T R R<\ $ , H h         p b0 S0 00 0 T  $0@  T@0  T0@ ,0Tğ$00 S Q0Q3 r &T <  0Pl 8S080m80$04 40\XTLQ00000( Q 00 0@ 00 ~ݱ0 002  R m0 00̱  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0#0  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 70 @0 0 lduau4\o^p \^au4 t u4u4v4 v40P`*@G S : R#: , Jc0 ፰@`p`B0 Xp0C$ 0P8 R <0 ,4 0 mP@ 0P0NPP`  0 0B@$B -LMxPW$`K 0P@)㵂p$ ,0#  0@0(0(?^ H᠂㟂H 0p8ʬ040 0ᎂ p-LMP@Ⴢ`8 0Hphx -LMp, h— lp2  h2l ,* B: @P0  TU  0\20\2 0``V $0Z0``V &0Z>❟ ($8 0/P@ t2 |,\[03iP @ 090_P @ 090UP@ 0`90K0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`h—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\dQhBlp2 P h—l 0\` Շh—lp2  h2l ,` Vȭ @`1`>V| ]h—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\FhBlp2  h—lH 40\hBlp2  h—l80L \40##` Ph—lp2 P h2lH ,` V P x1@Tp!0040`THPHN0L8 sh—lp2 P hR3l1 \倬hBlp2  h—l ,0\dhhBlp2 ` h—l 1\`VJA`V@DZ@ȉ5w4%50w4Dw46dw4@%I$6t!%6xw40  -LM HTe | H0S 8$T| 㲩El@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPpUUU U mKteh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2-00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\hBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\4hBlp2 ` h—0H l\2" 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 RQ^= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 $(N@g,x p1@`X hB lp2  h•l 0\ }`\80\8mP`\(0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pLw4!6w4x4x4 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L|(PM0h| -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p4x4 -LMT2p0T2|0H0,08,8|T $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT2003 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0.|`(|0S R000R0 A60S!0\@PƎ R 00c0C20000#2w{`{$0S` 4 00hB lp2  h—0l \Z0 00{`j{J@s$0S  -LM`@(0 S4p8P!P 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@㏥ T 0 0 mTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P/0 QhBlp2 h2 l,3 `VZ00h/0S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`EP, @ ?P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0i,0P @, k4040<0<@   ũ140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $pez08 08hBlp2`  h˜0l \0S 0 R FzP@` njX0 P0 ,!Ì ,(0=T&!6Mb0 0  Q-L 0S S 0SQ 0 0 l\x4-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@&! 0-L@yP0hy -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y (!(!(!(!0!<00  CP Ey@>y00S  X 000o{000'y, 0r00  o+ RP 80(S"ˠ ʠ0S80 S0000  6T6<6$666 -LM04p@Px`x0 0004iP -LM@P0p14 RP80 TrWL1 R@,x`P~x090 x0 `  0 pUxxL0$ `Rp 0909 ox0 #>WS @ $0S Z002~x`P8Xaxx4x4 p-QLM@`Pp1T 00 @DRT0  0 @DRTʃ0p -LM@d P 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳.!,/! -! -! -! -! -!h/! -! -! -! -! -! -! -!/!/!0!X0!0!hB lp2  h—l 0\0ISh— lp2  h2l , }hB lp2  h—l 0hB lp2  h—l 08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0WP`$ @ 0A,(0"A 0 P `4@  D 00ps(04 0,08`090or0  o靟x40 0P  -LMP@0r0pSS 004`090LP40S rrpd0( 90 ir P40S ri\ y4 - 0p`L<0@@prP4zr 0-0L@P80h -`V`V` pP0UL`p` B_@7d 0^0S APP U h_6uaua4y4a8"E! -L M@ 0@.a8"E! -LMD0P#((0"tP1'ATN \0SKȀ<`(MP 04000@`;00q@yiq0S 0P*0SSS <`00$0P$0S iS,0 0<0>40 8 dpp 88#0 p^\y4hy4WEVE! 0-D0P @L 0uP 0000P0@H6 -LM0s@S* 00 0000 -LMq`PU @ 0@(~P6PU $00<0$0@X0 P:00 dp@^p004;0000 `\ @1@!0 H ἒP@00d@0 H 06ty4 p-LMPK@` i10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$:  -T LM@HT00  (0R 66Ԁa|y4 006 -Lp`P7@T@ hx R(( `@ pp00 y4y46 -l`L@PTp P 0S `@T$hO0T0 h6y4 p-T0LM@PT` P 0S @Tpp6 -LM@h 0-pPL0S`0@T P@T00020#J66 0-XPL0S H0@T P@T000 .66 p-LMP60@`TL  (`0#pțpy4 -LM@ h- -LMx@0Slh鮛d嬛@T BLP0 @@ 0 ,噛@T6y4y4؉4/5y4#p+5 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0Q@H60@H6 -L[ P00@-SP@  0P PR  0S0P 0P 0 -LM@Q+  0Sz4 -LM$0p@$0  P`y Pq P  $0S $oT` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K `a4z4aa܀a6؀aԀaz4,z4 0S; 0S8 Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00 0c0c0 0QWuꐐaaa46<686a06a}4a -P@L@PpP`P0P @D@PPP P  000c阐aaaa -8@LMxP00  0@aaa0 00aaa8 04S00 0 0S405@6aa0@60D6 -$ L0S 00 D6 -L 000D6@6 -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U@t T_P Q:P00\P0S0p P@$0?Sbhz!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!pz!xz!z!z!z!z!z!z!z!z!`z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!z!{! {!({!    .P@ -,:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P預aaa}4}4}4`6a}4 -LM||`P0Ulp@Ñ0T UPe > PUP0U00 3 PP6H6T6 0-@PLP % 0S cP  P h 00C0\@P  0SU00hz0 qPP ~4L6~4 0-H1L0@S4!0CQF!0D]S& T T T T 00h 00000P@Q00 0 0 0n p@x0 0 S 0CRL000 (00  yX6L6H6T6P6\60H6 0 0 lQ \6H6p+5 -LMS@ \00S SL L0L L0P 0^0?l 08 0`6<~4D~4L~4T~4\~4d~4 p-LMP@PLU` phޏ8`ۏ0 ,$0ҏPp ^l~4~4#%5}4 -L MP@0T(*$K(pK,`K$$0 夏 $f , @Q h0( \$0T\ (0DS<剏0T:,0H遏dO^\N^~46~4~4p+5 c -PL`pHpAP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 t4 S 1!0S 2!8S  a1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@,1@@DT$@D T_  00CS0 00CS0ڸ0 RE00  0 00Sv h00S 0So P00S 0Sh Hpfꨑaaaa~45p+5a~4h6d6 -LMp0@SSHP S 0S iX 0  uP{i  T`0 Q00 28 6S Q 000ꨑaa 0S00lꨑaP0pQr  8 80, ,0 0᠑aaaaaaaD0<08 pQ(0 0ᨑaaaaaa-L0H D0pQ, ,0 0䨑aaaaaaa 80cR   (0 0 0ᨑaaaaa p-LMHP@ * D T h0\ `` T` T0V D0\ P00pP 0d6h6 0-@@L08PS0S00000h6d6 - 0L@TT xP\ lp`bXd0 4P 0S<00h鳍p h鬍0c66a~4~4{4 0-\L@P 2S P(偍0P2 00l64 p-LM`P`@2S@T<phd)PT0"2 000pl6(4 -LM@ K;40S0:00A0 R0  ^ p-LM`@PP  0S  pP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$ꠋPl6aT4 -LMP`@V 0FS \o鿌P o麌p0S  S(Pp4t4 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP郌 xW0`p0@2S @T:0T0 P0(j.Pl6|4\!T4 -0LM pR K >TP@`2S@PT P Wp 6l6 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5광al6 -PLPM`\p 0K@  0SV 000鴑a -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (%tl RW xK| K0P x| P@hK0@@ 6`a6D5444 0-LM(P@ 0@?0鴑a-00 C광a -L\ 鸑a - 0L0S 鸑a -L\   鸑a -L\긑a -LM$@T鸑a -L\ 鸑a -0L0S긑a -L@PMK!P 0Q0SH 0 U0 RX7PTPH@<<0 4 ca44ada44p+5`4aax4 p-LM`P pP@0T:tPt@0T*d傉P 0 @T:@p0uP 0 @T:Ā466dO^\N^a -LM@KP -LM KPK -0 SL 0  -L \   00 -L MbPh^KP Z PT@K_P RP,NHEĀ44؀4R0 0 0  -T LM@HT 00  (0R !$6 6a4 0 0$6 P-PL` @T pP 0S @TP@ 0P0`0 000 $m0S4(664y4 -p`L@PTp \P 0S0W: ` @Thʼn 00h(6y4 0-LMl@0S`0h鳉X屉PU G@P@D ,, @塉 PU0(6 444؉4/5P4 -LM@.h 0-LMPKP@@$ h0 0-pPL0S`00S @.0 . 0' @T0)0006(60 6 -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@(66 -LM0PhS` /S+ bS` `$pK 0S /@x $ h$ @PX @ @0f0P,`lSd4#t4؀a܀a4 p-L MQP@D00CS |!!!!!,!X!0 bp-p0 R 0bp`0K0,0 bPU 0S0pD0 R< 0(`$p`6\6X6T6a&6&6,6 -40LM @R ig cQ^ 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@@a@0a S_R@ zTh43344 -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 ԇV@xq f0PS`LK0 PBTU@P !0001 ,0S ,p$pX T KT@ |T0cP T K0T0 q0X P=U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQ`aaa4l64Н! -LMtpP ` PXu  0S %D@ @0  aa\^ -LMP@0`p 0PS$ K$P $UP0 %D@@@0 Œ0300aa\^ -L0L0P 800P 0$0Œ006a\^ -P0LPl<00P  Ġ 0 2 006a\^ 0-LM^P@ Plx0P 40`0Œ000,@0S PP000bt06a\^,0,P 0S0座06a -d0LPlP0P  404 02(,06a\^ -$0L0Sa 0-HPL0@S P0 T 0 a 0-`0L @R LP0@0C000PS T0000a46 -@0LM\0 @T a -1LM1\@pP >P  ?FP`^ 0!\ P?@0H0  0lKD h0 l` @P P@0\ K0@P@?\80S @V F 0 SR@ FP @\ 0K0 K@0 | x t pP \0K)P0@\0 |F\ 逰aXa4 -LM!N, ,0Q !0Q!hR̪!! -LMr@W41R2p U8`40< ?㳀-Π@4/00 000E ?PPZ( 0 S0 0|0 0t0 5@ N\`{CN U? ? x!!!T!"ԁ4 -L3S -0L"R"0 0 3S 0-L@xXPG0hoX -LMPRTr@` @0 /0`"0T@ 0X@ |"$0@T ^2S -LM@  000hn4 - $ML0Pb8,0 0T53 /003 @  0@ /0`"0 T  0@ 3   0""H0T" 0T" 0T #0 " 0T0" T2SB0l" T0d" T/0h" T" 0T@|" 0T @ 0 /0`"A0 T @ 0 P|@d"0 PTU@4pK P@"0 PTU@ڐ!0@000|" T  0@ 0`"0 T  0@ 1   PP"0 T0" T2S  0@ 0`"0 T% @ %5;5H0 ,0S P,+l" 0TJ`a4 -LM5=@S 2/0Q @T 0S1000! B!1 <P? š2 \$s  Pv0<U!<30 =⮏1 ("P  Q !PB0TR0 =`p0 pc 0`"0T 0p 1- 0 0p"0T&8t"0&lTx"0T 0p 0`"0Tl 00("QT 0 80k  :{5;5Ё4 -L MPbT@P  0P 0`"B0 T0  P |" $1 )Rq  0P 0`"0 T P 0 p1p!”0"c\TM , K 4+[0[^0'0c "*1/0a0` 0 A S0AĀ \!p0^:0^* L("(P+ [ 00C0Q0ԇl"0C0 T0)S{ 0< ↁ000S, K4 -L MPrPT8`@  0@_ 0`"0 T  0@ |" $  0|" T40  |"$ 0 |"T|"  0T  L3 RK Al00l02S7 Q0 0 0 0`"0 T  0  |" $" $" $" $l00l0t" $@s p" $ T@t00t0x 5 x ; %500C(0 PB0TR0 =0à ,  0`"0T  0  1- 0 0p"0T,!8t"0T,! @40L000  p:#04 0qcp=@0 O0BXP 0 ] u /(0  *O@a(aP6L6`a a -!LM 0,0  0SX Kq O*@K| xR0 Rd% 1CX!50#0%050  c N<KK8[7 [ 6[ 5 [;[ .[<0[ - [,1[9@[0[0#2[  !:[/[娐 3p[4`[ @$" <0K0.!P" <K80K;K:K9@K7K6K5PK}{`G 0Q KXyy<Kvy,0 S ,c`aLa@a4 0-LPQ 0Ha -LM0pS@, `N밂PP00 N0S! $@4@ 8 4 8@ S1#$4S;!x!0!@!!`V00Y00S'V0S1!@PWN @dDFA 02 Sp1b1 R000?N ;   O``X0S,0 #`818`(!@0P`A00 `0@ @[P`0@0 X X0/"?CQPEu }~H{~ @APEuPZ @~*\T:y  :Yaa aa@aa 4Pa - 8LM8A#4@ S @0 R@aa 0-1Ls@LP sDP@0 08040 <0M00@M0XaaT6@ad6 -LM@ MH 0S00  Q0 0 0S00hMa< 0 0P -LM@ qMH 0S00  Q0 0 0S00h\MXa - XX%$00R0LMSp_0S CMd@P0`0J 8M0S(%4SZ(1   1 !@P*M@dDFA 02 Sp1b1 R0``00`M t: S:#8#H NP 08#H$gZ0S  9`aaa aa -LM`P&(@l1pUR 8\1U& P1U p(GCP p L 1pL1U7CP L@lw*CP0 ?R#p L0p0U :00SCP @L< 00 S090 L0 R@R R @aR @aaR -0 `R 0P0pLWt    H|Pl0U vj@8PS(00P B  -LdM 0l  h PD0 Fx@ `@ p` ht 00 0l@8 `0<` @@ D@P H X T   8@T0$  lP00CSQ8hl P@l@`lX1` Sd \  0=S3 p0@@S@<P@ lPT1@ Rd 0@ 0S 48 l0R ,Y40ST D0T 0R, 00000 R=Q@ RL 00a =0T3 RPL P0O 0X! T0 3R8 l0SL ̀ L,KH00¼0@L @dP<DFA 02 Sʤ1b1 R0L L L00<dL!*8 l0S z)L V6aa aa -LM< Q0  @K/P00zfE -PL0@ Qp`:@#R D3S`D3@#0CD30  >P?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00Pkp?` `! P2 BPgP  -LDM4 0 0 0480 H  pD ;tVH0@L0 PP0 00 ;D6<&<60s4@0S@3 0#2A TL0 dTZ TU%T80BPP; `RP 00B ;PP@SL`Dcp`'P @T T  T  T T T|  Tt  TTd T\ T 'k,aaa aah5aadaaDaa$a -LM`PX1SS0 C10 $@K @P@A$ H 00S@ 60S; _` K0P! $Һ0S [ ;@'`0 S:![00b0![000![00b00S < `$媺0  R*0 S`%* b -LM@ \ -LM@ P  @$ @ $ -L M@`d80p0CS?XP0XPPP p | 0 D0409PG9 0R 0 PXpH<3dX@004;00i9P$c9d(36@4 - LfX40@o$00CS|("\("\(",("d("p("|("|("0 X1S  0%00 ; < 0p@-P`Q@1!2n1[/73n1Q1Q0[/ Q@& 22a11U3a11U0S@0S` C0Q@ 0 0@C!0"b12cp0 Q|3 -L4MPK@p0 h!!0CXa00/A!b2c2c!babSD[0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  \*!l0!X0  @00@04 00,00S0c,00,i0CE"E"$G" p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P10b4 ,0S p,K0 0PPT0$ 0 0PP`@K 40PPoP  KPPC[B Z#D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ CP!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS04"5"5"5"5"5"ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X C#ܡ  vCP P_CpH0!>0kK1 ̑  c. . j?K!#[ ̑ -`at4 -L,M 0 D 0 ) K3S`@  gP1D RBBV"p  0@tP@01 1PP"0PS@ U3 410  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%8"9"9"9"0:"d:"8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R Z!"Z@@@ )K@\0 S*dYD   D0P@( ) K P  646 b -LLM@Q@D1U d0 ` 8d0K00pW !Z-Pp@ `K !Z0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 ,Wp b0S -L MBpBP ,0  ` 0@ P@"@2V*0S @T:@W p!m! 0 PP: p  0P@0 S 0R , ^P -L$M (14 D @H `p 0S$ b P 0 @S@R*0 S  R:R*0@ S S8  Q Q 0S< 4 # S S 40040 0S S SQ 00 Q Q Q Q Q @ 08S8 0!0;L0  H  0 0C0  L0 0Q0 R0S .,K P0 (1, 0(100,0@, $,0, (00(0,,00C,0,(0<0  (1B0(133 PR00 4 @'3?  P< c@0S 8?@ @ Pc? (10w+P3X00 0q0 P0D4!(10(1 DY(1! 0(1,L0 001H  L0 100 0(10(19 00(1 0,4XZ P% P ?& 0S0 @P2 @dDFA 02 Sp1b1 R0002>0 ?0 0G01H Px_?PX, 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp$G" -`5`LDMCH~ HH]i3L~댋G!%/~w, ş0 0S 0 0@ 0 `8 R08 P<0K < D0娔0S0 0$@`D0x4 ,0l4 1 1`4 l`X ` _D GC< CCP@O' 0PG,4 $0Q- 0:N0`V000#3@p@A Q-@Q0@0P K3PK@cFF_Pp00 0Z[PP@`0*`144,`G(3 >0H! Co!F|V2Y0S P0SS0@HPK뚉K0 i"@11@T|GExŸ0 @@ @P@H@0S P0 $"@=0S220SXPa $09$00 PP 00!A@0q0@0D0 P 0 @00@0 0X! P Z 0000Zs_1 XP_0 PPW0 H>Xaܲa34aDaaaf1 -@ LHM0, X 00 TK0P0 T ( P0 S$ [[D鄅444 -Lp 0 08pp`aK0 90 0-p p (("\ -LMŸ@,p \`P 3 R \0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 Vh1 211 21 Xa p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PG, (@0P@G0&64Զa4a -4 L014 s$ 08000l$640$ 0S00 Q0 0 0S0040$ Q  p-LMPP` 0@ 0\ P 14` 01! 0 00 10Q p,0  Xa(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`PU0  0 00 0G@M 0P@$@$  00S0P `(00(0 ,00C,0 (0,01ԶaP$6 -L$M`8 ,P 0S ,00,0P^P$< B @ P !!@4 EPP?4p P" @0 :0GPUp  0<S< ' 90 P lE 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0, 10@K DPP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 "80` P (00(0* !  (0  (0W  , !(0` R0(0 ! !(00(0! FPP( W`4p8 ,0( 0C,00p,0 0 p p00gP,   ,Z0 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S $6a -LlM Q$P  S& 4 P,/A#bl p p@K \0 0  % 3Pjp X4R P$002c2c30 xKS t0p $x0P 0p 0 =9@ =C  0p !p\`YQ# 0#00F0.!YAp0Sl0S x@Kxp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30 z Z0  h0  !! Cl t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 1G 0`01 ' 0 (0 0(0 00C0ZHs  " ]C l Yp ` 00 0 @(  ( 00C0R 800 F H p80 P(00(0  B 6  X, Z ⌐ p l MbQ6?B4 -LM0@$P` A@p 0 S  `000 p-LMP$`pJ08O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:lE,0$80HEP4,00,08  4? EPԶaa -LM0@  t h j` 5.0 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT  0 P!4WN0`I4P 0@4P40Q000p(0{ 8\ 0< #4# 0Q80 @E!8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40hE40,  , 4t꘷a 0-@L P00  0@(00(0   0h 0-@L P R 0 0 00  0 (  ( 00C00hP(0 0 (0!P -L$M`"0$0( P4P@8pW@ W @4LD0  0MP@T0$0!0@;00 0*P@1 I 0  0P@ 0  @p ,KP@., 0@0b 0(1 Y#q0S  p( 0TYT$1 !S@#@3R 1$ R: 0S* @T  0 4`DP418 (1TP#2@0T00S D b66 -LM,06KL ,0D P0H" ? p1 1 Q Q Q 匡 0<˟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Pp*B#H0P `: D@P R   R? 0`SDd:d*@P@dDFA@04 Sp0 1d1 R D0D0D00D  dH00H0 D2PUp H0#KPP@f7  42 ?Pp?KP 0"RX 4"uBP42p` ?WpWKH0C0Q=8QL" 0p TC8P'!l? ,06,08(@P@dDFA@04 S`ʐ1d1 R 808 08  008  8_ 8C0@ H0 D"0PT2 U 7  42 S?Pp?KP0"R T" T" 4"BP42p`P2@f G0 `R T< 0 P"0100b0P 0S42 pw !P0 #4h0 P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00XPp;42OKcT2( 2 K P2<$P, = l?P& x q -|1KS0# 42 K42  0K? Pp fp@00@0, p0) 1, V  RD ,07,02 ,0<,00  0  ,0bD%P' @`BL"p 0Fz F<,0S KP:< H2 K( <P.,0 '?lw 1S H R < S <H0 3  @0S@0[30@0S,06,0K < l?K  ,06,0 @.0 00000 0  0\~ Pl ,0@7<,0Lc2` 0" 2 0 " 082 0S/KK 82 3[VPpH: KPpD 0s@ 8Pp#H@"D00D082帀8"82<@"82$ 8(00(08",00C,08(0,`VŻ*<> 8@!R0Q68Q qAL"p 0T'PT@1@!@P@d6DFA@04 S` 1d1 R 808 08  008  8~>A< 80R 0R0R,070H,0)ꪱ00C +?DU8ad6Q^a aa b$6V,6 -LMp$K4 ,@P  `@= PT4(  01 B10R,0 P@( ,K =Q'00K@8,?P4( 0,0 B0RP,0 ( 4K  =P@"`V@J,K =Q'00K@,?P0 ,0`V0P,0 Z  n=@P  -LM40HH,0(FD:!$ DLaa\aXab4 0-HP@L@<08 S800$< @P+  R 0 0 0 LPP0P0P 0  00CS0 PH">D 00C0飮0>*OLaa$6\a -LM,0@ h -LM8@ $0 @@@9" -LM 0 ' -LM  l  \ \  @@    0 0\$  -LM`HHwP@UD ^P, ^ )P#B00jU  t0S: p0S*\0#0C06 0$P hF<@PpX(1p@@A( aF( )  ),1 ,@1m,5,  0 ;00 , ,0<0 0?F0p 000 !R !@00@0, F, @ k00002@1 Q ,0,00,0,0040 ,0t 0,0,H`@,06,0,0 l0t T0`P 1D0S @,0PH#T@ 0 P@{\ @) H;),  8 ,0 0000  Dp0S 67cAPß0 R400 0 C4 P 180S !80<0 0Q40 T0!P< @ L0P0T0RP0L@0TPD0,0@  @ D @P H H40RX08QG P@2  1 <BFv 4F"40,S000000000QP4 R ,0 @0 $"@#,000S ,0 P4 00  *!140!0400 67c@[,0 00 0000  ?, 0 0000  1 0 0 000  &k$40,0 \6$6 ^$6z4@H6apF#$S#\a-xS"S"da`a\a aaaVb4 -LM@P P80Q 40S @1 R Qa 0-0-LM@0lKP -@ @P@ 0 0,̌,KYBU00ܲa P0-L@8P ,P04 KAXa4 -p0p`PVL  P@  ?$ p0P`@@}@넸a$64 0-XX0@ TL  P0 RP d@T0$6a -Lp$@P`?0$ P 000 0p `pp0S 0 S  -LM5 @u p4P 070 ' 0d%` RXQ  0ASKꄺ""\"""\""0S8  0 10P 0000  0 0S 0S 090F# 00 0 0@1" 0P0CP 0 0 MPP0000S0S?0 0 0 0 90 0S #0SQ  0 0S0P 00:0 R0  00 0 0@! 0P0CP 0 MP0S0 0U:00900S00v 00 0 0@! 0P0CP 0g 0 @00 PZ\0S: 0S700C0 0 u0Sr0* 0P:0 R0U: 00 0 0@! 0P0CP 0 MP0S0Si 0Sf u"c`O0S 0SD00C0 ROI0S00C0H0S2  0 (0S% 0S"0P  `090 0@8!PP  0 0S 0S090\0S 0S8 ,>(>Xapp@ <4X4|44444<4 -LM@0hS0\   ?D? 0<S h?$? ?d4444Ȉ4 -82LMP`@ @%P ?> P_PS PMPppQAgA, 0@S1 V0>0nÃ0g`ƃ. Bx!x00  0L PP H!H0 0cC61 Vp ಐ 0 f R0 f 0S P00, ,@Ppp P P pp P p p P  P P p p PppPPppPppa$6Ԉ4 4a$6ba a,4 - @0 0cC61 `BL!bQ`p T 0 S0``00`mt 0& a aa$6h0@-0`S\PX0 Q?#/0 IS0B!@R !R %50$6$6$6q^ -LMp|`0L Kl !@6$ K@LPP @ 4$@0@0@H6$6(^$6aa a -L@PU`V 00B- P"ʀP P P80B`PK8 @@8  0`@ \@  @P Pʄ  P|  P P Pd  P\  PPL PD P-0$6aP4aaadaaDaa$a P>0à PP PP @P@ P P   P   P  P P   P  PPP -0LT4 -LM0@ ;Ph? -<0LM   @)0Sh,Xa -LM0@ CPhY -LM @ PhI0S00 00 -0SL M00` @ p(P|0 P  0S 0 @ 0 P  #Xah3 p-LM@P`@V0D  Ppphl -L$M00 3`0 P0Q&Q< , 40 0 00 @005000"@<0000 0000D`404x0, 80 Sy 08 a Rm 00070@0 0X D H @0$;H D H 0S8<00D 00   @0H!@00  00 000*>H4 00  4Z< A 0l   0 l\Z 0S 800S80 00<70Q00 00  00500PEXap4x4 -LM4|@: 00b!Ce -LMd0@Sh5꽬b<0S8<0 p-L MQ/|A`"t1) ``@TA?#)H1 @0Q?# $1@)0!S 0S:P @ 0@@3 0H@@3 0P@@3 0@@|3 00@@t3t p0@`k3p6aaaa aaa$aL4&6`4ah4Lat4a|4a4(a4\a -1LM 0 !@PTp 0S0 @T(뼀@ R0`0 @T 0S @T9P0S00``pT )i)`Ta$aa -LM@ 00S 0M:똋4,00P 4 RHPXa<0 40 P 40 S8Paa<0 40 P 0 SP aa -LPp@P`$ @1P   @@ RD0D0D0 @0S @a0S@0 @0D00PD0_4P P {3T` @1 000p00! R00!`00a 0 10TT3@ 00  P@ p=,00,0 @a aa(a -LM@ @RD0D0D0 @0S 0@1 -LM 0@ `R x0S0x0 R000 00CS0 h04 .4(aa -H0P@LQ@p ` 0S T@T @Q 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R   @@T -LM1`NP,@Kp0 @9,K4 0K? 0H | @ t2Lx p@000P<N:3{5؋44.-Č444Q$4\4 -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *90nS& aS @0(T00S1@TKH1 h 9wS0KS! P$$@1 1U4pP,0p0 R 0SKτ 0 v9 0n9wP 0d 0Z9|W9xU9tS9piP9ꀍ4aXa4a4%544ĉ4̉4܉444484@4P4\4d4l4t4|444؊44(4`400H400@00 0-LQ@P 40Q P @@1 R 000@ 0-LQ@P 40Q P @@1  Q 0 0P 40000@000,0700 000 0-L0\0P   0@\!:/P@0 p-LM@14@ Q ` @PU  p4J400p p-LMP`U6P1 40P. P@ Pp@@1  Q p,0  0 R U4P 40U phP @1  Q p@@p -0P` QL@p .pT  .`X  .WV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U ROPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p .pT  -`X  -WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T C@@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!,P P,0<,00 R*0SR:0 0S 000 VP -LMd.P@400a 00CS0x/a 0-0LSP P @s8000 0-L@P Pd8000 0R0 @1 , 0-LP@P0 0@ C.?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000 Q^0 0P |0 Q P 0T@P@ P ( 0@T@PP.a -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP@ @T   @@TpPa 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @4@.0. p-LM0(@KP `*P0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSH"""""""L10S0S0P 0R W   Q0 PQ0ba>0>0  00ab0PP0<@0 /000B0 P$6%66 60S  i* -L$M@ , 0 40 q0 @@0Kg@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% N3. pI30@R/ -3"M2 0S @##mSPU`!q p0奎 @K3' +3 &3,@  34X 8< @K@KP à ]C@TPa`~ pà &3@K( 24@@K 2@Ba6 0-LP| 0\@ IH 0h)00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L+@ 50 0 pP*00^a4&6 00CS0,a 0-PL@ T0S  000@0000hF\0^  00lS R00@ %6%6 p-LMP @%T0`SX 0 R0Z<00@4<0 R00T00T0phX R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ T T00CQ000 0 S0  0S00h %6%6 0-PL @T0X0CQT00X0 0 S0  0S004 <00CQ 0h,0 P 0SP%6 0-L@PP XP 40S P0<0S -LM`p 9P@dP 0RP0 R0 0P@ %60"(0 R0S R%6 - L0 P0p"44 -LM0S7 䀟` PRp@ f  P` RU@ 0PSU00000  \gU@0S%68a64@-x0 p \ @ 0S \00  0  0@8a%60@-P@Q9 P7 SM ,0 4 ^-"""""""""""""""""""""""""""""""" Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0@!@ 0S -L M$$@ O 0@o(Ѝ4&6a 0-LP T)$O/@}30810a$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$0O*a -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0&PP L&P , $00$0 $0 0$0  -LMP0 A` p$@01 0!000W8<0; 0110 010@ 1 10 0 10110 010110 01Q 0! Q 1W 01$10$1(1 0(1i|$1 0$1 R(100,0,000,040S 0 0S ,07,0,07%6D- 1B#20R00S$1 1$1R%6 p-LM@($PP `3 @(1 0(1! P$1 0$1101 !(1S0 1,07,0P RPp%6 p-LM 1@0P 0`S S `p0 !8< !S08< 1 1010 0-LM$@ !1!010P8< 1 J0PP 0؍4 0-LM$@P1 10 1Q#P0 K -%P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 %P 0-LM$@P1 10 1Q"P0 PK $P0 1101  !0 S1%Fτ"0#1%( 3(F N%P -@LQPp% RvP` @ 0zPTr 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\09P V R@@T 40S@@T,  0P V 100CSPa P-Lp`P# #` P @T U 0 V  V 00V U U U @@TP@ U 0 V V 00V U U Uhi -PLM@ P h p-PLM`P @T U,0 ,0  @@Tp@ -L M,A P`p$@(10(,q$ai%0 !<  <  !@ ! 10 1! (1V0(1 0!$10$101%6 -LM@,pZFt F,X 0G a$1 1(10  "0S00ć @1 Ru P13811%711, 0Y1a , 10S: 4S ,o,   #20Y00S&10Y00S 1H01, U?p K/02S200ć9101S0  ,   W U Z0S  5,0HGY101Y 0S010U 10S %6.oa -L@ !,13P & 0`!$0@ !, ,  !> S6 $0D! 1 S S  ,1 0140S  @1 RHU?,  .P(?'U PH+,  P 0@ !101%64, H*010,  -T1LMP@0!q$@ !$1!S0, 00 ,!(4 01, 40 00 R`5 101 1    !1 (1V 0(1 0!$10$1010<  < $Q001$1(1,1400 ,0  0 oXa%6 0-LX, 0*00D0, !@P 0hs$0$PPV%6 -,#LIM0,  ,0 Pp  006:D R @0S Ÿ,0 S ,\0K  00 D@K l"01p6,0TK- 0 @ P P` @JK  0P`80S ` o0 ֯@V \, $16d ?.CK 0 T!H0"00.).H0 pK|` /$t` $1|K\0 (!T` X 06P0 &L  Ơ0H 尵P` 05P`, 7[` pP咯`CP`W, D (0 RO>`a44x bV%6 - LN -LM@P`p[)T0EP@SX#`#`#`#X#`#X#X#`#`#`#`#`#`#`#`#`#`#`#`#`#`#p $ 1 01410Xa4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 Sy!P 0 0S  l  0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` P 00 P0-LP@T*@T:{P 0S* !0S:0D00 )4 -L@`p P`P0 Vp P  00 00S0@ R0000 0 p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@PP( 0 S600%6 $0R0000 0 %6 -PL Up ``@T @Th (`@T @T%6 -LDM0`SP\` pw 0B Sq!XK[P@>X00C S_# ###4#$#,#4#<#D#T0儡 S P=\ dP@X'\`0 \KA0TK 0 @Q XT  Q  @ R\ 0<P@ p\K P@`\XTP-D@P@#%6w+@|%t$$#-$!p% -LGM<\, P`p @ 0B9S9##########################################################,0 S ,0BES񟗳#,#4#L#T#t#|### #t###l######X # # ## #X #l ##### # # # # # # # # # # #4!#d!#!#!#!#!#!#!#"#"#"#L"#d"#######"#"#"#"#"###########4##P##l##########5 u55 5ş 0Zşş 7h0 0K FPPW 0S0\40Ssp0|jğ0 L@P00W00SP4 D0MK 4 41P0GC ᨔ>o:04,4 I0ğ0 L@P00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOK, PP3Q 2R  04L 0@2 2 (2 "0L 0PX"T"P"(2^ 2R  0kL 0^%ANK 08 SPP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0eL 0^L 0W  0R 0PPUL 0?-= A`a4d4d4@e466 6aaaaa &K N9&@1 1 0BRS01111@ 0 R`00`0@ 0 R`00`0 R P  =100CS> > 0K0 1 z_08 K10, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T(!P=9@ =C, 0 ,0 ,00  "$20   41 !01 !0@ H1@1  00 0 1K?` `0X Q0V/@< c%00.3V6?B1-2 -QLTMQ0DSP Y 100CS,0   V 0 00 V 80K`0 \ H D T P0K =p`KX @P <  XKP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt <P`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKP`@P@*0S @T:0l00S0*d P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` 80dKt d0 `,0  TT070- -LM@Pw0Sz b PU ,h"PUPfP_x2p"@`@  @LD2  FP@U`@ p ,0 "S0f"Y 4",0 @ `$4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC00   T 0PU ` ,0 @#4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U%60  0|0  0 c0cR 0 0 PP$0hP00 PP%6 aa -LM@<00 0 00000h/%6 0-L  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@0%6 aaaa -LMqu0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0So]S0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@1a%6a aa -LM@PT 0倐0c/a"|,K0K l 㐌0H0\0  b,G$0@Ta a44 0-L0LD@<84PK@TP0h a44%6aa -LMP@T0@ < 000M0 0&6al^#&6%6^#a -P0LM D@R80(0 h+&6&6&66a -LMH@0DSK40$00 &6a&6&6 &6 -L MaPQY P= P9X0 P@0S ,Q0S" PU qQ0S PQ00 P 0tp K00, 0P@U4 440$-&6 &6aa&6&66%6^# -LM@P a -L_܎4 0-8P8@L ,x $t0h'^^a#Hb# 0-l0P@LT  0 0 0404 00$0Ba0hQXa6oagfffd c -1LM!p0Wダ1, px1@T l10 0CS0 00 | Q5|0 @TN1,o dW|Px0`  x t00| x0 tv uK_`91Q |0 T 10S d0K/`H 0#1!S  00abaa&6a6Xa- p- LM0 P1R@0tt00BP0 0CS0 kP 00CS0tphb 0-P0L @@0K/0P10 @00@0$0h Xa- 0- `0RL PH0 K?@1  D00D00hSXa-4 p-L1 M PK`l 0PR 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S 000  d好pu 0R 0R 0@ 0SXaвa?Bb( 11 R00 aa -LM10@Sg#g#g#h#$h#g#g#g#0100S 00h0K/ RT0T ,0  U? R1B 114aoad cD t0< 0 0S0#0(0 R0 .-aoad c 0-t0P0$S$0#t0L @K01S0 Շ Ň0-@-@@@@@@0 00 00@&6a,a$a4a -LM0@S`p>0S,0S00S7  0PS0U 0S PPp)0Si 0h `0T[0S <U4Rsp0 &6L4h44|44 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0 ,`@08JC8 1!Q4K 08SVa &644 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00a -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0DP4K 08S,8 6d6 -@Pp L4`V 0 h$W  0f$&6 p-LM @`PU 0 phMp؏4 -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP i 0R0 S0 0R,0 S00$a4a4 -LM`@/PpU PPN 0 S0 (0 @00B 0d! P7$` 0\V@@Tʄ@T@ P fAV 0 !R0,0 C <0V|3 2S00S \0 !R Q4$4\4d44444 -LM @`P0pS[ 0S-RP WdA0S S2 $@0S R 0,10  0P , 0Q % U1S RR 0000 0S Q0 0Q B 0 R00$P  d6$a44 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'O 4,aT4 -xpL@`T 0P$ R U@U00000 ,,a 000a0  B Qma -tp@0L P `R $0S@0  P PT0$a p-p0LM PR` $0@S T pV V -P T8$a -QLM@0Q 0AT (00@T,00,0,00CS,0 -0LM@ 00  0@@4a@-$ R$ $@@0^"*$0S $@ @0S:$0S$$$X@@0^:\ 0RX X0R$P$0S$ X@@ @0R:^:\ 0RX X0R$P82P *0P ": -LMPD 88#| , `0 a@Tq LyHq00D!@1`  00,0 <X@ PX`9Z `<@? 0O@X Z 2 8`-0 0,8,@`P  T< (0R0#34#4Բ54444ȑ4{50  0 Ha@a00000 -LM00@(  e 0 Se Rd}`H00< @0 00 0@ ,ؑ4@aHaH0P@ ,&?B(4  -PLjX`@08P@H p`c0p0t0hT -LgMℑ 0,0  D!(0("4400@$04 T` 0$q$@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |x0L0 ,0S \,SL00< V4T^`aXaH4\^p4edA!4)Ȓ4*ؒ44 -LM  P@-  0 00  /,#4#l# 4), R  00SSAπ |. 0 R$0|$0\|-  0^Lae4 -LM`@pPP    pP0D 000 0  0@0&6^ R0 00  0 ^ -LM`Pp ^H QDP?1@ T 0S2 @T0NS T#t##Є# 0 -T /0,0 P[T 0 T 0S 0\^La@@ R4 000 S00 ^$^ -L M8@4^ 0 P00 ^la@4 -(0LM@T @T$^ -L MV, 0 XP. ,PG{ @0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  RP@ 0-@LTP  @T000@YT R000   00h -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP+  R 0S 0S * R 0  0004 0P  # L4 -L4M@`paP, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  *<R0#03^0S< 8@ 0P L<0 0Q\8@0P  000 0P& ,#,0 m0@4 L , L4 -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp000@0D 0W d U*00 U R000 SPp    T4|4 -LM0@`p& PPpU 0W PP  P @R000 *WP$(@ T00L4la p-LM P@* 00  00 R 0  @000ph`h 0 p0 0S0 0  @` phla -PL M@ L 0@e @T  ^ @T % 뜓4444 Q0-L@0PA 0R m x0 0 PR0 R P P0000 0S0SS RR 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 ph h0p( @ (^ -LM `@tV`Pp0S:000 0`0+ 0@0 0WpUP@V  0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p%  `( ` 0<0` PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pe<<L 0 P] &6\a(^`aD&6@4H4^P4 -LMX @R\0T \0\00X \0 P PQ  Q R0 00  0 D&6 0-Lh0P|0 P 0@P(^ -LMPpH L0Rz `V.P@  `VT  <000T Pd0` 0 d0l0r000@T[ R0000 0 D H0 B0D H0 R00C0 R000  R 0``0 00 S  R000 R 0` 0 `0V0D, 0Q0:""0Sd0` 0 0S0P `4l4 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P!04 0S0T0  0 R000  R 000<00CP 0 R000  R000<K7p 0 S:`=눔4z -<@LAP^[P`@P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p` -D ,0LR@p:PPP  ,`VU  0D, 0Q0:U> p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@ur4p -LM@0T`80  r@T,K ҬPU 8 00R8 K @,0 d@4 $0pLc^=9 =4p 0 00 40S"PX8P P R000 h0p 8PU @0D0<,0lS:\L&6(^ -LP`pw@ hn 0-LM@PT $ 0@T0鬔4 -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXHԔ4 44L444ܕ4444p+504T44444 -L* 0S p`a{54 -p-LM P 0@``,0 \0 Kp`4a -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShoT0q(PW  0U00da068a&6 --L0LM,  @!0 \ Xa --LM 0 --00LM Q0r,6 -p-LM@XXP 0`@^00@ R `>p&6&6da p-LM@\PX`  0PP=00@ R Ppx&6&6da --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSU#l#l#@#l#l#l#l#l#l#X##l###l#H#`#`#`#`#`#`#`#`#`#l#l#l#l#l#l#l#l#l#l##l#l#l#l#l#l#l#l#l#l##l#l#l#l#l#H#l#l##l#l#l#l#l#l#l#l#l##X##l#l#l###l#l##l#######l#T#l#l#8#l#D#T0  0` 00x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,k\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm``  [cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  .,D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D H0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D K`a4$4,444<4X4`6l4t4H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  $P PaPh hp ` Ph l  S -L4 -@LM鐈5 -LM @pT0Tؠ0P  @ 0` 0  00坠00@- 0P^c: 2#80S$H *   ,0 9,00 0oa -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@0S 2[02KeP qE-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0d6&6&66&6 p-LMh`@qP T0T Q 0QUqU@@0p8s0@P&6&6ܙ44,0, 0$ Q 0÷&6'6&6a -LM0(h h`\@\ 0 0S<:80 0005a&6'6a000 Q 00&6'6a&6 0 S-L< 800( S $S ah]{5&654 -t0@LMA \L0S#####,h?$=h9d6D5{54 4؉4 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi0S" hPK_h`0\b 3` KpKl 0pcPl=9 A =p p l p l0 T2RHL"002c2cs , P@ 0S @0,0"F0@T t@,0#T@@0T,0QQ QL@0KPVP| P@T| P@X| @{p\ d0S`K BP@`KP@hK\ d0` h0P=9@ =C` \ ` \0 \D| %P@Q H| P@G L| P@= @Ka<0K8 KH0 40KD X0 0 K,0K@KT P0 L )bQ64b?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#ӓP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  3E 0-04PLS@ SP0FP 0R0000b 0-@LP 000PP0  x0@R ,0@@0,00h10S Tz0(0  bb -LpMW,0 P`*0 S0!;P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pgp 00 -LLM0d $@0dS0!ph WH0Kp0  Pl dl pPP *p0 R0:z 2 PKBa2a11J"c11L0 P 2P_XK≒L T0PX04"PP L =9@ =CP L0 ,0@0`,0 h0poh 0S>z" XPKeXP0\Z 4PK`K\ 0`cPl=9 A =` ` \ ` \0 d1R@\!002c2c $, P@ $0S @0,0 !F0 Y ,0#Y@0,0 y Y pHKPc d0l pd pl PቐL T0S0L0 P0  㥪p H 6Mb?BbQ64b -L M`(p|PP@[|P@Q,K0 KvP@J,0, 4K,00$P,00 K000cP@040 4 0040$4 000<,W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt @0@0c@(D0@0'<@0!e p@ < @0^ <@0Y*0#p@@ 80Pt Ǜ@00@0|| 0Pp@0 p@0@0@0@0<@0bĠ4Ԡ40Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||Z06(a -LM`lPg0 p@"  0@D  D \@0訠 $☀ ";p05  R @? 0SU 0S 2 )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU WZ x U WK 0xU U U|Uu 05 00  (0r05^ UZ   ^;8p09` (0S.@H 20U0S 6 =   y0PD 0@$  $ bb3\^b - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$(8$08$88$@8$'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0S8$7$7$8$8$7$8$QA0 0(!)^  so 0@d 0 d  0=`H T PPT JO  L-0c Z0 = PH @ 0`0Od  d -b3H}5 -PLlMUp` e9U9^9U95Z:@| 0S , x0\ $1 1F0S GTT)T9@ P@ ,9U+ 9U b8UY 9U 8U 㣴p0;p0垴㛴p0;8U 8U㐴p   5,0p  @ 0S 0S||^ ^^ 00CS0 @ 000@! 0|0@!x @1 ,00,0|~P@ 7U; 7U 7Uh00?X7U! L7U@1| R 㯪PxP,06Ur  Gu<nH0 pm0&0p" yt6U7 ch6UU -6U P6UF0Sp0p000p0`0 R ` 0 R @1| R,0 h 52&@5U' 5U5P lU*h0U 㵳deh02 P@hP" h0  ᝳQ4U 4U 4U¤@1| Q_,0\ P 0SxPx4U :l40SjX40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  R`(p@ PKK020  0<p0 P@WP@Px2U@  PC  x \:زt08t0 @8t0  t07t00@t08t00 t07t0 P. q0S S p0(0(S" @0H0 1P pKl p0 LP D` ^CP@X `d0 `0rg@ `h`EIT  0X , U0U 0U 000St{t rtzt ^t a(6t,@ot t t at nt (ast@f@t@[t@wt@ht@\^bt~f}f@(6t@)6Ztetvtgtt,064 4-0L0Œ@P>Ap`@ .H0S`VW T+  P`0 p0\^ p- 40t 0LM"@`1Ps sP<0 p80<`00@0\^ (60(6 0-=0p 0"L@<P0S00  Q0 0 0S000ẖ\^ p-LM= x0 2`<P㽱@J ᶱ0 p0191p 0Sp\^ 0-=0p 0"L@<P㘱0S00  Q0 0 0S000h鄱\^ -LM= 40 @2< H >P\^ -LM0@  (0 P0SM0 p-LM@QP`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP p(6 0-L@PP 0 p-LM@P` (Q,Q&p0 >;-p0.(php0m h< p0ŒHQHPᖿHP(\^ '6 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L㊰p0P0p00h逰 -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =UP@ ( P@0p 5*0p -=`b0V``V=J`VZ0@   p0  X:p0\34 Q0-L@PA  UPE0 -LMPP2 Ƭ(`$pKP@ $! P@`P@ $ P@p0:p0圬0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@Mp0 t hڌxӪ0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10KS4 S1 1R0 0lj$K0, K] HAN=0S 0 $00!0 $0 q?B6c$ O(N=0S(0 ,0 0 ,0 ( (0?B6c, ;|01c1 @R  1P2;P 0 <0/0"bT uDbQ(484T4t4|444?BHh444ȡ4P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS p-LMP@ p0`(0(S U  &p p 0-LMP  0N᩸P>T00  bb p-LM`P0> S@0B0" ٪B ( H P00 D @000 0@Dp遗@abbK$ - `0L0C0 R 000  0 (H0 @P唪@dDFA 02b Sp>L 0 S0``00`hyߗbba aa -0  L20 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qbbb -LMQP`/00CS d$d$d$d$d$000 PiZ-p0l0h0PpT0T@ 0  pqbbbbbb-R Rt0t0\ \t0t088Q O -P@pL >㥖0E/>1 `W>p 0 0P0  錖 -LM0@S0S000A?j> d> p-LM@㘩0`SC 0^P` a/.!0AS1l0PU00\ xp -LP`oVp&0S 0\@l0% @l T@ 00S 00`d d0Vp 0SS 0 0Eh0 -L@P;`\p U/ 0 ` \L ?>1A 0S>0`Q\L0 Q` \L0 0H`F V0`b 0-@LP U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0hΨ p-LMP@Ǩ `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0p?>1 @ ,< P0 ᇨp4Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpFB R- R0S1 0 0V$ R! 0 @cR@cT@ S`dPp  00S 00 0V  R  0 A( P04@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 ^@- `0R   00\ La/.!0AS1@ ^ p-LM@㪧`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 0ᆧp -L Mp}0S# 0S 0R op @@`KP@K S -`,0p@1P LP@U @ Y 0[ @] -LM`,0p@1P HP@U iY 0%\ @a] -LM`,0p@1P HP@U HY 0\ @@] 0-LM@,P@1 P \0Q T0Q  0P\0@1 Q 0,0000at qt @-,0@@1 00S   @[@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ll L P0h b;6*6>6 K^bb^bv$b^4v$,0 P 0SPb -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am -h0LPpU` @ T*0S4@  T:PUb p-t0LMP`U @ T*(04@S T:PU(0ph4 b6 p-|0LMP`U @ T*$04@S T:PU00(0aph b6gfff p-t` M@Lh 0\P@L 0@w,08 0ph3bX4b`4(6,60 <0P$6d)6b p-LMCl0`PU @ T*,04@S T:PU. 000p bb p-LM@`T"@@PLH0@P  1 0a1pbb p-LM@`T"@@PXT0@P$ 1 0 a!1ܤpbb p-LM@`ѤT"@@Phd0@T  1 0a1ḤT  pbb 0-@L㨤 P 10C1( 8P<0<0< 8 0 10 x@ኤ0 (0S $0, $4$ bbb P-LP! pe!` 10C1* 8P<0<0< 8 0 10 @|tHTP (0S $0, $4圑$[bbb -LM`@!T"@@P@T 0 0!1  1 101T !0hZ)P$p Q0p0X0` 00 xbb -LM -LM -L M00 0p`40 JQ14 W V  0W:pcW`0X,0 ,KRV 㪣00@S"PP " 101岡ᐣUP 40Su 0!0gS0! 0h \,0$00$u8 18 8P!8 0 <` 0S 5`1P1l0:嘡 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XP# 000PXㅡ@P` 1 1 101mV 1@  @ :)01@1 0$ 1 bbbb Q-Lp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@! ] 00 0 pd dR0 00 VW W`iP!000`` W @ PP 1!1 101U @$$ R 1 0 +10 ,( 40#s:0U00SL( 0S% 00#0Z00S 3S0 @/PdPU70778707|Ui  X00R00SuU^ @04 p< 4p4 5 L 0P0P00S 40  707780|7ᶥP 0RS04 00707780|7ᝥLD WU @0 0S 40Zdlh 0Sl4p<  R< V14  4 40pPD @L  aL 1SS P00bP0X0,CX 1000cX00P P0P PdP0pU ZlPZdhl㉖T <& 10C1) 8Q<0<0< 8 0 10 0d0喼TjdP (0S $0, $4$8ND0 P FP8 \ H R W|Zdhlw L00bL0!RR P00bP0X0,CX 1000cX0\ @0 Q 0 R  P0d0 dP.@ 0Q 0 R8 $@ 10C1( 8Q<0<0< 8 0 10 0d0  (0S $0, $47$d` L00bL0!RR P00bP0X0,CX 1000cX0,\ P0d0LdP㥕"@ 10C1( 8Q<0<0< 8 0 10 0Xd0᲻ᆕ (0S $0, $4݂$圻4Sv  UTpU 1S, 1)PU 0 9^0 SRY  407077L'8;X 0|7#>PL' 0@P4 0   @Pp Q! ᾖYpX00W00SP PU bbb p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033Ŕ`3033#TK@040o2[03,0(00 00S<003M -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@S$$$$$P 7tPTPL0T@0T0T`@`00RU 0S@000 0004  ` Q!k401#8S#00Sd0W  H0WS 0S 0S S d66 -LM^P@p \ 0S*p 00 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0@T0 3 003` 66 -LM@@ D0<Pp@h 0-!40r@L$ r 00LP<0<080 (  3(@03 0P8*6H*6X*6 0-40@$PLt0S0t0  Q0 0 0S00t0S7070hݒ40$ L 0  191# 3S,000`0Q 0-40@$PL㻒0S00  Q0 0 0S000S;0;0h颒-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6Ld0S 0h[LS0S 60h鬠 -LM0@00 68 נ6L30S  -LM0@00 6. ẠL0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤٶPD A吼0 @0 0 @0 @D@刀 0  0۾Tp`Wp@ 0  1SS 000 0, 1000 0@0S 000!RR 000 0, 1000 0 0S@ ׺bbУ4 p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1000 00S 000!RR 000 0, 1000 0 0S@@ @pw4 Q-L@`Pp 1 0\pW 0S0 0J@TW U 101h閻0S] !1R U5 1 \  00c<H  80S< \!1R U@ @ 0P00!RR 000 0, 1000 01010@0@0  н 00 0 0  1SS0 00$00 00a\U04 -LM 0@S 0S -@`TVLP8T 0S `c c 1SS 00b0 0,C 1000c 0N!p 10C1 8P<0<0< 8n 0 10 \@]1VTF R5$00b0!RR 00b0 0,C 1000c 0!` 10C1; 8P<0<0< 8 0 10 x@%T R T@ @T 0S @ @@ (0S $0, $4<{$e (0S $0, $4${$pMo 0f  000f0!RR00f0uZ @o bbb4 -LM0`SP: 0L0 00b0!RR 00b0 0,C 1000c 0{!p 10C10 8P<0<0< 8 0 10 @劳^TP0S  00 (0S $0, $4z$kbbb -pL @M T`1PP& T#@#$$ R 1 0 +10 ,(0c0Q P0SX0   X RX ̫PP)X0X0 XK PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP1/,T @ V05@1 0305 ~0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$t @,00C,0(0,  -LM` KPPp*0 SP 0S !0pS$W  嬪PP 0 0 0 $0pPW 0,  B, (0,ٖ7P@P$$ R 1 0+10 ,P(P0C& 0S0 0000@00h!hQ 0 0STP 41D!0Q 00ph~00500啍0@ 0Sግ00 000.0 B600 h08 . XB000000 @<08 . ,bt b bxbb b bbb bb0@-0 Lt0P@h0 P P0P S P00Sd0S00 5H4 b| b - pLM`P  4 00 !!10AT P0P S( @T, K P@,0sS4P 0S004X0@``,~8 8%~0N0Sd0S~8 0000  ~0000008~T 00L 500 0@@媋08,0 },0S 5H4 b| b4 0-LP yP@ 000:00 R0@0 b> 0-~pWL`V80S/ ,*L RPP 00(:00 R 0P8 80H@bHT@!d bT800808 <0 dS< 8 d80S:S<}0@PU o00000}H8 H gr}֨ bb4 -LMp`d}1!0PQ[|1|!0Q l1l!0Q \1 Q;P1@T' +00d 0R00>}0 ^P00D X0 000p`4@<lht  0@Ɗp}Vpl\ 0 @@崊p}V0帋 btb b bXa bbxbb4 b b -1LM 1qa 0K@K 0Re P|@PT 00000|00 Px0S 00d1\ @Pq 0R8KP 408b00Pc=9 = A@ @ 0@0S|P@T00300|80> 0C& 80 >0C&   0P@00000  D00 , 0"Xab bbx btbbt b b4 p-LM@b|00`< P0X P00  Q|00 00  40Sp00;00p4 -LM00@ +00x <R00 00S00 00@ 00 h00500h֊00@000`00d400qb4 -|4L Mph4PQ` 0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q 塬PT    YF0S l#000\ 0P0 00 @#000\00000 R000 R 0S  0 0S0 20 0 @$, P0QT" 00 0Y@00@0 *0 b  10 60 iP@0!0 R? Z8P0, R ! 00 00Z0Y0S0!0 R  -P060@0K8P8@@K04K8 .PP .00sM 4^ ,0DS2(0H S-:$00S03 $0Q4 L0^0L0  @PK0 0@0K800PK00L @@f@PK 08L00X 0$ Q0S R0 0S0!$0 0S0s@@K @PK80$ QJ0S R0 0S0!$0 ;0S7,0sW@00@ K@PK@008 600@K0P T ,00,01Xa4 -L,M00K ʟP@P `H, V"0(%U 04TJZX 0,-@00X 00000P0,  Ppo00 M + Hd004 @PP@ K0L `p S80  L8 @_ ,\0 ,-80 S@ HQ N0 80X0 ,80 0 00P@K06000 0A80`p S ڍ00:008@ TT 8PO~ 00L @0 00` +d M-LMP0Q 0@0 000 X0 80@ `00 @@00@ X 1% -LMpL00  L H0AP4q ` @ HM80Y080004;00 0PU !l \i 0@40, @@00'[8 Y 0S @0@ P040P000P妟1%bX444 -L M@0, 0a + ` 0@0 Rp`0  @<0A ,@@0Pp` W 0-LM@0< P   &< <0<0 | 0P | 0S P<0 <<0 088 T00Q0S <<0 0 {Xa4 - L0; S  b 10S080|+6@Q1 0 ! 0- p-LM0`PU Q \t0 \ !0SpH@ C`P70P Ӟ-6 bإ444 -\ 0L!R @0Q1S0!!0Q峞-6 b$4 0-`P@0LS HP@0S0@1S@1S@+6@-0S 1 1SL 0DS  @  0!0R0@+6t36 b 0-LMtt@ 0dPLH0H T@@P@@T(P0\4&6 bx b8+6<+6 -L M$$@ 4 0@d4&6 b 0-L@PcUT T 80 Q0(0巗0P0 0 Q0+6 b -LM@0cc00C0hŘ b -L M00 1\ 0, 40 \W\ `P`V 0 <p,PY 010Y P@% 0`0 ,0Y000 0 400 Y 3PYo  @0ppVʺU`Xa -L M0SPIJpP`^ W @ 0@  Q 0CS-  @T" `(p 0 (, #P0p@Q ( R,0,0,0$0( ,0 pT ?00@0W 0@  0R Q 0S0^ #(pK'`@0K 0GP0`P F%F%F%tG%PH%H%T,0P0  0 S 0 00S/ 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 +6+6 -LM0P@T`K0&$pK  0pP@ $0DS XI%xI%I%I%0J%$0 $I$ 0S B $0  0R 0P@ $0 $0@'@0$ $0 0 @ @0$  -Lp(P@A 0@1A 0 Ps `@0PU`P``0@004 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr =sus0suu0sXR0S0 uq000 0scgl4 -LM 0R ) 0 `R 0 4 Pp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00} \0 -L,M,0$ 000 `P 0S 0+bP@ R@@T O000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 $P@380[c  R?@# *\0× 000N0/Se @0 ۝ԔpR ͔R300” 㗓p>@ $ ;0 p媔d妔P墔pGWc:0/S Y0+㈓6 k) b b -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < , 0 /S K  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@v@00@0T $ 00@060 S"P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00Tk00CS<< R;T0$ 780S2 T0$  3#0S 8@0S00- #P  @00@08Q   #`20S 0 0 j 0 ( |`V   0S  8 R|`V   ~#00K #X0@@ @ p<QT0$   @00@0<@@@00@0W 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SV0S8 0Q0R00SH@090% b @ -LM80@0 p,0   `0SdV 0 R &!PP p 000ZT0$  P0  @00@00`0CS ZT0$ ,0S T0$ 0 @00@0,0S 0  "0@ < RP   " 幗44 -@ MLdd 0\PVP0P @L@HHH0H @@@@hL &64 b b b b b b^ b p-LM 0PS`@<P @ @@@[PpZ꼦4;[ -0LM`@Vp SP $`VV vXv@P㤖P ` 0$0 P0 00$0$(0$0p )/Y 0@<+6 -|0LM0Sh0@T 0S$@TP0 $ O^<+6Ħ4H- P L0S PP 0R b p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0pXo^^ b0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00, k 0@S Pq R#Dq R 0S k Pὕ 000@8@(널4,80P@0@@PR WP XPUj;PU X R\0\0\00X \0 H  H j80S 00|0<0 b6^Xa b b bz4T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d \ P0@0  P8p 0P 0 P P b -LM800CS1!p2?0P`b@T | 0V0 @TSjdp R| 00 Hj|0p `| |00| p|0p|TP < +< <0;<0 V|8 80S@0S  %PT Y80S  X   ^40 840 LXa ba -LM@<0PX `   <<00!wH @p00Q00S0@0 PP @ 0W0 BR00S@ iL0S X R\ L0 \0\0\0 H00H0i@ X X R\ 04 b b -LM@iLH8t t0P\HX 0X0 \ 0@hxi0XSX00X \ @\ b b -LM@0T 0CS@@0  h v@0SH0 hXa 0-h0@ P BR@ L@L 00SV@0SH00hXa-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0 b b -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 Xa b -L M@0 K  0 @ Pxi% -L M@P@U0@0<0`p48<,<0`<U5 V-P#U @00CS@0L0S0t 4  @H<0, 0< <<0iw\ȓ 0"  0X44 b4 -L@\ 0Xa -LM<0`LP <<0"0u yT0S800CS_|\ [ 0S00 S | 0S S8p0Q0 <@ | |p0Qp | 0Sm QWf Q<0;<0<@;<0@T  P0Q |1!@P @dgDFA@04 Sp=ʄ1dXA R|0 |000|0 |g0|0@0 S8 H0gL0S0S X R\0\0\00\0X  RX 0X0X \0 `\hgt|T X P}8 80RWpZ(404a aa b@4T4@-2@H?0\ | 0T \80Q b -QLMp@`P$K40 P@T$ -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -L MQp@@ PI R @1@T 0S $@T-T A@@P 0,0S/ S+Q'0@T 0S $@TT (SP( @($@ 0@ @n@)T- 0 im<+68+6 -PL M0 `L 0 0@!X {P@ 1T0 0j04` \,  T0S ,KP! U`psP@ ` ,kP@W,p @jg0 0j0` <0 R4`( 012=0 b ,6d4 b-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p$0  0`004P L 4 $0<$0Sld RiSgRe0@ 1R`ᄠX\ mP@( \0R\0ń0d R>@!T@0\ 0   0V0P@@T@ 0004P 04014S0 R 0S  R0\7@ \ $ \` P@d0 Rd0 0Dzb -LM@0  01R p-LMP!`@4T  R00`VPZpv% p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  [P @  0S 0@ 0S 0 @  -LM`@pT P R0 U@W L啑X @呑0 NP  pㄑ bx44Xa4 -Ld@w<0< R  0S hjا4daܲa44 -41LM $1R ,  tq !`0 2cQ|PEU:0 00S00`0|PEU*V , R)k'Y@|)|d@]00000sd$W`pG,0S Xaܲa'taQ^ 440@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@ja,6 -LMA\-P   -LM@pPp `pPH00H0 0qPp0S P- L p00Csp0 H Sp Hhr^4 -LMPp@`g`chP : V T0SSR3 @R VP T0S00000000  X00:00U@ cy00500H!0^qP@ clQ  V T0S RVQP c R T0S R T0Sc0p Nl0S vc0 P@mcp0Sl0S  act(444L4 -L`pWcl@PT 00  @RW 0| l0S @cha -LM0!P`@0 dK0< `0 d 8` 'P@ATp18!Q K0@ 0 ` P@LP`U 80S> 80S@% W@W@TU ׎PKT@ K0@x_x\P0YxtK4V U@KP*P80S@@KPP,, b p-LM0 `P0 K0 0  P P@@T|@Kd 0|0 "0ˠˠK Kx P@ pfKP ^ypux b 0-LHM080 0\K4 X0 \ 0 gP@ LP80SH@ 8KHP 640MHP@ <0@@T8 KT@ -L 0 00CS 03 0S 0S Xtq0 p@PF@dDFA 02 St1b1 R0``00` F0|03_Wa aa -LMp|`V$ 750 @PpF@dDFA 02b SP0 S0``00`VF0|03a aa -LM@r r,4p+5|0 r840S S  (00S 0 < - -Lq`4@-| q  qL@H0 800@< (  3 03( 0\66l661EP!010 P?U@U  |L1 "  40 $,n|  40 KZP@   8| 0 @|  0@* @%T ?|>1 1E  .0  | D`<0;<0 | !88#cnXa4\^@4 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ40 Ƞ!$, -n0\^x4XaG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ86bųE.¬bbnm33bk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$HmQbb3364@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00 3 3E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM 30@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S 3p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 @06bb -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , PXabb@- @  0 201 R 0\ R R  0^0T,0S bb0S R00  -LMpx<0 3Qp`@` PUp,0Kd @T=0 SP0@=0 =@ih08"@(,0P, @ @4@00`  ,P@ ,T 0p 0V ,0t x0sn 4K 00K P@ \4 l40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8  [P7x0 qD0 4Ht0T$p T q! (0x$嬱 (0K$p Pp( $\ W (0S`Du] ᐱ@0T$p@0R̲4ز4 -L MQ@p`d%X` 0D 30nR\050@ 70 0/`]PP X 0\ H S00`X H a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P,K0KX PE5 0P@600K4@K00@P@-4\0H0 R $0U  P 0 PE A\0 0S 4XP@ 0\ 00U00S4 -L$M00@0 < D <0 D0PJ 4K 0 K0LPp<@00K408@K@嶯Pp+84H@ `0T*PU  0 @ H0 `0T: ᠰWD00D0  ZP 848pᎰ8劰PD\ -LM0p`0K4K 0PP-00K408@K@_P84H 0R *@T T 0S H0 0R:L`I E8A -LM⤐Kp  | PQP@$  ԁ0S   @T8$0@-@T2PQ @0(0$ ,P@x`80S|0" 0Qy0 Q $0 LMj0  0P@  [$0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  P0@)P000m@KY 0TZaY0Y SZaY M| ]00 03@c_ K/^ 0 Q10V`\ 0  0iP@  s Xo^ -L,M|0`p %PP 3P47 V( 0@ 0@@hP U $0000  0PP(KP!4 4 ;PP, 00;000,0iH@iX  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2?S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00c"[D80 4Qt0LP 3R3 H0 x0l3H tR880l0[0P R*l0 4p0]4 C@`\ d0]d @0RX OP|0@@,P0 R0 Z P ;A<,0,0 |Q-P00B ZPP< P ` PP$00100P0010h0 0ԡL P |04 "!;42 忬PP,0\H@ WP 0|0,嵭0,0 y$ WP WP WP{/0  4 8<0@CqYP@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0逰a44 3400 -@L pP`0 A|`PQ>`&<;$0 :$0! -LM0K"@P0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` h[Z d[MB| `[ D Vp p-LM80@SP0 0<l0S 0\S `V p 0z0S0 O -LMQ`0(  $0 ,` h0@Sph, K 0STL - 0NP$  $$ LP.\ K P'@ PK K 0@ PKD @ P tP0  嘺0  0 ,0S ,8J J};[0 [ 740w 5 @0QLKN KO0KX0N0 JKQ0E0FKH KJP0[ 0P0K5`a7644 b -LMP` V$ &P 0@ B`T><3P`ԩ0 0 f@`ǩ?  -LM@ - -LYML 0 ,0 d! dA P! h0`! 0h l! p! t  KK#Nh!0x1 P 0@ 0 $7 ,0S ,K8hA `L0X S! 20A Tp1 T T&T80BPP1# `Rl! 00 '#L!lA0@Lp d1t 1R2\1  x0s h`V  `=K/=KX XQ`P@ld\d0x a0`V`!\T GOK\ `1QKd =K;PP :D1ROK@姢PP HD1@ H0bT!S0!P|1 0U*0S S0t1  Q @tA 8 H T|1  @ 0 PU:~hA0S`LA R0p0l0x!h0XA00dMKx XxQL0 0P>PL0 x0 pĂ0 4ȌD \p@3 (K 4 t\- KK A?(KA/(@K0K0000h0 St! :MK $PP l1S pAl@D 0pA T0l HH A?( K K?K 0 48<S@1SX `H a0C@\1`p 1HF,`$`D2 (@K 0Kt!MK4t HѢr`/=KQ@0R@@0@ T` SbV~KA_x0 s@041 14 (@KV 3 V) (K00000h!0S:MK#PP @ 0l1S pA@DpA Tl1 `Vڪ @0@ MK 0(@KKK,0SR0(KKK,0pl z @Tk Tt  Tfl  Tc T TT  T\L  TYT< TT4 TQ`aD4ah5̏5aadaaDaa$a  8  8 08 0-LM0 PR 000@0T  R00`0X @ c+P  0 00 -LMPpd 80@0CSBXP0X`\P | | 0 D0400s!@פ! 0R00`X  lO0  PP0  X|0sH<KX@VL(36T4 0-0L@Pt 0@MU 0"P  0 0.$M0l44%5h4 0-LM 0Px @ 40"00  B00RȊ&&&&&&Ȋ&Ԋ&0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QL M,  Q :Q{ Q 000 0` VL "@ LEPP $1 010 1   3 0 p0bV0p+ "@+E0$0" $ R 1 0+10 ,p(p00P, d 0 `0E(b4 -L@T 0` S V@0<00`PU 00S PUQ dp0S S l0SQ h 0˲(b\o^&\^,b 0-LMQP-P P@K00, 0 P0S000-0T@K00, 0 PQ0 Q09696,0 P h0SlP,b 0-LP@T t0 0P@t D( hP0lSl00p@p 0,bl \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*}<Pp (b p-LM ` 0S 0 PU 0S PUp 0SU j@ _pp(b@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱ꈬ&&&&&Ĭ&Ь&ج&&&&&&&&&&&&&&&&&&&&& &(&&&@&&&&&&&&ĭ&&&&&&&&&&&&x&&&&&&&&&&&&&&&&&&&&&&&&D&L&&&X&&&&&&&&&&&&&&&&&į&&&ԯ&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&& &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 BE0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S &&`&`&x&&&&00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P96 - @LM 7)h%^,& -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  (PAP11 0AP PAP0P0@0@0a!R0 0! Rol% XE  QE 0\0 A@96496896<96z4,96b 4 -LM@1SA(PDY0Z0J0@(@`  p(@@000 (E0Y%X00` q l0R0 000  0@AV@ @@ p `F0V <968& p-P0LM`%QU @ 0@1php<96 0-L,0P@T @T0h4b -L`pQM@H0PU ,0SPUh}@ADb p-0LM0`PS@ 00P  `*0S 0 0` 0S  0 0`PP $ 0`S00@ ph @496<b4b44 p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`0SD$0 `0`00 @phO ]@496<b4bL4 p-LMP58";502 0("(2 0`$ixXQd~{ R0 10  0 PA A R0000 0 0SI 5 P 0S0C 0= PQ vQ0% 0S0C 0% %01 $0@T 0 R 01DQ@T#phl< R@0@ <0@0 < @0 ,&|&&&<6b@c4b<96bXb -PLQp` 0@S` TV@0@S0 0C0` o000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@p[@-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T |B0S  @TBPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S 096gfff, ,00S0 0000960b Q00 00C00b -LM܀`0 V$0  % P"0 @PPPTU 4pK> C &6P`PU@00T00S$0 S $#(`a0b096`4 -LM0@S  P, % 00ah%D&6Q 00_ p-0LM`PV @T 0  R @T`Vp =P 5 0S 0 S =Pp4b p-0LM`PV 5 @T 0 R @T`Vp0S =Pp4b -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  P  P 00 P$0  Q 0 4b896@96<96H0Q P 0 RPQ4b -pL W`4 @T 0S @T XR 5 =P Q =P0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   8& 0-5P0L50 @T k@TQ 0 S01 10C1Em0h[ -LM5@05 O hH^ -LM@F h# 0-@PTL @mT00000 p-LM`~p0P@T %5R0C @Tn80ph#(50S 4b6 0-@0L@PT (<P @T004b -LtMXPTU, `@ 47U ,7U  70SP6U ,0 S ,&Pp 6%U p ?6Ul 6Uw c6U- x6U \ p  0  0,Q5 @]-_P0`0 UP%   %q< 00\5   @@ 40SPr0S  Pc$5ATQ PUN 0SK0HX0S ;S SK@r ? ?n `5L@K05 P3K5 053KI @TR 0S 0S @TF 0S7 U@` 0S<Kc$ PU 1Z 00pZ@ PETUXUP0 0eP  0 1 > p1<K9 1P PE p `a4bx4 -LM@Q 0 S01 10C1Dj 0-@ L,mPP 0 >?80 $000 $0(0P0<b -LM0`SMPU 9P7 PU  <PP5  5Pp+ 0@T 9P& $@TP@ 000@00 pp  0P  T<0P/S<0P9S<b p-LM@`TP y9P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0OLpP R000 0 0 = <b -LMȀ 0R$0 0@T 00@T$0 S |$"@`TP 4pKV`Fl8 H> 0PP@T`a4 -1LM@ T$ P 8P $@T$0 S $~"T  R0 @T 00@T@`TP 4pKV`F!8 (= E0PP@T<b`a4 0-P0L@PT 8P $@T0T 000<b 0-`0L@PT 8P $@T0T  0P"0<b -LM0@S SL 8PT(  7P h0S3 0-T1L0MLQ@ T  8H8P< $@T(@K70 (0K'K`P@ <P$< P@D@K ; KP@ <P ' P@0 S X!0 T @T @zT<b`a4T34 -L$M@0Q0  %2 800S80 0 S h~!<55P2K4 K 800CS80ʴ5<55 `a4i -QM 0P P -Ѝ0 ЍP0  Ѝ -L$MPA`AVDP HP @ p2P Z g@S 40 40 \0S @40  TQ 3 R*TAP@P@0 R񟗿&$&&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&$&&$&$&$&$&$&$&<&4PK  @0P6DP 1  5 sH0S02K H@ 0 1^  80S $00cN  gZE 1000@*K  : :D0 S<Kr:Q@ !1`R001S00 000!005  !P    g 10 1w 77PF S 0 B0 0   0h0h$0C0C!0{gH @0@4PK :@BK@04PK  P%P02Ky (7/P@0<K0D0 @0 @e:&@0 \@PAP 40 @P80@0Cp80P l3R: R1 00C B 0 !  80S$00c  wf@T 1000 9 S0 0C 0 0d0d$0C0Cb^h i fl2  ,T2 P`p 0pS! i ,Rg  0`R 000S@0@0@0iT 000e0S,000 0PP0 B 1U! |1Ul`1 $ H1 P`- 0pS & ,Q000 0PP0  5i&E50 ' 0 P` 0pS  P000 0PP0 r 4P ki9e`gD96-c-cb5݆@c<6@-@@:@0\#" 00  @Z00 ^L96 0-r/0L@P0S0 Y 0X \ZP@Y 0r801<0 0h00@0  8000E  /s?:0H& -LM!@R \0700!R\@-@ *,  0!\ "0! ":H3@-^p`*#!^ ",!1 #: 33 0-0LSP@/ S /0 ^8 Z80S0S 0S0S0S 3000  00 00l 88d0ST 08L 0^ 0 000  0 i96o96]96c96 -LM@p@,`K4K P@I,0[ 40[A T  30S  @3PP0 007 {P@  7 700 p1 0S!00.A 1014 7  -LM@@,`K4pK 9P@A.T % l30S  @c3PP00CS0 ^ R0700 10C1N4JF -@LMhx96 -LMp1`P0S@0 r01 #Tr 0% 2 0(50 \0%0 0 0 WPX0Z Y@t0 <y0@a4ȁ,&&Db -40LM @P0 B0Db -LMpP`@y <P 5mTP 4 10SZp00p0  QM QAB` 0R1000T!Sp0p00p060N1 @`0S h0| 0h0  | 000 @@ z000c o7 (t4b/`@b40 3A0 2@c-c-c̵4b4Q0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i &i -  0@  -@L`p  PP @  0` pP0 _24 p-RLM`@PPU@p 0-L P@\p 0  30P \ 0 ~P%2(4P4 -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1! L P UR*01P UR:$ `)0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  z@ 0S 1 \1S960S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00<^ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f3 p@T0TS@DT0TS $P`U"0WP 2 AWkPP0DUpZZW ! 0Pp8 |10@0. W3d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |/N  .Ppg. 00 F3aPb4^L;6Hb@;6d4<^ 0R P* 0R P: p-LM0P@S0` 0 T\ d.00 00 0P0`@pD/p[@Lb4 -LM0 @ pQ8 1e  1E# = S000 0S000 0S000 "=" S000 >S0 00't;6d4l4 -LM@ !qR1 11 Ph 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMe.S@ 0`?C0CQCD0T T(0(0 0 4̹4 P P111< 1N P PP1N  -LLMß0qP@ `,0 0 h dKh &hP,0S5UPUd0[pWTK8h R2b3c13d0<3 ,0S ,,dK0  @T@p0d0[WƖ 0  0 0  B0 ƖƖƖ@2 1l0 0yƖ|rh _U 0pWp p00  t0 P@pp0Wl @ 0PƖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0& 0 Ɩ 0Ɩ 0Ɩl B0 l0 0Ɩl 0Ɩl0 0Ɩz`a43 Q00S Q -LM$P8S ySp S p  Wp,0S7 B `<` ` ``VW < @R4p@TP1 R P4D7 S7D4S gV ['Z'Z'Z'Z'Z'Z'Z'Z'6<6x 46<P` W@<\Ġ @Tyrpp iS Sppp 0-0 0 7PS007L@S\',\'X\'\'X\'X\'\'X\'\'<0 0XK000 00CS\'\'\'\'\'080000808070:00;0<0<0: -LM7@SC \ ǀ 0 S057A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWP3 -,0LS1P` QY2/A Vy00S\ \g pVT?>1 g.Q L00E\@Q0?>1 g. 1LQ 1?0@7\@Q $1g> 0@@T@@0`G 1g> 0@@T@00 0g.S L0100S4P34 0-$7L P|000 R̠0S 000S20S@D0T0d0 `0Q00R0S>S "=" S Ra'a'a'a'a'a'T 1S1 RP 7S h30 1 SR@30 0000  p@-1 @^PT * ^0 0S0:W0 0CR  000 ^00S0 00p00d0bT00 R 0S00 000S00C0 ̫ -LM8@S08 -L 0 R!`80`86 P 7S d80d8 / @X  00 P Pu 7SH 0 0S 6Q6  #,@ @@)DX0H ? 0#l0T0 7L@r@P@s804 @ 7S PU00X00S 1S   7@60  00  7S0Ss0P@S ,4 R 666P<7sH30#  3 R   `66O P 4@ >7S 90 1"0L P BT +7S\T80T8P \80\88@ U$ UM0dS5ڈ8'0RA8 R <7Z@ 5 o  p(0  0dSڸ1S p8'0Rp80 8  ,@ 0@z0dSڌ8'0RA8 R <7Z 5   7S 7ST8 4 0 *0S4@  BS0@ 00@T:4 R 4@0S0P 0 RR <60R007YP 6 0@0S <7Z , 4 80 P 0 P2S8@ a aal<5%5@4p44 -L M1PS@ pP`^  "Ks"[9 S 5 `2[ (T 9R 5 R[ 9( xX. 0Sx0|000  B @R0 001S5 006S6؆0܆6"( h 5  4( 5  ػ4404d44 -LM%@: 0S# $ 00P 3 -LM`4@Kp)0 , 80 `XW@<#0# <0 sPa T P ,0 S , 8KP76 06  W@T 8K P<( H 8K P00 < \4<#(  < { <u(@  0 ` h 8K ^P t t0T (@P@TP0PP pWP@@y`aȼ444p44$4T4x4%554 -`LMPp @9# 560 07+ll0X0C4W B  `0R )TS  353576r0b0s c t0 d0969696l0p0t:70x0 Px00x0<7Wx00x0d 0-@PL  #0760 B0 W0CX535367b0r0c s d0t0696969l00p t00' 0 -:LM:, \@P` :\ :\ j:\: :\ `: ,0S ,_x:P`@\ %P6;67S 7S 6  <{# P 4`6{;6 c9P`1p ȠDž \9g> 0  R! 1?0@77 7S7S<7@ l R09Q<79\ 9\ 0`8wP`6@ 108%S84`|z8dP`t8 R 6j 6 ;g4`6d6 a ;<8\ B08\ (8\T7>P`N7!S F64`207+P`;7S8 52`4 & 06  7 S&  X'0o2cH'0047\4 #(7\6P` 7S Pp x0  jPp`6\ 7S<7l7S@$6P`vPp <7P` 0S S Sp 00 0x5P`60SKP @㜐Kp 0HS   0SkP`ZpV0CZ) 11C R# r P6<6<M K6`@pG 0Sp@` 7 ZZ0'RP W<4 @R\,4\ , 4\ 4\ 4\C6@3PQ><6#500#0053\ 3\.7S >1(q.  03\ &t3\ l3\ iPpK!  7S y> P KP [OK ! Tk<607P0KP [2\U *2\6 00`8p00P0SZPp2`V70'"P` ,2\v`Pp 0|S:GK | `V0|00Pp| 0S*;Pp  0|P`PK! aP`P0[ SyN@ P ['OK  7S'R~ 6 { c `<#`aii iii4Xa3i i ~ti8i i 64i|i|ii !i ii5i i 6i(i i i|i8i| 0-!h71T'X7!1L|\'`7 p1P' QPp'X1 T1Q08!002a V2V( V#!V80B@@t0pS700 jGT  h 0@ " @V V  V  V V Vh  V`  VVP VH VԦ'''';6aĽ43aadaaDaa$a -LMl'p7@Rl'p7RTPl70l7 0-LP@T 00l00000d 0@T@ 6 0  <7l UhAiN @0<'00lP  -5L`@ 6 6 73 ) /p003036  037Sr007{  (t 4 p-LM`lP1g> 0l@yT@'0@@R l0S@7S,#6@ # @ 7@S 6 R @6 p{# q P @y7j P  # -L$M\5 `$  6@#<3( 4%03vN @R60627PSs PpA 0@S \ S WTPW/  <\l@2100'R <  <7W R & 06 $0S $+o7S6  7SP &0S !0000o6@$PWp 0 RpPP DpKllA 0  PPDK?> g. 0!LS2 0S2 \\ ш?>1 g. 1LQ @p \`a4544H4D7<'sX  7S0 p-LMT`P0S@0 0 T pI@a -`LQ0 @P@dnDFA 02p Sb` 0 S0 0 000 R00a aa -L`0 @P?@dDFA 02b SpD 0 S0``00`h$a aa 0-P@L G000 00-P@L 8007 SvL' h7S07XL0h p-LM`@PUh80 h8p p-LM`@PUh8 0h8 < ##<7l l p 0-LMHP@0vN K@0 KB 0S 0`a\4 p-LM7@SP 0 pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP7<ǐP@ S`` 0SF S p 0PQ Q 7S # PP PS00Sh'''' 7SS# PPP00'R# 00'RPPV 0SpD96 -LM@PAAP`p Q2Q/ `7P 0iSS  0io!1`R1SP1P0Q10  1 0005  / 10 1(*7霾4 -QLMp`} 001p  80S $00c`  6/`VW 1000@ p  9P21) ) y~ u #q1!S-5 7S  PZ WlPl@0*!(0006S`6f060f50S)!0@00 S 0 B0 0  0f0f$0C0C X<6,<644 -LM`Pp 6P? 0iSS;0@S)0&00S!''''P` 00`C20`0E*S=H''H'''''''''''''''''''''''''''''''''''''''''PX`@ Y@U@P -L4M, PPi `p p6@ 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 ,0<(0 0` p(43 0-0@0PLUPP e@0 0-0LPCS  @0200PQ@ 0-0@0 LPE@0*00 40 Ƒ R  R     -`LM Vp:X"@0PU$ 1 0 q!1UVX"@`0$0$0S !0 ;00,(Pp 0  l0    `T@9`0W@`0`Y uPY{6 1 Pp @00 9<7"`32'R  l0   <6 7<W7`S% 00  l Q00   00  003 R <W `00  p 7#40l` #300lX` #31@r0`0Y/ Y5"`Pp 2!$ ! PP!P PW4  00 M ((0m`mPp 1!$ ! PP!P PUW DH$H0DS0SP T00R00S Q00P00S00T00  0Q00`P00 \ S @7SP00 FT1915r 2 ' Pp 0y00'l` BO@ Stbb4п44 -LM("x`@PU$ 1  !0 !1U0  @0 0K00p @  808bb -L`!x@PU$ 1  !0 !1U~ 0 @0 0;00p808bb -6 pL- dPS @0P0 PP~ `# ~Q 3"`27S  l0  6004 W@0`0PPl`Q00  0 R 0`0c0 0`00  00P006 7`D96 p-LM0PS@ ` 1S 00|0SP0xP0|P0@p000g)5 0 0(20up04D D0D @0@ 0!Z0 0D'7 0!1 H* Jx''y' -LM@Q 0 S66 60C6()Q 0 S66 60C6) -` V `PULp@0@ 0C^SPUU dV@PLPU<V@(h PPUl4{5p45 -PL`@pP4'L'|'' hc^0 . Q( 0@!T\WLHV@T,h  @T #2 "\  x, TDt4|44444p+5/5{544,<6 444444 -L$M@0 ,  D7s 0 l, W0< , W` R8 4 p[0 00 0D0 @ 000 0 H0 L @0Ss 0 \oP@  0R\D 0R ,0D' 0< 0P < H0S 0\  00 P0 \\3 L R- Y' 0J0 W 0 \ 00 W4 0R08 R0S0 0< 0R00S 80@8@ pY, 7S 0S40040 @ -LM 66 600|0 \@  \ L0 R 6 67 6767S6  -Q66 8861LS p-LM GP   cT0S 3 0 T 40P040 PQLP0S@H P< P P `<0X R,   ;0P 4T X0@KX ,0,0 :K  $L4K 2 2K0; K<0K< K 00X R  L 0  PL0 SqP 40 <0 S D<08hD\ ڻ(0\ [0T0kDP˻(0 LSPΆ 0AH0@0 i PD 29Q 0R\ 0R\`aXb441P P .  bP0000 h H00\^Xb 0-0PL 5h0HX0@T 0%H h0X  Q <@T%  00000%  0 00%  P0000Xbp-. P, Q0Q 5Q \ 0 R \H0P X0P 80P ,0 R 00P (0P4b=6 -L(M 0p(0 `ֻBP' 0S <P! 0SP tPU 0 S PU 0SU 00 0 ᱻ(0 S h($6 nPP 0 0 `@T? 0S <@T9 0ST4 @ 0t 0 0R t 00t0tP00 \80K7 K4  H K P  R000  0S0C 0 6ɨ`ꉿ6㽨T`aXb41i p-L$M`0@0 E 0P0CS 0 ; 0S 5p R000  0S0C 0 04( < K+0K 6〨C`a42i 0-P@0L G\0 $ =P  010\44!Q Ƞ Q 0\ Lx0("S*d0"1@ 040\ L(0("S:0" 0b -LMDB^` 0P@x s2" 2 "00`@墺 S` @@ @ 10S!0 0 0 A(P<.$4<,(, 4 "x %< 0! 00 ! R1@(P<4(<"4%<000A(<4,$ T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BDQ1 <1.Xl 0 ,0S ,0 ; 00 0 P  0 0@, T00T0 Tz``aXbX4`b -L M 0@p@A`0d` 0p0#!dP0 0d0  0ppg  -LMK)X? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`遷*xp0 p.``P PU2P+PD?66@6@6Xbbbb4b4b4Db @6@64 p-LMdP0S `׭@T 0 S00 00C0ɭT 0Spb -LMv0@S e000 RqP "2SX00X0 o8 0X000 0XQ0SF 0SC : t 0 00t _P000 "48<#Q000 R000 0S  bF 4X P.P 0%0S q Q \4 R(00(0  o00S 1 a P@P 4#0S#00,3pW 0Q pWp0#$0$ h("( "4 4Z0 "48<#8  `00`0,#00S!$)-"("4 4Z00SY 쒟2  Q IP: 000 @PP@) l"@00@0P "4 408#8#$0$ $"00弬40$"040 Ÿ0 10 㪬!@o饬!d00d0堬1d00d0W L 0Sh 0Sd 0S`c 00 0 R 0S < R 0SR t R 0S  R 0SR|00|0 $R(00(0 t00t00%p00p0o P@P000e P@Xb`b@6?6bb,@6(@6<bDb=6@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0RXb @6 -L M p0 01 cQ c 0  0 RT 0Q0R  R> @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V  w  "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V ` R0@00@ ,$00C00f8#8#$0$  "4 408#8#$0$  ,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP``/0V0C0@  P`$00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@P٪ @dDFA 02 S`(1b1 R0000 0 0! 0 0 0!B W P 0P U   `! h00h0V 0S0 0 0 0\!000 00C0Q Q00yP@P00 nY 00S0<0 0 0 0 0 0  00 00 <b,@6a aa`bab - @LTp ` P R000@ Z0U0C0 R000 0@P @dDFA 02 S`T1b1 R0pp00phk,@6<ba aa -L`p0S000 R P00C0@ T h@ߩ00۩P 80S0C8000hΩ꿭 00 0bb`b(b p-LMt`㽩0S pX@00峩0S㯩00ph骩(P000^0Sbb`b -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@Tb(@6,@6`b -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( Z1P H R000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0P, PE0S P T P 0 0H 000  R H 0D0 P P &Tx D XPi4@K 2 [R3[Q0S 10[#0 210K[8K@  10[0S% S 2[0<KA <0 20[020K@0iPpS20[3 [0Si t d儕P. 20[020K20[3 [0SX0L0@ 0*P H  ?6@6@6`b@6 p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 嬫P@p0,b(b p-LM@0`+TP p\0D #10P^@6 p-0LM$0 (K0 (K'K1KᓫPP+ 4 10 S 80S0C80p00 R0`V @T 00 Q @T`V80S0C80p֫P80S0C80pë4b -PLP& P` 0@10 0 pD00 P@PE0U :0U0*00@6^ p-LM` 001PC@ c 0!0e 000e00 000p -LM1P `@,P 0P  l$(00(0oIP 0S8tX  0R $P 80S0C80ß000 00 0 I\3  0#$(,"(DRD #0RPp 0#!DQD#Rp00C0< 0R 8#0 S0!0# P"(00(0 ",0S$00$0p ,00,0WN APALr(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(r(@r(@r(@r(@r(@r(@r(@r(@r(@r(@r(P, , 00j1 R lP 40 80S0C80,((@(l(В(T 0S p@T 3R ,0 S ,05㒌@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 @Q   @X4A 0@44 3PaᏩ 3Paᄩ t0 0 t0 t07t0 0R  0KՖt07t0Жt00t00S6SŖt07t0t2 R= ; 0t0 0Ÿ0D"00| @_$2X|0 |P h0  HP0  &L@ 0SF   @L@` /#0!t0 0 0A S  0bSQ0\0S 0R @ 000 S @1 0P000 / 0 ?0PèU &0Paᴨ U b`a`4 HA6bLA6p*6b8A6bH?bbKJIxA6bxblA6b6bK^bbbb@A6bDA6bb80PaႨU >@v0P0l01 "! 0?0 g┨ PU  0R? @1 0c0cS0006/ Q V10 R ,* 000  6!06 8CR 6S 1'0 1 0 GP!*P$1`N0Q0'0 !\@0< <m $!0, 0cS `4 000x"0"?08t0`0`S \t07t0V0K )Pt07t0K00C0#(3(#0#R?60  000cS0l#LL10T13@_0h 00 0 R000 0 0 &0 07\0O$$lT!00bSLʠ0X0/t$? R 00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0S \  0 0bS `00[>6t S7 10T01t 0c 0 0bS^0 00 & &0$&?08t0`0`S? st07t0m 0K@gt07t0b0!R$ 1'0 10000S00C0 `af' 0O&0 0 P7bt7t'|'R? R =X 70 S\ L!p00bS P0Q0R00S 0S T@0S\ X10cSL0T1p L!Հ`Vw 00cS0nS 1S:6Sht 0R00 l R8 0!R 410cSb l 8 X  |P h0  HP2@:t 0h!0bS5t0`1 S`500/ 1R 40 ;0S m )0?0 ? /  0RpQ lT@L\X a0lS0VBX: d  0000|  @_X| 0 |P h0  HP40 ' L@ _0St<; R  0t00p+t0⸥t   0L@ +0 ?08♥HPKd`Kƽý\ \  D 0@ @KG0KH@K#0\K 4Kd@KcKK0 &Q Qw ! 0 S- 00 %0 S   0P p  DX Ta( 101  g R =@T2 0R #3Rʌ tK 0P P P  yP1010 S01010P 0 (  0} 0H0KGK D d0KKcK0`0 K]> 傤P   0R00 R PD1010 d0M  00 0~  04 `p0t0 0<4(<"4! r 0 Q1 !0npP\0 tp z Zt S2\ Z h hXZ0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R8=!,=xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00 0S J? dh `Xt ɃXh  r X00R00S0,h00h0 0!0bSHD0ODK@ KPp 2 02$0  1 2W' ˟h00SW ` 0 h  h00c<  80S Xژ\ 0+P \ 0Sy h0| 0x0S 'x 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$Q,!$#, 4 T0x#^7^9ɟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S8ȟ 40!0000@ 0R x(0?0 400t1SV uSS `Q-d1l\d@00@0tp 00 0tpZ1 0cS0Xt0 tP=x,0 S ,.0t07Q ` (R `02SAS6S@7`pópt0`7坘|7 1!"4 40| l t00| m0&00 |@S;0 0H @` S!@( B"40 0l 0|| 00H U0 Ga }FZ 1 0cS!S 0d0 0 8#8#$(,"8S~tv |P h 0bS700cS60(R6rN/(00(00O/"9C1 S 01&6 SƱֱS0ü6l"0@?0⌐L2 R |PU 6S6S@0 R P 40 L0tY0 8S ʰ0 G P!P 0QbPV$1 A@10@1} ,0S P,廒|(N0 8)0 0<@Kk0;K<0K( 8 5P@ L0 ጁ0L0 06$0 0$0Q<0P [ [/ 5t0%K>`PKdK(0D@XK0;808( 1`ab:A66@64Fr`?6L)b -@L\}t0`0p hQ}, N? , O?Ɍ LQUP1 Q 0r0+0r0P0,H0l <^*40  ^:00000Yb:xA6bA6 p-L M@}t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08pph|<00<<0 bbxA6b6b 0-@L|t0P6 S \0P\ L0,  a R 8 80 ?0;0h|bxA66bMЍ -LM Q`Ppn \ 0Sd|, @0V0T00SNTD0@ 0 Vf)),)\))8 )))))) ))0)) )8 )d )T8 Y 0,_|00A 0@P0 0Sx000Dh0    Qh0< P0SK S. EPx% 0:0t T #08000#60 ?0A +P,7P 0S ҿPQPx Pro0 S0S0S 0S 0S 0SQ0s QrPN ᕺ 0S 0S 咿P E;08m [P50- ** 50,H0{H0S0@ 0 QϠ 0# 0 01  00# 00 B0aR  rg 0 0 0r A0r0h0   ᥻ h0   ᴻ -3{U V V  U 0 Q  0oI 0o锼yb`x@X , 8 0tZ `S 0 B0 0  0e0e$0C0C0tJ(0S9@s$B6bMЍ -LM QP`@p 0Q0T00SQ8;););) >),<) >)<)X=)=)`=)=)L>)=)=) >)=)=) >) >) >) >) >)T pZ  X utᬹp mtW2 Pph0 22  s t Tth0  p Ith0  0S 0S$0S(0S 8p2tp *tW(0S!th0  0S  0S$0S(0S9p  th0<<,808 s000zxh0   0o 0o-h0  ;\lXh0  JQtM-pKh0   0 poA 0 o!b(B6,B6dK^@63T4 0-LPs@0hs -L MQ@P`\ 0 \8 0*{z @PiR{0B6b -X0L \<1  %( 00 0HB6b --H0L Q 1(   00 0HB6b -L MȤ@+@K0 0 PN+ ["2S S (00(0( 0S :"2`S0 S 0 $(,<4<#: *0K0S0000 + ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0K7P 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R 2pW @T Vf 0S^ @TpW@ +[ i0, O\`B \B`{00S <P  T0OWr 0pR)000SPP0!0P0060#"t1 @Pgr0`S `r^r000 @@ Wr000 00 0 0R X 0S 6P$00$0`*K }PkPPP+ ['000DPP + [ zbHB64b,bb@c-c-c`4 -L M`)0K p6) [0""S) K S1S1S1S1S p6 R d6,  , r700,1S01S41S81S  Q Q Q Q 1  80S $00c ( pW 10(00@`00!( B("("48<##80@5 I 0 B 0)P[Ui U^40K (40+K,$,"*)0+ K00*K *0K媮*[ 048!,!$ <0##$# 0T000<4p R (4 R 0 R ğ ( B0@ ( B0@0 R   B0@  B0@p#(0/0(0+K) 01P4#7000p'SV 0( B(0 0U  0g0g$0C0C00S S7000300S- 00S S#0 0 0 00SuX (0/0(042 R(1S 1S2,  , ]1p  80S $00c`  pW 1@000 @ 0 000!"4 4`!0庀(1 0 !   440)P[U Uc00K 00+K,$,"*)0+ K 0嶀0*K *0K宭*0[0+K 00 P0#$0$ 090 "4 40S 0 B0 0  0g0g$0C0C %b@64b-QM 0*\ЍvЍHB6 --l2LhTMd 0 Q,0  pP1  00 0 0@S0510205 :x0K  x [0S 000 ,0S ,w0[S 0S*P0p00 HK㨚dK㥚0 "bV< V l000@@0K HKdKc@KG@K\0K  tKPo 0 `1/<1t [000x  㣚P11<<1@D0K GKd@KH@KcK `0KLB6Lb`a4hbD96 -,3L M0SS0  S#3QQ2 QQ Q( 4 4!08#840  co@cPp $1 010 1   JoWx )1014 $`40c@0_00!004$`S` 2 S 4 ,0KB@ ,K+@Ka00pa0$01$ (0C8#8 $ #Ġ0!$ Ƞ@̌,<`,Ƞ$ <@0'K, #$00@0$0$ 0   a0$  0庐嶐  !( 44 0 H 000[7( 000S4 N%Lb bb@6-QM 0*\ЍJuЍLB600@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o闝 @Jy?Z@p ኝ m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q p`a4  0 00 -LM @00`XpW PU (<0L1`0/1"b0bS5T 0 +P:$0WpW6 0iP 0 R h00h0 00pŏP@0000 0*PT@ H0<ᦖї0 SQy)444 -LM ^00 , 4 `@^ p (<0H4`0/1"b0bS 0 R0011(pX R /,@K00@P@000lT<0  0*P@|8  00P4P 6 0 R h00h0 040@_00 0Q0 ,d0X 3@_RX00S ,<00<00, H0 _,0 0^$0 YR Rw<0PS( 0"?A3cP@ Ÿ8 0P@0 oP1 0 R' < Ġ /0 0\0 d0, 3X O,~,<00<00, 0H ,0 0Q <h04h0T `P5 @0 ۔圕@,P 40S 0)0,0 0|录xd<0(0CD0/"b\0P000 0,妕$MQ4y)4444@4\44 -LM  00 $5S% `dp X0P00C 0 嬗@_0 ᨓ a0X0螗0 ᜓXY X`K0K 5"PK0K -"P0S `0( 0 P0pS 0!0 Su@1PŸ 0PY pW!` 0W `p80 W`0(0Y4 a0S- 0T0S" p W`d 1X0/0 M d03!OX p80 W`eba000Q 0 T0(0Y 00@`K/P @P0H00 y@A 00K/PP0 @D`HX  0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S tP 0S``l0P0S 0Sl0P0s  0S0l0P0Zll00Sl0  ,0`@ 0PD妓L#0S0__@L)444444 -LM P@,`Ẕ0 ᶔ4 Ე0<  D 嘔D@/">C2"/P!008BS@ C4p?#@W8 40$tDCY8 ,0 <  004,  `T@,zP@1@#W<rP@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@p˓P 1PBt0 0ZƓ8 0 T 1P-幓@ œ`,@ᨓ`弓VP3"0 SPPP#0 SP8 0圓`80 -LMPp  P,P ,@`VPUPa 0 P` ,@V,0X`VP 0 PP`,0UPV -L$M P@P`4  T 0cSP 8 \0 B0C0 R0 0 0 !d0 @0,@K/@IP@,H"H`Q@ 8  3S ?2 0O T ZBT< !8?\>`0 0/ ?> 00cR#p@[ T80@0aX`!8?\>`0 0/ ?> 00c0R#l @T<TZ!D!400C40 h!40040T0ZCT$@ ?Q>`0 0?>0 0c$0@0C$0 P B 4 T 00C 0 @ 00,m ,,RU `0 0ς?>00c ^$00g$0 P g 40  0W0g 0 40 g0C40!400400,哊$,Y, 0 ,?ґ0 8 W00 ?Q>`0 0ς?>0 0c8 ^$0g0$0 P 4  00 0 40040,0 ,U 14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  P80PU,080 , 8 8[80`h`0P,080 ;U <4 -LM `pP@4 PP00 0 0 !d0 @0/,@K@sP, ,划H Z8  3 S j 0S P2 U0O@ @P> Z!\000/ > 00cR#< 018 a^ Ϡ\0.QA00/ ዌP  p1@R\0/ P~PJ @1 Z\0`000?0Q0P PP奍0.Z\0!00> 00c# 00 0C 0  P B 40 P00C0 ,0W U0 00 P 2 020 0崎U `0 0/ ?>1LQ 3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480  34R`008008?.a 0 bS1P< 0 2 `R4 `0RA 4 P00,$08 0a$08P×n 0 0n 00000 P 000\%1R |04@Pዎo@P჎0 e0` aPEul1 RX0  2000000 ,1 RT000T000 0\0` Z`0PB D P! 0 R`0   0M000 P 0 000\%L0R|0Pk0 ('(444 44U 00cR#0@g0P 0 S P Q,0` XƊ, 0@ 8,0, @/>QU B6t3344<4\4G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 t;00 嘍85 0 00 0 @ R@  PU00\pP@ H` VV V 0 4R@_ 0S}:0Sy:0 @T00 T00S:  Rʴp0(`VP@Pa P@P  0S:0S: 0S @ P00/P P PV; 8%0@@0L 0`@V PU  /0PPP (0 P0@ xK P`@ PP 0x0(    ႎ 0S:60S3*@5L 0`(0 @ xK 0bPP \ 0/PPz 0d x0X2O 0<H囈 @0@P0`|0Kd KPPP | 0` B| 1X`tKV P >   pd G 00/@K@rPPR`G|0H Qa V p0S @00xK  PP6x`` d G 00/PP d0X3O0 00 H<70dK@P @PP ?Q00Sa 0 B   tKPR0s @0 0t@K T` *0 :00T`:Q00 V0  0OD 0 h00dh0   R0qd0G 00/@K@P @`0KH $q 0 W  4VD@P`K0! 0 @ 00 xK DPP} x`\` @00/PPY d03XO0 0 P0`@K!a X%U0<Hj0@Pn \J  @00/@K@YPP90 05P00/ d0X3O 0 ,@ 00xK  PPx`Xt` 00/PP d0X3O pK H<0@P{PP` 01X` X0 0  (0 xK00 @  @PP[P ᠌@@00ۘ0x1( P U  > S>00K L0 R-PK ?@K 00 KKK K0P00@f0S:0] ^MJXax44- M Ѝ -LM`< Tp$ 80  000    0 08 00R00S 0K/  0 R 0V 000O 0 R V0D  0 R 0W( 000O 0 R} W0  @ \0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RG `p 00 0 0$@Јx܈`0d CB_00 4@K@P@@0Qx崈40 H Y8P < T0$ @ 44A4,5Sʴ0 70W0   W 0000qV0]V 0000NT4 -LNKgMTQ`U@|a &8 0BRS p 0S XQ0S R mPP >K |p`,0<4 DP 0 pSlq  0~K0``T\OX!QKlQTa45S:05XqS*NK P aS?K P0` 0PP 0 R 0^K000nK . q L000  0L0K0K lX850p1  0 R 0~K0l^K000P `P~K@ 00@.K@`Klq8Kt 0KPSo`t0崀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Sjt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pմ000  0PRoK p 0S㴀1( ? 0p0 0 S0p (0P UP@K p 0S㴀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0  XK@ 0 l`PtS/ PKt0 p0QO0@H K㴀t 0S t.Ka00h1dA0e@K 0 RYtPt Z\@ 0T PQ 0SG 1p0.Kh1dA0PE\!0OT`aS\\6 0S `a.K1p0h1dA0) \QUlQ0 0S ^K000\aVBlQ0QT @aT pմlq^KT0`Q3/nK h |a p崀d|a 0S ^K000 0 R |qg /0 00| 0 |ah00fh0K0`q WNKlP 6 p 0 S# 0S:0S*la LS>R-`0 .K a0000Q관 0S:0 K0w`a VjNKlP  0S" 0S:Z0SW*la LS>R-`0 .K a00D00Q= 0S:0 5`^K1( 0O& 0S!0(0 1p0p` U pl P01R/0 0S:0S :l0@h  &| pഀ| lKS>0 lAL R-NK ?  K00@관 0S:0 1( nK0O`!SlQ~Kd _@FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l1h0 |AxQ p崀@|A c0t 1X t^K1X a0OPXqW0K0 ta0R00X0  p崀0^K000>l>KP a@@A NKPp` S?K 0P0 PP 0 RY 0^K000Wl0@ 80S L1pqHgL{ LrL VlP 寇 p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@관 0S:0 0.K00.K0MT 0( S/& 0S :0S:(0Sh0S 0S 0(pS   0 R 0 0f00` 0S:0 0TaS鴀Xq0S0TSXa4 -L4M0 4 0L P P80  \ @ D t0@D@T D 8Y D:00@p40/0DH@ < 00 m3 ,00,0<0 <80&Q0 <0OX  <PP80<sH/ 0@ TT Tl#T80BPPXV`Q@ 00 NV<0 H@wt0@T !t0@TT0$ @<aPPP @t D0@B4  T0cpa@DVWD Tp8 RQD娃aV2@Q( L2L"@P@dVDFA 02 S`1b1 R0@ @ @00UL0P@TC< 00:00d 0,KC" 00#PPP,0LP L  0R0d ",K P0P0LP0 ,0PL L0H0 00L0 <av sB@ V @TG T  TB  T? T Tp  T8h  T5TX T0P T-<R `0Xaaa aaaadaaDaa$a4 -LM @0KPP0 K 80 D P 0 5R/; 0S&:0S":000,@K 0/ @ P@8 R,854H 0 80, , LRS>-0`pǏ00 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠB6t33800CS),))X)))))0S0 #Q00 #LQ0 R0S800CSĺ))))))))000 10B0  2 R0  00800CSd))X))X)X)X)X)000 10B0  2 R0  00800CS )$))D)))))0S1 S20#B1  0S 00 -L4 -h1LM`Q`!00p|P@<1S΁D 0 Q/0D@$P4`P05S`P RD0D0 0 < $0D000@ <T0#PD P DPQS. 0N0P0 SHŒp011pGW;00P000 0R-0K0`@K` ? Kh00 0S:0 0SZ0V  WDHP t {@  l 0S1 @@0S:0S*H H@S>0R-LPK ?`@K 0H0` 00p0 0PK0H00p P K 0`0@0 0S:0 @ H@ @0l P@t@ BU?E6 -L\M0 08  4 00PL 0UT0 p4@80S S uT8l  8 0l R0000  0S6d |6X 0S 0lS00S 0 Sl 0< S%4%R:05S:8408 0P0R00S T@ l  R:0S*H X 0SD 0@K0T`\ ^P <0l P x<8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000$L 4, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 JP`\0S<@H0 0Sf ,X00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^)V T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 %,s,,0H Hxsr< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPbP@@T0( R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @Pl@..4- -LM@ KP 0 0 0-@DP L@P00 4 0 0 -( L0S 00&^ 0-LMP@ KP  0S 0Sl0P0S F0000 0- D0@L PP0sf0+6 p-LMP0 @B 0  P 0sM 000Hp @_ 0S0( 0p00F0@8@o@p+60 0S00D d< X R  0S 000 p-L M0@ `Rp KE0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0  0H1 HQ9 H1L 0RD0R T+dDH!0S< L 0S L10   R 0S 0R H!  0SH1  p00S@( HP,L)DYD!000@!8PD0 0C0 RD  00C0D!000080: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u KPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp \ 0 P 2 ,0S ,OK0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000rT1H !e 0Pp3TPpMOK 2TP 0GpW y V P10[o0 0C000C00000000PJTr  0S00t00t07`a b41 1@R#`@ P; j\!0bR0S- PP0S$ P cP@?>1!D , B 0H 0C0,Ѯ$0"A , -LM `,劂PBP00  0Ɩ6 ,@K@P^,0UH(@ (@[>1 1@R#P  e> Aq 4XP/ 0lQ0 PPZcY.!1E0,0C000*  R0C 0,& 101,Y(0Z"p @WP;  ${Z ,啮D4@4h44 -L M Pp``$M[0V: ]Z , 6 $@K@dP$0$`H@[?> 1@`R#  0,0 00D 00$$F; "ZX4 4,4t4 -L M P`A \00\0SE(Z,6倢0 0 6,@K@0S-,0(H`ZAp Q ;  ' 0,&0 00 00 Q,& 10C1X0,园Y< R,; yX wX444 -RLp`$P@ $P`ZA0Qd WP 0l1 P0PYLKXP @WP; Y D4,4<4P4 -0LM ; qXp4 -LM0   0 Q0p  0 Q0 Pʴ A0(PU /6xKaP`x00x\(0 j|K 0 P`  | p(0/006``0x &|0X2Ox00x0<HWx0@`0Kd KP` 0` B 1XPtKU ` (  d H 6/xKP`Qx`@K H0QQ U   0 |K  01P`2 |PP d0H |0/06``嚭 6X3O d0KH<@V0@`P`\@ 0Q xx]x嬬 t@KTpO:Q" +0\ ʌ0dKAP 6/PPWx 00: 00x冬0 @PW 04C0 00 0' 0QdE 6/x@K@bP`0Kx 0H x幫x 6Tp:U=0! 0 X|K 0 P`0|P P00| p Q x劫/6``` 6 3XO00<H V0@`x弫  6/@K@P`M0 6/帬 6X3O 0 |K  0)P`|PXP tP 6/``喬0x &|0X2Ox pK H<Ux0@`xP` `0| X 0X0 0 EV4 -L M@^ 0    Q -LLMT@d ` d h T`@P刀ԡ 04AX@h pTXpKU\PK  0%P@}Q\ ) (!(0`1@  R`@0 P` V@h0S ,!$0(0Q ` 0 A1QXP\ p< U@o T4 X)00d 40 /00 C  H\@Q0U0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pX(0S0O@0`00$ `V*h SH,!0 0Q (003OX 0P0 ,00,0咭P@ / \PXa@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` R 0S 0S1ST0$ %$Ko$  000 0 P 0S  * 0 0 p -LM@TP$  0`K00" 00 T00 0 U00 \ 0@0D!0 000 00@(` 0@DpV,V0RV$V664@K @ΨP@ 4Ω000$@V40 H:00 :70 XY 4 4Y K0\ O'Pd l1ğS t@t Pl1 xU:h!1!@P%@dDFA 02 Sp;1b1 R0``00`j%0@yh!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,H:0 0$t  l 0t!p! i `^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5`aaa aa4aadaaDaa$a -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `h@h0@ PP<0 X@ \ h x  4T0$  00CS4` ḨPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S-p@L@ pP t t0 BOK|  @K P PPPp80S|@< D0 ,0H @0S 8 R8 R  Q00 000cSH S@  < 8 Q  0R 0P0 0P00 TRT p0SLQA0L 0,P`l RRKx0SH 0!RD 4@T0$ =0d 4PPL8\$ <@T 0R T T0t@@Q 00 0 X+\  4Xp 2060| @K OP0 `@X0 S0;04p ;06x Rc 04d PP!0|@P0l00S, 400 KT0PP 0   d@Q 0Q 00 R OX`\ 4Xp 060044@00@0` ,g}8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  |t0 0c p ?<@_UT pL ,K/0&PP E64<4 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@NM444$4D4X44 -LSMh! #hA0  ,0 6(@Kp1 34  L0S㈀ `0 0#60C St*D*l*L*l*T*l*\*l*d*l*t* A?(K h1KK  QhA 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa KXP@`Q0 0R@`pd0S0@ 0Pp@d ` pP0V`0MKS >K>Kp @Pl!Pd0P0@00S c0`P/VUh1 0a@ J H F D B @ > A?(K <`a444 -L M@0K RK/P 0000Kb0K/P*000000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S*8*`*@*`*H*`*P*`*X*`*h*00$0000000000 0  -L pdo^Xaa^aP4x4x4 b -LtMp Kl @?PP$< ԑ< R  5PP  9P3 U < $< R $0 0 Q3 S< 032#  Q @0(0$ ,ᒭPPc`80Sz|0" 0Qp0 Q $0x LM 0 0PP K $0J 0VP ZWUԑ0K!A aYGL0S`"Z @K0KY AZaFG\!0S 3PSP1 0  ,I@`? 0KA@a'G ,P  D Kٶ` 0 0PP  - F0 bPP203 <$Xo^X \ T0R0 0"0   P X PD L 0T0 8!R 00T0 0 0d0  X 0: S "H0 T P S0LP0 0L! !L L0 0Ph 0 D(hX DT` 0\Q ` R  R XEP RHΪ TLPA0 H HK iP6H0P ST  0P0 P R P T0RL0R x?P0L 0R T 0  . 0 R* T0R& P0S! P0ST@兪YL000X D1P L 0! B!L0DoD刪P0 0: S YTL P` R00 S T0! B!T IP0Y 10C1 P@ 10C10 P 0P 000H,00 0 0y DK  ̦DPY8 pL@P 0PT0 YTQ  P RD`Q00 S @PP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0 P.0[S L d#9"[X3R`  04  0 D 0 OT P aP P0!RBY 94T0L 0R` R00 S T0P2!R !T000P0 PL P? ` R00 S T@0! B! 0bDX  0 H0P0X00S*X"0S TL Q 0 0 0 X DTL 0\ 00 .RdDX  0[X 80S  H "D 00 0 0P 0DK 0 ᡥ D 84H4\4X4t44..4 -Lp -LM @p0`0i(0K PPQ(0@ 00041`!( 80 ! 0 , 0BPP ~PP 0  +(0066 000( 8( P P 0;06+6 b -LM @Q 0S00 h 0-PL@ဖ 0P 0,S i60e6bb -LM@hN -L0!&R 0;4 -LM@!00CS  h;44T4t4 -L0!Qh 1S 01 0@^ 1 ! 10@0;44 -P@0L`$ 00Rp0V $ Rr   0h -L@\p`P 0LS0 $ RU0V $ Rr U  0h000hT -L M$$@ ( 0@b34&6b -LM! MP@ !n9 -LM@bb b$bPphK5b -LM$0  CLPH0"v!&`Q $0Ss0K 0S$Pp W a\0!011` g01$N$0 Ss, , 0 Ab b b Y00X0S@0 bP` 0 40 ,@! @d= 0 <0 !< =A@ 8 8 !8 = @80 $R  !0=00@ 80W$aP0000 !0011, ` 4b8b<bXxb g0X bY bZ b Ab P0 l$b0$0f -LML`$ 0C#6PH SpP@ 01@ST0S @ T0!@R00R0S TH 0!P  0-0PUL@0 !P!R 0SC Q 0U0000hJ94 -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH sPL 40040  $  $ 0S $ 0C#vP@ LP0SB \ H0  0! ! !R&\  l!700CS0 $0Ss40 040H L@$0  CH"&0000000 0 ! 0 0040040  B i -LMLX30 1,0 Q@T< 0S%0 R"2`)pW0  ```2YW  .0 0C0,0 q2A02|.XW87020 e8444 p-LM"V@``  00b0eS $0S 000  pA844X4 -LM@ b P$ !60 $R01 0$0 -L@ MT, p$PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!117000 44 -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@ `F -R00LM@p0@PAU0$ G Aa0 b0$ @0S b0 0S0 b P0 b b10b$  ?#>C@0bb^ -4qLM|0x 0PbU|081  0jP`5  䠟 R0@0& ~  P `0S00@@ 5x 0 0Q0x h `0Q0`  b @76b@H6a^Tb44 |00`|0b-8`0P0 0C`  0  Tbb 0-@LTP 00ST 0S 00 0C 00TT`  0`P0002 0201@Tbb -LM 0@S0@0 S p00Cp0bP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TP^ p-LMP P` P p@ ? `202gC+ -(0AL0$1@TPop 0S @TP \~/0@S000@`p@ 40Stb p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 V0 65tb4$4 -LM @R)(0 Z$$ aV p@P0S@PUZ0`,0V$ Zca|o 00?p00Cp0@T  @0T~n@@ p`0 @ L 0T0Q00S ,0V 08W@3@H60>0 S   -L MRP`HA \  ^( W- 0o0 0r -LM@ 0H*0H1@H60 00@- @58 0  0 @2(  0P 6Ob -LM 0 T4ܲa -0P@LT`p ,0"  @TV 0 R@X 0m'@U10S SL0 Q* Q 0`0SpPabPH6 -|0LM\ d '\0+ KKOB>$)!I (bTbb`4 -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ 9 P<   X00 P00S 0 X3ZP<@e, T @!8 < P d0p` @000 ` 0  0P0000,h 00K L00  0P<\ F @H643" -1LM ,0 0`fp,@p娐PLA P 0c,p^,K 0  n TP@ 0J P00( (bbTb^^8^b"c'@H6|4 -LM>\0ǠȠŇ@`P'0 ` p P`P000ZU 0 0 00 0JP(' PP 444 -0ap #6RL`QP: P@ 2% " ZU:J"@T  P PU@  0S:P 0S*2 "!6#" -0a #6RLP Q@: PJ " T: R p$`QV  @P 0S:Q 0S*! -LM.0 L (0K^ #̌P@# 0p` @@XPD ,1, UL0`pc!  0 { @T  ~0 04 =jzZEUdz,4H0 h p0S %,0 0I@H6<4"cb 0.  0; -LM0@`p P000 `0 mP0000 . . (0KPP  0  (P L43" -L$M┡L~(K!@xp00 `@0 P@ 0`PJ<1, WL04 c P` 0P@  4 PW00S,,4@ `%0 @@@@Th40 44 4 zGk@%&Tb'@H6H4T4`4 p-LM΁TL0K! 0@`P `@4PpTb' -LMPNPA@Tp`Lp,K, X0    \$ 0,LTb'40 -L`@PUT@@0p*t@H p-LM@P?`*ph6 -`L0S 0 !,B$ R; 00S000@T `p`P 00@0 T0,  S(<@0hbq^@H6bb<%+0 X%+4 -LMĀĐp@T 0R 0@ 0TP`P @TPPU  0P000S }bb@H6b4 -LMPx`xp@0Th `U @XD 0SW0 0C 0bb4b -LM@  0@00hbb -LM@p@sX`P0S@ 00 e 0&@a p-`@LM,P00LP (@DH@@P@T 0@F @@@p7( 00S0` ph+4b -L M@`p0 P000 `0t 0P000 ,0K 0  ,PM43"000 - 0 BRL` LP '0 @P@dDFA 02b SpD 0 S0``00`ha aa -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php p-LM00PU* `Ph@T T10T1h0T0pP  X0,P0 0tt? @P `2"X0 P L@TP8}0@$ Q^Tbb$Q`DH64@H6bb4 -LM@T0<<hY((h  T1h@0CT1hNbbTbb -<0T  P000L0P Wp1X!Wp!, KP,0,  , 0Wq,pQ@J 0S *40e<00 S^@T 0S:Q@7 0S4*$0XJ:08`S0 8088 <R ,409 0D0SD00CD0,4000 $ 0 ,D  00Y00S@T 0S:0  0;$ 0 00P 000  ] 000 0 ,43" -SL M@pS0` P000!`0  P0000L0P X1Wp!X!, KP,0P ,P 0X,`U 0S *$0W :@PU 0S:0   43" -L M@p`0 P000@!`(0,  P000L0P X1Wp!X!, KP,0P ,P 0X(,`U 0S*$0W :YPPU 0S:0  b0  Y G43" -L MPp0` @0000%`0  -P0000P L0Wp!X1X!, KP# Y,@X 0XP,`T 0S*D0S: $Q %* R3 0S0R@ 0S:,@T 0S*$0W :D0S@T 0S:0  0 $ D0h0   ,`T3 Q0*D0S40  80(0S0p X$0W:D08 0RD0 $Q %* R 0S|R@ 0S:000  ~,@TE QB*D0S[ @T Q:Y6  g000*T 0S*D00CD0@T 0S:,@T D00CSD0 @T0   < $ @ 000  ( 000 $ 80wP T $0SD00CD0@T $0S02 0\ T00  43" -LM0`Pp @000#PX0 P0000XHP,@U pD0S PU0 00  $ Dp=000@ 0  HP,pU 80S D0S$  0CPUd2 H &RZ 46 S\ P 80SbPU000  eHPU= D0SG PUX4  T000(U@ 80SD00CD0PUHPU 80S PU0   3D00CSD0 0 $ D0000   $ 80tP D^4   0(\ $@@D0D00  43"b -L$M@ 00 @ P L0Z!Y1 Y !, K P ,P 0 S*,40 $ ZQ 0\ 0P S:  QP< [*L080 ( S4 + 00 ( 2 R$ $0 a Spi piW HD DAP` @T 0 00CSdg+g+Li+Li+h+g+00S3 zW $0 Spi pi 0`4, P 0 , <0 404 00@ @4<P< P  Q:@ M<Q2 ȴE 8 0Sʼ2SD:00CS0@+@ %aLH64 -LMp KP`@PT  *,R 0T :800S$@ T: -LM`p$@  0P@b -LpP @`00S0 XW 0p09p 0 0 000 p-LM `P0S @ᄵ @=phup -LM P`0S   @j @#m[`p0 @000(!`0 P0000 01 LP 0!`p0 @000 `0t ZP000D,0QLP.0  mEpA43" -LM0@0CS0&0`p P000 `0 P00000S900@LP P 0KP P 243"b -L M `Pp @00d#0Po  @P 0 00P L( HP, U0 4 p 0S @0SE "S 8@T LDpP&(P 00S0D00D0  @0@P U0 0   $0  CH"&0 0ppr@T LPU(P 00SK40p 040Dp0D00D0  @0@IL R 0D0S  0pp>L D0S R R 4 <004080$ 0ݱ4 <0 80 $ 0 б$0  CH"&0> R43"44 -LM`LpP0 P@@$U, H@,PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@T44L4444 -LM@0`p P0S+W@T   ?C00cSP @TP ?C00cS <$ 484H4`4VUUU\4p+5p4 -LEM00,0  pKŸ2"KoK 2!4@P2 0 000 0P  X( " @ Q  Q6 T "0&! 4!00B@@T  R R R 0 ,0S ,R0  "0"2@@ @T   R R  RXRP`a|4@343444(4tbT4l444dbTb444(4 -X0X L1?0c1Q< 8 80 ?RhD,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,Z ``0K 0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0@ lPD  H D H0 KP 0D0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K j|Vp:00L00 S  0<S: H4@ )DL V8 (*80S0)0K 00 Ha9P 0S)KZ )0[ S  )KjpBV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,  0 @`` 0K VP000 P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0PPH 10S     0@ |0 垹P80 J,0( 0C,0 : O, VʦU^  R  1 0R-*  ( -LM`P @;9 0S6 *S"*`R 0T-@PbT >0N@T# 0U T p  00 1  ( KP(0$ @D  PX -L Mp P  0RP p`R >0. RF 0WCZ@:SW<: @0` P000 `U0 P0000 0P ,0K<0  ,P0  43" -LM0S  *"*R 0Q bQ >0Q 0\  0P P  -LM@ʠ,ʠ\  0R lR >0. R 0^  00P P -L *"*R 0Q& bQ >0Q 0\^ T+T+T+t+|+++ 0  b  0 *  0 p-LM*"*R 0\-b\ >0\# 0^ 0 H,&R `0d$&@PQ:`0S*#p  0P ppb -LM ʠ,ʠ\ 0R lR >0. R 0^  0\P  -0LS   0 ` P P # -L  -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < P@<X0Q9 `p0 @000x"`0d P000@- 42 H)&R R 46S  @ ,  0,0 0P@, \ 0 80S 0 @ 3T 0 < (<\ Tlj 80S   |0@ 0 P 4 00 T|0 0 , :#:S 05$43"bVT -p| '6JX0@@P`LAE@HVT 0 S @T8 0S0STb2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0bdblbtb2-0C22HSD000   202  B dbb -LM2@ P0 00  202  B 2 0h0h0   @@2402   r" @002bdblbtb2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0lbbdbtb202c202᤬840 #Q:0 Q: 10b1b -LM , 0 "X00 ZY"0@0ŸT0T0\ XPx ^ `Y0  a0<"6AB4  8 (0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@004PXL@L  00 0 c8% 4Tbdb`H64Q`H4bB},Q`b0Q`bdH6t44 -PL R: 00B 0 0 P b4 -LM,a> 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $MT: |᛫Ph5*DD@ራ0>0>0 0hH6,Q`0Q`4b"c 404 -LM␢0^@xRxŸ00ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UT 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0U`H6Tbb`44 -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0XsT 0@P<04m(cb44`H6bb404l444 -2L M0Z ! 0CZ pWpWaT1Ό 00 PPP00 T Z !0Z00G Z, PPX0Tp3qPU,  Q 0 0 00   #&X:P !0 0X P01 P#&:XP P!UDF Z,u<0X ,00 oo`H6bTb@H64Q`4 - LM 0\ , 0` @,pP 000 p8 00\,($0$To`H6 4bT4x44Tb4 -L Mp,0 `@S0  <0R4 @0R D0RZ 00S, 0 Q00S(0QP 2|2< Q p2 Q 0 T~ T(@ 0!` Vi Q00000  B 2 $00C$0Y 2 00 004 04 00Y,0"S 0",I` Y 240P2ᣨZ% '&:X PP00P%,HF  0`|,0 0 0` " "000,1` VTu41`V a VibbXaTb b4 -LMp\`P-X* " 0`P "%&:X PP00P%FF`0`  0p' ` 0p " "000 #&:X P00$  R 0 0 00 0   R 000 0 0 " "00C0"0 0"Tb -2L P0` V0 2Dr# :X P $ R 0 0 00 0   R 000 0 0V " "00C0"0 0" 2a |aR 0p10  0 " "00C02 0: R $12 000 202  B 2S02 00C 02<2 0@0#000P0P20$ 0R0l0 4 h R @0V p 2p 0 2TbbdblbdH6tb -`LMVp At00TPPU `V2  "  0S 0$"2 - U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V 0!6 4P0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 0210@T0 $C02 !2022  0 p   0!6 000 `0 0,A0 0 0 +b -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TX 00 dP Рq2@ Z00S 灡!2022@02H@Tb$P,+<+<+<+<+$+<+<+<+<+<+<+<+<+<+<+,+<+<+<+<+<+4+<+<+<+<+<+<+<+<+<+<+<+<+D+L+ -LM`t`@`0< pQPP 8"@ 00h^ 0 QTbXa4 b6pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0bVUUU -0LM @`P< ) `@p@ 0Gp1 0V1`0 p @ ?CSD00D SD0\ ,0,R0SXaTbb4VUUU b -䐟LMp 0`S' PS00U 008 0B6C0@``TP,0XHl`8{i(,J g0bb bbb@4 -LM pW     ? W̠ b D@D0@0S0  S  R P U ' pWK 10 1 @0="0Q/S 00 0C002"$10$1 01001 @pTR 20p00p0k1 0R1000@ 0S04ʾ0  h p0S 0 l h0R 002۟0X00 \ P0S P0KU q 0 0 PPP Xd| Wx \0KQ0  @h(41X0P41 0P@ ` K0K0PXPP@P > Wp  402"  Q  ゟ  Rg 2d0 `0K$ T  T!ᆟჟs202h08! W8!  2  0a h0K @0 0@0!6 #k K LP 202 @@ T K 0 !6LD 0 P  ' 0!6;0P P@ @@ 2(10(1,10,1#b -8RL101@@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  Wኞ<1pG0<1 0!6 nP 2J02 J `2"02p T00R00 S n8,P101zbtbdblb -LM @00 8 @븡4 ( 0 S< * TP'*0%Q :c0!Qr*`, @2Z U:< R0 < R@0RD 0S4 <Q<0@ 2#40 0Q!00@00 00C0" $0 0C$0"82Q08 200  00@@80<0 bbbTb -`LM Vj3PP >0^P%&@<  0<S V# R 0SS:넒0 ( 0Sa 8 4 z \wH$&R:0Ra0, 53:q 0,&R:0R03:0S @1,0a<1pP12" Q4 0*R0#  R 8P, P\ , 1`ABPW2#40!Q0!0000 00C0" $00C$0"0 2b```"00 PP,00S ,0 4 0 < R@0RD 0S<$04 0bbTbb -LMp@T' P`Q0000 0002000@0$ 0R@0$0 4 @TiTbbdH6 -@0LM@T 0( T  @xH64 p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`pb4,4`4444@4p444484t4444@4h444Tb4 0- LM0PS0P 0PdP0eP!\0PPPux@Tp 0@ \ PJP L0 PB0hI0abHQ`bdo^484DQ`b@4H4bP4 -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @P@dDFA 02 ST1b1 R000 \ HQ`ba aa@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0HQ`b -X0LM\  0R \ @ TT000@ؼHQ` p-d0ML` @P0 K@ @P0,d(4pDQ`t4-X0^ P ($\,40\DP ^HQ` -EMLPM0,0 |$ p߽0S S P@,P `V FK@0D @P4 L$ p t H _P@dd00C@S񟗔++++<++X+80S|0# @eʽ3 ,0S |,p,PP@ @ \@堻 P\㛻#00@d80S|00 0080S+  x\ 偻BK@$@0PP@ 80S \\?<0UPP@ 0 K@\ pEPP@  STz @vB~KpGpGG>K0C+P@F jT1` _dP@a0SIBKAG>KA0C+eP= 1` Y( PU! WpG 4 O#J6; 0P@An4$P`@,DTU WpG Y|@<0@d |4 `a|H6^44aL44HQ`b -L|Mܒ@0XpP 0 0ᡂP@80S S @0X 0 0᠂%$ P2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !0P C@\0PP@ 0R50X @00@0 !0D!000dh00h0 !T0,0 $4>0CFT0 0bP`d0 RP 0K 0@P@qp KT$;, PP@cT0 4P$LvꀰaQ^H64b b44404X4 p-LM0@( +($00PP(0; (BP` 0 00p@80S$ c0@ P0  ́t$h00bh0@IP oL0(,$040m\Vp@ N뀰abDQ`l4 -L M @ 6@#8"0+ -L M@ 0@8"0+ -LMXp$K4#&:@cP`! ($@Đ@b0O&#J86$;\ @ \@Pi0OiA0 0+400 PDPi 4 -L,M< @@ v`dvD n@D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 -4K 8K,0K塂P40s Z<Ld  ?80P@f"pd1`T1P)@ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x0^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8  e$0 0e#&BT4A- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -L0HK 0 x0P@/ U8 W00W00SbP R00Q0#02SXT0 0C0 S UMX0 a y0HK 0 x <uPP TX 4Xa p-LM0 PU@ p0 S@`@0P0@0 y  u Xa -L M0 p` 0S 0S0000P 0-LMP1@0T0 U( T0S% (@T@T 01 P0S @0@T0h߱0  (Q,0,0, 0<0000S @0 0@0000S0@hcLQ`TQ`0S@-+@,  0 000@{(4H6H6 RQ-L 0P0000 P 00S000@4 RQ-L P P 00S00000Sh4 -L@M\TK K < 4 <#:0K [0*":("0004 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$0004 -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0WP\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: `P, 00 P @0  0,\,, P , #- 010く/XcXapc -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#hw\ ,,00@ P c 1ep`PX UPE000P:Pp 48<#hH\ d,,00@S P K`P P >4K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P V^P 0S \00\0_CK K_^PpQ|XL5T <5T5` (K``Q P K0[ pS (K@K K 1 0 1\K^Pp 0P WY e^\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#0003T 3TU @1.WmUy @1 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S 1 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0fn 1T3+e JaWu 0Q0 T 0Q0Q*00Q 0`aliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i \4h4Ri Ii Qi Si Ti i”4Ni0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 & 5 -0S S/cH0SVG Q@ HP`PP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q8(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,pP0005S Y eP d0 UKY5$#Ġ0Č$7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dK2\K0HKd0KcK(|Ɵ@K.44HKHK GK3K0P ѾP@   P 80S0C80ž@T 80S0C80ŝ .KaPL 00S 00$105 H0Kw Ph |şP.DD0HK CKH0KGK0P 厾P@7  P 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cx4 R*) i(0  hɾGOK@HK dK  ,ğ(P0Q Q P  ᰾ .KP 00S 00$3 R /  (0Px᏾^@K@ZXß HK( dK0 RP  I v=2 R (0 Y hK jP 000 ` /P0 82 R 0L Pa 1 R0 1 0  CVD  P`7q 00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`C U 0 R 0 R 0[S0[0S[Q5#$0$)K%"48<#Q !PS`aM^T< PU p ` 0S0C 0 00 R 0PV PpP}0ST PU p ` 0S0C 0 00 0@0S00PVPpP[R`\4@-|0\ 0S \ Q @ 0 0R 0 0^@0 0R` p-LMp`@PT 0S @T 6㾣@0 0P0 S00@@ pR` -p0LM@T 0S @T P P R0600 h+R` -LIMp`0,0 Ḷ00 P 0SvP,6 qP`g 0 0 PU 0SPU6 ᐶ100,0 S ,0SU P 0 0 0R 0OK`0`02MK@0K<0A1T (K 000S< Z R0600 嶣 0S0C 0 HpS/K :700SP` V &P 00 0 ``a41i -LJMp0P 0  0`0CS 0  0S < R000  R 0CS  NKJK00<0 K 0-K 6E`a42i -pL@P 6 㗢`V70 0 @T6@   -LM@P6 P RP0S0S 00S0 0- @LTP 0S@T00S uP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\H^\Q`H^ -LM0@S S  PP P 0P P P0P P3 -LM@PPP  0-P0L@T P0 P0@T00Xc-P* 003P: 00 ? >-RALQBp`Lf PUe 0 S\D@ @\P0 S `ap344 -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZi04bccK^4 -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0K^ -LM@ @0T0  0 R @T0K /M%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* P4bH^ 0- LP  㺟 @ 㳟 㬟;0 -LM@; 7 4 h0 -LpMpxPK0@X 0 Dx0 p`K'D\D 0 00   00#0 Q  `aaaP4 p-LM P\ 0S \pQ  R X00G\`@` \^ %P QP ;PTTP cP < ]P T# T 00#0  p  IP00 0  00  0 00   d#PT0S 000   P GPP PT@#H^H^ -LM@pPrPT T kPD P1@T T `P, @T'Pa0S( 0S 0 @ `( PpP@ P`p(x0 h`0S h(0( n@`0S(0( < `0S(   4bM^`4444 4H4 -LMtP0夀K@(x,0 X  5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  4PI@%P 5X0S0 000AK`Q @K@KKKK 1 !0 1\ڸ0[00K [ K  QP ,0 S ,' QP/P t0 R0 T KP ,0 R `a$3t4M^44 -L|MPK0`x@(p$0  FLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$80 0\0g`aD334M^4 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [  [000[S  A0BS 000S |@KX-AK A [PKAB00l0 0 %"4 4  0 w$0 S $Bl`ad4 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S p X0S 58J0 R (  x0 R TPSH,K_PP`aM^p444H^3 -L0MԢ0p(0 : PU 0` RP U PU `0S6 VPDPKXB:{T0S( *MP'WZ'08 HQ 1 0@80zHP10  0Y P E,0K8 P<080  , 0R0% ~*0oR`R`cS`tK^ccpK^c ccl4 -PLUp `2X !@@( 0 AZ P$4D 00b04 00C0Ycc0 0   00 80<808 8<<80808 < -LM㥧㡧0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0Sm00i of 0@<bS`cccpK^c -造LR0S M`P00H80S Hp`80@@80S800m3S`cc -LZ-(0嵯 0 寯0K^K^K^K^Q0-4 $Q Q(0 `0P@ 0R4q,Pq,Xq,`q,hq, 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  㖓P @0 S00 0%K^4 -4L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) P,0:S @0 40 1P0MS1~  80S $00cn 0 @XX 10000 00SZ:XN p4   R= R1  R) R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S S00000S 00S S0 0 0 00S1 Rt]/0)0S: 00 B00 0  0h0h$0C0CMcq1P@ t 0R0% :P 0 SR0M0P@ 00K mP 0 0R0% * V UV (PcM^4cccl4 -L$M8 4 8 p0Qg ! 0@40X<0 9 0 S<%D ` ":V :4 0@ WPP0,!!- 0 @0S ʀS S eS) X< R4@  @0P84K  < <0@40 0S04P 1   0 @@0Sx,x,(y,4y,Dy,4`;P@ 40S 1 0@4 @ 440@0 4 S S4P 1 (  0 @@\ \40@P4P 1  0 @@\ \404 40S 1 0  0 @40S=ʂS400S 1 @0@@ RW X&S 40S 1 x  0 @4H)0P 2+<4.+ 4 940S1 p 8^400S 1  0 @X400S 1 8  0 @@\Al(4 0xP@@44 f 1 0D S`*L@PLP 1(1$ 101@ 1Z< 1:)011@01$ <L ( I E00 0g(0 0D(@0~ Z0  ǟA.L` BP`0@ `4Pi@ 44 0DS : 00K P 0 0R0% *S! ʇSf DS! Sj400S 1 h  0 @@\'X;%4 0P  ^4 @ 400S 1 `  0 @@0S}XP%40P  :=4 :400S 1 P  0 @@P\X$4@0P  ?4 ?400S 1 X  0 @@ R;XL$4@0pP  64 6S 0CS40S X X#40PP Z ß `LP`0@ (` @0S@@<P 40(#1140$ 101@ Z 1@ p 0g ̐  80 S- p32( < Y  04\ 4 @1P:)014P 4$004 s0 (0P$00 p00g4C@0S@PX:400S 1 H  0 @@\~XX!4 0P  n>>4 i>1 R$!4`P0@0S 1  0@4<  00P@ ,0K P`4  , 0R0%` *P `P@cM^4cʚ; cbb cK^aac4cl4 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S , 0KPp  0R0% * 0 S0% :X dK0\ d0Kc K\@Kl  dK0L PS@@KHK}0 H0KGK HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rf\@K   0K0 Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ )`ac4cH^M^(4l4 -L M@0(  $( ,<4<,4"|P@唩U110SPHDPKS0 C0KD K<`K0SG G P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(F5\0W00S0%" K`aK^K^K^cK^T4 -&LDM0PTP ,0 0S80\0 `P dP @p` :Y  HK@h@ 0@K hG0KHK6HK P@0[S U5 ,0S ,?0[0S 00f@CZ #긍,,,,0ST 0S SZ T @0K@ [R R h@K H0KPd0 Z Z Z 񟗳l,d,@,L,<0\0 㳟@PP !!$ 1$010 1ᘟUF 1:)01``P\ $0R0 Rた@$y$ R 1 0+10 ,`(`SKA @a0@RSD0SA La0LRS00L S:XA @a0@RS `A@0@ \-P+^H`PP@X Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0WQ000 , v0 `  o㮝@`0$0奝$ R 1 0 +10 ,(0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S 7P0pi0\0jS\ 0jSg P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P P040 4b -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 SPK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 4b0R@%!0 0 g 000 PU0Sn 0Sd 0SZ 0SP !@( B("("48<##80@@ 0:4(  40 0@@ P L0S 1 0@LQ 1`P 0@L  0@1P@ p1 ,0S |,00S000 00S0 0 000S000 00S0 0 0a kbAg00SR\P 0SM 1 0( LY *`g?XFU B0  P P00S0P0 `acTK^bbb0c4 -LM`@PT :Rp/U U S*` T  \(`P Q` `S*`0S` = @`0T0U00S - 0L 刧PK^K^W` 0-LM PᲘP@ 40P00 KPP劚0SL L @808 7P000K^, - LMR 40 S L00P00 0 TT4 - LMR 40 S 0 0 ;;4 p-L MQPPP 0@S0 `ph&P 0<P飛p*p 0 ph飜pK^c -LM@00K p" 0@ 00 "@0P ,` U0@K!!  0K  ?@0@K  p0 -LM`xC4tC0@!0c48nC0!0c4<hC0 0c4 DbC0 0c4 D@!390Q 00R D ICpZP, @0PP A0 R ~p0H, 00 S0 L 0C # 0 0 R Yp@ꫪ @ 0T  # 0@ 05S1#=#=`哻cPc`cdc0chcpc`cTK^c|K^H^ccc@ccM^@4(chccDbl4 -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( rPP , 0R0% *%cl4 -RL M`p40 @0S SP V g* }pP P`eV@1P@ !SN SVZAP 0/0K ⨾00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*Kb"[P"48<4 #8V0Pˆʎc@c -0L0@Sp S S S 0@ 0S 1  0 ; @0`P``0@c -L$Mh0L ,0 @ /  DK)0D L PhhL  0Q^ 7 0(@3T TT +T-  PPA p3T0000aa 0V43T !T +Th0 3  )0\L PL @ (2 ,0S ,儣<Th0 2  )0<L0P1P@ <T (eP@  00Qh0 1  )00LS0L  L h 048<,Ơ0ŒHK)0= H L0PhhL b@PK W@ [R! R Z 0Sh0.  )00 L0PhhL .?0[0S S #K?0[0S`ap4c -LM$0K@ p3T#0[#0[00aa@XPP H011 01!  ԍUV#U !0 00l<  80S $00 00lV* 0  `㬍@h嬲$ᤍ$ R 1 0 +10 ,(0@15SQ CSd0PUh(o@0  200 ?0#3 0P-c64b4N^Mb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0_ 0 @@做pY _5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@)00@!@10 r!01 !1 0 g! P@ H0pkPApָPp\0S @40bMr@0 q\@PZ q P@` 80< 0CR80E56MbM^M^X0GS S S#S 5SS ʇSS S p-LM@!`\ XP P p3000  00  00p#P00pQ 0 0S X塚pPUt( (唚 pD5l5 -SLMpP@` R00Q00S3R`U-  ZP$ W W *`X [ c0X0P00S` U Ꮠ`   -L Mp, m0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4cm0"0 0D D 001100 %!c -LM, 4 0 Bm, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <m8<× @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  ^08#X: ^0N^5 -LM\0@,0 `p XK͛ hKɛ 0R60帐 0 弐 Đ 0% P@ i:T_ `xK 㴛0S@ u0S.0Sş@0 ,0 S |,hXKh 0S hKH (50S xKٶ$ ҶP϶ @(0X0ST0SP0SL0S&[4R t0S חd0S`0S\0[Sx0[S S pG@K QP R010 0S  0S 0S 0Y0R00Sh0[ xKSpp_P`z K0P@BY Y0 00 S 8s0S[ xK] Y0@4}PXK ÖPL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXK #H@K0xK@K0 H0KGKnP@ 40  00 R TGoVe 㦵P` 0  p0S 0 R w0[0S5#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *Ht`aTK^M^c55555P55355$5P5cl4 -L|MPK 0 , 宕0S Y0 00@`j@tPp d !1 01$0  1 jW 00S"W U 0S @00 0     0@00 :0` d`K0HK@c`0U H0KcKGKd0K\PK   R0S R 0(S@@K 㩙 0KKּP @@K ❙(` x0(0     0 ᐙ Rt Rh ^H 0@#$(,""( :( @@% K0R0 $  K@Z 1`P 0@ 0@@0 \ 80S0C80P2 ,0S P, n P Y@ 0 @@ 0P 0ὔ1 0 Y @ @  00S S0 0 0 00S1 R P 80S0C80emV0 8yTE  2PN>@@@K{H5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 i@堎$i$ R 1 0 +10 ,( 0( Z0000* 0( |L ( lG R 0T00  0| Q 0S C pphhph/(5X555W` -LM00 0 0 @0@ @@g -PLM@ -|0 0R h0 Rծ 0P (0hQ 0Shy000 埏PN^M^50 5 -PLM@ R000h_剏P 5 -LpLM0P,0 `@ <KBT2 l Rl@2 Rh 0S# (2 RŸ@0 舿1 ,0S ,xsPp @(0萏<0S80S40S00S5 0R0% A:P7 d@KH ?P%` R 0 l 僡 Y0 00 S 0 R <K6Y0 JW@ <Kl  0@0 R D0P@ h0K .Pp h 0R0% *(`alK^TK^M^cp 5 5 5 5cl4 -LpM0@,0 `1PK 厒6 R 0 0S# 6 RƟ@0 ׾dƟ,0 S `,>x ­P⿭ @(0,ߎ0[S 6 R K⭭ ю0[0S 0R0%` Y:VO @KPE MP= 0 4 TPK8( LKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF KY0 D<<0K@ @g90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 22 R  0P2 R լ 0 R 0S  R0S\ 0SX SR 0 SB K`0 K0KKP0h [0  /h K0h [2 00h0K1\K 0$(,<4LphP@ 80 R SX0 (@rM^ 5 -L,MP @p^ T@ D  1 ; S00D0 7P` L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0j W P_ L0 @T 0 R @TY @n^80S P1 \00\0`0p᩟X0 P0〈P 0Y@ 8K0q  00bS00bc8 xRQ:Q0 D0S 0 <0 ,0 H =H 00+P@ 0 R ♨X0 (@帉80< S L0 < KP<Pt0 R x<X0 (L閉tL0 ``8<0<<<0~n0`pfVPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 @H6"c -L{85 -L{T500-@P 6 0 -0L{P% -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS -----------------------------------------D----P-8-h-x------------------ - -,-4---T-l-|-------------0- 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P3X355 5T4h%5p+55X455x5\5(54P53D53|5335553 55$55,545D5L5\5d5 0-@PL> `Sl h0 $$ à 0 < 0 $005x5355 -pL`@Pu$ T 4 Z DU pP@TXD4(4P55555h%5 -L0 Z\@`%Z' !00St 0t  rW\PD  e/5%5(5t5|55 -O8@LMpOSP!b$ $00S 0 hdX@@  f5@%5(5t5555 -@$40$&S !PL$pdxl dVH555(5%5t55|5|5@z5 )3 -LMpH`@PL w8P$1( <0D $00HH!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -LM@!R ,0  10 6LQ L0K/ 0-a -LM t0@ ,0 ) L0 Rh|b0, ~ 00bXad c p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `[{P0  R R R 0  R R R0Spp p-LM0OqThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0p c c!c c c !c c!c cW`W`W`!c p-LM q0Pdd0K`TTXx T`P H0Tz<0`u00`p w!iAi cP^l c !i!ch c5 -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00@0?00?0Q^` cl ch!c 0-H1L@4 Pvz8040< 8 H0<0 @ 0 -Ld ku -LMp$`H Q@G 1 G1F?(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 00 !01BK mPp10! 8PHD1X <04Y 10 1%K`K 0 LXal c 0-LPMQ@$P> P dKmP8\00S 0H!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08< 100 -LL,M0@!00H!`4 R   R  R0Rႁ0僁0#q W0P KL0 P pH00CH0 p 020 pP0P L20 HPK A Sy@ j8!lP bXaH! 0 20L -LMp`JLP0 S@0 0 I`6@a$ 0S00!c -` LR000 | |0@PI@dDFA 02b SpD 0 S0``00`hI7a aa -` LMT ^LL @Q Q\ 0 @7HXaܲa (1 R 00!cW`l- -LM0P 0 !H1pAHp!Z5 `000F4 0 QH1P0AT  0P @T` H 0GV m~Du-T`  0pGXaܲab!cp5 -`,1LM 080@0K(PUK  PU Kp0(  PP  PU K0@ @ P_0P00P0GH 0-tPtL0n@Q011!!PLP@0H!0*4  40L0C0lsdsT!cp^d!cܲal c`!cH(c"cTa@e4q^5@H65Q^oa05Q^Q^Q^`^bd5|555 -L MQ@@@00C S0L--l------<-D-L--XŸ 0N<2^ 0S- 0O2 0S0000  00KSO- 0#N1 Rڠ! 0 V^4 ^0 S QSR Q P(QSRQPq,PKP  0NP@  G G 0@@NV^ h0{XP 0 PM@c0jQ^|!cau^a!cd/c^(w^!cp@-P0@S` 0 p ?2c0TQ000S0"c2`Q0$0 pQ^Q^fq^Q^Qta -L@A,@` pf3PP 0 p 0 P0 0   $ ( 000$0(0003 -L MP S$(`p@, (KH,K @P,00$`p(0 -L MP$(` pQ-0V80, @ R0@\00T00S\0, $0 0( `0  (K,KU -L$M$(p 4 80 0 R8 P0 UQ0 `! 0@ 8T@!,K040K PU 00`V00S P P00 $0 0( 0 -L-q 500$0(000 0-LMP@ @40H0S?Q'P--X-p--0ES--$-,-- 0 @@X0@D@@H|)rxpt  0P  0P@ 0 Q0X0H5!cl cl5555 -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @D(cl(c -0L M0KSP00 , ' 00^*@p`0.&R:c0 R054 5ƒ0:00  0 0 ^: Z sb ->0LMn<`p4 JP@B 40 R08 &8 P00U* Vؠ 0. \   0Z UJjF:804 0S80 d@X00K@, KP00L00  o@H6l c"c5>0 >0 I@H6M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K A, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K>y"c  0-LMP 0 .@K PP@ PTqP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHl c!c -LM`0VPp R a :VP@bT@!W W `d L 0D@WHl c!c 0-`@L\0P 0  ,0R 0 0S0hnh!cl cD5 -LM`PV r @0S  2S @2S2S lphndn0JS .........0  n0n0@n0 Pn1`VAA0S 1 R$ 1 ?#+0AB%@hn Z 11@T !m\ntYn hUn81\ ?# $1H1@Q1@!+B%0@ P8n5n0/n0 0X gnu" 0|  Xncmn$3!c4L 5P 5` 5p 5 5 5 5p+5 c c c c!c|3!c 53 5d4 5$!5 !c cX!5!5!5!5!5!5!5"5"5 -L$MCp< #@ 000 0, !@ t3p#Ph3UPQ\HaZpH0< ZN@t T* 3 R0S0"0S :S8 D H0&R{ 20Sw 6St 2"0S00D0 D  0 Pl2 RQ00 D0<PH  ZwZ ZX H0H0H  D0am@< 0pH  R 0 H80 \0040 < @00 ,0 08, 407?0K/S4  0S00,8m 0X 00 H ,m@< 0;0 080  <0@4 00 , H 0R6BSa eZ080   m@< 0A80K0@< 0 P l cbXa3ܲa` c@H6oa#5#5,$5\$5 p-LM( \@SP`8 0 l l (llll$l4l00S8@< D lHxlh`kdlH Tl Ll$5$53$5$5d%5x5$5%58%5`%5l%5%5%5%5%5%5%5 -LM \@P`p  0 P`0H1 -LMH ^0P0p @`H   \l 0 `p0 H1@  -`!LM0@00 0.!0 SP@1HpxH1@4 X.: `N @0U PP 0;Pi P   0>0K/S4  0S00Tl  @0 R  0H 0PbXa#5` c p-LM@0P`XT" T jKc0V0P00S 0[0ppTKc0V0P00S 00pKb0V0P00S 1[0pl c&5 88#4S S - LM(4P`0Sp @"0pLP`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SPfM(4 SJ.`............@\. 0 P;D} 0 :#:cQ! 4@`*Jk  @Q`1h#R& ?P  @`0S000S pp`V  Q#  +*{h`00i"c&5"c"c"c p- 88LM#ĐT0`P @0  &R%&:FFp4P Xaq^-@-0  80@0@ h0 T@ 8 H0D000H0D0 0404440044"c-88P0S P0S00 40C4H0 Q H0D00C0CH0D0440C0C44"c0@-8P @+ 0Q P00RP @0 0@0 P0 "  4400C4 0Q  H D0 0CD0H 0D H0 0CH0D  $4 0C4$$4 0C4$"c -@ LM0|@  hS ` c8(c0@-x@PQ0000  00 0  0 Q 00  0P0$h`- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0$h` -!LM!:Q@T!h' 001PQ fp$ KP$0W 000p`0S &21p,ffP@ g`"cf` -0L0b0^@0TP 0 x$0'g 20PUf'9? 000CS0 0hf"cg`f` p-L,*(0MP"1"(  P! 0 S: @#P0 0D`L L0S   0+fp"c"cl c -L f -L f( -LM8@PTp`  0S 0` @TH 0L\R S @Q Q Q \ 0h0hS 4S  0h @T\  ipL -LM8@TP, h` 0U Z 0`@TQP U00P00So Vm \j @R U Z @Tb ``` *(": 1Q"( 001 0R  0*"%,`VLp7 W 0S  10#R0 S 1D0Sp10a@ 0S0S |a d1P U P@R `@TU VZ`(*(": 1"(Q 001 0R  ! 0L0p 0S  0SpP000S 00 0P `1"cl c"c -LM@ 80 Q@ e @ 00 8 40  `0 :8p#*  ! #8R 001 0R  :#58PQ ,  0`w  T"`0 0PPP 04S`  H0D 0C H0D 4 R 0` 80S 4 0S(  0SP U 0,SP  0S@Tt100S T! @!@ 0S P 0S  0S D 0S 0P 4$0C 4$ 0S  0 S  R H0@z0H 0S  P"c"cl c -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@pXa"cl c -LM8@TN p1L D H 0S 0L`ppT0 4W PE PC P%*(":1"(Q 001 R40C4 :#%40C4 00 `0@_T@W8@ 0S 0SPP@P,@0S P@pXa"cDe`l c -LMX.c0 @$ 00 4( B0S 40$@$$e`@e` -L$MP<P $ȟ"&R:0R*0`,0  1 0````UpH   4 4 R 4: #5 < QD @ D@ >0S@ Tǟ#&R:0R*0a00  1@W2 0@0 HQ`  @0 `6W  T  8 4S44SSD0 SH0H0S S L6!X@0`0ó @0` &U  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`zTU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 4S44SSD0 SH0H0S S 4!AT@0`0ó @0` U  @0`00@0  300S p3 0 P3@q 0Sn ,3Ph ?\P8 ]  "U 48  Mc0 `D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` x!U:  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8] 0@ 0S 0P O0 |eg)*(":1"(Q 001 0R"cb"c"c<3l c` c"cDe`$&5@&5 -L0? =#& R6:0R3*0l$0  1"R 8\ 0P \0T\ 0 @00@0   $0 2R @ ` #& R:0R*0l(0  1"R 8\ 0P \0T\ @00@0  bl c -,0L ^  08Xal c -!*(L":M1Q"( 001 0R  0`* " !Q:0Q *0b!0 P 0b -LM 0HQp@+0 T ?= ?0S% :3` 00#! @R00  00#!H0S  S 0 0i30QXal c"c 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00l c"cXaoa$h` -LM 0@S000L00l c -PLM` 0S 0Sz0000CS0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!VHq& 10S 0 R *(I0  0 $R$4$4$4 iA\@00#!0 hP0 0  "!0000~"cXaoa$h`` cܲa`^e`l cP-0 R0P  0S 0S  R00L00 08   0 000oa"c$h` 0-<04 [ 0P L$@0Z0hWh` h`l c p-0LM 40 x`pP0\\@ 0 S@R0Tp@"ch` h`l c a p-LM 084P4@KX0K@ P0@ H`[PP@P@@00ZphaWh`h`h` h`l c0 0 "c"c -PL0@P$ p10pS*`|(\ 0 $>"*01\06S0:0@<,L1"c0h`"cl c 0-0 L"*("1"(P  \@! 0 SP!0!;   @00` c"cl c@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000` c@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pGP ` `000@0  0@0$0)$_["c"c0h`$h`l&5 -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S 0" "0 "0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,PT0 "R@YŸP 0$T D@ T 0@T0!@Y0 @S0!@vY< hPJT:kw\o`P@) E1? P 0 01  @`P 1 000R ;P= N\9W 0pĀ ZZW`"cl c"ch`"ch`h` h`"c`!c"c h`g`0h`$h`,h`&5&6@d`(e`.@e`Q^&5De`&5f`f`.&5 g`g`.&5&5X`8'5d'5 -!: P0@S`LPp P@: #Ŵp0L L \  P0p@:8 0 0 U0Z "cl c"c'5 p-LMS@P` ,:8l#* #800R 0 SP*  ^0"5060p nZ"c'5 -80L0 00 Ơ U0 q^"c"cDe`"c -d0L \R00#P00*0 $30hZ"cQ^@H6Q^00 R 0  \05055Y"cQ^Q^ -L$MU(U1"0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEPXH0H 000 <0040 000 000 $0 Xt(5(5"c"c"c"c"c"c(50"c -``LM0pS P0  @P@^00 R"cP0P0S  \:00Q0S"c0@-l0@P 0S P  T :00U0S000"c@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 "c "c"c"c"c"c"c"c"c"cF."cE."c"c"c"c"c"c"c -0L0Όn`VPp@0?0?0000?%:E%6;PK #;J jV!ZWQ^Q^(5 -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:l c"c 0-80L@T (PT X DT0@e`"cp+5 -X2LMP, @ @,8X, 00$ X080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $qX01!R.P I P ^.^.^.^. _.^.^.^._.^.^.^.$_.DP  0PP0!?#=?00c?S HX@Tjڣh@X,@Y@ BP@CPmPFP$.X"c8)5L)5`)5x)54h`5)5)5 -LMp`P1SP>U#&R :0R*0a!B 0 T H4$4DLW8@T V 0 *$W@T@4h`b)5)5 -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P  h`h`"cg`"c -0LM@0pPP% KNPU$: 8 #! R#8 001 R00*"5*T `  0@}OP4 Tb"c -LM@p fP 0SPTT0 R0 00b81Q00@RU^Q^q^Q^*5 -LMRB2< r R0S tRP "88 #$0LVH2`fP 0S@ Vth P0Up7*!A06T&*46!SAQ  Qx1 :P|p`UJ1 16T:0U00 pW0#02S0ESe.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e.e.VV0V}V "88 #$htV(0S} d$'c^l cQ^Q^8*5"c\*5l+c4"cd*5p*5@Bt*5*5*5*5*5*5*5 0-LMPK LP@ 008@l c -LM0@Xl c -0LS S  -H@LH`P. pXH!.@ H1:404H1L@H@H!L X0V800`H`0 0 043 -LM 0@;  hPܲaX" -:#:LMS`@PR pK D  WjVJZT"c+5 -L M00' H ~p@g0>0L ^| P.U@`H@ $@K,0  $ 00ZUzjRTQ^"c+5 p-LM`00l H0N@0d0>0^P 0,0 g-L 0L0H p,T"cQ^ +540 ( 40(S"4S`o^40 ( 40(S"4S`o^ 0`o^ - 1LM @R)% (B? S +0  "!   *U(U%U/f UU|/fL*\00 S 4 U0 Uw(U$.fUQ^%6,+5P+5t+5[+5+5@ -pLM0`S" @0  2 BlT0PU *   00VU:`2 0Sq^+5 -LM`T^@PƄ ?p 0p 0,`e0@@pq^l c-??!0S0q1!1 R  P 000$0$ P 000d@d -LM P  .& ?x,~8ȟ 8+8 R(8* u)8( X KV800 0 xDTtXtATlI)à@XXȟXTȟT bPx@ 3`8`)T0'T a,Ơ 0  HT000 )P@ 9#9S*00 S0)\:00 0C0Q 000b1,0 PUZ0Q I$IT dR40 C\ g:0 0C007*gQƟ0 C\V:00C *0VQ0 L0b1\0匆u:0 0C06*?QL0 L0b1\0_:0 0C0D6*)Q00 L0b1\0I:0 0C05*Q0 L0b1\03:0 0C05*P0l0l10lkST%dgSH5XcS<şL_S0 C^ :$5L*P0LS0$A `P PUE `Zd1CP PUE `Z4$ +ST 0^|DP`&l@0@N @@e 0@@( S :@ :@ :@ :@{,0 9@t0C(P `:@jPU @Z <3 @0@ "0>0>02 a\2"& Ÿ 8 0R0R_$ !01 `2\"HTRDRaN!\N1WNyR"2 1!1 nR,kRTH! 0 @uI_R5#1,/~ 0@0 hV0C ^:00C0O0 0b10 @8+5@l c cTaAi` 4(cuap@r^l.8t^+5l+c ,5l(ch+cL(c q^D(c0,5\,5P(ct,5|)c,58(c`(cp(cx+cT!cT(c,5,5-58-5H(cX-5+c"c|-56? -5` cX^UUUU-5-5 ܲad!c.5.58.50.h^.d^3t^D.5P.5X.5`.5 P-LP t2R l2 `B00Pb 0O@"P@0 SS  QQQ00 Qx APQQ0-S SPX 0-S0SQ q00C@CSW|z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.Xz.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.@0000Sl00d0`0K@@HNQ@0 S DSBOTa|(cp^p^.5.5tq^.5.5.5.5 p- LM0@S p00OPP@` 8x0SphOPHP`D OP4P `xq^tq^.5@.5q^ q^8t^ @.5p@0Q 0    -0L 0+R 0  hF`t0O0Sdd  0\SW RHHD0 PP 00 cAix.5Tatq^.5|q^{.43ua 0-LMxP@dT 0 0L PH@0< P H(0(0P0hq^P,c<05D05+c+c}.0  B Q2q^+c - L0 \P5O~.L05T05 -LM#pP0S`' `开@T R0000 0 ##PhI@T010< @ I10S@T$N#Aq^+c6+cx0505S 00-L`PX@HpHP 0 0`0P@ p &20+c+c -LM@``#0pS1P0U 'P0P0S UKHPP N0`0C0;#P@O101/#+#P05P,c05 0- @LPXFI!000 U $00S0(0h1P,c -L,MRP,`Kp@ M%40K,KK P@ P030[4 [2[81[<4U @ /0[0 [.[8-[<4 00t0  uO0 N05 -LM2(KJP`0p vM,0 @p(@K@ @z0' -L M$PK@p`]M0:$0KXM  L  L  L$  L8k$P0 P ` PKG' -LM2(KJP`0p %M40(K $`KPp@ @&0 -L M,`Kp ML0PH@X@0 ,K@+PK(KP P0u' -LMP0`KpLL@0K UP#K0 /K.KP @,PK -L$M@4`KpL L`0PT@!$Z4K-K [0 3K2K@ P,@K0 0 0bS00-0  4$ 00bS -L MYP pR`@0 0SX1 h 400Sd  0P@8 04SOX00 0>S  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@PK0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` pK``$U-Kz4K 0 3KP `p,@K -L M0pK@` KK$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S hf/Pu,0P# P 0`V U004P< (0;4P00@ @0$0 0SeV hDP 0,0hP -LM0$ p@(X p, ,0P,Ћ.T.`.p.h.`V W 00 P0p P-0 F V 00SOp 0,0`#K0505 -Lp`PP Y@  JO` 0$0  00 @0 000P 0ҕ20•U@ pP #U`  -LM,0@S$ȍ.(.Ѝ.Ѝ.؍..(.8.T.00Cs0 0 00, 0S P;p  ,hL0S (15 0-LM0@0S S T@D P0`` PN-P0@DS000Sa`.&aX15 - `L$0p04@S0P0p0CS0ԕ PKꨏ...h.Ȑ...X....`..h.$0( R0(0P 0  0@0PS 0 x$R l1Rd1Rh:  R50ˠʌ ʌ00ɌH0 @P`00P  ph0 `*00  004`;00Pበ8qI``iI`eI\|5d|5t|5h4 -L"M\P@`p l2\ ,@0S p  02\U 2\ @}̠ 0@ @K1\묠 ` K Q 0S(   0000 0  0p0#00, 00 6 @ ` vKL@D04p80P0&<@1011011 011@01101`0\ X0\x0P Q1 <0000  0 0 Q@Q QQ`.4 Q- LH5 -0 PP0L000 1S010 130S00H3q P4| 00#`Vq 4@40!`R F3VhTGQ^ r^555 6 p-LM`5P##PP441S 0@0T1!@R0T#4PU p40 p-LM P@| 0`\ p| 0`\0` p-LM0P@1`Tp1@T -LM `0PdP 40!pWW 1 L60P!0Q0@T JP@ 0T P 00 1P$08 <40!\@ P^ @TP b 0 S 40 40!p P4 r^'0@-Q0P 1OQ1Q00S0R00@ -0`@1LTpP 1@T -LMQP`0p%1Q"1Q 4 1S @X1 \@ 0T4 X P -LMQ@P`0'1T$!?T0S0V40P X 1 (3Pp 4 1q-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LMDŸ Q, @4F / 0@\0 | w\3 \p 聟X- P`K PK@K ~  zP@0!0 1R 0t `F<1 ,0S D,.Z 7 .(.0.8.@.H.P.X.`.h....p.x..................ꨀ꤀ꠀ꜀ꘀꔀꐀꌀꈀꄀꀀ|xDt`\hd`aD5%5@54P5\5d555555̀5Ԁ5܀5555555,5T5`55 -LM40p1` SP p P@ 0p bHl2 dd2  $0pP{P0 @Rp Rz Rk U 40!Q 1 f # 0,Ky0!0Q  202202 202,04S!20\: 2H04KS1ԱL0 1ı0 4@ C0P( U$1 ! 41 R0S1A0 - 010 0 0 4P4 xVE 4@: uIP0S`RU r^i`q^44<.T.(4 -L MP PE㢟 , u`p@ 0PES u@,0Y7G000 _CP ,G0 0 SCP G  JC0 P 0 0R ,@ -LMK 04 -P`P0 S00Ł0@p$ (00L\p31t  0d 0Q000DW @*80S(t1 hD0@T 00, 0hL00<( 4bQ<00$r^ -L M @ 6@T.$. -L M@ 0@T.$.H0@-8%V l l @PA ll@0R鵁N` aA -L ȠLM` Ƞ ,Ĉ@,d0 0 P,@ h0 @ /Pp 1!:U :U vt:U :c7U 7UV 0kd7U \7UHQ #  3IP 0+;6U=6U"*6U 6U"P$6UQ Qc00 "  d 0@0P 0 c000~06U 5U 5U㲀U@ R0`0 >0HS"5%@P@dDFA 02 Sh1b1 R0``00` 0P0S1 0" 0#$0$   BR !64$@P@dDFA 02 S`1b1 R0``00`uR0 0bJ10000 2 0,$,!$#, \@Z`s0SLtCP R0`04 A>  0@@@"P02 <4(<"4!<002 0#$0$ 0 S0S0002@2@dP`|2U t2U ? D@0D,S? 0\PKP@PZ0[Y [$ R !5cP@ 0P@D`@K P 0 P0"  6[#$0$&K A0U 0,10SU0U 1U} 00U0v0Us 00Un 0`a$r^ Q@c Q 05c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cc,aa aaddQQ` -L M,0 0pe00 @=,=R聟PQ0`0l F= d0( 008,!2040 1 O p < ` <0P*KϠ<0  +-<0P00PP8 &P0 0bP 0 P`Y *(0 ("4400$ 0 0,0X o_@ <<00 `,aQ85hy4WEV$.H5 -L,M` 0 ؀"4pKP@ .~<%4K@(0K P P@~P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ pEPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @F@0  N -LMP`p $P P@ $0K   pPPPP\P $\00S 00  00  v -L$M@`p 0@ PPb 0KN 0@@@@ p*P@0\@@T K 0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @  0 q  N -L$M,`KP @pM;Y0,K0 (K$pKP @@N@  -L$MP $ 1`L  4Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 4@ 0   N -L M0pK@` :$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SLM@Pj Qf뜁pQ0`0V :  Pp0 0@T@b@bPU?J! @0L\, 0 @=p0 @P@dDFA 02 Sʬ1b1 R0``00`0N^J0D@T;p a`,aa aa -L M0`KP pC:G0KP*K @(K8)K0 -K,pK+K@ @@; N -L M(`KPp  :@K}(K0 pKP @@! -LM@}̠ 0@ @ -L M0@KP `p9BU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L Mp0@KP` 99CV0K/['Ġ/K)K8'KP 0 *Kp (pK - ML`0 PpPP@0nT `:PP` -LP -LP0KP 0$ .7 +7R@0K&K(Kl 0)@Kp 'pK#@T  0s;0u -LMp0P@K`+K  0 66R,K%K0P@,Kˠ @$@KP#PKP@ [0[4 CRK 0;; 0 S  !`a0u5 -@L$Mp` P,KP 0( 6 6R,K%K$KP0 @#@K P@  04 S 0@.0:0u0S`.l.p.t.x.\2nP0S-1@- 04!400@p0C S Q@ 0@@ 0 ( 4S 000@ -LMK 004 -L M@1@$01(00\`P0'1!0S2p<23S2ԡ92ġ  0P!0Q000870 1 Q8 .tP@) 7T T 7 0 Pl i77 P8@80P@7P0  ?@0P .xr^tr^4p+5|. r^4%6l.5̂5܂5 -@L `$P P00$ ;004P$ 嚎$P؀ 0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UlQ0&(& GEXo^.Q^\o^\^%6 - 8L8#Č M R00 P,(Y, %P@ 0 0 Ԡ'P`tpW7 1'X` ,0 S0 90  S0 90 0p0W0!1 010&% -Y 8Y 2 Rp`0! X-. 1X0-.1 gP` X`p101"TP1`01 0p -P`1$`r^ - 0!4LM#$`p$P@A 0t&PP7 V0 70  V0 700(PUP0 11 011 R&p$ l 1<1-B[$`r^ -D@!88#L!.$P`Z0  2 S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 2@ 4K 00K @ @<0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MP 60@0pQ2,Kl  p/5,KX0L @` `p0S0@00 B14P5 -LX  0 P0$0B(0P S 0/-ct.-c%5|55 p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!p-cb p-LM0@P`S.......@ D0P!!00P ` p@@@{/-c5-0!! R R0000 0  0!! Y -LM @ 0@0hwpU<-c 0-1L!M@4 0800 0P0< *00S P/Cb1ϠN3l"c11A}S c•ϠN3l"cT!!A0DF0)8 0h(.-cds^r^0A@5MbD/c5$.05 -L$M400 ,0  00K(0  $ 0 0 @0@ D/ p-L$M048@K4 0 ` P0 , (` 0\H D 0@<4Pp0 , (` 4@ P qP p.@D/P5@5 -LM@q/0s/鰄55 -0LP<`  "!0>0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6//0/0/\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  .Ȅ5 p-T0LMP`00@8 ,T00 8\p-c p-0LM@ P0`<0 \00< ,T0000 0<< \pho-c - 0L 0<,-c - 0L 0<,-c -(0L 00< \-ca -X0LM@ 00<,0 0S(000. @-ca5 -LMQ@0>0~n0`pf_PP 0f0V@0*` 0VT( K,0K JTZ:0 P, 0L00 @H6"cQ0v@H60 -L=-(5 -L7-P5 0Q 0Rj`@ -0L@Mt@f.l0d@ \@ A!0\@0 0  "!j`5-ck`j`0-c -1LM ?ops)J`0Y10  "!QU PP  0@PU 00#!?o0cSp 008 401o-c-ck`j`-c-c -LM@X-0DS 00#!40 0$ !!阅5-cG-0M  "!āġđ!R  80 QPR Q R  101 R R1<1 R\ p0x 0P `0P @4`$0 0  @(09)0 40 ( pP` @$!R 80 QR \@0@ 0 0!!Ѝj`k`-c-c-c -@@LM8 *( 8 0 -c -LM0,"0S{ 0`  "!r@P0   080 Rn0  "!`00#! 0    090 RR0  "!`00#! 0   000 R60  "!`00#! 0   000 R0  "!`00#!  1 L0 0!!s^-c-c-c -`@LMP8  0 0#!, pP0@S0<0! 0TQ4 0!  84`\@@0,0 0!!40 R @++Laj`LaQ^5Ѕ5 -LM`4 0!!0Q!0000 0 @P@dDFA 02b Spd0 S0``00`vJ 0!!j`a aaM  0Ѝc0 0-c-c-c -LM0@  "!@0!!$ $0 1h-c-c-c 0-L0LP 0P0@  "!@0  "!-c 0-< L0P@!!@0  "!0-cH- P00 01 0 00!`-c-c-c0 S- L( ( 40  + +5xj`5 P- L 004,0P 1*@l`,5 P-0L  04\00S *@l`P5,0Q0 Rp0 0X0p$PpTX0 p |4! 00P\ $P0TX XP0) P` $\eP0TX XPTP04 0004 d80*0x0 0PbUP#U@U0 PT0,PE\U@U5SP0T,,P0T0,\PT0,TPU0x0h` -0L`P0 0  ^Of Pq0T @,000SNP0T,,@C 0`S0 P 0T,\0@00P:P  "P 1 P0LT ,P0T0 \P0,TT0 P: PT \ _"Pp0S00m1 P1LT ,@ P0T ,P0T0 \p[!45 -LM@0S 5 -P0PLT ,P0@T ,P0`T ,00pPT0 \P@T0 \PT0 \|0 0 |0  -`D0@0V|pLPD0@@|@ @0 T736"  @TD00CD02 Tx@P0T ,P0T0 \P T,0   P0T,"5 0 0 0-0LS@P P10S F00h0h0 `510S0S 0-P0T@,L,Ps0S  x0S  R Q 0hI0S00#0Q00S 0h -P0L0@`V%pP >/P?/H?/P?/x0V00 ?s 0 1 P/@ + 0y,u^t5@u^0 -LMh@Te Th $0Sh0TT"@h0$ $0Sh0 h -LM@"P 0h -0P ,@L0`8@$@T@p@,| 0-L@#00P8P0h -LM@P 0h -LM0P 0`I@LOTp00 P cAi -LMPh0d8p2/ p P` Lhkh•p0p2@ l@  h•l 1\p 0pPI h2lp"pb -#pP@ d.hP4PH < 0  ꄇ5!5x550 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X Q^.cf45 -`,0L(0(@dϠ>1 0(P\ p 0S ]m@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0`Ar^.cds^D0, S0D0D D @00H @0.c 0-PH0LS@ S 04G04 HP0 -LMp\ PU  ( i@T4`  P$0< 0:000 `@0@Q^ 0-@P LR000 @ H0 BT@  $Q  R8000hg80 8004H00QH  0Q 0Q0 Q 000D0T0QL0Q#!@0<0 <0 0 AW@_W@@W@DW@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40uh -LMH 00R@4< 0BH 04hx/P0 S 0- LRP@ @ 0S #S0S S S lh0h`XS SD@<S485\5d5h5p5|55p+5D2555555 -0L00x0 S -LM@H0 R |04Sh@Q^ -LM@hl @0\ -t0LS0 -L M@P` Q 4Z/8Z/Z/8Z/8Z/@Z/XZ/8Z/Z/8Z/Z/` 000h@00 0\p 0  hhp@T0p h@tpp\T0 0hl\r^@545[/p+5H/c0AL/c<5X5@/c@t5 -$"LM0Sh0PUd pp`j|z` z@`l ` ` @` ` k k t yugqQ6 `0h0`0l ,h0@l ,h0lP ,p`hl0P \h@l 0\hl 0\h@l0 \`0h0`0l ,h0@l ,h0lP ,p`u^ 0- L0S0PU0h0l ,@@ @  @ @ Ih0HIlPT G,@@@ @LL@KK J J @H0u^ -LMh00 K $ PP@0  "!0 h0 ,h0 @ ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,+ 0+;S{ tthl 0\h@0T l\!X4\=l hw!!h0 ,h0  ,h0  ,h0 C/,h0 0 ,h0 4 ,h0 8 ,h0 .,h0 < ,h0 @ ,h0 D ,h0 O/,h0 T ,h0 \ ,h0 d ,h0| l ,h0x X ,h0t ` ,h0p h ,h0l p ,h0h  ,h0d  ,h0`  ,h0\ ,,l8X p0 T0 P 0L0 ph0,h0H ( ,h0D , ,h0@ 0 ,h0< 4 ,h08 8 ,h04 < ,h0'0  ,`0hx7,  57\h0l4 ,h@0l64 \hl0 0\6h@ 6+R00l \hl 6\h@l$ 8\hl( h6\h@l, 6\hl ,6\h@l$ 8\hl( 9\h@l, 6\h( 5l\0EIh 5\hP 5\h h5\hPC/P5\hl 85\-h 0l\ XUhH 0\hPL 0\hP 0\hP0 \h0 \hP0 \h00 \hP04 \h08 \hP0< \h0@ \hP0D \h0T \hP0\ \h|0d \hPt0X \hp0` \hPl0h \h d00 \hP `00 \h \00 \hPd 00$ \h` 00( \hP\ 00, \h0C/\hP0.\h0O/\hPx0l \hh0p \ hPX00F/\X h`00I/\hH0 \h@D0( \h@0, \h@<00 \h804 \h@408 \h00< \h@ ,0 \P0 T00@ L00P00 0@ cAi@/cL/c -c@!D! 3%6H/cu^ 5*h0 \h@0 \h0 \h@0 \h0 \h@0 \h0 \h@0 \h0 \h@0@ \h0 \l hP`!lB x1$ !80S P h 0l\0 0 !qQh0$ hl 0\sh0P" ,d2Py  t"xr 0- @LP,0@0 \ ,0; \ N0h 0-.@LP9\0.\ 6 ,0= \0hz -LP`ႀ p.9\.0\c.`0\0b/\.,00.\.,00.\.,00.\Bf/,0@@D t %f/@0\WpG.9\.0\.`0\@0f/\.,00.\.,00.\.,00.\@f/,0@Dt f/00f/\b/,.,00.\' -LP`₀ p.9\.0\.`0\0b/\.,00.\.,00.\.,00.\DBf/,0@@D&t Yf/@0\f/@0\WpG.9\.0\.`0\f/,@0f/\.,00.\.,00.\ 0b/\.,00.\@f/,0@@Dt f/,@@0f/\.,00.\' p-LM@P`0 K@!p p-LM@P`0 @pA-`@0 S pP  0R 18S8Pp  0T0 T  R1 0 TRu^(w^ -42LM @`PP~ 0  "![Uh UQ U: U" 'U 0!!q0S'S  ! PAl h v [ 0Pq0SڂSL8Al hn( ` E 0p0SS@l hY K 0 0p0S S @ ;  lh =0P@0[S L P lh .P,0 $zu^D/cu^ (w^5 0 D/c R[040R0(0R>ӂ?00 L%6(w^ -LM,@0D 0  $ -LM?@00,D 0 T -0LRP 0-DL@P0000 4 0h1 0`1l!0hp+5/ 0-XAPPPTL 0S@T0$0S U -L MP00 4X1,q0040 U? VR (1 RBXaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` $@PpTWd :P@ d- 0  `0```0 @Xa f ,w^R/̄/5 p-LMXA`TP 0S@Tp$0S 0S $0 $0005 -LMXAT 0S@T$0S 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  xaT0!l@d!T01STJF04aS ,0S T<Q 0S {QwuT%p0lW 1@S  0!p0T@`Z1T 01ST (NPKDHEp4h%55\5%5܊554|555/5X!R0S`0(0S0S -`0L( `5 -LM(0@S d10Sd1 `0_Y `Xp\ `0 D 0`R:@P0Qw\,P400 P] 0D40H0 P0P `H(0X P?@ 0S 0 T0S (0     0X1S 0S`00`0L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H} 040 ,\! 댋5 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0P 댋5 p-L M @0@P4@P p 0X1S3 0S0 0 -  0PP0C P0L L QL5 1SP0  5M  1N -O )P0  C# p -L M `XPQpK 0SH  T0S Q\ \0^࠱ RQ3 V+ `400$ @TXp\`400  ` 0`AT   TXp\`40 0 @꘏/ -L M pX!RD 0SA `@V T0S T\ \0X@`VT \0S P`400$ @040 P `X`T`i`400$b m 0T@X@`A400$阏/ - 0L40 ( 0-XAPTL T0S 0@T05 XTU00P00 SP$ / -LpM`K@p h p08GF/V_ 8 PX( $ p$ 000О/ -LM 4`0p " @ KP @KL K~?K";P< @0D "H0 0 P0 P " L0P R0X0 TH0D$PL0X L PE PK "D$X0NT S񟗶H//////////`/h/h///T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT T\&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@Dd2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@PT@ T0X140 0, 00 R( d GP d @00@\ 9PP \  X 0X P0 04 0 40  0 \ PP \ 0X00X P ,P@@Q UPU@t@P1sw@Pt PpDPm Pix4|^R,w^D5h%5D5p+5 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`SV$p$@OP0 IP0 RT  0 R 0R4 -LM `<#0PU 0S; S XPUi0830 0 S024 40@40PU Ö$P†TÆ ?00 P#P 2>φ40 40Pφ 40P@( PSU&11@F? R 0R Q pW P 1SpW Q0 K_P TU Y 0R P 0R 0R 0 P@2"32 #"22""30#3P–T 0TP2T $PP> 30CS D2D"3 #<2<"2"424"3#0< "@<0S ?P0 <34 400<38 400"<#4 040 }P2T $pPT1T!3 #L1L!2#@hPSU$$@Mn0KiPZ0  PT0 RpNN0 R= 0R:B?<24 724 0| S /값5̒54  P x 4 !ܒ5!!!!55$5@5\5|5 0-83Ls@  sC PP 0<#4 040 <38 400<#2 00 4 p-LMP@9T`8  T@ /p5@E @3S<i<Y@Cz<< 0@z ! 0-LMP<0@4 @0P @3 <0h0 !5 -LM@@<%<h/ -QL,M@P`p?<38K 400 P0<3 <0K40@ K0  0P@80<  4$@T<3@ p400 <# 040 PLȓ55 -@LPp`3 $@T`V@3 $@T3 $PP003 -L0M<34pK P00 4\ 0`2<8K 40@h5 4005PpRhO`LXIS~p   40@P?55 p+5 55@5L5l5@5 0-@\5Lst )  PP%5S#h%\ 040 h5S 400`%r h5 400h% 400 0鷽 -LMP@HTp` T ?dhsh~Y`ht\@hh 0 `h@0S8d5h`]ꌕ5 5 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0QAP0 P 0S 7P#44 -LP -L Mp0("p`BKP} 0M@ ,@40@0Pn ͆ @0-P`1 E0)Q1,0) @0RɆ Ɇ$92 d 0X IR4 h 01X !@0@HQP* 00\ P  =400Y 4,00Yo\TLD t x 5\p = 8h%5%55 6555@5 p-LM09t`@0Ppo-009 = 400  0,40 } -LM@PU`p0  U 5@ 090Q09l0"\0,e< 0$00  8= h 0-P@L 0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 0l5 -0L* -LM@P`p 0 ` p 0 @ @0 -0L MЍv^ p-LMP $0$00. $0$0  $0  $0|x`@$ @0S}Tp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  Ht00 0P@ e0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 8  X0 LL0H08FpW`F(PEZ%5\5T5X55/`~^/// -LM$0@  -LM$0P@Plpl`@ \0 Dѷ0S0  R  hSꬋ4\"5d/5 p-LMPQ$`@  0@0 !?C1 @$00 0R0#S 0S @ @ᵷ655 -LM$0@P 0h#0h 0-0L P@0,00 \0h1̘5 -LM0 @Q@ 0( Q0 ,00 \00N -LMxpxP@A` `0`TT@0KL 0, ( 0@ $P `  4|q^p+5~^,$4#4$4PV0(/ ,$4~^ -LLM \Pp@` 0d!Pꧨ? Q-LhWR 0-LM@PP0  00 0-P LR@ R 00Q |0Q v@@ @l R@80Q 00Q 00@YW ZW $ 0s 0s@D$40~^ -LM@T@T@9P $0 R T0@~^~^ -鐠L0pP`Vʆ0lQ@i`HcV Pp(0@A@W^D$40~^ -PLM@ 00h0@~^ R-L 0 h0 ~^ P0-L@P T00hz0h| -P2LM@Dl@PP(  2 "00080 0Q0_0404a04 4 `0< 4 `8<0H 8 <0 8<0L < `T400A`tRV8 `Vp p00A`t:V 1 1 00 00S@,0 0$0 (@ P 2,K 0T0x th@x -0 T08 < \/c/5@&4`&4@/,/4/|q^D^,^p+5̖0h^$0S0 \2h^ 0-P@L0PS0 \0!0U  0hh^$0S0 \ h^ 0-PL0S 0S0@004( ,d0 0 @04( ,4004X04Xh^ 0-QL0S0$ @T(0S0$ @T0004(0#004$ X004$ (008 84#8$ X004(#0 004$ Xh^ -LMx@0S0$ Q0S0$ Q034X034Xh^0 0 RR4(c` l00d S S P0i 0^0 0j ]0 000 0 04(c` 0/ -LM Rp@B R࡟t^(0KP0*0P`c( 0e(  0X( <X( 0X( 0X( 0X( 0X( 0X( 0X0S( 0 X( 0X 0(X0 S0 0(0p 0$ ( X0X( 0X($0 $ '@^P5x5 p-LM0 @P` (V  V (pp됙5 -LM0 @P `pT TU00Xiy (08U#80 U0 밙5 -LM0@ P` [Up $ UPL0S iH(085#8$ Xԙ5 0-0 P@L 0X 0X 0X0 -LtM@4000\0@ 0SD h80P$ hr^pA5p+5/5 0-t0L @<04P0 \0P 04\00500h^ -0LMS @h p-0LM P@0`40\T$T5!TT" T pph"T p04 X0\040 \004 , p5^ -0LM P@PP @5004 , 004 ,@^ P-L P 4hPh<5 -2L M P `:0 04\0@4 1\5040 \004 , 004 , 004 ,P(pK04 0\004 , 004 , 004 ,APU5MKI0 04\( 0? 0(0 (!C3 0 ( ^ -$1L R`P>U< 0 04p\0@4 0\5 040 \004 , *004 , 004 ,@t^\5 -h1LM \1+R pW`Vp`@PW, >;0 84 508 WTQ N5 @   @TPZ5 -0*4' 8$,o cAi 0-LM@seZ  0s0 Z0 t0x 0 P|0 P i.0S j~H0H H D008jꀚ5\/5t/(000X00a}/P/a -L -L -sLPB -2aLMqP@4`KT01@0T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01^ 0-0L 0S 0 S 0SQ0@A0@ c c PD00l/"b0^Q0 0`^Q -LM@hi -LM0@S eRRWP0 00S 00 Rڴ0: -LMP Z20PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`帀0V oVP0Ӽ09P000W0X0AP 0S W r*m!0V QW 00Y00BaQJUPpW@:p@@p帀'4:6gfff p-LM@P>0`S 0S 001PpN00 -@Lp"`P@PUPV0P0  0-@PLP000!0h  -LpaS0`@S@NP`PP0S d@ VAT_@D30Sd T` n -H0LM @0P hu^ - LM0S0 @T0Y\hBh0p,@ 8 #8~4P6 hp\u^@B 0-LM@ P0  D0D0 @ 8 K0d00h X0 0'4p+5,$40 0-LM@PP0U0StL0  JH\0\  @H 0P0T 0  05<0 -LM@0L0S0P00L0 -0LMS@  S00P0H 0hHH0P0P>0 -L@Pp`3P /PTU<@ p-LM`\PXP P@0dS:ph0dS: p-LM`5@ TPPU $   00 00 @ Td 0 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00$^h/cPl`VUUU 0-LPǿ@0h -LM`PP 㶿P P@@TX,K TpB O᣿W!X10SW ppWT0\ `S, ( X, (0@@,, (0Tp`0\ 0 R@,0d 0ll(0h 0lPl,P ( Hh00`0aBaD0@H (00(0a`/cd/c^6Mb$^Q0Q00 W@R R | 0\q 0 Q  -LdM030 | |3| , m |0_40|#0 02  9P/XK  @0S S P@0'\00t||\2\0S0P1P!|C>  505(2  5@055Z@C 2/@=H_00%0Pfx@K x!| 0/x0Kl KMP |S100|0\0o0hT1d! 0P Z D 1 ,0S ,,|3!0`9.͊_0@@%0EΠP0`@#Hh P 8`p@=0Pl0%|\`a| 655Ț55P^%6'00555RNLT5t5 -@L/`$P P00$ ;004P$ A$P؀0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0(mVVXo^l0Q^\o^\^%6 -LMD@!88#0!dPp0 , 80h040|Õ 0s 0 0 pl! < 0H .0$X0 00$80 55WEV -LMP@p`]$(|(0"4 40\0$L0@ Dt 0 \T 0 | \ P | 0S0000 - XX%tLM' `4 $ P@0  Ő0s 1Vm (1V 1V | 0p0 0 001V ,0Ke/ QP1V8 :D10S  0pP0 % %0 0  P0 |# 0S0000V 5054  %44000 0|G 0 00 "   000 0S005<^mdedAsd rdAhdk~gd0 - 88@#DLM$`HPp 0*H0 P(TBĠ*0 I|PP!PP <^ -LBCMB\`, p 8 8#T % P@ |# 0 SȀ(PPpP`  0S ,0 S ,S0`QP!ء00 |3 WNSⴡ0 S_ Xa0%S0000|00@0000( S0!lhtC0PA P( p1S@%0%0%0%0$00 S 004! 4!f0(S 1 !pbS0!W㑓)`h@00,K0,0B]/|K/K<[KKXPLH~|T^`a<^,5X^\^45H55p+5d55555 -L`|PzP@ P P0pW U ,f( 6H@00;00000Evv|#00ܜ55 p-L$M|#@0PSp8`K @5 @0 U00K10K002K8 KT0|,0 P <2[2[   0u5D5l5 p-LMP@8`EP+ 00 00000 0 0 S0$0@00 @ 00 40 ,0, ,00 400pp(0,/010 0- 0@ JLP 0h06 -L$M`12l1,0,0 p ^8` 6^X5 00@l5 P ,  0$00$0v  o) 0(+@ğ@n,NP0$0 o0@ ,@0S000 2080 080 00S 0 00(-0 0 C,P4#8@P4 00 0@b 0  W 0 5`%`@ 0D80HP0 (0$ @l3 {P0) @ Ƞ_,Ƞ0  D L$0 0$00q $0   0  "$0 0$04@  00PP0 ``0 S 0!0(S Tڰ0Q0I 0 9`)`@2 !P90-40 0 0S\0#1 00 0 1 P ,vP( 0 , 0(+@@ @ Ƞ_,Ƞ0  0 ``0 0 4`$`0 0` `` P,@:0040 B0P@00P9 0 @T0(.T00ş  0 920'5555L5 -LMP12l1, p ^ `0@yR420 Pc 00 [ 0@@= 0T R P0$0@(0 T- 0 0$0@T  0 0 0 000 bQڰ0 '0$0c zT 0  (00 00  dX @ 0p@0@0$0/ E  0 H'5l55555 p-LMPJ `@0 00$ 0 ( p(ph p-LM`J@ Pt00000  ph( -LM02ct$Y1 pP,` 0 S ,30T30505050\603060`4060400$00$0@ 0PCt00 k(0!L00 0@ 0S 000@  @E @0 000C000,   0S\0#10 )0 00S  0   0" 0 00 0 @(0  p0$00 0L+D+ 0$0( dY 0  0@@0$0 @*z@ 0PA00 (0! 0} 00   0000@d@ 0P@00 (0!T d@ 0P@00 (0!] d@ 0 P\@00 (0!Y d',5L5,/0T5d5t55555t5-08$0"R(00  0$0+ (  2( S0<0( 0@000$0 -LMđ0勯Kp _K,0 @ 0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R P(K0m ,0 S ,   509 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" `a 5NEFX' -L M<`Kp@ P~0<0K0 60K@?4 K7@KSK00 5 KNP3[= -LM 00 0 @R 0S 0 0 0S -LMp\W`pP @WĠeT 0@T8V2P Nt^^%585ȉ5|5 p-LMDP`@ `P @Tp1p鸀^0 0 QPḀ^ -LMP@ D@0@T 0S( @T꘠5$a5p+5 Q-LP. `Pp@aFQ00`V00S00@0@T 0S @T`KPP 02$04 40>$a5 -L=$0 hƳ05=0\6Q^ -LM0 ,  R "4"@ !$"R`bpK0$PP@ 0a눤@T TX 0Ku@P  T-0 pK`K<& 4R R a  mPY@YaT0 ST0S *Q0  0P X0S) h TR R b 4 5PpYL@jY)T 0K\NP 0SD  r异 0 00S \2 ,0S ,p,88 #Č`2` a P,R@(Ÿ00 !((!4q"$0 T "U0s0 0 0 S00 0S񟗲@0@0 B0A0@0@0[,((0 "4400$04 @DP \ Mu@M 1 RP# EP@0 开"4  0$ 020$0  ppnh000 h`#000Ta`a^^\45p^ܠ555t155^^ 5P5#^\5l55 -LdM(0p Stp xp l p p P<3(05<0S2<080S` (x0 \0Z 0S<00(| @4l0pD08V00 S s X t0 Z1 0Ol4( 00< 8 @p05 P ($x Hh@Ko@ +x00 Zx- S 0S 0S \x x 0 01 0 | 0 |0R00000,0S0?0,080S00, 8V 0SEO < Q\VV00 S 0S(: ` 0(H0 4S S 0 4C Q ˠˠ\d2d"0\"4SR 0S1| 0OX 0"@0(00 <0p 5P1x0 H@(0e?CT 1R x R1x0 0@e?CTx0S lp ipPx W 00:002x0S8T!Sx VP`(He/nx`  > 0SsQq S 00 0S S S` 0 0`^ 0\S St 0Rt0 P`0S  0CSS`0ꨡ55Uԡ5WEV55 -80LSP`p (0S KKT r> 1R0S PV# ,(@2@R0`! 0R 0R: 0S  P 0 0 V08e/e/WEV -LLM(0@p2PD@8X p p @0l 1( < 00@ 4 P@`JHhKo@  0S 0S`Pv v 0 01l0 p 0Ol0 @0(0<00  3P@H( @0e?C\ 0R 0e?C@T e/f000 3@00:0000S1P (HWEV -LM(p< P`DD8/\",0 ĠB X 0OT SX0c\@. 4<0(p,4 0O RQ /RQ00,0S0 4 8 00 0@4000;0000 -L Mp$ `vP@  W Q0 00 P0  00 0 VPP 0S0 !P U ݜ 0 0 @ 0P `/c -L M0@S K K 0 㷜㴜  Q-LpP 0S00@T 0a EP@ 0T p-PLM@` <TA,!<0 ph 50545 - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @"P@ <׮p0S Ю 04`0 0lpp@4(00  0- PRL R1<@T  00  0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hGh 02\o^XY0\^@(6 - QLM`P6q0<@T/ 0R 0 Fp0S0p00pRp 0Hp0޷  0 p0W 0  0 0>  ^6 -LM@p0  0p00$ (0  -PLM 0 0 P<W P-L`@ 0PU R@B $ph02T@D@(6 p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp@(6 -LM2"0!Q2@< 0 -LM2@p( R U)1<`V W 2s 20 2ih2 02p  lPp`i,p 55D5h5 -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hDP0U2pPH/ck0555 q-LP@p QR1< RL ͧp R l0U Ru2602R巧p`V) l02 1<   1<  ht1< R    0 2ꃧ -p0LS Q R h0 $  Q 1<0 S 00  p0 Sl  -qLMP`! Qq<@T Bp0T 0 0 00`<0`T 0`0 0+&p0S @H 0@ɴp P00R00S`5Qp 00⑹ 0-4PL0@S\00ZP00/c -dLM \L@0KK <P <P  /c/c/c 0-d0L \0R@P 00$\ 800S04 /c/c/c0 ^/c0  ^/cq0 -H0LMQ <\ 0 40@/c Q-0L  pS0  A b00\p40 -LM0@ 00 R 0tS0S00 0-00L 0@S0 4C PR0t0R0000h400忸 0-LM@P$KT 0 P  0@SQ0@SP  0 0@S  0>0 XW 0Ra R R! P-L P ?#?00cSu0u0u0u0hP Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0 02o@ 0(@:"P00R00S0P 0200 RpP0 b8^5/c -LM0Pp 0崁p@`@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP 0 od (0 p 00 0o8^ -\1LM p0 04`@0pP 0K  00p 0 @8#x P1: p0A!0@p A! p0!!  p0!!8^ -LMp @ 0p 00 0 -LMA0p 00 00p 1S0a0c8#0p 1S0a0c8#8P * p101 p0!!p0 p0 @p0"Rh(e00 p0!! p0!8^ -LMp @ 0 p p 00 0p 00 0 -h1LM p0 !4  币40X#8#8B0CZ80 >1 p04`0p0@P 00KPȠ% 00 [ 0 P 0 S0(p"0, @@D0P8# 0 0 (40" X8 Z0 0 08^/c -h0h LQ@ X   P`0R P 0$ $ G00Xl`\l`^`l`Tl` -@0L R 000 0S 0S 0Xl`\l``l` -4L,\ \ Xl``l` 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[00 80 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀廨  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3餄^^ 4S @08#<@8oS: S>; S P 0 R0,R+4 -LM@Q ꜷ00ܷ00$0<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S  (5 p-LM0`PP@ SP c0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ 0 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S  P5x50Q 0`c Q- L9鬥5 0-0@l0P0 p00 LPU 0S0hЄ^5x5p+5Q p-LM`0PSMX@T 0S 1P!00 S P0 +pB0`0CS0000 R000S0S0| 2c1ѠPLƿ0@ 㖑00ɡ\o^0\^6Х5إ5 -LMp ,0 0'0#0#@00 40 BXY 4@ |0t@0|04 @0,004  D 00x000P @ <0 R"8 ` 0S P?#<00cS{ 00pfU -L@M0 4,8 mQ`( G QMQLQCQ _AQN -@Q (0S ( 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ 0T 0Q3 0/S500(0(000(00(0(0(0(0(0(0(0(0(0(0(0(0(0(00(000(00(0(000000000(0(0000000000@TPp @TTK 0X@K@IPsT0X @p004 8PJ?|55i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U'LP000  ^0 /R 19R00C P^L0 0 C^L00C5AQ$00000000 00000000000!R,00 ,R ,0,00,0 p-LM,@AP0CQK\1111111|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|11|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|11|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1|1!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMp0PS@ !0@Tp0t R`@ 0!0@Tt x RD`@ 0!0@Tx ph<,4<-4 -|0LS@` QP!0PU|0PPPp01| 0 !0P U"l.4<.4 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C ꠅ^@755555 55555 5$5,545<5D5@^L5T5\5`5d5h5l5p5l`^53 -LM@PTp`\ 0 S  0z P(0  0FP 00  P@ < Kj  0R P t55 -L M` P@,, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  ጮ@$ሮD1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 PlfdJ_` Z<2<"082 4"002 ,"0$2 "0Q0 0(02 0 1 00A S- 1 1 1 1 1 1 1 1 1 1 1 1 1;(  0t!0p1 0h1h!0d1( 0<(0,l(0,<(0be \0  c㋪8@PU  \0$!0" a}<0 05  at8@PU k(0 0(0W íD$῭@5<厫 101@111111d 1 1111115 0-L@0PS  0Rc0Q 000 0T R@-@0P 10RS<8 0024 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  ᗮ`F0v@P -L(@pP`0S P$` W(00(0(00(0G-@MT> T2 ,P E-./0p1` U0ޕ0ޅ  eS22 R0ޕ0ޅ b BS22 R0ޕ0ޅ b BS22T T 1\hЍ 4 8 <\h0 48<\h0/4-! !^p@-C7@<00RP`h@$ 0<$ XL1H!!0"PEu R ^@@@ @@@@@ S ^@PEup(0  \B1 P0"A-(0@ @0 $00bT0C$ X>" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  jP@ p  00@p00pȅ^ -LMX@$p@% bT0 apGL Bw &R$  ìpG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@Tp@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000pԖ^̅^UUUU3333P^Ԇ^ -LM@v 0 ST0 S D塧@00 0 000 0,0 0S015h1L#1"1T$1X 1@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 l`l` -LHM`\@p oT X !4.0 X@$P嬐 W& 0P 8PEpbu ( 0PE#200u0   @ \0 AD! 1000C0PE00u0 PEu00@l`l`l` -LhM`\@p oeT X $!4.0 X@$P嬐W W- 0P 8PEpbu ( 0PE#200u0   0#2000 @ h0 AD! ! 1000C0PE40u0 PEu000 @l`l`l` -L∡M`\@p oT X D!4.0 X@$P嬐 W4 0P 8PEpbu ( 0PE#200u0   0#2000   @ t0 AD! ! ! 1000C0PE80u0 PEu0000 @l`l`l`A-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000|Ԇ^P^̅^p@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0pph0h  @D1t 0p 00#0q0@D0#0tԆ^P^̅^G-0M, 0P@,P00X0PPP` U$p@,!0pG0 wP( 0b@U0S T eR0 APd 1Z * 0! j\8%1^<,pG0w0Ѝ%0Z:$P 00Q( 0e 0 0 0A22V$00S,P`00`  `VpG! a `Bw  02 0,Z0 @ V0S 0 S fR0 J\Vڬ3 00003 !@@D\ V0S Q fR0\@D(\% U0 S0 S eR0 0 @CTŸ 1Q !2 0 c\ 1^<  pGw] "0A\<X"0  000, 0pG!0 w> 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S3P^̅^Ԇ^0 0 S$0 S000S 0X.1,1*1/1E-M pTJ<h@J+X< ,$P ` @h0 P- 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEu@-A;A'<00<  |hx0h@  0011 @01 (01 0 Rl`l` -L<M@\`Pp mj1 WT0X(# U$% 08 P@Pcp!!( P0@#1<0 p 01<0  0 \ 0<L00C0@p (P0@00 pl`l`l` -LXM@\`Pp m 1 WgT0X(# U$+ 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 d 0<L00C0@p ,0@000 pl`l`l` -LlM@\`Pp m41 W T0X(# U$1 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 d 0<L 00C0@p (0@p0 000l`l`l`0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 051 4111@71G-M(T) <h@pX)'< ,$P ` @h0 P@ / 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@l`xm` -L`MP\p@` md(1 XT0X'#@v$, 0P8 N`c~& (p @`0N0x0~  01x0  0 0  p 0L 00C0N80~   0N~|m`xm`l`m` -L⌡M`\p@P mT1 XZT0X'#@u$5 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~|m`xm`l`m` -L⸡M`\p@P m1 XT0X'#@u$> 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~|m`xm`l`m`(0$8 Q!0  Q:240@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP t80`@T  @Tphtm` -L4M, <aP4 ,4< ,@$0 0⣡ , 0 404@maP8 u ,  \,  0@ T,0D $0L0 L,0,$0, L0 (P 8 T@ H X@ L0pWLX0H ##,*,T  80@ 0<0 P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804P48a4a4 4a8 0-L@ tP%@tTP 0h(0-LQ@0 0R, 0 S m`^m`,0 P 0SPm` -Lp `Ps0@T U 0$ R @T sV 0 RX 0( RW P sm` -LM` s $ (0Psr@ R0P0u s0 00 0X0`01 Pssq@ R 00M vs< 夢$ (  W.W$ W$!W80B@@as R 08  80Ts088 ၢ0@`8 @W W  W  W W W  W|  WWl Wd W<__P sa ^m`LaaadaaDaa$a -LM@ P`sp P@& U ,0U 0S0,PV 00V 0S 00`00("X0rrP -LP p`r@PU10  rU 0-@L rPP@ 0C(S"H r05@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS0t^ -LcMq0P@$0 70@@R00}/#\B1TTT 0P0 $0S h$DXTa0S0D!0000iK1 <0@00 m`0`2SО@4 0zP$@X0S 008 R 0  0S0 00C0Bt\00X 80P0H增 8坞0P0`a^L5`5t5p+5Q^=5E155 p-LM0P\^ @L p0p@X\Q```P`` `0 ^ pPG\P ($^D5PG1^0cxH1^555 0-L@q0PS0000 0@@0R0hq0c -LM@q0S R 0 00  0  h|q0c p-LM0P\2S `0S @ 0 @0\2S 0S ? 띋00\"R P0Sx@002c1 T ~P0S , 00C0@L@[^456<5 -LM,q`Pp@ 0Tp  R0000 0  q qP@~@T0cD5 Q- L⬝L5 88#$R\\ 0R01SP0SQ 00^^0c - 8LbMؠ8#P( `P0 Sp@jKq0S|||  0#@d~P@ pT (0 S 0(姅 Ur@`a^X5`5 88#P0 ^0c -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P  7 0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 \00S 00<1 wP0T0 V 00S X w]TH KqT H KqPT H0Q @0QQ(0$0p^UU@Ut}f~f0c0 0 4 S-L@PoA`p <0 RpoQ ^0c -LM@oH 0S00  Q0 0 0S00ho0c0 R=  0^ p-LM1@s 88 #4 pS0P`$0<`80o00@o 0c^ 0-0 _0LS@ P0S 0000 8X00 0S P0S ?  ~0 ? ~ p-LMX`0SLP-@s f1S0P\00C0p^^ 0-LbM`P0PP@0  cK T fK' 0S 0 `ah5 0-LbMPP0 @ bK0 `fK 0S 0`a|5 -LcM䀟0k_K`$0 @B fa[-p`n @0iK0cS0x 0͇1p}X嵯T0P n $0S ,$弃mg`a^^0c0c5 p-x0LM R 00p`B Pn0`S phn000 0@@0 n= p-LMQ@@P Q pTP P0S \ R 0`S S\ `1PS 0-LbMP@0 @S0 4P0-L0S600`"R 0fK1 Y0 S tH02j0 0`20|H0@ 2c 1{P ۚ`a5655 000^ 00C0^ -LM  -LMPp^@`   0S & 0S ^ 0S K09 P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $PeZ 0 -LM0p$0 @RT0P  $P@ T00 -0L M@ 0K0KK0K@K@K@K@K@Kv -LMȠ,Ƞ @0 pP@6g`\ 0$  (g$t@ gT0 $K$\ $p1u -LMȠ,Ƞ @0 pP@Sf`|\ 0$  f$t@fT0 $Ky$\ $q1 -LLM02c10 @ft0@ShZ655du -LM@Z 04 P*0S 0P: -LMP`pf1@T 0SR (@Tf0e ESP@E 0 P` p0  0,P/ 04P00 0 P 0P@ 8 0eS0S: 0S:(Q,0,0, 00C0 f^^ -LM@f4 40((0S0,@, 000hf^^ -LM@R@\dbp ]P 0`$0eP@T 0 R1 @T$0K@ BP`#$0$@$0 @00@S00  Q@ @00  Q 0 0 0eeT ^ -LM$0S h 0@0e$ 0S00 @ he ^ P-0L 0 i{5m`34 -LM0K0K㸐@`BT/K -Kp4K0.@K)K+PK*K,`K@P4\ 0 @)K*@KP4 0  -LCMT0Q0@`O P51!sJKKK1 (B(0P&,1?0@CP I_KPE00 $("8  00X00",S ?00^0 0JKKK 0xP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S P-L@<`p1 SP"U 0S 04 噑W 0S 0 4p m錑  m; 7 TP Nppp霬55 -LMB4 , @fpT0 P0D01鼬5 -LCMhK_K@K `0, 0 4!0  PD 01pVg!

1 1DQ@T XcXCXT#00LßQD  : 0S 00B0S S3  +)X 0f ?JP` 2X  0S00S 0S  ` KyP ` ` P L 00S 8 V fJ0X0f840` p\PP` 00B0S Sf IPd P010  P 0S}?d0000dB0S0 S`\ X @ 0T4`090 /P@TX 0 剉  傉01 0CĠ UKV0K`ap+555,5%5\5455̮5خ55p15<5X5t5155ԯ5 -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  T  GP 0  0 00  `PP    d ߈  W R d 0SS00D 4 Ỉ0 85T5|55а55 -00QLX0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S % P 0SZ0  0S   -LBM p0004p`PD@t0 \I H0@0X0 @T@0s 3@R{ CKA A Bf0 ,1R6 #P111s- Q 0!1S,0 0 Y$0 (P @ e Fed00] ,K0k| B1<0 S0SS!0@S4010150cS64^p+574̖074<74 -QLM@CϠ m? R  0S T @ hy Q0- L@P Q 0|1Sm?@l p-LM1 S@P\`|P50p5l` 0 50c -0 RL`p@ @*PX@ P 0p000 @WP:!E? R 1S 1S 1S m$>FO_e\ &em'e>FOQe e00Ba016Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!P,P @T*0P\?@T:@T*0\%@T:L0W 1S c LKeq@/RTP LK0|  @TRQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c aƀ 00@W0@m004{\*~00m`m`05 0-LM00P@K4U kQ4 000c0_Q 00Cm` 0 0c -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ{@40Oφh P40RφL P40Uφ0 P鴳5̳555505 0- LP@0 PP 0 }P 0S 000CSPPP 00 -LMP`@N} J}000 4 080P@XY\` 0X0 Y 0\0 ` 0S47Pp X0S0S S0 X0Y R 00CS񟗧01H1H1@1H110 Y0X0S S0BS1 1111#0|T 0S0@T<0S| =Qy X Rs R00c 4D0 P i4<@0 PX0SG 00p@QPp @TZX 0S- 4S* 0S% St2Y T00BS 1T1T111H|0 i $|P |1P X S4>H0 P P= > io|>0S4xP 0 S00S=  X0S 0@Th 00S> 00S<  iB|PL c @ > < : 8S*0Y0 00S PS 00p+55L5P55\5`5P4x55Ĵ5ܴ5P4555 5(5,545 -pL`@P@P(PU@ZJO0@0CS0|@OAT P<0W1 !0  zhp@ -QL1  Q S 0S h -L`p@PPPU@Z@P`@PPU@Z\@`>p -LM0@S  1S01 1SfP P1 010C1P1 (zD5 -LM`pP @ 0TP@@ Ƞ,Ƞ 0000 R P@@!= -LM@PP`  h0!T` 00040 R Pࠁࠓ=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @?0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qrx  | 0P00p000 0 0PPEDd 0 P@00 0S Ax^= p-L M0PS@- 0BSD11h11x111 1H1T 0R0P RA R*R# T00CS000@  0PPpph90\# y {| 0 T T 0Q0ph a|D 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48E5@ O?=<040QL0 20CS2E` .H%6Q Q? -RLM`pP P$ ; 0 0k PE@jPP 0 !!$ !0``1` `rEU! oE@oj$gE$ R 1 0+10 ,`(`D5X;e5 XXm1Dt00t0 LpX |p00p0 実 1S zx5P? R`^ -LM? @R0p'_o# CYN R V \yVX0zViC,0 00 0S  1S >16 p-AMLAO0P `0ܠ P 0 C400|\\  <P202p Op`p'15 -LM@? R#? R 5+Q P 5;5Q 0S010C1<P5 ;%5 ' -? LRP0p₏5@@ ZC)~o @xTڴ5 H , l7P9 7P3 H \ U NlMx2S 5O@05% +%CU XUT0mUP mC(o ꬹ516ȹ5 p-LM@? ?dPP? 3'dPP = τ%dd @*nPP ̠x ` P#Op5 4gop. * 1155$5 0-? LR_? ( R $@T HN0@TL0 0-@LOPL000,  0 -P?pLP@`wxB1TZ1TD*1T4 1T ` gB%# = S =@S @ 8C8`2%2  . n2 # @ o5050 R0/} 0:94P`5@`09l0T `0TT0P\բڠD0T/0F;`2i 1i i i 5i i 6i( p-L Mt0@0t0P`nAO0 K` 1SAp8D5 -LM@h -00%P-@%LU  sTxPS|P:P!`PpPP`PpP P ? r#brbNP P02 &n n8P |P0|2 xn d n"P xPxR ,m m\5|555ܺ552,02 a, -LM@  X,20CS2h| -L MϠ ^`Pp  @0?0(0K:HCʠHC6 GD(K!K%K#@K"0K'PK&K$pKR@T -LM?`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0ppom+  5 -LMϠ P`UCĠp@ K 0Kih 0P} K L0v @40Po[T p=m! 85 -LM82/ 6S00@ RA?< R 0, G0ShmT5 0- 0$3_(0LS $@T L0@TJ0 0-@LOPJ000,  0 -LM?D 0Rp( 00 ,0  (0S (.U 04K4 [30[ d1R`hU&h@ P0K< 50 0 p0S60KΠ =0!U @P``ap5 0/QF 0-@MLP 0@Kl 0X 0@0@ @H(1[#4S4  <0@H 0@HK <0@@yH 0@pH H0@gH 0@^0 04@WH  0   0-LMP@ 0P@H(Ϡ  ^0  0P/H  H0P&H 0 0PH v 0PH<m H0PHd 0P (0" -LM 0S0 0AP 00$X4 -LM`Ppk0p2 [P@"0 #?㕯@@"0R\#)T3@/2RP@ p$zkHb3!L p%.pz  `ik0< H" 0S;9830@TLfP 0 S00S\" 0@T> υ08e?0j  /k/0@  0`K0`K0`L υ0E!?@@4k~ m  X0Pn10p|!5x1 t!0p1o h!40d18  <0 L!L1p'7 0G$ R "0!7"J7(j4 P0  $>H <00S`"x00SX"s ipjp+5$X425X%25R5 5Ļ5``0+ԁ4<"22$2H 2L 2 2 2 2л5ܻ5 -LM00PS0`P ? U4hP9dP4lP/H:H7=2p0CS25@O G704(2 0CS 2=H gecQ Q? 0-L=@bPU$ 1  !0 !1w=U0 s=@sb0$0j=$0 S !0 0,(~o gd@8Tڴ5`   /r7P5 H7P/ $ # "  82S 5O@05%+%?5G DG@0iG P i-5aꬹ5426ȹ5 p-LM@? ?$PP? #$*nPP ̠8 L Paps apl 125$5 -P?LP@p`k41T\1TF*1T6 1T ` 4%% = S =@S @ 8C8`2/%2  `9 `y2 `, @ [5050 R0o 0+4P`5@`0+40T(0P\դڢ2i 1i i i i  -LMP0/@|To t00t0 a]40 K p 1SJ4D5 -00%P-@%LU` F8PP<P7@P`PpPP`PpPPdrꧏb^rꡏbP @oP0@2x `r `P <YP0<2b x`\ d`P 8CP8RM ,`G y`\5|555ܺ55 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(Mp8K6P@~,0[+ [4S-`<K@ KP` !0`< `0 Ġ(̌"Č!̌  P`T0 Ġ(̌L"ČD#̌L8#D !L 0 @P`6@<P Ġ4(̌<"Č!4L.< ̌DL8#D 0%L @qP` < O=n L _<r ~ (z 555H5p555 -LM05P <5Ϡ000  m/B0T00p` @ 0ȠȠ W p" cP `HaT@5O<5 H 8  #8 5# -LM @P/P ?_ hP5 -LM 0S4! 0 0P 00X4 -LMpBP KP  _ ` 0@VJ(2S ,2S 0P|1 fPHP 52O@`W(P $^~ Ta1!0@5 1!0 X 0pbQ(0  2 P 0 S00S," 0`V00S0"00S("  4^5555#05̸5DP2M2@R25 -LMp`P@x^ t^ %0Slr`` ἀ!ΠT开0\D 4 i/iP^p+55d5`C2a%6 -@L1H2`Shpf0P0S 5@ (0010H2Q Q? -RLM`pP P$ ; 0 0 P\1@\VPP 0 !!$ !0``1` `D1U! A1@AV$91$ R 1 0+10 ,`(`x5 p-AMLAO0P `0- P  0/"-C4? 0@ 8\X  ^P|20|2pk \YpK2\5 -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 B -L M0p5P@` /@~υ 0@/ 005  00 @ 7Pp v7P 42S %@ %5;5i/ P  "\ꬹ5ȹ5 p-LM@? ? LPP?  C&nPP ̠4 L Pp [p I25$5 -P?LP@p`j1/1T[1TE*1T5 1T ` /%$ = S =@S @ 8C8`@2N%@2  ?  7@2 ?  @ [505.0 R0i 0%4P`5@`0E&40T(0P\եڣ2i 1i i i i  -LMP0/@|To t00t0Y[.0 K pI @1S.D5 -0 5P=5U@4LPP8P7<Pl`PpPdPX`PpPPPPrXbdrlb(P <P0<2 [ ZP 8P082 xZ dZP 4P4R ,Z Z\5|555ܺ55 0-LM @P0PP 0@  9PP 0S 0Y4 -LM`P@0Z $Z02  "0 P'>'.0@ 22 PxZp}"PU>2s| 2sl -`2~OP$K0` \~ 8\? ,2 # JZ2"0@5 2"0 X 0`2^Z#1  - qP4@1 ""0pTP U'P 0 S00S" (Z0@T00S00S" xv$ <Po ,Tf(0!R@T^Pp 0 S ,(0!0"(1p+55Y4|555* a̸5\2xY2^2r55ܿ55 -PL -Pp`00@S 5@ v#00,mr -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 I - !LMOPp `0ɉ'>  P  ||  -0Sd20d20K# p ['d2 -0 5P=5U@LP7 P8`PpP0PP`PpPHP魿HrPb꧿0r8bP  帾P0 2 pX \XP 墾PR $X XꜺ55ܺ55 -P?`LP@pD, 1T51T&*0T 0T p , @ p>@ s50530 R0f0"4Pp0T#40T(0P\2i 1i i i i -? Rt00t0lXD5 -LM0`5P@ +7P: 7P4 ?? ㆽPp  FXi+?"> uPp  tpO0\  pܾ%@ %5;5Xꬹ5$55b2ȹ5 -RLM`pP P$ ; 0 03 PR+@RPPP 0 !!$ !0``1` `:+U! 7+@7P$/+$ R 1 0+10 ,`(` (00C(0 ( R Y(0 Sl00l0h00h0( ` j* 7Pl00l0 <P ? V*  5b2@5 -LM@?PU`0p ?*5V;U5 VV t00t0 VV '* (K 0½ P(0St0p000t0p01S *ꙅ `x5 0-LP@ᴽ 04 P*0S 0P:00SQ Q?Aq- $0A0 0!q "\^ -LM 0S4 0 0P 00Y4 -LMP`p@TYV HUV P@$ #?@#0S#@2/@3S0 K᭽P@000400 寿4 2>0080@0<0 `Tk80se <0sb @0s_ f),`K 0P@J V ~X tPY1tp!51 !01o !4018  <0 !1p"  0@2$ R "0""8"X P;0 2) U )02U4⽼P  0S 0S 0@T0S@0S80S0S<dUQPp+55d525`}2Y45u2z2|22ԁ22~2`25555 -@2LSPotPu;00(2p0CS25@ 2h"02(0 } -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`K幽2P0CS2 -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pK匽2P0CS2 -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PKH2P0CS2D -LMP`B哏Tj'p0/y 0 5 T  7PE 7P = w} u m 1H0S D0SP5P@@05%+%'E: T :P0 :z'#T$< ȹ5265 p-LMBPT p+ >$ 64`0@  -Tph-'Q Q -LM┡2 S`( tp5 U  <5   (0S (<0K AQ)[ 0)KDRU@ P5<5  0 W0S s?0 00U@P5 `a5 p-LM2`SP4"8 "4D0 㢸P&4<H0 㛸POD0|  `320CS2p ,CS` px25$5 -RLM`pP P$ ; 0 0U Pt&@tKPP 0 !!$ !0``1` `\&U! Y&@YK$Q&$ R 1 0+10 ,`(`` 5X0p R!1PZd Y0XP # 0P/" $P 0 S00S " 0@T00S$"00S"  4Np+55d555L2ȋ2D22n5 -@L!`p`00PS 5@  00! ʲ!nQ Q0m -RLM`pP P$ ; 0 0 P!@FPP 0 !!$ !0``1` `!U! !@F$!$ R 1 0+10 ,`(` τ$ @poPP ˠ( ` P$P6 4hL/ + ꈎ2p255$5 p-0LM@PQ00 5@ R R00R``V p|20|2彵0SU(phvp"0 ,L|bm85 -0`@LQPp+o0T 0T p c505-h0T  R\  @ p@ "mi i i 0-P@P0L HR 0t00t0K 1S 0hmD5 -0 5P=5U@(LPP,P70PT`PpPLP@`PpP8PG8rz@bALrzTb굲P 0RP002[ KU KꟲP ,<P0,2E xwK? dqKꉲP (&P(R0 ,bK* \K\5|555ܺ55 -@LP`!1pR001SP1 P 0 Q1  z 10 1}7 -!L000p'0 @`Pj0S$ cb 0R000Sp0p00pPh0|0h0 |000D000000 0@@0 9-c-cb -LM 0S4 0 0QP 000Z4 -LMP` p@tJ hJ fP@@<#?@#0S #@3/@3S4 K P@400400 4 2>Ᏹ080@0<0 `Tp80si <0sf @0sc 0`K .0P@K \J L tPIN1tp!51 !01o !4018  <0 !1pr  0@&$ R "0k"E P/0 2o Y J e02 J4P  0S 0S 0@T}0S@0S80S0S<l Iꪷ Tp+55d5d2@520Z4̸5<2P2P2222|2255H5h5 -@2LSPotP/0v0s2p0CS295@ &k020 խ -LMP`P p 2S Q?0@0$0K20020FGD$K#0K@K!KK"`K KpK2@0CS2 0-LMBPT 0K K 0PP[ -L MB T0K @K@KP [0[ -LM 0K\ K  P -L M@B$\ K0K K @wP 0-LMBL^B$L K0K PK@KK 0[PPP -PLBpT㓯e2o @Tڜl | 5R r 5 C h 7P5 z7P- g> j 6&H0S D0SP5P@@05%+%. p_.l0`.vH@$  /ȹ5.D265 p-LMBPT pLD <` 00@  @"T ph;".'Q Q -LM2`Sp`t5 X  <5  o$  DRU@ P  0L0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 P&4<H0 PO̠D0x  `X儭20CS2pBb (G`[ p25$5 -RLM`pP P$ ; 0 0x P@?PP 0 !!$ !0``1` `U! @?$$ R 1 0+10 ,`(` 0 S200S1+ $0@T!00P P P 0  !p0 A00S0 00Sp0   XBd5p+555 d ''' 'ȹ555 2 ܸ5 -LŸ2 RP0p  0  0SXb0S 09(B @Vt0Iu !@00CS0+ 0S A ` 00C! 0Pa0 S AP?AP#xAP d1 㷦ꍩX *P002 dB+ ]BuX P00 LB EB]P P00 h4B T.B8$i' 5 '' ܺ5555\5|5 -0LmMSp  !0`B!@%=?ZDP U@@T,0 @ oD e??0    卨幧P0霯0, LA0AA5[4'' 5'' '2H5 -LM?pH0 \`,0 H \(A0S Q00C!0X0 S1 @D]00P p0pᴠᶐ,0@000?0@ }@  p @$ CD0P@@FoEd '''' 2' -2LM 2Rp` l2R `2R ]0PH"=p 0 00@0F?2@ BŸ   @֧- 0@? SO 1 R 1R" ʌ1R 1R Tx1 @l1 p p 0 00 0 1R 01R0ASꀼ222222222222222 0P 0S0S? 2K"K,pKsD0 ,pK2K"KkTd ' 2'*D> < ( -L@M`83? Q@ (3\ 3Q d3QA  ] C0?p0P% W@-00 00 Rh>2  mŸ ` p 6l2P@ @    BB%-(L@ 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&!>V?G K5KB]PpPW 0"K0C "K S`2p2x2222222220,`K2KT0000000S:T0,`K@KBKd T '2'\5(T > < -t0tPL @`T0 0 q @ 40P 0(00C ` 0@ d ''' p-QLMd@ P L0L 0 S `A`p0` \d ''' p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S App=P 0Pd '''' p-LM 0@0 0`P Pt0 P 56[45 -0@LQP ?U` UUh6᪬ P>UHp  80  00CS0r x5 -0P@ LR0`  Tp TThx |>T h@h 00000CS0@}`*1S   x5 0-t @P0LS0\0@ z>0S @0P%7  ̤P7  0 5 0-x 0P@QL` 0@0 U>Q @0ۤP%7  P7  0 5 p-LMP L1PHA = (0 fP`A1=$0 \P400=,0d P咣P0M@%͠   `崤` 00CS0pᝪ꽫 L=`궫 4겫 ( 2 255$5Q Q Q Q0 ' -LM`0p 0 0S"R; RR0 R. R 1QA 0%͠  @Q000z00CS09,A$!000ͤ00CS0* I0 z= 0K o R0 Q# Q 9CS񟗹p2222828222<K@P=8   2X555 0-l0@LQR RR R@P 0 40  k00CS00hǩ - 80,?0 Q B$0  '' 0-@]L\ # 0S 0  00 S:0 S B<0   0ha? 000'-0 ,B$= ' 0-0@P00L^000' p-LMP@T` 0 S0  Qphn0  '' -@LPmpP\00h0 _2 p-LM p0@P`0SH  0000Sphq0 d ' 6 0-(P@L00h/d 6 0-L0 L@8P 0000S0hCd ' 0-L0 L@8P 0000S0hq*d ' -LM 9  :070 71 6G< &< N>Y0ڄ1!51 0x!x1 0 ( p<v{L1!1D1(188! X0@0!:; 1 1!1* :os  >P 0 S00S)0Yh00S)   o:p+55 5D55X28 @2D3 h5 <6<6,3|2d223,22['  5 p-LMP0@A `H墛 9S P9S :#   p 偟ޠ }`09 p-0LMP99`@hY<P`Ll  Pp @ Vp 9 p 55 p-LM@`Pl PPUti@Zp&li -Lp `XyP\ Z ҟ0SS @L1 R@d) 101d)d9d$00d)01d9d) d9S. PdI1$ d)$0S 0d)1 01d;00d)(d,d9<0d)8 d)1 0Z`9`8"9  bbb 545T5x5 -@\ `PLPpd9Sgdy꟟\i -LM@Z4P 5A0AS { 00 'R0 - 0PL@ 7Q22222S $)\ BP > <7l41,1a<7l<7l'K 0!#R00<1  S0C⠐81 ; @p;0PP `$ 1 01 # U  @  00$0 $ R 1 0+10 (,PP;c   P)P@ 90/. 0b98,0 S 4,@@ <7KKl  .4 0 <ǚl0$ .4 00 \  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P 5 ( "(  0hDP$2,242<2D2L2T2T2T2T2T2T2T2T2T2T2\2840,($ 5 555$5,5545 p-LMPK 0@#![>  01[8#Y#h #͠##: 0P`/ʄ|:Zj0.  0)- <0p -L`@0@ cTdTDP@p  @~TP /`\4<5 p-LM`PV@ V@@|0 L\R@ ZT@  8 , @ ph  0-L@PUT T 00CS 0h) -LMPc0@1 @T@0>S @H cTdT  "bP<@7l0<'~OlV.0 NH p@ 01}@pm !0@T`p噕P S 1 > 0 9PU1 >0 /PE4PX8fP@1. 4A\ 0 @匕\ 帔P Q 5QN n   =5;5%@ %7 S  .  w `.q LD.\4"VS\5  55X2D555$5 0-@P Z5L=05U   t  P9S 9SV0h~ Yy YYD00 .0-0@L PN% W0CQ  T 00HSAQ B00HS0 0h6 -LM`x? (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@Kϔ W3 p-RLP΁%-M`  0 ph-t0 tP0P@> @@ lPɅTIy 0 ph6 P52 4 6 0-LM0 @00P<@0-TT@T@ -0L00-D0000D0<P h-0 40P*40h -t^4L5`5p+55 35 p-LM00@@P0`SD00D0 0@@0ph 0-00@L@P0S R000H0 0  0h -@ML40@ @,@'0S hC-hD5 35 -LM`L0PS#DpD@ 0T  R0000 0  s oPL0S @D@TaD5 -LM@0<@0D0 -0P0CLpS?< 3 3 3 3 3( 3 3~ 0 S00 0` S0C40lP`  0$0R  0 4P  0 S00 0C@` * 00 0 0  00  00  @ 0 S00 0 S0C4P` 0 @ $/0@0m`m`D p-LMH@PT0`Q4& U 000SHPp@T 0 R @Tp000SH@ pPp p-LM0PR `@$0 $R Z RR 9R3 4P 00 K`V 8K@8Ÿ<8N0 @@<$p0$  ^``00 @8Č0`` `@ u1R 1RH 0\$  C 04 <+Z(1R0  R 1R KL   R # 00S0##400R R   R  00S0C4H\0`H 0\$q  j3 5 &^(^$^ P-0L 0 +{5ma^4 -PUp`L e |P@ U 1R@P-0SPP p-LMPK`@P) 0` P4p 0-@4PPL 80S0e00h> -LM@e p,P`A )<08SP 00@Ps s0l0ML@P \00l m0n@o@P80X q@r@pPP@'T0<0P0<@0P S\8e 8N0@@<P@ <F@D8el (` aP@m3 -L MP `0 Ƞ(,@0 , @P`p0Z ,)( < 0R)< 0 Q0  "< 00S RP K R D -LhMؠ0@(0 PPK` (0xK(0 g,@d,@ @e \Pp0T  @@o* (0 S (y`a585Pe Q-L@`' 0S$ 0S! -,PP#p P 0e0  0 S 000 0S 00 Q 0S3 : AQ0A Q0A <0<  $0 0 nama 0-LP@T 0P 0T0C?0D RR1*00 RR1:000 - L`ePU e 0* p@T e$ '0`0p' 00 ?0 0ppppP0Z00P00 -Lp` PU030#\Z0 @pT0 +%4X0P 0p -LM `Vpe @ 1>PU @e ) 6@Te% &' 0@ p`0 `' 0 0 0 0``P@000 P@ -L M p0 0W`e , 00 (.PUe & @Te" &`@& 00,0(000  0pP000 P] -LM 0`Sp(PU! $K 6P`eD @$0T0  'P`e5$00@TPU0 0sP 0AQP0000 p-L M`@P{P 0 KP  0R 0  0$0  $00 p -LM0`P4 ep9 P@0 0P 0,p` ( 0  0 00PU0e@0 0-@LFP0 P(0  00P000h2 -LM@00  0e0C 0h P 0 RP\ P 0 RP\ -LM("HP0 T 00 -LM("HP0 T 00 0-P0L00@T80  (PR 00 -LM,0@0(00 001 0-L'M@PL@ K @ 壔0 PS 0`aL5 0-(0@00P L00P,00 0,0 00 -,0 0(,00 L000 -00, 0 0 0 0  , 0-00 00, 0 0  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,0 0-@PL0$00$ @  @R00@0 -LM0@S 00P .&000\5 p-LMP@(`V $0S00S 0R*1 00 0S00 V 0S 0Sph`pp  -LM00@ zP00H p-LMH@ P0`S ph000 0@@0  -L$Mx`̠pdß `0 @,&& 3\00 4PP 408 PP  &8<@ @0P PU(@K $08$ (0K0' K&0K0 4$0KPP44?PPSLPL0PP0TT0XS P@h8H iPH PUHPX0͠ P PPPL M<1`*K 2K(  (? 1 P %0 x@5 0 0  xpq)0X2<8D P 8@ @0vPa _|55~54T^t,35555 5<5\5,3x5* aE̸5/3*303 - LB% 5 -LM5@+-Q* \2S 0 S 0S0! 10C1hTP 5;5Q 0S010C1<P5 ;%5 -LMx@P`P5p;5utPVt0p000t0p01\Si7 Stp 0-Lx@-P0h& -0LMR@P(0 x`, RRP2S S0P2͠\AHX0  @P@$ $! $P2\2P"S0\2(0K@(0S Sl00l05@ Pl0p0l0 (00 0X( &`h0<0Ph0  ;,3x5 5@5 0-L@PU$ 1  !0 !1U0 @0$0$0 S !0 0,(4P`x,0T 0P\2i 1i i i i  p-LMt0`0@t04#5 ;%5PDphD5 - LMx@5@ 5@05%+%h 0-LM@ T0PS T0LDHH  ZL0S(tP0p#0'+35 0-x0%P-%Ut @RL0?RtP -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40D`(00(0 !53635 sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WP ~! z!5 5,5 p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@:K!L5 -QLM@8 0C?. B"0}" z"t55 - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h ^45 0-LMT P0@L \  0 @0  P=$8P 8$8P <8T @ $8P@40 }T00T0 00h@T0 l0k0 T00T0 @)X <#3  \0 + ;8#(0$8P 8T0@ \0  ,  R,,$8P0 :365 0-P(0L0T0@08T0$P0 4PL0 0h p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@.ppp p-LMT0@![Y$80 P8}`$8P0 4P ` cVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00@Uh, \00Q0S p-LMP`,0@0P 0P 0PPP[0Ud0`[PP`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00zT 0@ T d00<0H0 0j\0HT  0d0T 0+ [\0T H 0d0T 0+ M\0H( 0DH0& ;X0H0& 2X0H0# (X0~H0# X0sH0"iHPQ- -LMT0@h0S 0 ?C5A0P 0S0Q  0-T0@ L08P0 $4P0P8$ 4T0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000- 000008P0 $4P0@8$ 4T0@@ \0 3P   006    0060000 0S  < 0060 006 0060@006 000 00608P0$ 48PP0$ 4 -LP 8_4 p-LM@P`  |(0tH0 L8 P`0 T0d  $8P4 00 X0pph8_45,_4 0-(0PL@ F 0ES @F3`F3 F3G3 H0"S 00 H0"S1p H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 8'l0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4% 8P0 $4P0@8$ 4@ 000 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP \_4 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph\_45P_4 0-(0PL@ 7 0ES J3J3xJ30K3 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% `0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 0 0000000000000000066 -LP _4 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph7_45_4 0-(0PL@ 7 0ES M3M3M3HN3 H0"S 00 H0"SPp H0"S 8P0 $408$;P 80% U0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DTO3 O3 O3 O3O3 O3 O3 O3 O3 O3 O3 O3O3 O3 O3 O3O3 O3 O3 O3P300600060000006006 -LM@8$P 08 -L"P _4 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph>_45_4 0-(0PL@ 7 0ES Q3Q3tQ3,R3 H0"S 00 H0"SWp H0"S 8P0 $408$;P 80% \0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008$P0 4  00000000000000066 -LXP _4 p-LM@P`I  t(0lH0 L8 P`0T0 $8P4 00 X0ppht_45_4 0-(0PL@ 7 0ES T3T3T3TU3 H0"S 0 0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4000  00000000000066 -LP (`4 p-LMPL`@  0;(0H0 28L0 0P@?>C2<0 S T Q P0$8 40 X>8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\   $4P@8$0 88P0 $4 -0$8 P8$08P 8L0(`45`4 0-@L8P0 $408$9P 8P$8P0 4 P }U0 p-LM(0@`PH 0BS 8Z3XZ3Z3[3 H0"S pp H0"S3p H0"S 8P0 $408$;P 80% 80 8P0$ 408$9P 8lp p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<00<0006 -LM 0T@P  @%#,00R0S ? 5Z p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0pph!5`45 0-(0L@P0  H0"S0ES,^3]3^3@^30%0\:p00 5 -LM@a8$P 1<8 0- 0@ L|PP  0?.C5BBT@ 00S$ P a4l<5D5 p-LM@P`b0S  ( |H 0LP`8000T0 $8P4 00 X0pph a45a4H5 -(0L@pPA H0 S?0BSa3h`3`30a30% ` V j80P$ 8 0$8P 88$P0 4  5b\5 -$0Pp @0 `0 ,@L8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  0060 006 0060@006  0060 P x P8$P0X 4000000060008$P0 4 D5l<5 -LYP Ha4 p-LM PL5 3S@`* L5 3S? =  (0H0 P`8 0L T0 $8P4 00 X0pphi\,0L0? 0L0 Ha45C2<0( H 0L80P` 0d0T  $8P4 00 X0pphDb458b4 0-(0PL@ 7 0ES 4v3Tv3v3v3 H0"S 00 H0"S4p H0"S 8P0 $408$;P 80% 9~0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP b4 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pphb45b4 0-0BPL@ S Xz3xz3(z3z3 H0"S 0 H0"S+p H0"S 8P0 $408$;P 80% 0u -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000C 00000$8P0 4' 8P0 $4P0@8$ 4@ 0060  @006  006000600068$P0 4     -LP c4 p-LMP@`  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH'H' 0c45c4 0-0BPL@ S `~3~30~3~3 H0"S 0 H0"S)p H0"S 8P0 $408$;P 80% .s -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 0 00000 00000000 000066 -L0P Lc4 p-LMP`@!  (0H0 L8 P@0 T0d P0 $840  XP0 8$4 0X ; X @0X : X X0 \0  ph2p$8P04\Lc45@c4 0-(0PL@ 7 0ES 33ā3|3 H0"S 00 H0"SCp H0"S 8P0 $408$;P 80% H0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0@0,0$8P0 4  00300 0 000000S S000 00 0, 00000066S00 000P08$4 00<000 - LN5 Ó0 ?0 0  P 00<5 p-LM`@P0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0pph75,^5|c4pc45 -1`LQPp@V(0Q 0GS 333Ԇ3 H0"S H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@p H0"S0% 2v =,^7c45 -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000000066  ,^7|555c45O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb3 in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811  R R 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R-  bs_notimpl_bs_mmap: args at 0x%08x -  bs_notimpl_bs_r_1: args at 0x%08x -  bs_notimpl_bs_r_2: args at 0x%08x -  bs_notimpl_bs_r_4: args at 0x%08x -  bs_notimpl_bs_r_8: args at 0x%08x -  bs_notimpl_bs_w_1: args at 0x%08x -  bs_notimpl_bs_w_2: args at 0x%08x - x bs_notimpl_bs_w_4: args at 0x%08x - k bs_notimpl_bs_w_8: args at 0x%08x - ^ bs_notimpl_bs_rm_1: args at 0x%08x - Q bs_notimpl_bs_rm_2: args at 0x%08x - D bs_notimpl_bs_rm_4: args at 0x%08x - 7 bs_notimpl_bs_rm_8: args at 0x%08x - * bs_notimpl_bs_wm_1: args at 0x%08x -  bs_notimpl_bs_wm_2: args at 0x%08x -  bs_notimpl_bs_wm_4: args at 0x%08x -  bs_notimpl_bs_wm_8: args at 0x%08x -  bs_notimpl_bs_rr_1: args at 0x%08x -  bs_notimpl_bs_rr_2: args at 0x%08x -  bs_notimpl_bs_rr_4: args at 0x%08x -  bs_notimpl_bs_rr_8: args at 0x%08x -  bs_notimpl_bs_wr_1: args at 0x%08x -  bs_notimpl_bs_wr_2: args at 0x%08x -  bs_notimpl_bs_wr_4: args at 0x%08x -  bs_notimpl_bs_wr_8: args at 0x%08x -  bs_notimpl_bs_sm_1: args at 0x%08x -  bs_notimpl_bs_sm_2: args at 0x%08x - t bs_notimpl_bs_sm_4: args at 0x%08x - g bs_notimpl_bs_sm_8: args at 0x%08x - Z bs_notimpl_bs_sr_1: args at 0x%08x - M bs_notimpl_bs_sr_2: args at 0x%08x - @ bs_notimpl_bs_sr_4: args at 0x%08x - 3 bs_notimpl_bs_sr_8: args at 0x%08x - & bs_notimpl_bs_c_1: args at 0x%08x -  bs_notimpl_bs_c_2: args at 0x%08x -  bs_notimpl_bs_c_4: args at 0x%08x - bs_notimpl_bs_c_8: args at 0x%08x `^2-@@Pr?0RW` p3L3X3d3` B`p Bp` B`RE0C`R9`333̗3ؗ3333` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `꬘3И3Ę33` B`p Bp` B`p RpPP2-B@P00O0RW` h3D3P3\3` B`p Bp` B`RE0C`R9`333ę3Й3ܙ333` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `ꤚ3Ț333` B`p Bp` B`p RpP2-D@P?O0RL` T303<3H3` B`p Bp` B`R:08`R/`33333ț3ԛ33` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `d33|3p3` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480`^0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   d4` `! R0-P@ 0bR03 B00^``0 B`3`1`1c11c!0"b2c3c0acP@^_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Qh4i4i48i4Pi4hi4i4i4i4i4 i4 i4 j4 j4 j4j4(j4(j4(j48j48j48j48j4Tj4Tj4Tj4Tj4tj4tj4tj4tj4(j4(j4 (j4!j4"j4#j4$j4%j4&j4'j40w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- @ @  88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx (" "$ " " " " " " ""!#"Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2007 OpenBSD. All rights reserved. http://www.OpenBSD.org  $4<5444ȋ4Ћ4@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UpO&Z&Z&[&#[&<]&#]&H^&&#l^&d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@8)*)** )))))))T* h*****D*d*p*x*P*0*x*T*vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ --#54545454 X4X4 5X455 5555555555p 55p 055p `55p p55P 55P 55P @ 55P P55 5 5(5 55,5(5,55F5 5F545F5<5F5D5F5L5F5  p85(5p85(5T5X5@\5X5d5h5 l5p5 l5t5/x5U5o|550/5U5p 50{4 (255 55 @55 `55 45 55 55 55 55 055 @55 `55 55 55 55 555555 55055@55P55`55p5555555555 555555$55 (550,55@055P45`455p855<55@55D55H55L55P55T55 \5`5 d5`5h5l5t5x5 5t505t5@5t5P5t55555555555555555555555 5555 55eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0--#,545<5D5L5T5\5d5l5t5|555555,55555T5\5d5l5t5|555555,555D5L5T5\5d55555555545<5D555 5,585D5|555555P5d5<5x55555l5t5|55555555555T5\5d5l5t5|55555555<5D5L5T5\5d5l5t5|555555545<5D5L5T5\5d5l5t5|5555555555 55\5d5l5t5|555555,545<55L555d5l5t5|5555555555555 5l5t5|555555545<5D5L5T5\5d5l5t5|555555VA5$3PVA5$3VA5$3VA 5$3VA(5$3 VA05$3pA85$3qA@5$3qAH5$3qAP5$3qAX5$3qAd5$3rAl5$3tAt5$3tA5$3A5$3A5$3 A5$3A5$3`A 5$3`A 5$3`A 5$3PT5$3A 5$3 A 5$3D 5d3D 53i 53 i 5$3 i 5d3 $i (530$i 853 ,i (530,i 853 .i H530.i X53!i h5$3 !i p5$3)i h5$3 )i p5$3-i h5$3Ai x53 -i p5$3Ai 53Ai 53Ai 5355555555555555 55$5,545@5H5T5\5l5t5t5|555555555 5 5, 5< 5D .8"5 .L"5D .`"5 .t"54."5"54."5"54."5#54.0#5T#54.h#5#54.#5#5@````` ```h25252525252535,35P35l35353565353545845X45|45454545454555D55t55555565<65p6565 65 75 @75 |757575,85X85t85858585 95@95 X95 p95 95 95 95 95 95 95 :5 0:5 <:5 l:5 :5 :5 :5  ;5 $;5 D;5 d;5 ;5 ;5 ;5 ;5 <5 T<5 p<5 <5 <5 <5<5=54=5P=5d=5|=5=5=5=5=5>5,>5L>5 d>5 t>5 >5 >5 >5?54?5T?5p?5?5?5?5?5$@5@@5T@5t@5@5@5@5@5A54A5TA5A5A5A5A5B5@B5pB5B5B5B5C5W5>W5>W5>X5>$X5?PX5?|X5?X5?X5?X5?X5?Y5?0Y5?LY5? hY5? xY5? Y5? Y5? Y5?Y5?Y5?Z5?$Z5@HZ5AhZ5BZ5CP\5DZ5EZ5FZ5G[5G$[5GD[5Gt[5G[5G[5G[5H\5IH\5J`\5Kt\5K\5K\5K\5K\5K\5K\5L]5N@]5P`]5Pt]5P]5Q]5Q]5R]5S^5S$^5S8^5TT^5U|^5U^5U^5U^5U^5U_5U0_5WP_5Xt_5Y_5Z_5Z_5Z_5Z`5[0`5[@`5[X`5[p`5\`5\`5\`5]`5]`5](a5]\a5]a5]a5]b5]4b5]hb5]b5]b5]c5]8c5]hc5]c5]c5]d5] 680~9o:k;lL|=>@ApD FPQSTXY] $4 ["$&'X4gklrdK2&4<0400   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt1000l00100  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?TC1C1S1S15̫5ث555555 5(505@5L5X5`5p5x5555XBBp@m@m@m@ f(  pt""(4I@@@@1` #U4QFb '               >@0@@ Q@c@c@< 1L1Н101tX1̧1L1Ԭ11$11س1      `1\11H11411L11abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` 74R94 :4];4z<4I:4@;4J=4RD>47>4 P;4 |;4 ;4 ;4KA4 B4@#*B4 B4 B4 B4  B4 B4H@ B4 NV?4 _@4pB4C4\jE4 "F4 :F4 "F4EPF4 F4m?4KF4AG4[ H4H40H4 >I4NJ4j\K40L4?PL4nL4 M41111L1111L11(  v      W 1 Q `  1@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   1  L+ L L1L2 D   O  {1o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@n@0Df @  Q k k"k"k"k"k @^z BF |9 8d1111 B  w W UP  <1b0 0{&"79=F@W wn a- <2222+2 ,2.2\/2@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0C2E2F2`G22V{%1" `"'`~%ZPtT2TU2Y2e2$e2Pf20j24p2hF h22d22$t2Д2И22@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- 2L223585<5@5D55̫555555X5p5x55!A  !@@@@E3G3H354J3@K3;3 5 545LM3XN3P3Q`P50Q3?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD4.1RAMDISK#45 @(#)OpenBSD 4.1 (RAMDISK) #45: Sat Mar 10 22:03:19 MST 2007 OpenBSD 4.1 (RAMDISK) #45: Sat Mar 10 22:03:19 MST 2007 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterdrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) : where did the card go? ne2000_attach: setup failed ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comcomprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocregistersuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx \%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending not lockedmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensorssensors kthreadsigaplpauseissignal coredump%s.corehashinit: bad cntkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleNameSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSLFSLOFSFDESCPORTALKERNFSPROCFSAFSISOFSADOSFSEXT2FSNCPFSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_crypt%s: %sassociation failed (reason %d) for %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) %s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: station %s power save queue overflow of size %d drops %d %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUNauto11a11b11gfhturbo0x"NODS %s->%s(%s) type#%d %dM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %uMbshortlong protection enabledAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdkdodzegf2fifrgrgthkhnhrhuidiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamcmkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5Finalmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p uvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplsctkplscsiunable to create scsi task threadslackingoutstanding scsi tasksgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook %s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasd%s: WARNING: unable to establish shutdown hook drive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totalSCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc_read_epN: ep %d, no xfer fifo full when trying to set short packet ep%d: fifo error endpoint %d already used by %c%s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: couldn't establish interrupt %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info port 0x%lx/%lu: %scan't allocate memory for command queue ,0x%lx/%lu: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedlcdzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s %s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statezssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedraiduse one of: %s[a-p]parsediskrootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOorasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadconfigusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: %s %s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: no report descriptor %s: no memory %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out %s: setting alternate interface failed %s: no union descriptor %s: too many errors, disabling %s: usb error on rx: %s udav, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not allocate protection frame %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control usbf%s: can't establish softintr %s: usbf_new_device failed, %s %s: can't create task thread set config activated %s %s, rev %d.%02d/%d.%02dusbf_devinfo_allocusbf_allocmemusbf_start_next: %s cdcefOpenBSD.orgCDC Ethernet Emulation%s: usbf_add_config failed %s: usbf_add_interface failed %s: usbf_add_endpoint failed %s: usbf_add_config_desc failed %s: usbf_end_config failed %s: usbf_alloc_buffer failed %s: usbf_open_pipe failed %s: usbf_transfer failed cdcef_do_request encap error mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s  0cd'(p@@ @ @ P4e4e4e4e4أ4e4e4d5e4e4f4 f4f4f4$f4,5(f48f4Df4Lf4Tf4\f4hf4  (,*&% # ! /$O^O^<66pP^P^H6H6q^q^<6`6r^$r^|6,6Lr^`r^|6,6r^r^H6H6s^s^T6L6s^s^T6L6s^t^t6L6$t^066L6$t^066L6$t^06d6L6t^u^T6L6Tu^6T6L6Dw^0w^|606 h}^ 6|646|}^`^|6468~^ 6|646~^~^T6L6^^T6L6T^h^T6L6T^h^T6L6|^L~^T6L6^^T6L6^u^T6L6^^T6L6(^<^|686^^6<6P^<^6&6^^6P634^<6X6 t64^<6T6 (^^<6 6!64\^<6 6!64t^6D6/74^6D6/P4^<6 6!X4^<6 6!X4^<6 6!X4 ^<6 6!lY44^<6 6!Y4H^<6 6!Y4\^<6 6!Z4|^<6 6!Z4^<6 6!|[4 6<6 6!`^4^<6 6!^^<6@60,^@^<6\60\^p^661^^661^^661^^661^^661$^8^661L^`^661t^^661^^661^^661^^661^(^661<^P^661d^x^661^^661^^661^^661^^6610^D^661lf4tf4|f4З5h0,&&C!l   h L @h4$J N ,Q W U ,V @ s  ] L G 7n5THIS is A memory TEST patternu4%K$ @ d w4     &!!@!!!!!X!,!H,!6!6!8!t !7!47!d7!7!8!p !7!7!h8!p8!8!P!(;!\;!h!A!A!B!8!B! @ @   )З5E! uaxz4"z4t]#`4x#z46z4Q!x4U!z4hV!z4U!P4U!4U!z4U!|4V!z4%h-6(!-6#-6#-6".6"D.6"p.6,".6".6".6# /6"L/6 "/6=%/6#06#006%"h06#06#06#06$&"16<"H16D$"t16 >%16!16(!16T&"$26l&"P26x!(36&"|26'"<-6'"26'"26#P36>%0a6-6%D.6"p.6,".6"16!16(!16T&"$26l&"|26'"<-6'",a 6-64%D.6"p.6,".6"16!16(!16T&"$26l&"|26'"<-6'"P36>%4a6@="d646"d6nativeh-26@@,"-;"X3l3nativeh-26"-X3l3\4h4t4#Ĥ"" @# $ 4%`j"p"#%%#%$% d%@% D%$+ # #"%%"","# P$ $$ $ $ $ %̴%%p%##"#8_"$p"## "\"#""### D$a#%% % ؕ"%%####D"##{+{+#+؅+ t+ Ĉ+## }+"""\" Q###xP####`"# a" $#% l" l$ $ #("##`- p$$$# ##### # ##L#"8$# $ $L# %0%#8""4%##y"ī%H$X$$0%8%d%#N# ######" %# ###########%###g.#######%@%######4"""#######t%|k" d+0"" % @+#%T%\%D#++#̾%"*#######################I#J#tJ######J########## (+" $D" %" +### %H%%l$%#d%%%8"$"@++ |$####### d" " " D"# {+}"###%j"IJ%p%###0H######L%M#"""Ȍ"~"<""~""8""P"d~"$6$6$6|$6%6 $6 %6 0 d###%6%6%6%6%6d@B d6%5(4<48##D&6 (#L#\### # ! 4;5P4X444444t54d15444x5{4t44P54544{4\5ș44ԙ454t4%5%5$$ $!$L%$t"$4#$%$l&$%$&$'$'$'$)$$*$T+$ttyclsttyopnttybgttyinttyoutE$F$F$0G$+$hK$M$S$e$,$%>%2lockf@` 4$4,444<4D4L4T4\4d4h4l4p4t4|4444444444Ī4̪4Ъ4Ԫ4ܪ4 -6>%.6#/6ԍ%16x%16#16\>%$26d>%|26%<-6l>% b,6%P%%\%%H%%|444-64`-6 4-6 4-6 (4-6 44.6 @4<.6 L4h.6 X4.6 d4.6p4.6|4/64D/6 4p/64/64/64/6 Ȯ4$06 Ԯ4T06 406 406 406 416 4@16  4l16,416<416H416 T426 `4H26l4t26x4264264264$364L36-6(36P36<-6h-6-6-6-6.6D.6p.6.6.6.6 /6L/6x/6/6/606006h0606060616H16t16161616$26P26|26262636-6>%h-6x%-6%-6%-6%.6#D.6%p.6%.6%.6%.6% /6 %L/6`%/6#06%006%h06%06%06%06%16%H16%t16%16#16#16%$26d>%P26@%(36h%|26%<-6l>%26%26%P36# b 46-6>%h-6`%-6%-6%-6t%.6%D.6%p.6%.6%.6%.6`% /6%L/6%x/6%/6=%/6#06%006%h06%06%06%06%16%H16%t16%16x%168%16\>%$26d>%P26%(36%|26%<-6l>%26\%26%P36# b,56\%%%`%-6>%h-6%-6&-6&-6 %.6&D.6&p.6&.6&.6h%.6% /6%L/6%x/6%/6=%/6T&06&006&h06&06&06&06&16&H16&t16&16%16#16\>%$26d>%P26&(36 &|26&<-6l>%26&26<&P36>% b|66. .. -6>%h-69&-6^&-6`&-6`&.6a&D.6a&p.6b&.6le&.6 h&.68k& /6r&L/6r&/6r&06\r&006r&h06r&06Hz&06@~&06&16D&H16T&t16 >%16%$b76 l&&20123456789abcdef^^3333H~4\&&#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2ʚ;3ʚ;4ʚ;C =D$E =F$cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ \;6;6':'|' 8''N'\4 ';6;6d $0H`l    $0H`l|44444444444X54444(40484@4H4L4T4X4\4`4d4,2>6w(S(De(0f(t(>6))6)((:)x))>)>6,(L )!))()8)')>6(X(t((>6D@(X(t((D<(J(>6?)X(t((L)>6)?)X(t((>6@(X(t((' (8 (>6(X(t(((44=6>6' dX$?6(?60?68?6,?6}E#(D<8Q @X,?6?6@6@6=6 =6=6=6(@6?6?6?6?6?6?6?6?6?6?6?6?6?6?62(@AAA==(A* dd%(i @@@@@@@@@dA6%h-6)-6l*-6*-6*.6*D.6*p.6*.6*.6\).6) /6"*L/6"*x/6K*/6=%/6)06"*006#*h06&*062*066*068*16:*H16?*t16 >%16)16)16P@*$26h@*P26)(36@*|26A*<-6@*26F*26,G*36hm)P36>%bB6-6%.6hB*D.6*p.6*.6*.6A*.6$B*/6)16)16)16P@*$26h@*|26A*<-6@*bD6-64%.6D*D.6*p.6*.6*.6DD*.6D*/6)16)16d)16P@*$26h@*|26A*<-6@*P36>%bD6 ... ...PL*L*PL*4M*PL*\M*F64G6G6-6>%h-6Ly*-6*-6*-6T*.6*D.6*p.6*.6Ȳ*.6Ќ*.6ď* /6"*L/6"*x/6t>%/6*06*006\*h06*06*06*06 *16 u*H16*t16 >%16f*16*16P@*$26h@*P26a*(36@*|26A*<-6@*26F*26*P36>%bE6-6%.6hB*D.6*p.6*.6Ȳ*.6A*.6$B*/6*16f*16*16P@*$26h@*|26A*<-6@*bF6-64%.6D*D.6*p.6*.6Ȳ*.6DD*.6D*/6*16f*16d*16P@*$26h@*|26A*<-6@*P36>%bX'EPES EX_(X`hpxH zE<EP9EP9 ?l!E8ND:E8ND:E8ND:[q݅!E8ND:E8ND:E8ND:,&>!E8ND:E8ND:Ep 3b8!E8ND:E8ND:Ep:N4=!E8ND:E8ND:E8ND:!E8ND:E8ND:E8ND:  !EGsEGsEGs !W!EGsEGsEGsl!E8 E8 E8 !E8 E8 Epg5!E8 E8 E6+q~!E8 E8 E8 !E8 E8 E8 2aE8 E8 E skb!E8 E8 E s=yaE8 E8 E smWd!E8 E8 E sRaE8 E8 E s8!E8 E8 E sDKaE8 E8 E s|!E8 E8 E sƆaEtEtE sE%f!EtEtE s9:aEtEtE sQ+!EtEtE s+vaEtEtE sV\!EP=EP=E sнmaEP=EP=E sI8!EP=EP=E s,(aEP=EP=E sɛy!EP=EP=E sDFaEP=EP=E s !EP=EP=E s qaEP=EP=E s %!EP=EP=E s MYaEP=EP=E s W_wp!EP=EP=E s _YaEНEНE s mU!EНEНE s 6uLNaEНEНE s =px!EНEНE s aEНEНE s{!EНEНE sWaEНEНE s*- !EНEНE sq!aEНEНE sTaEPEPE  5k!EPEPE  ƾaEPEPE  z_!EPEPE  waEPEPE  DTo!EPEPE  pOPaEMEME  <4p!Eh2Eh2E  aEhd Ehd E F!E: E: E oHaE- E- E ΀B!E^ E^ E j_ !E+ E+ E'I7 Bu!E(E(ETz8 6{BuaEYEYE `w{!EEE ИaE#E#E K!E0TE0TE ]n6!E0E0E0?T|g!EEE?caEOEOE !EEE &aEHEHE ?U!EHJEHJE {k6aEH{EH{E B!EwEwE zpaEEEEE !EvEvE 4!E`dE`dE`d<x!Ex@Ex@Ex@(w!ExqExqExq(CΪe!EP EP EP (1j-!E};!E};!E};!(3$!El"El"El"( !E=#E=#E=#=4&k!Ej6$Ej6$Ej6$"!Eg%Eg%Eg%"}ǛE8E&E&ڀFESEh^ Eh^ p x Pr)EEYEY+ $E E E {E3E3E3/tmp/disktab.shadowEEE/tmp/fstab.shadowUE#E#E#/tmp/resolv.conf.shadow^!9! E0E0E0/tmp/hostso E0E<.E<.?E )1EPr;EΕ&y%E~EkEk{ꉮKE/fEa Ea z&[Eu E%EΕ& 7pE!E+EΕ&  )ppEEd%Ed% 9W}3D jC=z`4h|54~z.nn]AfOtUhD/Gw8'SIv ε089rC 9:aY_!X@ԳU6ttü[ch-,{iBEbR$up;'C 8B1k4ƥw |o 5 #$pVR*jϑ8U>sbeUp98MS!'623Ov7`կ] 'Ɲ{p˩I=yaxuaD Ͻ |)qu蛣@)NlـȖ"lcQ\o|t<:Y;Z͇d~O~ʹ 8gST@^ Gu#.U[J@okު5ڢw+F:J9Z:5X[yV6Jh-2f3@i vOI= !cS`fTIP;TeȱN 'HN `$17s}?.45d__EcK1 u>gb}1@H |V\vC&"`̅YsP._+w a7?:Ճ٪X 6=7طVٽ\d<bՓ$yεBVlخW3HIEcmOj WP~RbZ`9_Noqγ;)$\!d\<o(r]U#?+Y*3Z^R[=yVʼnŢZ)vB+N%?؏lN ]S-31:G8$B~Ta۬87pڙMJ߈B=د '"p1rK#:OĠbeHbefs޷9rŖWԷrx#F5-Zg @]+Twtf_|h0zG5mc=l!FSrRj(Kpiͣ]M%,Wݩh["PΣ?Bx)ѧ ̿}å,}"GEPob(*.=$-=qiiԩۘgC0ogG RNpBXIIx?/rU%藜tQ(M-)b[.Oh#y F1P(!_-,!\X  . .. catchmodchgrp cp dd df edexprMhostnameI7 ksh sh ln lsmkdir mteject mv pax tarcpioM rmsttyMsyncMsleepip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmwareɠgroup7spwd.db protocols)services) disktab fstab* resolv.confL hosts* ... ... ... ... . .. bin dev etc mnt mnt2%T sbin%T tmp usrvarinstbin.profile) install.mdupgradeinstall install.subt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ... . .. binmdec%Tsbin%TshareT . .. ftpgrepMfgrepegrepgzipMgunzipgzcatlessMmoreM sedP disknames7 . .. . ..ztsscaleI7 . ..misc%Tkeymaps . ..termcap ... . .. tmp db runemptyT ... ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons uall tuner0 radio0 audio0 uk0 random lkm tty00 R tty01 tty02 tty03 apm crypto pf systrace wd0 wd1 wd2 wd3 R raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _hoststated:*:89: dialer:*:117: nogroup:*:32766: nobody:*:32767: Xrwd1iYwd1jZrwd1j[wd1k\rwd1k]wd1l^rwd1l_wd1m`rwd1mawd1nbrwd1ncwd1odrwd1oewd1pfrwd1pgsd0ahrsd0aisd0bjrsd0bksd0clrsd0cmsd0dnrsd0dosd0eprsd0eqsd0frrsd0fssd0gtrsd0gusd0hvrsd0hwsd0i . ..MAKEDEVconsole tty memkmemnullzero stdin!stdout"stderr#ksyms$drum%klog&bpf0'wd0a(rwd0a)wd0b*rwd0b+wd0c,rwd0c-wd0d.rwd0d/wd0e0rwd0e1wd0f2rwd0f3wd0g4rwd0g5wd0h6rwd0h7wd0i8rwd0i9wd0j:rwd0j;wd0k<rwd0k=wd0l>rwd0l?wd0m@rwd0mAwd0nBrwd0nCwd0oDrwd0oEwd0pFrwd0pGwd1aHrwd1aIwd1bJrwd1bKwd1cLrwd1cMwd1dNrwd1dOwd1ePrwd1eQwd1fRrwd1fSwd1gTrwd1gUwd1hVrwd1hWwd1iXrwd1iYwd1jZrwd1j[wd1k\rwd1k]wd1l^rwd1l_wd1m`rwd1mawd1nbrwd1ncwd1odrwd1oewd1pfrwd1pgsd0ahrsd0aisd0bjrsd0bksd0clrsd0cmsd0dnrsd0dosd0eprsd0eqsd0frrsd0fssd0gtrsd0gusd0hvrsd0hwsd0ixrsd0iysd0jzrsd0j{sd0k|rsd0k}sd0l~rsd0lsd0mɀrsd0mɁsd0nɂrsd0nɃsd0oɄrsd0oɅsd0pɆrsd0pɇtty00Ɉcua00ɉrd0aɊrrd0aɋrd0cɌrrd0cɍwsmousewskbdɏ st0rst0ɑnst0ɒnrst0ɓest0ɔerst0ɕenst0ɖenrst0ɗttyC0randoməsrandomurandomprandomarandomwskbd0ɞ apmapmctl . ..chowndhclientI7 disklabel7dmesgfdiskfsckM fsck_ext2fsfsck_ffsI7ifconfigI7initMmknodmount mount_cd9660* mount_ext2fs* mount_ffs7 mount_msdos mount_nfs7newfs newfs_msdospingMping6reboothaltMroutertsol$umountdhclient-script dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 ARCH=zaurus md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf echo $val " # see ztsscale(8)" >> /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h ELFa(t4$4 (eep#pp$$### 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x / P000`P`0 R ^ *0 0 Q P:00ꜵ 0S SX 00-SL@  @1S@DQ@Dt @Dt0錣 -LM$@0S0Sꄣ -< L04S0 00 h?$ꌽl## 0S00ꐽ -LM`pQ 0S5/-p@PPPQ P Q088 8hQ  锽4Lh! p-PLM@@P` ph 0-@L APP \_<< 0OSP8  (0,0SP_ꔽh!TLD` -䢟䒟<LMP000ȂS09 pP=v A@T` 8K0  \ Xn TŸ8 ) R<Ÿ8 0a 08 Z0000S0A  10S000 B K_ 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU D00SRU!D0p! @0S 0S  0<! @0S 0Sp hD###\MP(#DX 4$̎8$ЍĞ$L -LZ 00## -LO04$ -LG P000$ -L<0 -0L000##0# -0L00##0# -Lp0$ -Lh0# -LCt 0-LMK P^p@81 0I  R@ 0b0CS$ \\\\\\\\,\8\\\\\\\\\D0D0E0J0AS00 0xS S *S 0S ", 0 $C0 C0# p-LM KP qr1 =I PY 0b0CS5ꤌ$$$$$$$$$Ԍ$$$$$$$$$`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "D0 0 (C0 Cp# 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0<$##0 R0 ## - L B뤽 - L B뤽 - L B뤽 - L B뤽 -LMd&\&TS!P00s D@00Cs0 00Cs0c㟯0X0$ -8rLP,20  )P ,10S0q QP1000 A0! 1)P0 1!)0P00 tHLQPa` \10S 0@ 4P4 $A0P 03P 03PG0  Rp: P 0 0; S0`@%,"\@0h0Q X BPhVm#^#ԟ#ܟ4$`$ 0-LM@KKP tG0: S\4 KP$P0000 0R"pq0S0000餽m @ 0-L1 R 1 0Su*Q  1Q   =8A @P 0!0  t_G l囎0 0"80 0 0 0  P0    00 00000 0000 @0  W00 \D L000 F0 0 00(000$@$###8$ -0LM 0RE0RQ0R_ x00 l@ R R*T bQ 700,00S h8$Ѝ̎## -`1LMP``p@Q ]P@  . ։0S@ F0/T0V000 0T0 0 0 0S00J[ 0pd  t@P@0 fR `!* 00 0Rb50 00#@$#(L -pLuM0d yK,0 k 1b1 P a!  B=9! = 1 2. RP@+0 !r/ p`iPno JP PoOK 0!dPPA 37 R  x1 RtVOKd0`!A 7  R ,1,R@Kd0!~w?KA 7v?K!00/C#b10  0 됀K p`0d wKPY뉁6 @v?K D*00 ,0SD,U.A? `$lMbР  -LMۈ@N؈@ -LG:% -0L0>P0 `@%,"0R p7q / 30p`0-  \P 0 pWp@0P`p 0S0C0X?T00  Z <夌  _E0### -L Mȡ00 `@%,"0pbq`C 2[ 8c8d0 K00 , "PQ4 `0pSI 0SF PQ4"`0 K03K,` p"p  @0 pR' 0S$ [[0`PP  lD@0 pR<0 0S@0p R 0S#m -GMLM2 `@P d "4jp?@E 0P8ܞԞ````F-K0 B BJ0 @bTQ7A~K pGpG@/P 4 04 04 =K 0C 0CD $ $d uCP0-S D> 8SD0$(ND㊫ (ض0L08`l -L06 _wxh! -LM`PP( @(K,pK 0  (0@ST0D -L M0@p00 0Si pPP 0S nSZ =sP0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`000 ,K, ?R0S@p @݆0"Sl 0=Y000 LPH00D 0oSP =uȢТ -霣圃LxMP@`p#hpA P0@$S3ģУأ`p2`2`p22y2 R2l2|"0QAPc<2 R 82 RpK5P`,r 0Sp j%P g `P? pKPPX0: S SK sFPB1 R 0 5 DP) `j_0SV pW P@3Wp@Tj_ W p0 R  6V   D WWP!PB`LlWy<<tHlHH|HpHxHضL$Tt -LMp K75@T` P P@ Tj_ 00T 0-x0L0PS0@Q  fP 0S(0 R00 R0h$ P-L` 0S<nS 0@ ,P@6.l0PP@p` ,Pp@0oS` Bh$ -蠟L0S 0 R0 R 4 X @ Pp`0DS 0 PUjOvP D0\j/T0 1jojFEpHxH p-L M `K P@ 0s  HpFp -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 2  B 0R00 0`p @T T%/ /4 Tv Tt/ /Te Tc/0 /,4  0 Q I ZP@E;0 xZ/ ] p͇l1 R/ @pTg' + Z`P% T0 Y >P@0  P媇To馇  `P@0嗇x P@X.0 . . 4 { 5Y@AtH|H0$q -0LMPpP`)0 R @;$0 1 0 @Q0 R 咄W@ $0@Tj_\= K$KF1@@@1$00 tHlH8Dl|Hx -1L4M`, P!10 00 @,0P 1P TBp< AH0`JZ/ 0@K 01@`T9 T7 . -T) T' ..T T -- 0@K,0<T00 ʆZj -0 - - 0 P@ 0 N 30PKY@lH̤ؤl -`L@!PP pJ0S p?Pp;餽 -LM`@P0p P@ 0S T >0 $$@h! -0L 눽h!P -qLMʠ`0 P6 \P0d .40( 8%P<(@dl @ed, 0C0  $H0QZ T. Z .D  l$T\n -HL M, 0 [PnP #1RL0S @D@030(,Pp g@,B`@,v#,Pc P 00 0b0  0 0$ D0QZ TF.,Z B.D lDS\n -AMLX6 M L6L@P p`84 , 0&pdps ?0@8Sz    $ L `xĶ 5` YPp0S JP44 R@ 8$ 9P41Ppl4 < @bTQ {T YY 2!P`) P  PP 0SP*0 P9P<40<4 P<$0R0X0S CP ᅥTT^PP B.K B B85P@ y4P[pR0S (>BK@@0P XP@0DP@Tj_0T@2 R 808P0"8$ 84P084 1 RcBKHHចP] {P5 0P0 , 0  eP )P`| 04D000$ 04~ 04T 0 00T P` 7} P` 5P .P )P N P`|7 p= ضHH HL!8\Цܦ 8` -PLMP AP` @ pK]. K80S@@ 00S00v)u 0-P@ 0LSP  0S0S0  -LM Mß'}KpG` pG , P@̄Pq #T@U p`P 0S (PP @KA <0A؉ 3) 0QqA9  ]9@X US ) )2 ,0S ,SF9@TSp@R P. ((KAA /P9#42 R uOK @P؃P ? PQ̃aMK@D0 @D!@0Sx ᶃ0S0S 㭣 H媃@姃((uK?P-]KZ VP[K  OP@S0 RuIKA 0P?`:0StPP@' 0,<T)< `\n JHhxDHЧا  -L4M⠘在T `D0, 傂 0DSpH  TTX' R  08S08pW $f @TP 0S T 7p DW7' 0N0WS_PBO0gWpW' 7` 7P h7Qp`' 47W0 (  p 7 W$' @ 6pW'  6pW&  p6Wx&0S   R P6pWHx0p&0S$ $  R 6pW804&܁0S( (  R 5pW0%́0S, , R 5pW0%弁0S0 0 R P5pWHx0%嬁0S4 4 R 5pW80D%圁0S8 8 R 4pW0%匁0S $pWH0$倁L |P xT t4Wo ,0S ,q0SG p4Wt$=\5P% pW )HiPTKPKY+p3PTxWC@T(0$P=QP)0BOSl "l Rp^ ,3pWß 0#P!0Stt3P p2Wl#0dpT"PT0BOSl Ml RJp^ p2pWŸd0"P0St t 2R $2pW0"x0 1pW"րx0 1pW\"ˀx0 1pW4"x0H pl1lW"T?pPBOl0 $1pW!墀l0 0pW!嗀l0 p0W!|P0BOS 0 p0Wt@!t0w40H@KLKL0 r000Kk  pe HY\\n048<@HPXdlt|̨Ԩ,t x$08@H0PX`hpx -LM` KH,PUp@ .PP T&P UjO 0 0-x0L0PS0@Q  qP 0S(0 R00 R0H P-L` 0S3nS 0@ ,P@A%l0PP@p` ,Pp@0oS` *9H -PLM`p 0SPM%*@*@@ %PP 0 p~9됩 -LM@p`PC Tp KYP  0S -SH0=1@ !@!WP 0@0@u -L M$$@$$$ $0@뜩ĩh!D p-LM@PPPdP'{PP ?Pp8Px3P` `-PL(P @ 0IMpp$CMpܦTX p-GML`1 M Xa T!P0@4 8!]p ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 P# $04 04 =K 0CN7P[{Px Pl R{0$Lc2-P@ 48Z Lܶ4ضPd` -L0. ,Dȫh! -LM`PP( @(K,pK 0  (0@S!$7 -L M0@p00 0Si =~PP 0S nSZ =@P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0z00 ,KW, ?R0S@p @z0"Sl 01Y000 LPH00D 0oSP 1uȢТ -Lz -ML M .0~`P,0 -\p B0@3SPPPPP`PPPPPPPPPPPPPPPPPPP@PhPPP (PXt= <>LP PV<P  ,< = =XLP d x=,L'P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`F9P@ $`;6Y0S 4: S < JMKHHș@ ( &Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l/ X00R00S7 P 0@ P 10135:3P &# X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A" Д0AP,  "6X@JP "dV000TU 3 5#:,P( "0"V00X@6h1h ? "6``U 0#5 %* % U UU 4S X0 4  \ P  @x"ؔ  YRJ^   m"$X T \% P ؔ PY0 <U U%1 ATE Uc ccS"Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx. <%!q0`J  0 5 SP L S3 p0# U Ugg Ug gg !X 0H,଄  <Ja !` 0r%P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 H4R 00UV `Pwz4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,X ضH4QdQH$R 4@XlH|HHHHHHHlHHḪHܮHHLHTHpHL<lܯ4d̰\\nL-LTX\dhltxHHgfffHȬHHЬ|ܬ D`|̭NK@XNK4@@4  XP  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$p ܤ P%0W^  Pd \0#03\030"S3  `Q{ P,<"(PK0d1P ^ U * X  PQ ܤ 5Ip 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&F !0S66TQ$0 N0o00  e T T!ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$="]$ 0% > 40Q^1V>d8U U Uʠ 5+ V:%V#FU8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 hPBNK@D@D*5a P ep$ e E4Pa4: S ܤEnK`F `F @P0    %+`\d4S: 8j\d4S0 T([44 嬄 D D ~gF -LM@(K;#P`5  Ppp0W0* R00S 0rS`Fv (P@ qP@Z`F (00T P P (0vj?(0 X0(0 T0*Ц -PL`p@PDP @T:T @2 i* -LPgM/, `yPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  %*00Y00S ,0S 0S 0S $0S5MK  ) pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,0 {$, u (l oX ~lP@ <4v0 8#8edA\A|pl -LMpuQ5Q/uQ& u,Q0S hE4 0uu`8|@|PPuhu<Q@uLuDu<u4u(<%DHP\dl Q-0L $ Q*  A)t -LM`@pr $KCPr0S0S 0 #)$0 UR#U防 p-LM`PU@ T<DPP UTUpTꤲ- 0\ \8 0000ӑS^ 0 ^0d Br0 BS 0r0 -ALM3 0 08 0 0 0 0t 0d 0T 0D 04 0$ 0| 0w 0r 0m 0h 0c 0^ 0Y 0T 0O 0tJ0l E]h!@`ȳܳ 8LlĴܴ -LM00`Kq@ 00 pN PPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@xB rBEP0 0( d;P 0L\B< 0p PP4X`h P-L ''댽 0-LMt@ 0PdsQ q@pq 80hs0(0 s 0S -LM0:(0 P0( 0S(0 0 (K  sPP) 0S& =P`u 00,pK U0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 UP,00 0oSP U,0(0yP,0 0 0pP,00 0iSfP0 TU,0$0XYP,00 00.(0p$  (08@ -LM `P0p-S000P(K 0(P P@  0S 0 Q (8A{3Av ph D0h0S $ "-,0 0$  -LM@姺00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 s 0 0`t -LM@h2p0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@6o0 0 -LM0@S  hA 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$rԾ -Lohr -LM K00"P+tܾ - LPw+nt  - LPi+ot  -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p (@ -LMx \, P`p 0LSE0 dqo@nT 1  XqW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ }0K0 X"r XK 0SXT1 ,0S ,qKlKllKla0S @K00!dE 0Sqi S  SetplhrI .? H+o<&o0 "o$  DTt4Dl$4Dp|4dDTt$ ,<(8HԿ#  0-0P@0LS 0@0>00HI 0-|PL0@S d0dn0<0 0HS@n4n$n0000HI$D -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 jHX8\ -LTM\ X3XSp`| , xp p <R|0k |0@0T #|5Mpa@ P(000p0| `Kx| sPxt KPJ4K|x P}W x|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,x Pn x,Pl^'WPP|0 |(1  0P 堵@Rkfk0l0  5P|0|0;.t  an~pA|@Px :p7 P'HM! HL(0t@8ht@-gtDP8#\d|ض -0L .0눽h! -qLpM@P`!LLpF@9 -PRhp||`1`00 00Q @` 0T Q" T 1@KhP0: S 0`S  0`SḍT 8  (l&IhI IIL, \<I\ -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R mP1P km$0 S $孍Gi0SPP BNK@D0 P P`1:2i?00 tFmIKAۋPP0 R4: Si00I  IH IIpxI -0L 0눽h! -l6LkM `P`ȑ ̑ , H&3Kp ?0@8S񟗏TTTTT TTTTTTTT0TTT\TTTTxTTTTTTTTTTTTTTTTTTT8@LT\d@%0000S 5 0S$00 0S 0S$00 4$$$0S } \401 ~\$DDT0P 0 R j 001 l$3$$^ c$0S U #0#SaPa  0R000 U ڌ3 R l3l 0 R6 @hshßQ 0@P fw00#0CSt8(U P z U P 1~ U P@ l2\ t- 1TJ0ES+1 U00R00S  (@忷PP P  $!i P1 R|q/KP?0ESU4!R,, @e/s P .P} }Ke/U   *1S> 0S::0*0S'0`;$ LTdqضohqlqlxo`qoL|pqo!otu!mdt -LM`@PaP@ Qe/0S \ 0/S, p 0|pP0S \ 0/S p 0jp0V$000 0  h:Lp +]$p +W oxotq -3LiM@3T,  ` Cz8w8t8r83 ,0S ,2b t3H00? `3 R P R- 0S 0S (0s& 0S! CjXpDI00CS0X0ӤX0 PpP B00CS00Ӥ0 PpyUYUp20Sh 0SS x2 R@0S 0 S! L q/KP8  Q'q/K@ A P  90P k0S1Q A 90P YmU_+ 00TK` 0PiH  bP)f0S %f0S H  QMKe/ 4!41Pe/~p_l0 R&  0P xo pq$\WEVxo! dqomdttofd<gd -LM@e00CS&&&&&&&&&&&&&&&&&&&'0hO7$ i$l p-L M 0@3QP,F P*l"@ 0@@dk 2 0R @ ^ 0S  R@d0V@    PR@p47ppPrI0UPh! -\2LM Rm D2p R 0S 0S <s2 RJ  0Qq *߇ P1 ""1\R' 6!Q0yM,@0W0 |1R PU`60S8SH{ g460S8Sl /;0@@`\P$`0`:h0 R0 R P  P xP  Pl!dPXxootu|WEVo hqlqordALedA`sd t -LM(0PS:,00p( `e/: 3@T3 R*4 P2 je/#긒0S "0S$RB/3jP  Q q00  R00 00P U` "PU: 2 R 1 2R 5P@ $( P1!!P@(  aֆP  e/W*0SIP:01 @ 814!a01^P1!`00P 00000rS0b 0=P0 l x0/00000rS@dqx|oopqH8#oo -LM0pS`B0S0%  R2!( , 0 4 8 |< l4S X("PB4S  <0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ 5ia  0@G0p X0 XS 0S S@!18 0F 0S S (   70 20 + &@  t@ \@0 M0 lE8,4<DLT\\nht|x -LM@Tp`U(XP@H0 B0JP@ S722333t3333333sX0 8@pgT`P0  U`Pt Ol q\ XT ( <P@ 6p`A>P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / P80BUa ,P 0lPP 0S 0ڕX څ!,L, DD 00Sv Sj ,$$":4Q 80!R,00CS0, 0  ,0, o5,0 8Q n  ,008V P,,00* C R +, 000 08@O $ @,0 085 P,,00* C R , 000R,750R,15 ,xʿ L,T80a ,<广gx\n$08H\ -LMZ0, x#00 00pӑ YX3T3` H D R030!,0 ဿ0 {Y ( u, q0 m8 i4 e<  m/ P@PtB Z 0| RY  0 Y/ P@lP[B Z 00 >$ :Y (42"/8@To0, 8@T$$$P  T   x0@ \0 BS@TZ@TP@\ 0PU@ 2T0  0 X0 00CS00  ä0T (4P 0d|p|8 8LXlt(48L` -LM@0p8(0 pP P@| 0 0m!0h|PD VP@\ o_Ke/ P ,P`D e/ \ TPP3 DA]@cX`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUd(0 S (x*Tdp`"4dT d<d 01lx!tu!0 LT 0-LM$PK@x,@ X p1P h (K`1pH (00 2P@_ 0#S c(0,0 ,0S0 (,PK bp , 0"S  _0S _0 S4c0$axdl;0Чx -LM@G`0S@ -LM@@X_000S 000`0S -lL M@p` \ |0 0  Rp P00 0 ``8# -AML ; MBK@$ I:I8 , 00 8$P P ᥰP00 PP :_P` @ 00`tP1Vj ޫ:P`JK0C 0C00 H i0<=P"V4 P 0S44X0P`+P44 0 44 PV 0S@40@4 A0P+VpPz 0Sw BNK@D@D 0<04SP  4 44!\0PpP^ W00R00ST0B~KpG pG DP 8V`P [1<PPBNK@D@D0 044 S;;S(  0(/@40@4 PBNK@D@D0 044 S,  0/@@ PBNK@D@D0 044 S8  0P/@$ @$ @qP BNK@D@D0 044 S0_P BNK@D@D0 044 S4MP BNK@D@D0 {044 S<t;P BNK@D@D0&i044 Sptv,(P BNK@D@D0%V044 Spt~P BNK@D@D0l%C044 SptP BNK@D@D0 %0044 Spt=TP BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S P #@T:q30  00S044 i04S44S .044 0< 0<$ @T6 TV* P `D4<$P V wPD4` <$4 D<4V fH"D4x<$Pa.].V QPD4` a<4P V BD4 T<$4 <4P  D4G4 <$0aC1 0 +.@@ ]$.@$ @$ h,0 @qS h,܀ X.@40@4 /,.@40@4 .) BNK@D@D0 044 STI440CSpבxʑ--@ @ ($ ,X|8l,\n,l<pPdtx8# 8\l -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (MPaPY (FPR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 Q-PUI-D-?-< 7- 2-8.-*-x&-l"-`-T-w-<H| <P -0LM pR` 0(WP @0a SPU@W0X0 S000 S S @@  ,p 00  ,Cto8 -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S ^ T -d1L(M\@@K @ Dq04Q@K`@@ 0< 0C 02 0H 02 00.  и ̸ ȸc ĸ 5 0pB 0`XX 岸~ `h!$X@|,<t82P *0P ": -MLM N~KpG ) e/9 , Q   P PplP L) KA  BA .K B B)   JP@j(K0PS44S Z(K0S0( K0@4@44 @@ @\4*S:\4 X4(KS:X4 0mKS(K00P Ze/뎎KH4: , $*P 00CS00  ä0k)(K00q P@ P 0@pSGUx_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_Xx_x_x_x_0Xx_x_x_x_x_x_x_x_Xx_x_x_x_x_x_x_x_x_x_\Yx_x_x_x_x_x_x_x_Y@ZZZ([x_\[Xx_x_x_x_[[x_D\x\]]x_p^x__@]x__U` _OKe/e/  P7  # I|b]e/B V0 P8 PP 0S0WK,@ (p 4ZP@ 7 0!Z/ 00]Ɵ6 R@@R@d\OKe/e/Z    0) e/P Z  P  e/`OKe/Ze/V e/POKe/Ee/A hOKe/7e/3Z  f c 0) nOKe/ e/XOKe/e/(8PZOKe/e/Z  2 / 0) {Z  $  !   .v7 4\ZUH0 @M3 RPZ )9B \3 R< C#PP  R0000ӑ yS0 R000ӑnSU P#00ӑyP 2 ,0S ,w|  P@ )e/e/PX XU P@  0M0[ $$@PP0S e/PZ  POKe/@e/<e/8 Z h |81 RZ  )9 $  P 2)0e/JKe/ e/ ~ ,*$ \M(`!x- A\nrdAlq1HO  h!0"h#tu ,Th| -ML M R, p0 @ S a`BV00?V ڰp A,0 S ,{0S 0S8 V08ǡ00000PSV4 00 0 ; 0  P@` :0Sg  @1^:0^0n005:0 S0S  0 P<0S9 P@ a Z440 P @0 P1 R 0S 00b01@ Q  Pq n P 00f PT P 0SS` 0V0R00S`V@ P@? a`B0S 0S|VBp domVp0( KBNKa@D\0 (K@D . 0<C h!OOLx p-RLM0@`+ a@ R\0"(\` ph1 ^0S  0 SS S0d0T!\ phI (<<dP0, 0 phh!(Ht -SLMp 8Ka`N‡PV(VT` P 0S0Sy  PK 0 SSZ, [RW R08 0R 0E @T0 4 0 S?0S< 0S AV408   P`1 R 0SS 0J(U` h5  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ PA 0h ((PU2UP 0S S R000(U 88/P0( h!OO|((` -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`p0S@0OO -RLM0`pl a@QgJ(T` iSR 唀R 0W  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i *0 `0T< 0Sh. 80iT (@@AP0h!(tO@p p-LMKP@ [PTPT`0 R*0R*0@  [PpOO0 P0:00 -a0L0p@TP  V P `P0 S R @000?S T S 0?S h`+㼻 TX0 ` BR X0  äX0 &K \n! -AML M4 8 , - MK 3(K 8 BnK`Fs< `F ~V  RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D RBK0A0AP@R0"S 04 Rf<4SZ0 MK 8+\ 8-Q `@  00* <\' nZP@/48`fV%0 U/ W{P V  @0aS@ lZ  U ,0 S ,v 6 2P@<l10 gfR000@D0} XMK4h <0㦾gbSe4@D( b<$ 00]??A "8\ !Y@0@D0O( O *-K0P kS gS844(< @DmS/4$(4( Q 0a#5<4 44800(K RK R( K0?S X0  BR X0`  äX0h 8\% -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\1 ,0S , vy 0g g0C B#b"Baa  X8 < TLL!LTH 0#0 0Y BKJJX@8<$T;K  ,CpP 0(K;K, S QQa B RR24  l4 mL00CS0X0  äX0 $ lt!8 -$LkM0Ke/ ,0 4dT0!PP P@ P' @T`t\lTX 0 @@cT T8@ 4T00CS00  ä0 f$T`@ QPP  #P,#3P P@t x3x t,@0\#\3P Py@t 3  t0@8 # 3P Pc@t 2 t8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dRu0b00S@<@P!1P P@t T1T$ tCDh!h1P P@t 0 tTD+0 ,0S ,t0  e/0 a00P h0h @ H0 |d!Y(plh!dP@Ol8D -8@TLPp60S S 0 (S"H\T& P`$ 8@T0S S 0R8#H\T@<0 P @r ,o\M| -LXM|`K@X p PP 0rSPoO |0@Sb00C8SP PRa嘁@R T@ p1GT0\0CS0<0  0DD PP 0,P* @&P" @TR 04@R T@ 0 T00CS0 "@00T ႷPx0K @1StP!Y -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`m((0 mO<LO|h! -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 P!H0@ 0R!705@20  0 OOO0@-@000<0\0. 0S?00  0@Q Q 0  <0R 8\ *0 SSP(0\1R:0\<0S00OoOA-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!QOO -0LD0C6S[긆@@@@@@@@@@@@@@@@@@Ȇ@@@@@@@@І؆@@@@@@@ @(@08@Hh`N@<840,($  K0C0C4 000 ! P@0@@ F8 坜PP 4S JnKⴀ`F10 "\a0@|$墪Tʄ1SBKAA  0͸ p 1dx -2LMp`@0P0 $ \0 ~ 0 ~ x 0p ^\ :` 0X ^< :T9, 5lh!OOT -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S  P V 0 SS Px0`000< 0S40H. 8 0h! O4@ -2LMpP0 0|0`` `f@t P0P tT @(=L  , h!@ -2LMPQ  0  @ +@t 0& t 0T:`pW; 0 \l< X0O @ ,[0 0?lh! -2LM`px \p0@PP@ @| <0< | \`h! -2LMP 0 Rp`0 0` `@t 0 t 0 @ 0xpx!t>P` @᳗P @T<!N 0 0T @h! ,  Q-Lp`( P% P# P! P !@R PP }@T! 0 /\ PJP P A4 $0uh p < h!\MP0S  0 S β -LpMpK`P 0sep @T X y0S@ 0@0nPJ rdAedA`\M -LP\p@` 0B0C3SO``T <0( ,0P<0( ,048  1hW <0( ,0P( 0V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4P$ o h! $!X!8!0 P 0Z<0 0Q>2 -L M0U@p@ 55 u  % 5PXXT$4@  $Pp 4Q 0SDP Ppd{ P(D0: S  S  S0 0p{ 00 R000Sg Rꨙlltl?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?o2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qH0S0||D K1Ps1 @\ 00 ~H!0!@M 00 ouH0!@g0*kH0d!@T P!P00p 0Q  PH0!u@0 0T P:H0 _@0P 0<0  H0XT<&PTL\șpm @D&x&&&&&&' -LMc0Ss0S 3 R S0S3 Rt3 R hCPHP,K 8K0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP嵥<@2`DBH P(@ 0S 0+0 囥a!000+P !1aA0 @@AP|u @ 0XU$1 v@e0APR0: SN8 @TI0K@D0 R㬀 00CS00  ä00 :( 808 $0TXXht '4'h@''P' -?MLMt0t` R   0S P MkDp0S?KK@D0P@D?+iP ' p- LMP|Ut`0   pV@0T PࠡF >' -\0L RL H0 @R0,0, 0>0>'(\ 0-QLP) 0S-ꀤܣ0  !iP@ڸ0 T ;;S0@0T@|0 tS>0SF\ 0T w>00  hP@0 0\X(|( -b0LP@@xr `PP PX"000SQPUڅ;;SNU8U0011 U00R@@T U 1 Q WP=E!0|!>l1 h=\=,E0S E0S E0ES U0P0 0U R0Q/PUE0 S E0S E0S E0S00PX=00 000X(( )X(0)h) -1LM R*ʔa0S& !00CSYxx0Sp1  0SK괨,H0S0 0  0SO=L=[0ȌlȠ@$ K$ @ xP@0 HP U0S \p0 @0T@_0 0@TP 0Q00000ꌙT))m) -P@LM0 U 5ࠟP.0 R  0p`W 80 S80S*0S@0jQD@ <000P(* -L M䁟P@P!0SLLL UT<0000U$ha 0( RQ R 0QD!< 1 R tD T:P0U$`0 [0 njlȠ( `0P@( Kd$@ PJD$0H o<<TX****\m+(+ -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 FPAb0 0<PV?KK(@D@D?+fP`G?+fP;@@ H!P+X@ EP00X0  P ,0 S ,.hC0 ;;C ;C Cp  C` C ?+SfP} mX+d+(++++, -LMdNK@D0 @Dp (0 Pw P  0 y,NPi,K-F,9,K'@,@ `P, K>0h 7+P9T +PXĚhX/ -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,c0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 e002,P\0` Xm@0 W-P+P X/,0h'40 -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S b鼚 XD4 -%ML,M%K0(J⒍K JE(H,0 (H %]b}K(pG P`$pG; S/R P58,0 S 4,Ob KH%0R/S /00H5 0H5` %,K( B:KBP`:KP fL%$(K0: S 4 o*PsPQ.P|4 R %,PsP00'P@40S(40S- :KL5*KP/QH KLP 5*KP:KH5P@0S 30S #a=(K0Q|3|#׸4*P#P* $P$C0S3 R *KPP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V }D*A b%K(JPJuP@ "   {<0P! 5t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X <0l 4 К d000Ě0HXh/0 -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4_4P 1@ X40$P$ 0S U0 R @4P 6 @0| ,0K8P P/0ST 000 08PXT0$1H1p11X -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ \h @$tT11X 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0W3 83H\n -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T JP T $`P ო00T 0$`00  mXPl0(&PC3dAd@d@v000XRPH\n -LpPP 0S ,0SP!&0aV 0S DP0S$0 0@0S# V P00 0$ 0 T %P(@`PP0F000= -LpwPP 0S ,0SP %0aV 0S P0S$0 0@0S# V ⼜P00 0$ 0  %P(@$`PP0000 -LM@(奜aMP@ 0S H6 -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 xd0 KX0P  0 @0 0 0S X0 \H6 XT6 0A0- SPL@ 0]0S8  R0S+ 0+`66 -a- `L0Q!0p@[ P20P d 0p QL e+4 $\+ PP 6660 KS- L%0P 07 -PL@LPgb=0  G|1  @d1  9Lq0 241  +1$  $1*  00   0A0a-  mam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞<|<<a=0A 0bPP2 HD 0 P,2 0 P 2  x*$0 S $V1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0Z Pv A 07qD7t7 (,$|770 mS- L~0P 070 mS- L~0P 070 y -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 P V $04 4`!f0 s L1^  l P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R (,H8$0 |0   -H$L|M0 ,0 X P $00CS 4   4圐K R 0  1 P3=6K 0) P7#00CSa=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,T2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0  (sq0b= 0P@60 0N PL [b=0P@06\  0> P 0q7 808(,$<8h8qQ-H0 4S Q 0 S  q -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y (,$08H P& -%L0M0 (0 H .P4H@ AR4  0AS888HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 y&S(0 S (R0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K# 0888 (,$89 -0` LK$KP P0`P| Pd-d 0QpL0L {P0, {% |(,<9 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0-\ 00h7%40 |000 0  \`8P9(, p-LKtM @`KP:P   \L0  Fp$p,0 00$x99- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^$Pꘚ9 -LtMpPK@P1 R* 0R5 0: S, 1P P s, 0Q` P X 0x @$XV,0L {$(P 0R @$ꘚ|9:,: -MLP4M H4p , t * $00C SD  3劔P3 RIKII 4S+P) ,#0@P \ `3 RT3T P00#$3 ,0S ,AP3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02LP P0SBB0S1 R  ;IKAAP!0S$\1  #s+4t!#11  BnKP`F`FU!B4: S>p@ PpE+ 0h#00 ,  %x '#B  X  ܚ|(,P:h:\`8t::0:: p-LtM`KPRP 0@T0: S /Pp*L 0#pPVp* p阚;,; -LtM0@/SP @//`@pKT/ `0S0S ĵx0\0S0S! Fx  -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HPj*00 "c* 0"\`L;x; -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00H1P/*00 T"(* 0M"$\`L;x; -LM@S0Sl`0偒P *0S *04 ,"$0 RP; -LM@ 0Sl`0TP )0S )04 !$0 RP; -LM@0Sl`0+P )0S )04 !$0 RP; -LM!@P) 0h!; -*0LM"*@ =P|) 0h!; -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T sP`W,0c3) 0 X!pWP  0p\!x/0Q`) 0 ;;<< p-RLM`0 Pp@0T<  #P( 0ph !( 4;H< 0-0@SLP 4 0R0a 0h2ꐚ8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  WKP p R0 RPa- 0S0S 0  0 ,0S ,LK(A4A P a=(K0Q p0| 0QX0Pe(4 0@  ]( 0$ ``<x<<<x& -0 0R00000L R0000 R0@00x0 Rlh0P PP0 R P$ ܚؚ< < p-PLM@` 0S pPP @P0/S00H 0 S8 @`0 0 PPPPp <<@ =d0 R00T0T QH0  \80 R,0 P0D H8 0-0P LRl0@T 0S @T00SU0 ((岅Pꐚ<4=h!< -QLP=aq R1 0S  0S0! @0S00 0 > P 0P 0P_' 0` V'P |P 008<D d=/ -L#L M0PS44sP 30C S8!!!!! -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p 霹T p鑹PH tP  [P@P0  P 騚  >,> -2LtMxŸ@0pŸT S, Pp$T 0 CR 00v2 ,0S ,3J0R Y 9@K1 R@(08Ț\>h>t>>>>> -0L\M⼀0 SP$ @ a Pd`K0 @,||0PdKxpK0 X $0S D$Ia=@HL$ $0T@@Ț  >>\>h> p-L M0@P{P 0S  `K0 0Spp  P0@-@ *00S S P*00S S R P*0/S 7S 1 P0@C* /R07R0 P* 00B SAB0@A^Ra0B7@A P:SW@E S B R:0000B R*PR:000BR*R:0 S0W0B0B  R*E-P`P *00S S\*00S S R \*/P7P10@.Po\*0/S7S\* 00B S0pBAB2%NPo\:PABraBa0B 2%NPo@ 0P`S2%N PoA- 0R`PC \ :1!`P00L \*\:000L\*\:p0 SW0 R L%">&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  :TP 0 0:S l R1 0 LP0᷁?0C0 h$ض(Lh!>> p-LM0@P/K)|P00l00SP`ph8<0Sph00ph -LTMptp % p 00@JS񟗈12222222222222222212L2X2222222222222222322,383D32222221P333232232332333244455 5(525p(4qDTR0S`0@0w,0S 3wCEPv  4 um4Po\j43d Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|P1@ 0S `Pa0CS"h44444444444444441` 0S{1P1P1P1P1 87t1p1{1lPzqT1z-L1y*D1y'xP0a,AH0pK @p O<1P@x   0P@ PUH@ 05 0'?ض`H?p?h ?ܚHؚp?PĚ\`?thI??h!DĜTn9!hXLК@ 0 TBXL0@0t0 X X0 t0SI0S| |0 0S8787777 0S@0tP0 0S0 0S @0nP 0$!0S0<1 pP1 RH!d1 pcb$^ Q ! R 1R B Q QA1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PᄨLM@, 0 4 8 0\(Bp 00@JS::D<D<::D<::D<D<D<D<D<D<D<D<D<9:D<D<D<D<; ;D<D<p;D<D<x;;D<D<D<D<D<D<D<;D<;D<D<D<D<D<D<D<d:;D<;;D<p;D<D<D<D<<D<<<(<\<0<L<\<h<|<<D<< w g+P040 6066666&0&00640Y8 P6 l6   s4 8P8 @D46 0 b5^6&6 X0T6  0-S 0 , 0S,  5000 >5%95@5P2d0h ,X0(d%000$T5045@%, 85R Q@b% % 5 00CSTY 0S==??YpP. Ym 80I`0< 80 VL ኈPD;P< PpXyP(L4 RYPW 3 , RC0S 0S fP 0S\30 oP@ =P P 2 P 2Pp(&P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q rP1<P0B LP dP}P1 RY0  ]izNoP@ NY徇PP 1 K/PP 000B"P墇P `P`P@  P*/P|$z `0S Pd8@ضp?`@l@x@@@@@L@ܚؚ,pTT`ĚĜL!h ,@@!@AAX Ah! -LpM`@pK@ 00RPPAP0: SU/00 0D 00SP   J -4L$LM4$䄟P4 $4p $p 60@DSpD`E`E`E`E`E`E`E`E`E`EDDD`EE,F`EE,F`E`E$F`E`E,F`E`E`EtC`E`E`E`E`E`E\F`E`E`E`E`E`EDtChFpF`E|F`E`EF`EtCFF`EFF`EFtCFFF`E`E`EF3x3x#000d3+ X3eiH3@c@nP@ P :3 R )  #b尒ŸH0pK  p 92P@l  2` @ pp`|VH@ L2PH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS G GhGhGG R|PP R0S,1 $\P t0 R { R 0 PPg PT`|0AtXpض!,@@hITAlAh!Dܚ,pTLĚ!hĜL AК@ p-0LM` |@PG{1!d0 P0R4BDL S00CS00  0p phh!ALA傅 P00l -L0L R0 R  {lAh!A P-L 0SpP1 0PS$ p,%Pp`=P@ P  ppP0VPPS0  U  0S(  Bpl@B p-LM KPp qd R0\4P0 0b0CS#K L L L L L L L LL LL L L L L L L L L LL`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPkP @"#  0 S R PP   B0 0 C 0 0 , -L 0@0Bh! -L0,@@Dh! -p@LM? 0\߯4 0LگD 0<կA 0,Я0$< ˯?h!DEEEFHF -MLML0P`(0  0S ,(0 S (@ @Rpx 0\S@ S  R R iPP`  API000S  \R 0R 0S lP 00@0@0S PS" GS0000S 00P 00PPPEZ0 0gS pS00BNK@D@D ;/D 0-@z(v FFFLPFF G -@TpL 0S `PUP P@@0`S 0 p`PPP PTGlGDH 0-\0P@LT 0 @T0U$ xPDGh!< -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00 0 NnPp  R/00`g @0/S`0 0@4n R/00pDGG p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RpgPT @`H0@PpUP00D p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQꠚ@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00<0# /<0C<`0S.000SlS 0/S 000 00C0d LĚ H -ML M\\1 `P$ ^KPE840,0S/^0S0 S0 K0S( .S @ Wp & P;0W$0 S x$!=d0 K@TTH~ @HtHHH (HHI DIPIxI p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0MI -LcMZK MpKK K(@DKK( @DN*K", 8匀KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,E<T *0S 0TP*0S0T0* K\ 0 1(K R K(u0(K RK*K:K( ZKX:KZK(8u0S  KP KZK(8TKQ :K(0L  T\IIh!III -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @@\S R0P -LMp㓵1PU|PP 0S`QP@ 0 S/R< 4aP2 T,/00 1  zbPP 0Saaaab|00 R0 eh@T0 0S/S @ ,\JJ̚ԚTT$JPJxJX0X P -88L(0 R:ꀚJJ p-L,M(@KP P P Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV PF P6 P& P0  40 P PpMX!sp@0S sP@0S iP@0S _P@0S UP@P LP 0K   0K  w 0K  k 0K  _JPȚbJ -x0LM @R`0 R P0 RP PaPtxl p-PLM@3 R0 (a0S= 0#S4 \S. PP$ ~0"C12d1@cP 0S PzP P0! 0px  ` 0#S@ hP,P  t/>3K(K=HKX0X P#3!"c1 0c!R 0S R(/>3t p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S PP P0! 0px  ` 0#S@ P,sP  x/>3|KK=KX0X P#3!"c1 0c!R 0S R,/>3x -PpL`@ 0Sd /PPp0 S 00C S0u 0S㔽P@j U 0SE00n0S1W 0S !0 0P!10@ @@P000 RH 0 ᗽ, } ᐽx P 00000 0S MS CS000 0S 0S cS mS00dv,QW0p0@ .QT@}  (9 KlpL8LTLLLLL@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R lH -LMP0pS@ q 20  00S| 0SS?T`q @P_0 1 !.B=R pGV0G SRopoptop4opppn 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R VCp010!.CDR Pk?C@.PT @}8# 0-LPL@DT  0鲲0S0 = | M -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00埻0h霻0|$qv -dpL0S ` AT@0`V01P@P}{U| p-LMP@T0 p0Sx`t 0 h0h;}X0P0?00 d 04 G̚lMԚMM -ML0M (R04 ,0  2 ,0S ,|64! K!8 0AT ~KpGR0pG8 @TֺP@, Q0 匩0Q  $P D! T4a=  8,1008 A  ]0`PS 0S0j40S  ^PT 4a=0 S0ń8  $  MGMMN3@O -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S 4P 00 0 0   EB0, PhPP 0p p00  ` WPP 0X0@ P 00  `OO 0-LPL@DT  0q0S0  =O p-LML`0S P0AT  0V@TPOUp -LM䀟pPP, / 0"c12f1`cAT 0S @T㘸P@ ~cP pP ,000! 0Aὸ(o0ST />3 P 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00典ჸ0/>3 0-TPL@ T0 04 @0060S00S00@P -MLM,Q,0S, p`* 1 R 0/S BKAAP % `Ѐ@0Q P@bBP 00(00 徠 000 ,0S `,t3T @P 0  @pP0PP -`L0S$ PPUJp0"S@0S ? 0RH Q BPUZ000\` p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p x -P 0S\ \P00S0 BS@T\00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR  (00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  Z0S @T0   0?H -LMP@ LvPpGvP \ 00CSP0 @ ($ 0PPTDPQ8Q -LMP, P, 4#, K,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8   -3LCM |3 B, R̍؍$$83 R  3 ,0S ,1BP0SPdU <"K> d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A fPdC000 (3>K RPVXCX_K#^?K@|A 匦PHx!1RS@$02P0;CS040@4Q0S|  `HdlA !r 10C1 =At0\ T0 02ᥭP@T00< KcK0 ! 孶`VKe/K:1 ߰ < K eKװ R x0S:ᯭ A ( 0S j5  1 刡 2 00Ì bK 0Pʱ 0<~D$&r464\&=K@吮PpOd&Y?KP0C P傮P Y?KP0C PtPwQjSF]?K _0(PK0@00  O? K ^ 300 0p1  000+]?K9 W ]?K/ 7 ]?K% ~sP@ 00 kOOK,>l@@H 0-LP:0^  x0\**P0\@ PL0@ D@P@4˞ <<؜L -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 ݭ1  Q P1@ԡ`0 810 @@Q0P0?P P$JKx!(@D@D0h!`Po/ {0P ,0 Q  ,' hAi`8#8P#$0$ @JK(@D @DK<:(<2: !<(K0<:(<2:(LL!<  0僯 8LМ̜WWW8 -L4MD 0K`KD 0P@K0 Z L7  C  ,hD h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $0 0c@BHX@000CS00  ä0  S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,uP|0 ă ā Ă< 4 <( "4\,<cpW0 PH 'U00CS00  ä0iK pmD 0T ѯPhß040p@gU0#DHL>$H 0 \!DP0S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/鴕PKP@0/0 \ 8K48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  a pМW8؜LԜW! XX X4X8X@XPXXXxXX$XXXXMQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004MK(IITK(JJT$0 tl * ^0# l* ^#0S`V* XJVP@DX0 L - ]P@6V0 j8#0 l *^ *^Q 2 R :  ,0 S ,$2@2@P0 gŸp`0 `6@PK0L X0/0P)K@ B0/㵕0/P@@@0/P@@奕0/00/P@ @啕K0LP@0/@)K0 BP@0/@僕KP@P!<0 @8l *$^ 蚍i 薍W 蒍P@M  !lf  l *^3K (JJ0 l *] 0R#K(II l*]Y@A !X؜YԜYt 0YxYY̜YY -L0 K M00, 000K 0 ᣓ p/? 0@ @ _` Q @0 RQ   -LM@gT (0P0PZ#؜ -LM@Qs$0<D @HPX`h`hQ $,4h_0S #!Q dp,A`X$PLHDh84\0#$(,"(h 0S S0Swusqo0("#YYYZ0S jP^ 0 qPV 0 UP@ x0SJ GP @0S? <4I 0S t `Pa\aHhaaaaa$P,a(b0bDbtlbbbb -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3 -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,/E.K B B0h$ !1`$ (@K  d 8 X \ @&? hBNK@D@D 0 P h F0D_0 ᠏p` "p Щb -LM r`p& PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S7P@N &廤,0SA&尤=00,0S0 00 㝤0 R @@P0, P( ,P6  c Ɨ@0 S/0,0C0K0 (0bbb)h! -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  "0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QP,$ -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X, 0@89P @" Q 70$ :  0mPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9 |ccccD -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 ᧌ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S , 4 0 |00S00YX   D0TPDHNPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:086|0Ta @P0088  <  + H ccccDc -0LM PU@p$`=` #T*U0 R  0喃" l`▂#0U<0 R 0 0喃" @dd0dHd -0P0 P00LMS0 P,܀ R0 P.:p$60PP5`@2:(P`@,F0B˞$ٞ|P0 R0`@004$Fɞ00$᳞@0 pЩdd -!LM0\00 \pG\(:`(P``ᗞ,F0B$叞0 ƚ \}Pt0t0l h d@d0 H0(0000X`hЩdlLdP\TȢ - 6 8`0(@ 0L 0SĠP`F묀pp0P3@00 00`PS P@0Ss0S呜P,Yh`Xd\lPTLd -LM@P00鮜T -LM@&B ?ᨊ Pa(^PUp* 0Аٝ0 T00P00@ 000p@0 (($`d0 dS D 0 Q00勜P Ģ(̢d -P0LM@᚝<0 P 0S P (d p-LM``0S TPT 01@CT*+)000p#0T*̢Ģ 0   -LM`P@aUpᰀ 0SP 0S 00C0$d b\0 iDx80  \0   >;eȩ,,e` 0-(0@ LRP 0 ,4, 00 0-(0P@LT ,[P  T00T0S 0 T @0Щ 0-LM@0T0 T00S0 T0P7@H̽0S|tp0 Rd T0K0  8 (eЩ$e,e0e0(!S 10`00!0`00 0@TQ <P 70 R T@D\  0;T@Dl#zX T0 R  ̩ĩeضe eLM Mep p-L@M P`KB0S 0S   pe -LM`t`ğ QS, @ Dd^ 0S 0S p P0S 3 ,0S , 0ṢģL0SD PA먓0S 0S7 0\CS 0S ?0S 0S , @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎ4H ȩ -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD K 0 0P 0  Ta D0S Y U`4&B ?fPPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aᕘPP@T1X@QcT P #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S  J0@$00 Pq p2l2    1㡖P x2 d` P~ 2 RA @>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/i (K0 @0 ,N0S 0Su P 00M(< CP0S &X^ P D ř6C tt,8he,hȩ$(hhPii(i@iXipiiTi<\n -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*㹕P (@ R00  0R 0S R0R0S P 0 R QP` _X0 S00Dō<<<4,m$iiii|i<\n -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  $  , -LM`VPڴp崀K@PT 0S  0T @T R 0S `FVP 0  0P 00 ,m -ML M0,0   BR(0(xt P d$PTDT$E>K0C4  L44 o$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:W$3 ,0S <, 0S 0 S s S # P"   00C0 " P  000 00C0  LR0S-@<2Vᵕ@Y P  2(KWKK@$ (@ⴗ0\4  X$ kEQ& B0O0  0l{ 6`X!0SV Eo0 !5@"%$1 R0 P P& Pd P <0:90|s ,jjĢ̢l$jjj(jjDj aa<\nj4jaiLjhj -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKR0((K0Q 0@^^>KMK ~ P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dX X (,0 S <,00 00CS񟗳0hh$0S&&L0S6 `03  00C SKpx 0S 00C S'8`@`H`P`X`h00&[ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R ?$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00p PS L0S|3(K4!  `0A?( K A?(K KK Q$\0 0 Q0hNK0ᴀ$00$03  0`0C0 ɖ@@Q @T; Q 0S+ 0 SP $00$0P "00C0"l>KMK x PH"\D000.S "P 5P00L Rm `0j 0Sg 4\@P^>KMK @d=$00$0@1  0`0C0 T崀=@?PQP( w50.SR 00Ph L0S# `0 0S 0<0P$0   k\jЩ,,k1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00nT4$ -LuM膟0,0 $ p! 1PW1 1 1  6 \ᔦP  (` ,6&=Pz !,6"! 0&1& Ŕ& rK㽔 f?K^4 Z(@1^*P P ?> P  RN/ 0`F<0^:6^  ^Lş 0P<,5% \ ?>1/1L.QAN 0 40\1弤 01 0S  1, 0 S  0l` K_KL$1R,6 1R rK P0S$1R& yPl0SV1#R&jP<6 P90S 0S ) d1 0S HrKr P l jß,0 S , C1! 0 000S  ReKL P !&崒001&P hTeK+ P & ᓒ!00! &Pq 1{ ve,6KQ01,&K `,6|AQ000L0SD1 S@D0S!1 S*0\!5 2! 5:? >PN0ׇ? >0N0CS!!&&&!101 ,6 0x ,6!q pX@0 H; 40mlmmmmn8nԩ@nLnTn`n,)hn -PULp`:4@$@TPZ ǸU:nn 0 00 --L 8Rj h! p-PLM@P`l0l R cT D0 Rp80 ㊸ 0  C Sn --L  --L  -LM@ DC h^ --L   p-LtM/P@TK P0: S p0`rSƒ Ӑ 0-/L@PU+D0 00%M/00(+ C+C00$n -LUMpPKPeP@lK8^0S(0: S  SU RP U@P P@0 R000K@:P h1: SD c$^ Jnnn P-L ;P 9 o -QLM@ P T (\o -L8P ,o -kMLM7 6@, @6K0A䆟 A 6 PP6: S 1PK z&P0S| |6 Rq 0 S i\_0Sa L6L&@HfHv@@ @@@@Ɍ0 0Ō0S P5P(0%<00PC0S0S X5 ,0S ,*L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6AP, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@ᦂ3PL ✂x3PTChG T3P= ≂P03$- 6SR ,@!0@T00 "2 gB00a0"S P x2C|lPP\Hd,(PPO@kT J/ pv1  LPP>, vp&R0S%"0!S$ puPL~@ ,@ 뚙?A Т ! $edAtt-L0(&S  d0 P0S\P P1 Pa S\Q 60Q -L: S  S  S H0 R4S S S  S Sꬩht -1LM `ReQHP@@ 2T|1 RRp1 RNd0ST D1 R <0QXp(Xv00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT YT00yTP s P00XGr@4(Ti̩ĩ|t ttt -0 @LM̀@@0 ` @@``։PUPTp p (@%P00TQ  p0WD0@@Wtxt 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0xtt p-l0LM@Ɠ0\S` @088 000 0 `PpxȢ p-LM0@S` PU 0 70U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T 0\n8tDtԩ 0-L0P LR @  (Q$P 0ɱ ti u -LM8pP(2G 2 R b  ? @_wrTo 1 RP a@T T rPMKUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1o 1 !@Pᆈ0 `@C@0P P  ?r@0@ 0P PPUgHz뼩ȢԩТ0 uxt!@\1 00CPp010  p@4 -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH DT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fՈ6`` ͈/00f V:TPU L0L X0 0 TP z U \K J,( -L x 0-LMMpPANK@D0@D` 0 jH F80 w 0S f0 0vpdv -LM0@ww@ -LM0@S 8NNNN00S lh0 R \P0008k3c뤽pvxvv -L`P ^똡嘁q@!pb@1 P|OOOOOOOOOOOOOOOOOOOOO@@1@@@0 900(@0 0QQ0 R|0 R 0 R|0 RP0 R XrnP L+H0J\nvh!v!Lԟ -0`P0@LpP |CPlP 00U@n0S8+PP$. 0 ^ ! -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rp0 CR 0@0R P0Rp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rp0 R T 0 R2 0T0Q0S* Dl 180@" eX`m@0!8#vԟ -0p`0P@LP dBP@ 000T0S @xP@ 0 ^  -LpM` 0Rp䠟%  np@ PP  PP p @TブPl0ld0 KPL, P 3hP$l!|ԟ -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?X0Y Y0Y0Y0Y0Y0Y0Y0Y0Y0YY0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0YX0Y0Y0Y0Y0YY0Y0Y0Y0Y0YY0,0  `  L4H4 0`00 / p0SV PEU@# iAP PEU@ȃc0S oAPPE@ $0S33 |3 00S UD30 0 %Y U Z U  ,  !AU "0p0t0 ڴ+APPUU|AP\PUSPb0S  AP 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q dwPE@< 000PEU@ 00S1Q! 00S  @0 krP 201S00S00S @ |@|0 RrPp/Ld{t %܁vԂxSp 0-TPL0@S s<0  0P@0000 p-1LM0`@PP rPUP  qPPp qPx0l qP`P0X00 DqP< 000pti zi i ~i 0 -L,MD0P`K@p,0 ($ & ? qp r0S n0S j0S%@PvP<   qp/<@TU  @00PEU00Sp<R,0 S, i$(4( p-L,M`0P@@K0 +$ ̄ z?`0` Pq0sHD m,8j f 0S kp i$DTl -L8M0@(0 LKPp`$ ᖄ D?U0 @ PK*P @Rp0h-S`@dC?P8@ D0D pp0 (0S (! i$ -PL` M0 p l*P`  0 Sr200000S0p,K(P dg,PU V 0 Sr,200000S >P m J#Ph0 r1000P^ 00S .  AR #    tAR #΂ d> > 00S ZP2  p,Z  >P% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU{,)VW<<( 4ȃ8#ЃTdd{h!܃ -L0 ,;>(0( pp 餮zi  -4L ,%>(0( op 餮yi  p-L M$@K DQZ8 op$ $|~P`  $0 0 ` opo 0$ PS 0@UU0  CR 0 R00h 0PU@H00CS00  ä0 ֨s~p鐮xi 0X! -P0LMH@D0  \ (0$0  錮p -0L0 錮 -0L0 錮 -<0<L00, Ro0Sh0鐮i t -80L4000 0K2lpK1p`K01@Tژ2 ip-QtPP@1@SPTUpPl rp200000S 0:SP P8l ePPU t@T0, CR 0 R00꺢p0K1S_-U@ Tڴ1S0Sp\X1PT![ L0D UiP 1S  0 CR 0R00}l000CS00  ä0 \m00S),0 S,S i i8iiii!i|CB$,48#DHd\nli x ->MLDM1圑0 ,   >KK(@DD@D d]|`  7P hP` 0S;,E8>{KL@K(pG $pG>[B| >| 8P 4p 6 hP@ <0S# <0TP( 0 0CS00ä0<0@T|PZP ,0S<,霮 ̃i i|̈Ԉ!؈ -x0L`! @ T @ 0 CR 0R00ꥡx0 ||t}SpRW` LDLVTP@xXPVX$~X bbd0S ^B0S 0BU 0 CR 0R00^505P d 0 CR 0R00Gx07< h! CB(0<@ 0-0L0MP0@@K( 0 V{ 6|0| gP0SXx0 P0 H00<$  0S(0鄮 6i(ĉHԉ 0-t0tP0Lh@h  \0\00 005@08 gP$>0鄮HP5i  p-LM@`00X`PD 8[@P$NP^Pp鄮H 4` -Lqd0d0`pT?0@#nPp@@Np0 / 0鄮H -LM@KD004 ( 00鄮ЊH -LM@-D004 ( 00鄮(THP -L M0p$0  @pp`0h\Ӄ$KP`@ $0@@S Ã鄮Hԋ40S 0S0S{-L0S 00  S\0S| 0-@PL0 Np0 〃0|Đ 0-@PL0 9p0 k0 -Lp PP`@ld0p0`@0 @L8Wl@T( 9uȃu p-LM0@S`P 00  SPp@0Sp -QLMPp W@QcX0$H C A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H H00p@0S% 4i$\nuD0< -LBM MLCNK@DP0 @D/㋏KKoK,0 PP/y 31 ePp2(K 0Sc 0( K @<PP@rP,3(0K 0(K 0QpRKH K <P@PqPP,3 0D ,0S4, Ki\nLTx -LM0@(0 4$4Qy4QtT00CS00  ä0 T 0S 0SSxXXp@K Ddx N30K( `0 #eP`0SAP@K( x 73 eP0PksPp 3 ,p dPx㙇p @4 @0R0 0  CR 0R000( CR 0R00 40) CR 0R00`R00CS00  ä0 880< LH20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^0\0CS00  ä0 8p10S P00@T`10S V8` 0|  t00@T PU$sX0@T  @0S 0 0$0S^ (0S(W Sl@0L!Xi d6i(x (Y\nXLԈd{ -LMX0Tr$0 0S0+S (嘆$B$ 24PK #t  D2 DcP 1` 01S @wA0 x! cP 01S D+w\4 01s< 14 8#"0! 40K@  DcP \01S vl| 1P s00CS00  ä0 d $0ST$ Ȓ%i tԒ"i #i !, -(0L00S 0 錮x0S 00S "48<#80  -DLM08@,0 0S0+S ƅ`p㓏Kpp <yoP,11.30: SOK.sv !1O_K0d bP01SD@ Wv,3 (K @OOK <:oP,0SOK.8v 0OK0 bP}01S hMKWP.v 0O_K0  bPpY01S n<1<1<1<1<1Y 10SB .u4 00L ZbP!01S) (6&81S<1S "@k8P Pda^\P PdwRO K0 ,0S,O \n8"i DX%i `tIi ȓԓ|Qi 8T -0LMaQ00p00P!0S5@T 0 /t؁0S K  h 00 ~ p-L MK,` 0 AP]0S |~V0000 P00P0S 00p0P@0P0P0 `20p( p-LMR@!X` 0S   TZ p@0< CR 0R00ꮚ0S7 0CU3* V ,0 CR 0R00ꖚ` \0 CR 0 R \ 00ꀚ \0 S0 S0SD>0 CR 0R00pphcp8@! Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00= ` R"R000ӑ0 CR 0P R  U 00  R0 S0 S0S!" p-L$M08@K`  Q9t4 <0K 0 P b 0}<0S  l}r0S 00S Q0S 1#$0$ <p8 -LMK,p0 Q` 0@S \}W0000T00TQP  s sT@D0T0T0 d20(@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  $h!H -L(M@q0D@K$ ,a 0 ~s$ ,. `p0S3 0S/ 4P%(eP0   _p㌂0@`TU.PPE Vt` h@00U00SV  0S,  i$ĔD - @LM0 1頪H 0-Ls@TlPll 0h- 00@X404 _0S 0hl0Дi DD-D0D-0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`pZ P8 %00XȆP5帕 P@ %< 嶦p< 10@GS񟗤,P\ȭԭܫܭ$@X`hp|D4T$P@@H4@@$4P($4@ $P@@@ 4333 3#P@3#3330ă80 ;0u3h#@t3P@@`#`3P@#@@x3,#PP@d3`3\3X#PWP3#00Q 3#< e<J2"P2@@@#0Sq`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0SX2 R 80S(Y 0/;40 "0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   y11 S41 R!1 Rt!t!p! 0S ST!S0 R뀯LT<$,X4xT -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@K5.0 #0.P @ oPol QR P   jP@ 0 0*0 0 0 *0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V j`V2 ,0S ,D@K"0 -Sox !0t p -Fo! 0l -=o1h R0d0  ` `!0-*od  000 )0-S EjLn 0R@@@ o P [)~ Y~ ?0 R0 0p Q0 R CD `堒\0 ]} \%4<`H`hXLx -LP# \ \ P  \  Ph P 3S40 RP \ 0L8, 0-@LTP 0S@T0  , 0 0CS00ä0! -L,M , 3S 2 R2 R 2@jtpQ[ @K 0ST T2@` R42 Rs 7,@ 0  $   1 RY0: S SK 0SC (080c!01 R 1 R0(D1 R&t1 R# : S : S L00CS00  ä0 pW ,0S ,| 凓80(T "88 #$[ VX@ 0B ?T@0 `F{  PAr \t\nplHd!| 0-0P R 0L0x0 R00d0 RX0 R H0 @T+j'j00鐯\d -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4i8 4iP80080 3S 1 R1 R 01@i80 R< ;al` g0/STR `Q0.SK R pG B< 0 ěHp0 0 -L(Mlq0@PKda @ 0 ۈH PPD3[1 ,,!0zP"P  0 S # 00 0 x 0x 3KOP8T 0ꓵ8 0 i ,<P`li  -LPM∡0H@Kp|P `(0 HP DP @P  tOP X  T00 S 00S(P +cTT 0CW$( 0 i ĝ6i(؝0SGS -LM@0@0 S GS@hva   -LTMt8Kp8@KhPK 0ppZ`PIh]P`# 0 ppL`P9h0@PV*0TSd K 0@T:T ]P@ 1a]]]TQ 0Sp~b0 S hP]Ж 0-L MHP$K@( K,0KP ,@ _P(0 -L$ML, @ K ,K$ K(0K (@ @_P$ -LJM⬡0` (0 wPp[SKPQLPP RK!b@b0T PULp(0 S ( b P @0S0S 00S.a  NK` 7NPLp80PP 0 &(,   4Ii @\l0@-P@U>01 0 R 000 ^0 0-@0P0LS\0S 0' ; ކ0P!P 0x 00P 00隳8H 0ꐳ$  o( -!LWM0,0  pᢆPUaKJ/ ad T MP=WoK0PS @W 0]KS  @P U00R00Sp0 ,0S , \\ K.0 ]0 O \ "ZD0D <Q 0$ 3 Ji( -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ KN]l`K@ [0 0p P ,0S X, Z@ᨲ0  (t -RML 7 M(% 4% @% , 7) ǟxx   , 0 8 < D  t' 岔p2 H0@/S@P((((t((((((D(((((((((X (,l|((Xh(t((0<0Ɵ:;;@00S lVA0C2SE,,,,,,,, ,,,,,,4,,,,,,,,,,,,,,,,,,,,, ,,,,,,40<00S|090;0:0;0:080gş80:( 8 07hFKL L4EG.Kx t :  B0p l 0P 0 +^5 09 N@ h0:;8ꕱ TNKA p@ 励0S 0 R 4%RQ #NKA <4P|ß0 R 4 R Xh 0@0sP00<0rV,0, "NKA 23 R 4 R0 S  "NKAN-l2`P0S2 4 R.". Z6P"=肟@90 >y/ ><T 2P00(圂10 \CsP /T :sPp!NKA P L0 R 4 Rk (`rذXDD a080 00V00NKA _1Pڠ0 R 4 R Pø;d0 0:;7B/0<0:;:?.A 4L4ضX!ܠ'('LUh̡L8TXx@ Т `d(HP 4Xxܣhp'u0,PlxĤ\D @(T<U|1 bZ Z0% 1PFKL@ L@@@@@@|aGK@Hx t : 0p l P 0 R11 P0Q1  t|\2$<P 90 I,%R0 KL@ L@@@@@N>K@0C, @:0C D PPJ$0S p0 00 )YP"0  NNKH2@D@DP)`' 0T `YPP2)( 0`YPxq Pp X 0S Q0S33 0 $.0% >5 IXP$  #0 5@T @@T m\T`$0 00000000@{Y@Tt@0D @T4 @0ROK4 Iq DP` 4)* 0 [Ypr FKNK@D0D% R44:0  4 $: 0 8YPO0 8LuP00 0 s0% 0% 05S8%R 454 00) .00   ,0S  < 4 (%R <5P(%. 0s 400) /0   0Q4 Z|&0) %R P0Sh&\KPEt '@0@XP86'0@XP&@)$ 0 @XP6)% 0@XPE(@C @ұ  ̱ 50C5 | @ >qsIpI,(0@ Lx00MKBKK dhdKL@AI L@ A 0IH P L PUd@T]0SV(0 NP@0 5 @`P> H804 =KL0Cˠ 4 $5 4 HP5 D 4 xP L%$  R 0SLPڴ0   L0S W0S  @Pr8H@:0=KEK0CL0C 0 0%Xp: Rh[f ձ; ұ/j MD0 S \N>K0Cɠ@ 0Ct* @W 905 ǀPP ;@<\0+0@0 )<5. WPh0s )|; WP0s ); WP@P 0)3 WP%3_P$O.K B BjPH jPJI4%4 0 @% 0) 30  @0IP@ V @ThOnK`F`F 0P@5@ 0S>IP=TK,3kI4]U@=PH) P04 X=@O>K0C)0C& D WP 'KNK@D Z-D)+ 0 VpDOKI) 0Vp$,.N>K0C 0C@ VkPT.00 1l>~$x>x 圭P  1 PPj1 hJfH  0 V$ RH,%0c/PP0  P$ 000P `d -LM8P |0 R 0 l00 :L M;;8P 00 @4 @ @ @ WG K V@@Dd)<00    0 ( -3L$M R 0SS@@@@@@@@@pp3  hV\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p *0P0?@ P`2 X00P 8 ~,ǯ@K<@@<4 Ġ̌(<"4!Č ̌$t0 0@@ X8#8#$0$d1p@ t1@d$t0 0@W8#8#Ġ0Č$ W0 pt0  0````W8#8#$0$0p`t0 0@@@@W8#8#Ġ0Čh W00 p@Z<$h@(Dh-p 0 P@ -L XP -AMLM@p, 8$ TF*PU 0T  0  PC*U5 0S@? A R:0dU7RPE6T$*BnK`F`FqD1D @ 04^0(! 1\   P0PE*ST:U @@0 ,0S , T:8$0b? S84S8 BnK`FBKX`F@ @ 04 P   P: \8# -LGMMmKS`F0 `Fp @,0 h ͌I.KTp  PU Q $3  ,0 S x,{0SW 2   Z 0{~pl  Pt P 0S4 p 4S) \0  < up$"000CS00  ä0 Q0 @- |o}P a!481 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K P,00CS @>8>H>H>T>h>@@TT(00T (00 -LM@ KPP"9p` 0 pM0s 0H H@0P* 'L$|\빣LW -T0LML @K0*0$ L000 90s 陣LW -LM@ 8|0 Jp >\ -L; -PLdM=6Px|l=PPXhKPd0K@ h@ d Jp  G:`@@jGo?@{Gz?~@$0@4@xVv xPd? O S+)( O X K+y)T \h0h8P XT`0נ0P@ 0p`FZ -0L pr눽h!x -LM`0X"XB00P0H0PPE 0S00(2( rP0003b22 .0S D,B,@,>,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_@X,4\D8@DHLP(X p-LM@JP `p -LM;@T00.0鄰0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;UdD -L0MԂԢ 0Pp(0 PTPK 2b20S @@PH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K]np (0S4(  dt԰ p-LMP`0,@KHP 0  G 0Sp  -LM@P  00R0R  00Sh $ -LM@P he00Sh# 0-LP@P $00S0h# 0 -L M K=5P@![A[R0 ʐP /x0td P00TT0@LP 400 PP00ht@p -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 -pP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*?040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0ıб` -pLM@ 00s)0@ܱ@-`@? 0"00\ 0S0S000\ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$` -x0LM@ 4 BN@Ap@0t hz 00Np` 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0(00S00B>0@-(0A> 0$Đ6I  -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4  0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc5=?0/9P6 0S000 p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0f+pqph(p -LM'3Px 404@0  0000 0 00 0 0 00  0?\00 -LMX@ 0S 00 0< @0S0 04h -LM@0 *pq @ -LM̀p`(P@TC@!2A>B.A 0 0$D4 dD P  40 40 4sto 0-tP@0L 4@ 4@O 40 04T<0@0h000 pD0 00000Sp00000S 8#p0 000 8# -p000L00 0S0  Pt tP@ qL0 0000 0S8 0(0$  8# (0 $ 00 0  -L 00 0 p-LMP%f@$`$@000_@000pW@ -`Lp00S 0P@F@x 0 0S %;@0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00 -鐠p0 刀0b? |`PUL@0S 2?0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U u?0 @0b?TU,0@ 00c0m^ -PL0`0pS @? 0 R ? 0 0CR00S 000$?000 p-LM|` x0RR@t?`0`P0 0R00C0h?00`00S c0Sp 0-p@LPQ?`0P0I?D P:00@P*0P0 0-t@tP0LS 0S 0S0800 P0S00 - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00 00( 0-L@dP}}x||||}}`}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&8P(̘PȎH|ВPtĒP؍\``P,xh@h̘̘,PP̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘̘H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S   -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ p P` -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 p -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0p -LMp`pP@uV iE 0S<00S,00S 0 0S00C'pIд P000P -P0Q0L00 00 0008 - L00 00C08 p-LMP`(!@0  000p P0-L@P@ 0T(0h(00PP0PP -LM@0S008 p-DPLM@`T Pp@Tp 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@D`$ -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P b @0Q P 0Px00Sl00 @,@ @0PU`XW,x  D`$ p-pLM`Pv ZP2p P P@0P`40`%@0P`p P P0`p -L0SH hp0 s 0 0  Bhp -LMp`pP@u P |00Sh0 tW V P@(0 f K!( -L M@Kq O p-LM`pP@ux<pP@uPph UT0 phHd p-LM`P@P  P pyjP@$00S/ ph -L M`P, , SP,0@cT A dxlP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@逵p -hL-` 0S 0 0S<0040   0+0 餵p<@D -p嬀0L`S%PPጠ K%@T0 C%0P08  c)  b)P@`D<@L0 0DS@0 80 40 00 ,0 00 0 \LPTXd` -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 n)$1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8( <L@PD\ p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 P\L<@@P $0@8$0 000x|@P |$0 000h p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS PpL@ -@LM80 00 B0 @00`0L<@P -T0LM0@SJ@000S P @TZL< -0L`Pp -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000`,PDL<@ -0LM00@0T0p` Pcڴ10U 010`@#P`  TJ1U RZT010Pe0 DPPE0 0U00P\HL -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c dh@P<L P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P%0 @@0@0@0TP 0 PX 000P 0 yP  000@LT<@, P 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000dhP,L<@`P00S 00<0< 80Q0(000000Xĵt@<0 0 X p-pLM@0`t cPP:p@ p%#@0t T T000CUP800@P@0 V000pD< -@0LMTpP$P $@0ꌀ0P0PE P@ p U `ZP @0<0Pfm"(0PE0@W0000D<@-p@T* R  :P0b0D 6@0@@0@0 t< @-P 0S 00Q t -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 t -L^ 0 ȵ -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   t` -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp+P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 t` -LM P@p` P@t0u00X00S T00XtuP@tTU@0p -L M0-S \GECU, @0`XP 7LPp% 0S" 0S@PP` !@!@@?P 0` U0SPH 0  0{Y L W40 , o(tSH 400S Aa0@S<0 -A @L2$0R20 -'PLM! $P .P ^P@0 00 WP|@000C 0`@`000T@P@ 0s0s(p4  -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3 -L M^@K |0^0s 0s\0000 H00 0400 S P 4 -LZP ,0, 0S @-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  08 P-L0 x hu J 0-PLM@Y P 0P[0=0C:SG,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, lPhPdP`P\PXP@8P0v040K 0(10 e0TX\TX\ PPP0PPP= -@LMTd ThL0 !@<840,h}\|dȶ4 -LMЁ0P@$0 * TTbA`6 00B S10 0C00B S0hQQ@`#0,SVVE1C B(1`$1 <qK 0S#T`VPK Kk@h0@1` 0`V@KZ0@V `PKO@LP0@`0P KHP  $0S4$ LHhu8\t -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e$% -l0LM@QT T@ hN$0  hȷ0 R000p -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RVHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH8888888888$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[VX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4\ W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHLܷ -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW,$$$$UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0   $@8#\Q PP -LMA@0 kD -LP0 0S00 -LP  0   0PL -LM0K0 =鰸 -0L0hL -`LPp@x`0PSE 0$S T; P80 0C$S'P\\\\\\\\\\\\\\\\\\\\\\P\\\P\\\\\\\\P00@f A 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`̸ -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ R\ t\0S R 0 R000000ӑS$0SdA0@Sa @0R0-P00 p-LM@P` ័X0@0P SP000000STm0Sp -LMK -LMpm`@@@# 0P` -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS  00CS ( 0 8 D @ @T U7`KPP0DS     { 0@p`P p-LMD`DP0@S 00P@P0  PpP 0-@ L08PS@00 0R+0@00LO -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 40 P@0@@hp`0Z-00hH  ,0 S ,  -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hp`0Z-00hH  ,0 S ,  p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Sp gfff 0-LM@P0$@K 0 O 0S o0  0-L M@P0@K 0 }7 0S W0  -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@] T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 hHD  0-L@Psj 0 04L p-LM`0PS@ t00SX 0@S  @00Sc?(0 0S0 >pDpT00C p p000C 000C?001pP0@-H 0\8001000\0 010pP0@-<00 CR,0010 BR0 000pP0@-8 0R (0P@0100 R0pP p-L MP` 0@R$K0S ]0 &00$0s 0s 0 01$ KppPP0@-P 0S0S0X@0^! 00S 0SN00^0Pp 0ApP<00 r0s  PP@-p@0\`0 0r0s 00000\0 pP 0P PPB@p -LM\X@TLD@0 840 ,{(0錮T tTȯX\ p-LM@@`P8 0S BPl   <0  p -0LMK0K00K 0-L M8P0@K 0 . 0S @0  0-L M8P0@K 0 N 0S *0  0-LM8P0(@K 0 n 0S 0  -LM@u q0r00T00S 800T@qr p -LMB@6P񟗓                                ,@ H      t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\PT` p-LMB@6PDDDDDDDDpDDD<DDDDDDDDDDDDDDDD0P\D8DDDDDTDDDDDDDpP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@ut0 u SR?P@09 \p0 s2  0 _0 S*P(Rph=Fp0 s ph| |0S0S S00CS00S S p@,0RP phph-ppTx] 0:S S@.S ?S  \SR R 0-0LP0CP@ Sfh                 h h       h   h0B0C2S=X t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t P t t t t t t t ` t t H t t t t t t x 0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:gT\n0T -D0L<080`00 ,0b A0  T`(0$0 0b0c0A}\ -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D008#"\00SH00S800SSS00S4@,0S r0000000S0S8#000  $00S00S<xt -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp lp -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CVlp -LU0S, ,h0S000hV  -PlpL† @090SX L0SdC@0Sw0Pxt< -LM@PMC0 tx p-LMP `@ (0K l0 0"T\^PP (0 00 p<xt 0-DPLP @&T000  00`,$@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q `@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@ @ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\`00S0 0 T84 -LM@K=0s0s n0 c -Lr 0 0S0 h  -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u 8p -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH` -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P <, 84L -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0$,Dp@-`^@P  \\ 0S 0\ 0SP@Up^p 000` 000` 000` -@LMTP oDl< gdah]9: : -81LMXH @@ K}sC@`a:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   i`:pH` -LM0$ KK 0 0 P$ - L P00Sd -LML0K Ap@T0[S00KT[d -GMLM7GnK, 7ǟ`F `F@0pxX D D d'TBp 20@FS>>DDDDDDDDDDDDDDDDh=DDDD?DDh=DDDh=DL?D??DDDDDDDDDDD?@@$@DD0@D@DD@DD@DDB C,CDDxCC$6 R6 6 R0%<0UK1 Ly4S 30(8UK1 Lf4S d <%tT5  n@5k$UK0 LK4S 08:$000S000;ꬤK0 L-4P@S =04@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L脲4S >0$000QK1 Ln4S (0,0dQK1 L[4S d0 0QK1L H4S000 1 bXq$B^KPEPE@bP  3P $0;P H^0-S [| U '$,0Tضxx $<L`8 -L4M0 4 00[ ,0 nZP@K0@\P@P 0L0iP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ 8#8L0 T3 M 00CS0|S0 000P@7@< 000<0SC0S #0P ]00ܻ0 9/㴁L< C444 00 0hBD@0px_ꈻd2 R  4@ 0SZ ,K00D ;PPJ <D080 ` 1B< @K0 00!P@$ P 1 xᅺ.q@ R x{d.`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @Q`VP$@Z -@L MX O&>gopn00~X$`pZ p-LM&> @`@Y NP PU$@pX -LM@_d0q,' !PQ YP@  $ (x,` Uv  V  iU0 0 -LM4@_d0q,' PQ "PP    wp00P0S@,0  ,  ,0P @;t  T @V U0 0Q  J(@sd -GMLM 0`p,0 MK@D@D 0P]0 )K oO~@0  pX `V@$p,0 S ,6y l -LMkU뜐0,0 so P 0  @lP@X,0\ E0[S ,0  X,00ZP`p,0  'xd8 - 0 S[R -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@0 o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Tp -L 2QU, -`q00 L 0p0S2 @ᯛ PǸP#Uw 11>p S11>.QQ$ DS<P pS8#Dlt 0-LM OP R|@|K  0S@ #pX /Q@0TD  <Q+ ,018 p-MLM`@0 0 Pᅡp* AK@@+0YP! T*AKAA 0r00000S  r\00000S 0S@\:0 S0tp 8#-Q* rh000000S  r@00000S0S QQ:8# p-PLMU`x x0d X- 0@0PP0P0p4 p-LM 0@Pxû 0`0X0S 00 0 0Q@P @f p餽4 -0 SL0S S h0 hrR -0LS S hʞ h> -LM0@S S 4  )h -0L s눽h! -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPP0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@)P 0, 00 0!0 0 000`xd\nh`d 0-LPcP ᰶ@Te?0hU 0-LMdPCP@ 0 SEKP0@   T0! -9L Mɟ 000`fS eS gS )))000P@00GS񟗳̈̈̈̈̈̈̈̈̈̈LLLLLLL@@L$Dh LLpLLLLL̊LLLLLLLLLL(L L8LLLlLLLPċ̋LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLԋLP<T u6 0 00 R5 5 5R95 ! 0 B 5E ,K帞0, R( P00R0S p AW\5 \EPD%00@%6 ,K⛞0, R P00R0Sp44u44  44 4 G$4 4=$$000ktt0 0 0( X4]TT 0ʪ@4S<4Q4APE3#0000E3 3<3   83 33/3)3 t3$3"3 333$C|P03\޴P D״P 0w(3 L3P0@S@# 2 .pp5D2P2U0`c MTPV00 S'V00 S`F1p0S "@0003@2 0T$223 0 h10QS0  00CP !X1 P 1!<tl!00@T410SPLV00S0  VQP0P p `Fvp ?`FvpWo눽8#T Pض8|pXh!Pht\`ddTtLdl! -LM@PpK# p P0Sʄ0 Q T p`4p  00 0 $c -LM@zhT@- 0@R:T 0 S* 0R S R  :0 0b0000< 00 0@D+ -@L0P00   T00 0D S0<PP4 0 0PS0h@DHP8 4R00C0 R0 @HD -LM@T- -LP p-0LM0Q 0R0SP  x0P` 3S S SҨ 0TPn1P@J0S `p|T -PLM`bPP20S|N P `20S7DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0VM SMP0SXJ@X00 R00SJX 0S0S0SL 0Y0 R00S <00SD(M !PLt< -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 07CP10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR I0 0R00Rh0 : -00C0\d`tPLT -@L`P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Qd" -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S XP0@ NP00C004 4   0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, -P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4S8#d" -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y:Np50O00O4S  0 0 Sr400000S00S_S   P0S r@400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr300000S>00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,8# -L5P5 錛 -LP+ l0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0d-\0Q 0\ a p-1LM0`S@P+P10S U t0 CR 0R0 S 0@00e,JIP$10S U 0 CR 0R0 S 0@0H0,IPU 0 CR 0R0 S 0@0T.L@0 00CS0 ph0  0p!8\h -LM@PE`p!'pF@K 0PDLDXhx` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$0ضL p-LMKP @P`J011QhTZ ϑP@Tj_EZpD]P TP` J -LKM MCNK@D0@D,0 pgIKKPPPM.KAAygP@4: S  S \RH,0 S <,imK`F`F P@ PP  sP@h 2 R_2 R B{PO \P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K dKKNN( 0<K @/wP`! #04 1D MNK !0P 0 0@xNH{p G@}P p @RD@0 0Pd :jP $$  pR:0P 0 2P T]] (P@T Ph5mK`F`F P8 taر -LMp(KLPP3 @T `W@ W Tjo(T%PZ ( D +(00(PZ ( D (00TGЦ 0-x0L0PS0@Q  UP 0S(0 R00 R0 P-L` 0SwnS 0@ ,㦫P@%l0PP@p` ,㔫Pp@0oS`  p-PLM@ PPpP .mP 00P @Q T`P. XP 00P 0Sp -L 0KM#+ -L 0fh!8Pl -OML M\3PJK@@| ,  u0c(# %ph 90@?S_ij444444444444444444444444444444444444444444444г444444444 44<04004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQFPB 0 4 04 $ 0* ) T XQKAdp* Z5<4 Y584 X5;;44 J>K 0CPBP P| BN0$\'-PPL 0<1 f ض,L0P<T` -LM@P T  Q q0@0  R\  8#\ -LM@ P T  Q q0@0  R\ 8#t 0-LM0P00CSK @ 0$ ϓ0 R  00@1ض -L0Q eh! -LM`P<P( @(K,pK 0  (0@Sy> -L M0@p00 0Si DPP 0S nSZ =ᘩP0`0@Q  P QLQJ  0V0P 1 0* Y0  0000V 0`0A00 ,Kᯒ, ?R0S@p @A0"Sl 0Y000 LPH00D 0oSP uȢТ -L$M<@K`P6PD  P40KPsC圃 -0,0K * K#"pr ?0L:Slļļļļļļļļļļļļļļļļļļļļļ ļļļļļļļļļļļļļ$ļļ|ļļļļļ\ļ|ļpļļļļļļ|0000S  @@KXp| @ ?@h剋2000,K +K.0Se D 00|!0`VQF `Fv  PPp   0z`Fv P@ p~P yP tP P@D0S  Dp\0l 0 aC#40K`X40ض$4,L8<0 o -LM0@S\ *PH %P8PP  -ML M0ß0`@( ,0 @3P`d088 B~KpGpGP"04 0X ѫ048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0B08@Tn ip@` P- UR4PX@ 1 ,0S ,cKAA BP<8#4P ^  \P0C0|0S  cY  CCBBU448t3B08@TBbTk  Th04p\n8ЧD 0-`0L@PT  ㈋P @T(0 R00 R0( 0-D0L@PT  jP @T 00\n p-LM:`ѦPP 0h 0@T  KP @T0 ph  Jpyt -`LPp@0   0@ -PLM  0SlSnS `0 @KTsA0S@ @ 0oS0  (u\n 0-PLM@0P L\ y TU0Kp됩 o -L M0 40 (KP`* +A2pP@0H U0S -Sl01=P APA"P@0P0$`P00`40u -0L ˛a눽h! 0 DL0D0H --L ah! p-PLM@P`l0l R T D0 Rp80@  0  @aLSDn --L  --L  -LM@S=勛 h^ --L [a p-LtM/PC@TK _P0: S p0`rS   0-/L@BPU+D0 00l/00(+P+L00n -LUMpPKP_P@lK8_0S(0: S  SU P U@P P@0 R000K@_P h1: SD @c$^X=H Jnnn P-L P  o -QLM@ P T oo -LNP a,o -LM0 $40  8 <Pp  P@=  PP a`.W X X0SV  0o b88 0SV  04 P8 W h ?W X0 8ßR030#00 00`QX0 ,K pz Ÿ@T 0S @T T ,  "4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P   0,<P趙p  0 >, 8 R" 0PU 0S  0圙U  0P卙PU8g84P00`XKc9LL %lh!TP\nYt0@` -LP)@P : q00  R.@P*`p@T  P0 R @Tj@0 0 000< @0@000eP`*8#T 0-T0LPU @N> @T ,H>@T APU0 -LPp @`T DP @T@74 100 00 @@mM  p-LM @`P 0PP ,0 R p 000pP -`LMP@($1$Pp` !0s ?S mS 0gPp) y0 PbQ VU UWtV fi^0 pR0`0sX\nضL -LM0@0cSZ bSZ4 `K   0pR R 3   0 P `V | $40"WĂ,(0 ("4S @ NP (D` p-LM@PP`pOP$0S`=ꤽ -PLM808 4 $@, ՗ ї]눽h! -L(MP4`K8pK4  00 PP%p 8uP@ 0 PPp 80( (,K ,@ $ 0 ]t P-L 0 ,0, (剗$9 0n](h!h -Pp@LP;`"pT@6 "P/$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$,1`14 11111a Q@b*911 RQ q|10sM P [ @+P9ddd|\00]p\00 0tضL -43L$M `R@P#TTP0-S  @P񟗩$,,4 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@PPDPn@0S_V V@ *0SR 20S@T:b1LP0S   RR 1 R001 o pP%|1 R\!0S0 T D~;0S0C00I s;8I"&<d;80 R U;P` 0  @@pPD0l ^ \L X@x 8Pt -LMA%QCH|@xx0  Q d\0S P 0R 0000᷂$@,(4 -@6L M P0R@`,P 0 4P { 0gS 5@DT%U0-S 50 , K zP5 R実P |||%:00@DTd5d%0Q4  S4  040 5 s 54 PppRp@700 SPP 703S 70S4 R0S ,Q  0S ,0@ o0gS 644` R4@4P<$ 4004:0SU V V$:U7V   :U00T00S 3 R3 :0@S (3 R 0k`9\<7 b0 0, K4 [0@-SBlt|  0@PXdPx       (0 0@2 z|@T , KO4 0 @T  B@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T `cyyph0$ @T {|Y\nt|8Ph$x|ܗx\xt -PLM@0!P@- 0-S ,@PpXx080h0000 x-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S  0-LM@0 S  0S 0S0S0SP 00 S 0 S |}Y00 K 0 (0 $0 0 PDPU <zP , 000k 8S -L$M(şPpP5 d E0@00R2\P4X @ (PU U  ğ 000U000DS񟗿HHHHHHHHHHHHHH 8HHHHTHKLK`l 0D@ H @ <` 8` 4` 0` ,` hP7L R/0S ,L R R H0S U 00S S0S 1#$0$0 0 00Sh QP 0H` hP Z00U @ P BP Z0 1`V@ 0 P P 0 ( "# v%P P41 R 8  $00fW U 0Su0S q0 <000l\`\@TLxt8$$Zx< -LMP~@00S p SpBT  0ϒ005Q^` ^ T0 U   V CR 000Rh60 R \-0R \ $0 S0 S 0-,@LP0S P@0 0-LBMQ0 0C @S0LZR 1x  0S dR0 L f 4F/K<  ! -0`PL@ p 00B S0B a0BSWBA0BS7BR@P4P0\Dll` `Q:0e0b``` -L@LM "00]P 0;0P -L M0 K@ 0Rx -L`,MDKHKP@  0D @ ,@ <` 8P 4 0` ``IPpmHP `Pd   0pp4PYH0pJ.V V@ *UL0T 0SQ 0@T:`0U0U@@T P  0@ 8 DP < 0@ 4@ @@p) HPV .V@*0S 0AT:x<P` 0  @@pH0p8-P-0*S  r $4 -PL$M6 P- P$ P0 P0   @0@y00 R0 R00x0 R"`0 R"LLL@ H,0D@U0HPX`dhtt@-@T<0 1  0B0R \ p-LDMa0L@0  PRJ 0S ~ X KX@PT9 0S0N j0TS0@  b$H D/(AQ   /$0  B LR 00,K/00CS00  ä0 0S Pp d0R PDP0 R0080 R0"0 H!$,t 0-LM@0PS3 @K fH0XS  cD0TS  YPQL 0  }0D0 R " ,0 R " 000Lt0@ S) 0000000000000000000 (000008<0S88A/,0(0$0008,D\hlx p-QLMP@" 0S S Ul0 R \0ph/0 @`/p0ph / "48<#ht p-LM@ `P.T=  0K0ES0,<<<<4<D.00CS $. R| Rttph.lhd`\XTP(D@.h  0-L\P@ "10Q0S cT0 R 0h.0 0h.0h{.U R R  00S S "48<#800000St$ p-L,M` 0@@KR0 P !KT*00 R ^:007. 0S 9Op , p-L$MXŸXb0 S @0z Rr 0S$HP PPPPPPPPPPPPPPPPPPPt0 S Np"R 0||!lh \ 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K q0 [R R/0[0S S Q"[-K"48<#8 0 .K/0[0St,`奒dP0uP 00z.㎒P ,ᑒpP 4u@u 0-PLM @ @T T ,|vt0d0 RK 9PP .ZP@  uP@utu -T0 ML\@4 <@P , tu p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U -!P`V , pU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HPە$<< (PԕP`tuHTdp -p2LKM@PHK ,@ `Upp 0@CT@V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <P0,(!pk1 ,0S ,qM ]0 S- ʀS S `V0 00S SpppS SpS Spppp tux -LM0@0CS$$$$$$$$$$$$$$$$$$$LThh0 h!h#u0@-d Q00XB.P@0L#"\ 00  P0S:00A00< -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!奔,@K 9P qZA <4(<"4(< p@勔*4@8 <#8  倔 Pp p+[*[)@[(P['`[,0[p P@ P`i00S W*00SW: 2ZRT,\ -0LS00S< 0S S hKh0 5u-^𝔰1S00CS0 `R$0SDHLPTX, p-PLMP@a@A 8嬅00!S 0 夅0!S0 奅P0 唅 0 p@0S P 0S0Sx0 { R 0S l`P 4嫏 @0 <0 pOd|l8TS/`. -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8L,HP@`//DdT 00Vd 00Np 00F - 0 L0 O(S - 0 L0 Od.4S - 0 Lք0 O?XS -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1妄$0Ps5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0e $0$0QR  0$0TaOS)HN -CML M% P` , \ EK@A@%z3P`4 5>5 T`4 |5 t5 1d d`50S y R<5 t 050Sp `44Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S = 040S 4$4Q T30Sc0 0S30S S0@04P0@00` !3P@~d43@\4XT30SD30S `43P 20S`4 `4 20S o 2@`4"2Q\20S@Xb0 0Svh20Sr TR0@P0L3P0@00eENK@D, `4 0PX4S`4MHTUH 0SE 10S< `43P6 p10S T10S  <14!41Q ^@10S@p0 #0S00S `0@0_3P0@00P 0SEK@\4XLd@0  ,0 Sh,,I OS.H?NNS8#"HN)T.N / 0 $- 0 @ 0^ 0($1 -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"1P 04S44 2}44H3PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAFV P44("/K0 P 44J3p 4SP44  RQ  0|@h0 X0 ,0S@,/H (OSS8#"HNP(\d -L^7@00CS00  ä0 F0S t00S h@h0hP`0Xp0 2P@`p`p0$0BO?NT.HHN -ML M" P4 , 0 ʂK@ A@"0P 48 2z2 48K t2@ l2@@@(PP, Hc8 @p R 2 k 20Sg KAA&3P1 K[481PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S w ,10S  Q10 S`0 pp0S00S @PpV1P0P0004 _0P@880@ ,0 Sd,(G l|OSH?.NS8#"HNT.1\NN0 S|t -LMHCD\ <<3|8#0 ,姀 嬀30S$0S 2 唀噀q$2r20 \0}2 vŸŸ"2m2x2`l2P`2@ L0W<242@ 0 K2 D21@{ 0810S !1/410S !1"'1`X1@T10 |p1pqHh \1AT1T \|00<0S(0@T Q 0@TP0 HO?\nN0)NH/PX.td.?(8T/HT./)H(ST<H\S(xNODDHNH//N$L)$S p-PLM@P`0S00P xanP00 \YnP L0 DpV 0 vp|tOXp -0L 0xHS - 0L0 0 /SN -0L 0\.S 0-PLM@ !0S000.P 1 2mP mP0 K1 t\0 0  |0 0T0 HPH@DX 0S40 8~0 DO|tNS h  -0L ? 0 /S -0L 3 0( HS -0L ' 0@ HS -0L  0P T.S 0-PLM@P\1 T~ NP@!0S000!P mmP  hmP0 T>t0PQ @,ˈ0@0 @0S 00S 0Sh0{~00`0@0 P\04@_~0 00 0Od )|t/(N HPS -0L 0 /S -0L 0 (S 0-PLM@(1 *~%lP1  # lP K1 s\ 0 ~0 00 0S000hPt 0@S00000.,0 D0}0( S0000O |Dt SH8  -PL M   KK-P 0S0 0}0 0P|@0}S t00S\0h}0\P H0R@0 P,0  T h OS /  &N -MLMp0P 0 00P0P 0 }}`K.P0 Pp# ANK @D@D$P X0 \]}P]# 80 VO 0S( C `O SP    -PLMd   KKk,P 0@S 8080 +}(0 0J O S -PL M0 , ,K0K0!F,P 00  1 }1 00 1 0 4 呹$ R0  0S 00O-0S 0S0@0S 0P0;-P0P000 E,P0`@4ȹ@l|OS.H?N NT.$  -PLM   KK+P 0| SKK+P 0\S T0T0 |D0 00S$0 , 8 @ OH Sh  -P0LM0P01@0P1 n|Ȇp 0\``P /-P0 PᰆP 00|S -P ,Pp0  X0,0徴P.U h)Op    S 1 -PL$M0 , ,K0K!K+P ,0S ,K0K!B+P00 1|, 001 4  4@ WP 400|S 4K,P 4\P,PP1 00@ <1 41 ݸ< $r1p0S. ,00CW*Ww0a050K00`!50K4n0pS0@0S 0P000,P0P00h00S ,00CW<㣸4@0 P,0 l O S.H?N NT. -ML Mq0$0 倸`|PP@P@@.Tnk|PP 0S`Q/#P@Lq@BnK-0 K@`F4!0▅ 嫅P+0 K0 10S AK{ ƳX00  /!0  *ABK@P`Pt00P!@ $0S<$ZA HDOH`S   -L`Mq Px t `tKxKh!"*t0x 0CSP1 HzD1C<P.t0S$Kx0t00t0 x0Pt0S@zpPKL PjP  P`x0 Pt00t0 x0 `P \0|z Vt0Sx0T  P0 0S< @  O S< D P X  d l H 0-L@0LDP0P 0000}S$0}zP0/| S O  0-LMMlPANK@D0@D0 !P DD @0TzV  0S$0 @0   OS  -PLM   KKj)P 0S |0|0 *zl0 0IPH00}S <0<0S 0z0$8  O S/ 8  -PLM   KK1)P 0S |0|0 yl0 0PH00}S <0<0S 0y0$ @ O S/H t  -PLMX   KK (P<800 y(0  '|  OS\n -PLMX   KK (P<800 y(0    OS  -LMM(BNK@D0@DP+(0 U)H0`P00V00S B.KQ B B 0BNKp0@D@DQ+a 砃*`P00V00SBKA0A@)0KnPP (0S(?   -PLM   KK_(P 0d SKKV(P 0DS <0<0 y,0 05 N O S 0-0@0P 0 0RL P0/ 0-0@0P 0 0RL P0/$0 0-0@0P 0 0RLP0/@H -LM4@0S 0S>H 0-T@L0LPSH P㶭40,0P 00H\PN/ P- L<80 x,0  hXOSpd  -L.800SZ (0( 0S00RNH0T. -PL M0 , ,K0K!'P00 1Tx=00."p4 tAtRxаd14  40SDAL 4  0S$A0>x弰ȴP+` 4  0S 0PU @%x声0 PP@ d ,040@ L0 P0R  l|OS.TH?0T -0L 6 0SS -0L * 0TS -`VLt Pl@lph000w000H000V ,00hHSOS(@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00((S 0-PLM  1A00`w P KK&P 0S 0 0Dw 0 00 P0 s0@0S 0 S  @g@00D0HD 0 S , ,0ON (SHNOD p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(uppO(D8#OD -$0L \00'0/X.`S -0L  0p)S -0L  0HS -TL P D00}S8080S00u( P 0  S/ON 0-0LMS0 lKkP@tPu @0 \ ,0yu0lu000O( P -L MTr0$ S( D P8"$K(K$P $0S (0 2Eu 2 10S1Cu(0a w0S1 0 11u1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0h@t0 S@  1 0U UP 00PUP00CS00@Ӥ0H@ T tt 00CS09 P0 R0@0t/XOST.)/?   0-PLM   KK#P 0S t0t0 td0 00%pP@0<u   Pt0@0^O8SL -PLM   KKʫ#P 0Sp0p0 kt 0%0sK0  AF( 0   Xt 0 ^O8XS 0Rn `h -LM00 @P  0 0h5t1pO -PLM0 ,  !,K0KY#P ,0S00 0t0 8 $P0 sP  0S 4Kp `0 p吀@ 00 h04dP_400080Sܾ^8OS4(D/$\ -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 obP@ 0X30X 4 3s3 NKI I tt#}1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 f}4@iQ4 Z% P 4("  f}}4 `000SP0S0q0100p`1%s1`CP 0S 10SX1sP1 1h10S ,A0s 0@0P,0 B xQ  |A "  BhBt͟P  PB $B `Q  XtaPp D laP@p  caP"Pp"rU`/|P` 0ST PV 0ST  2St1 Ϳt t1S t10ST\  B0T00* gx x1S( x aPx1p x aPx1pW 0S /FT|P 0S00bU Y| |1sx  |}K5p<o/K<00t@T|P8;01  t((+; 1S0 1 ~P;P@; 0! pǏ$ 㕼P EL;b  !p` P 10`S1 :0S, :0S(*0S!0S::# 0C\0\00h:p0 pÏR0S*P:|*!6P :0S3 90S/ɟP*0S'90/P0S*9#0 CR 0R00|9 00CS00ä0P9өAT #(90S 9 Fq: B 0[S ]P 0:SSPp :P0@080S 8t 0`q^K  7T0~Kl1 0h1 7  0mGp70X L@K p'P05 0\GP E <oLQ0U|1 G SOK <_P,{`70SX7 p| |1sƟ $ | P0S |1@nh 0@|1  L@K0@)PPU]|1S^|咩XF$ 0SL6"pxQU 0S$6"}pş%0$80%$:zP fP@X+ %zPP$<%0U$$0X zP0$$4$$$50S5 $Q p /K$P  !R B00S S S R B0! 0!R0 0S S S 30Sl4 "p HzP` NK` 3FzK0 e2SPKPP P 3  R  lŦdغ|3$/KZP  !R[ 00S S S  B0! 0!R0M 0S S S 1SF \20S2"o ^P"N0`0K  `e2S2 g2S D ^P\2B0 `SL2 o$RU ኤ|1s|8xwu "  Qt yP101  t!峯 1Stt*01 P 1S& S"<O@1P@<1 0! pǏ!= P0 1 J;3X  Ht!XT}D0?8\p $4@XpdT(  4@T}dDHNHH/O0< X":$H  b0@PP  p` P PU00S, 00S( 0S!0S:0# 0C\0\00,1$0 pÏR0S*D1.1S|10S3 10S/P*0S'10/P0S*1#0 CR 0R002 00CS00ä0021SX- dp0s 1S"0S 0R 20S 2Sn20S2Kn?P R  ;t7$\ 2|1s|xP#,0 S`,e4 -LM$@#n哦嬪O`XT -LM$@#n偦嚪OxXT -ML M60H ,0 0L P$ D4 {P@ 60SD4Ԫ Ѫx5PX  0SX T+P\  0 S \$ D4H`D SpD4L$:wPi D4LT Xc P `   \P   \P5\P$   |\P @gX$R P$ p/+@/w:Pw@pwPW3 W1*P0#03U0S* TD @@w`@ wPVV*4 T4S 0S Y 0SD4L$ttT.T +T :vw/`rwVP P`3V U  R0305`1:` :]wPT 0S U ppU 0S /PpP30S t3tT$ 0PP l30S;@3 0V@4 10S 1U! 0lV BNK@D@D0!zx1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 MD4`$0RD4 D4HSD0`$0Sr` ,0 S,2 MH ( DO. /0N/\n@x\T.SQT P-L`7 ޻ͶP@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g88#p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@8# -LMl @Z0SX  |Z0S<  uZ0S$ &>0P 0 ` -LMP0  呔 -PL 0 K  -P- L0  "z0 -$LYM0@,0 4p@` [KѺ ͺp4Kl  0h d `A ApP4"0L@KuP |uP $LK 0ruP#LK P0MyL0[S LK 0qAPU u  S }3 p1Q,,d\/upAP#P3T N p10S S_K <]P,u2 jP`آ* ᕾPP 0S U 0S S_K <2P`,tT PY <P`@TV 1 p WcQ 0pt1 @W]/KpA <P}J0S x ^?K 其PmhxA00pb0dQS PP H10S 08 0LjPPMP I| _?K,PP00S4p0\0 0 ,0S,n0 N|W0XTd8\ltS, ?OpXUx!xV1\/DV -LMd@ 0 0CS00ä0Gq((0 0 S O $tU --p1pq0LS00`& TATiH XP8 4 XPi x00CS00  ä0 /P@T%0  !㘦 @cxi0 |sP0PSTzD O \ SD )P -LAM M8B>K0C0C0 +,  %@$ S p< 8 4 BK J4`J U0@S񟗾  DDDP 0tDPp 0P'i审u04S440S (D(i圡$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 hX30 CR 0R0 S 0P0/Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4AI PP210SS5V4Vڐ10StA0 CR 0R0 S 0P04$RB>K 0C c R+#$r8Q 00 S Y44044 1V 0  <7 0 YR( 00S <$`0RR0F<,0 S x,k.< 0  T*S\H/OP/0T?8#S.xVX )  -LM00 (@(0 gw吤 O?|V -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$gTU< g<@T $i t< p<RM`<` D D D D 4 /P`# <<0S $$<0SLP@004S~4S y4St;m04 h04 qPL; 4 R`T0|S S$0@D4 @  4S$ I B *0S:`4 2Y 4S  2 +(d:IK4 4AAQP4: S 0:$pgHE>K0C 0C)00P 4S 4 S9T 9Pz 儣PpI 0SG >qP 9qP=D9`0S 0CS0X` 4@90Epq `v  4S8P@80<HP 4TSd8P- 84 $R P& 㑣㎣4DS7@$P 〣}4TS7P u4S 4  4S  bd7 0S k0CShBppS7/4 lPp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00vK.K 6 B B Ɵ0O4Sʸ4S 4S5办BNK4@D@D+*P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R00%4 00CS00ä04CV W0 S |4 VOh4#0 CR 0R00(4K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00<3P@ 0 CR 0R0 S 0`02P@  p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00n2 00CS00ä0c1匝40@  40@ 0 S 1 34$St1 4wޡۡ4S2  ա.ѡΡ4DS0@ ơ10S$1 "@Pt004SG4 S0  4S4T 0S0S ,0 S,*N/ HHHHON/`.1|V )  !P, S( $;D  -LM00 (@(0 gd O?,W -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` nPH H0S > 0RS ,0S X,00-S X>, PdQ<>@  d4>0S H0S , .0 80 R@0  D0 H0 S  L 剠P! =0S =0SNP00@0S@٠<0S<Ԡ(= p (=p.Hʠ@0@0 Š< X,nPS ,00|SO ,㵼P@/,b @0S 0 S , @㡠<㞠< T00,0Tx  T,l ㎼T/0p0WL<0S m0 S,P<0S `0 S ;0S ,t , ,0S HQ;0S  ; ;RV<;PH PH0S X 0S D fP 0S  $ ] YP@ 4 40S pW%,mP:00 h:p) ,00|S D ,0 00S,x  *0S:`: ,T0 00S@:, N80 00K!P0S;0 Y0 SIܭ堭P0`0 `.0: S )0S009 H9@T 0DS0 0S 0005QppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST7ݚ4077 &P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00w`6 00CS00ä0l46啚V0 S 5 W W,`V 0S 0 _UPPU 0p P@0S@0 LUP,80pS,5p05 080 VP00P0  V[5#0 CR 0R00494XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 T P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0<3P@ 4p`P0S CP Ba|Had30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00sP2 00CS00ä0h$2呙400@ 0 Sp1 000@ ,780 S1p 1p080@<D0SD ۝4m@ RH0S R0S10S 8 d1Rp \00 0,K0 ^p{K.<3 0$, `D0S`0d0D 㗝l00S70 @ 卝<㊝NHdHH(H\/ONTW )TP J\H/`.( ;!!1, , 0 DpxSHP4 0@P@ @80S 00S08040S4Kl 0S0SR@6<3 -LM0 S 01 `0, 1 a 0 S00SS  0S( p͟|` XP L B帾00$= =0 >K P 0S S5 Q<0S) |0S%̟L0P 0 < <P?B1cSQ < ! _1SA l< 0R0P<X _\H 1  < \iP,:(:?B1cSQ< `Va  V@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 吮!1 (,10$10 <4<  4 KP"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpP0DS00p㓼 PaV00 0Sd >KکP@0S S >K  ȩP >K ) 廩PPC P430 >K 天PxXC0r/K1 @P@S\PyQ ZOK3(K0S S 220S3 20S/L3(KKoK\0P1 \ S_K <@@PΥP 0eP R d2 0S82  @2H:] QA Q^ ^ 8 0@\@>)0@0 0  (         $ ( , 04<8@@D  ! 1S0s`0a 0 \^(1  0S >K  P X@~0P00  ,0 S,#XU X.WH@/NX/SgfffO`D?T*`<|}~|WpH@Uxdl| -0L,MP؀0p0U$0 D @KD K `崫@Ti00?[\H0K @H iP<QL $0S $"X. XU -LM!4 0S@0SD@H -L 000  -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,9fBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 e e e e0+11b0eb+e +e+e ၘ0S00  lN4 H?|WXUxV\`./ ))HHSS(NOD -LM`@00CS00  ä0 ד, 0$0000OtVtU ? -DL$M0D ,0 H 00 @ eP4@ 3#3Q040 3@T 30S 30S@@S0S6P 3[t30S \3d[T3 0S44P(兗PP7c0@H ,0 P@ ,ڗ㫦00000 4D P`B000YU,㼗82`D H0PZ㯗4"0@0eP 20S @dP10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 K+PS00S0  ?00S" 0,0S@0  4\H`.)T/OH0SHT*tU;$PN )xV'tV 0-h0LM0 0PK!K0  @T0(0 T0xVS -/L`PPU1 1UU/0p0W 0Y@+dᝩ.0PW0PdZ 9X0l000Pp 0X0U.S100E 00EPEW  J\POhD  -LBMAq0 S P 10S1  RAnK `F`F0X!Pg0 0URP0|, tY10U B>K 0C0$  0 K(4 0BK @@ 4Pʰ\00S0  HU 0K0 +PP@00S 0S8 \ tVSHxV' -BMLM07,',70 $'$7$ H , y'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@MP@ 0S 2d"_X2VB 2  L22 2S)P@벾P@T 2 0aQ1 [QxPK!PB =AP  [P00x0[SR 2S jP@2S寴 |^P@ 2pSX墴 PQ@TWQ $GP V00S&`0P  O[0 00` 0@P0 PS[P@P 0T(0 St(6 SH!H!|$TO$$ < $P pd $N$? TH/H)H)$ -`LMpPᒠ0@T0P0 P 00@dP @P w@T0P S00@@0 800P00?$O$ H T -AML83M4ß@0T,0 p0 3 0S 3@ SP w@0S 0S 00@T@0S從P@ 0SB 00SP/S  0 S R?fPDiBnK`F`F+|Z00S/S/00P+erZ]P*P߮1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DA00\0SX000O |P ?P@Є@ YP0@0x0 ,0Sh,? /(tJJ$%$%/DN1 SQX!H%Op%$% -MLMpp0 S( P`L Tq0SHHA0 @O BK@@$!d?P9 1$K R01000ӑa0CS'0t0UO 0 \0EOKO(0 S4(T. HO% %"%%& 0-0L0M0@PKS@,  0 s0S\@0S 00DPɭ  0/ -LMp0 SԀ0@0P`P "YP (KD(0`P R rp000000S`P T 0S8@,N fD/&X8#O -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p M=P \1\N000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 + pP X0S 0h LN00P X 0SH@8HN u0D/S$&X8#,&O0&p&& -MLMBNK0@D+p$0 aXB`tXP ^KPEP@t0 K0/S ҝ@ <P0S/S$0 S$; \&& 0-LMH@0Ps:0 Kp 0SPP0xwt@ -LM@P00s@H -LMH H0q,0 F6&6K60S |&Qp6\Ɵ  d@ ( A@ _P$ 蓃@T@dTd@K0 %[50PCUڔ5 ra9@ 6ş@ş`g0%[p `P`Pp%5VF%T5UWPT  @ 5@` \ B0%@Po[0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 wP@@w/ }0 |%KHP;%.Kz3/C0ur ᰜ@ ᭜@`0#[ ᤜ@ ᡜ@`t# [%KzT3OK0ua2g 2crB0@ #? 2cc#aw0S0S%NK/ sPڄŸ0 S 0S* f@ c@" <2S [@ X@d"`ZN !P!1P@%K [}0 V}%K '|Az1Po0uv 1@ .@`0!Z %@ "@`x!Zd1OK0uf2g2crE0@8!?` 2cc,! GqZOKQ 0JH~#HP 00CS00  ä0 m嗄(,0 S,U.A ((((HHH&4TQ&\n"h"ų"T""##O$# -x3LMp 0@@,0 K(H3H0b0P a  B=9 = 0 svP@ov/ |0 b{K\ KP@/ rP @K |េQP0吠KS0SLŸ HŸH2@K00 0Y~/ ~/ T{"ŸP@Y00 d!pY\P 0SL0SI@K]/ {rPBڜ R>1 P@@PR50S1:PP@ K /|0 @K)| zy 1@o0ef2f2c BDP 0Ϡ#PE0l 2lADd`0 @_Y@K0 S005<@,0 Sh,[.A>P?/ (H\n\H,$tp(H(ų(O( -LM0`V *0線0`YV@: H1 ?PUP@'`VA0S,0 :p0AT0J 0S :000CS00  ä0#  ~ P@| 0 @0 C\0\00 T,0p0S,0 `V4TO -L MmD00 K4@囆p( P0 1[SP00\@Oht@4T -0L M@K 0 K  詖 -@4L$~ <toꝧP@ Q " n@X  W@U" b@ ꌭ랶P@@ḗx :oIl K \)L)0\n((( ) )H)0)8)@)P)p)) -000 (P$0L0I!\\nh!) p-GML`1 M Xa T!P0@4 8!1p ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 eP# $04 04 =K 0CᰦPPx Pl H0$Lš-P@ 4倧 Lܶ4)ض*P` -L0+ ~*h! -LM`PF>P( @(K,pK 0  (0@SდH -L M0@p00 0Si PP 0S nSZ =RP0`0@Q *7P QLQJ  0V0P 1 0* Y0  0000V 0`000 ,K;, ?R0S@p @ 0"Sl 0Y000 LPH00D 0oSP uȢТ Q-0N. S$PP 0B00RQ  Q 0B00R -MLMⴂ0$0 C`2^KPE+5 p@0S T0T0S0 0CS񟗆D(2 05R|@{PvPd 0K @88 ֕`^KPE(1 PZq0@T ( P@TTC00S3 >K0C( P$0 05R++P&00S" 0V0 05R01Sd0 05R X H00QDp    $0S($G  k4kk0484@4 -4L M@P  = ='P#((((((((((((((H4 D4 @4 ,4 04$4 2$pc@30@cTQ%TcP b#P sP  PPX0S0t0p#cpd Y\3  TC PLRB 83 0000C<0PZP8 @ WF 20SXFT ~~0"0Z ڀpDFT$237 &0S,. 00F, p 2p S  PPPPF 0KⷄpA ,0/0,1" Lp@0 ᱤ( !0Qx`   `1pX PpH DJp<  ᰓp$ (p  p uL0ߓ@0 00G鈽ضk P4LkX4kd44kt44444kkkh!4 4445 5XS<5kT5p584x555 J555T -,0LM$@ zEEy 눽h!55 p-LMP 0S 000` ph `@x,0PP0080 04 ,0 $00800<`phk kk -t@LM0 \D0,000 0000 04 $0 0080hIk kk -Lq0P@T Ut` ,`s 0SP0 VV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h#!k. 66k k Mp-L$MHb@R  0K @, D0R|0SS S St,K0 0K@P  `0 R0@P100 0` 0S100 0;S<000@2S0?00 0@ 2S  0/"/0B1 00 0000 0S100 0000 0S100 00 00  0S1 0 0S$^ p k 6063kH6 0-HALM0< 0, 0@0P P  !1P00,0Q 0SO0K0PQE0P0 0000Y00 0 0 L0 0D cH 000h kP6X6`6h6p6x684p'k6 0-PL0 D0,000AT 000@<0 04000 (0080 000hk kk M-L$M̂r  8K$ Ց`,D"2PPP\0S4K8Q \X0;0S 80;01 S+l 0S0@T 0S P P_ @T(8K`vP@Y1|qS000000|<0,0h}P1 T1P 40PP^`  ՒP0000@00S 000SP00 0S@  0S 0S@0 0bS`V ʶ p_dXXT $0SD$  k666k0666k66!.7 M-LM B  @K, p^PPi!&4@!0 S0 P`E X@la0 P01S 100l0S A*P@$# @ l̐$ 0@0$ P@$$N$@1S 1000S P@( 3p-H0 ✐( 00,0 S(,r 4 7k47\7t777 Mp-LM`@  0K xP, D0R!0SS S S,K0l0d0S  00< 00 0S+p k7738 -d2LM\bXT24 0bXPm0S$20S B <0S0P<0<0S0!P0 <00<80<zPUA# P`80S|1 10 0 8ԍ800Hq80P Ta80 SڢO0 Í@@8@80S0 1080@0 0804 0 S0l080X8#8#$0$ ࣸ$0P$#寍0  488<#8`X0H [080<mkkk 8 8kk(8k. p-LM$B0 P@0S 0SCAa0 0S4 0  00,0p0QkP0  S000 0`b|0P0x008r9? Q0 00 0 0S 0S0 R0 0 00 00 00 R UPR\@D|0QT 00T0T 0H000phkX8kp88x6848p'8804k! -LMHHc0 (0 0Q@ 00y@80S1 20 F1 08m800801P 180QڣO30 8\@@8@t10S d1 80 0S0`0808K 㒏0SS 1 0R0040 070K080K C<3K0S0PP0S3 W08#8#$0$$43[4#DHL+0$H 0X 0@8 ,0N (0SD( kkk3 89p684p5k909 0-PPL0#DHL40$H 0 $0 0hkk@9k -LM~KMapGP@+!@K 威-@ !0Kx6 K0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S p 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \zpkk9k p-LMP$P(P@`40S8`V@Zph p-LMPP @/Pfv/|`0 @T @T0PRv0 s0ph鷲k 19k -QLM`PhB0S00ڸ`00@r0S4B4~/P  =00A=2  = 0 =( R|=$ Rw=, R q=`@4 Q 0 8p!0!d`=`V@  0 @ v> 0F=  0 v>  01=  0 v>  0d=X"=hu\k 199:k:$:<:P:h: ,x::::; p- LM0Qq`P$0  Ō$ 0 0 $0000 d K@ y$K u$ Rpᫌ(K0 (0 h( d 0ypk -Pd 0L&@`6pS|06S _20 6h 060S 0P&00D0D  V $,$ hk;0;\nk 44 -MLM P, zp < 0BS8@<Kފ<0@pK@0 @G 00T`K0T0 S" DW 1 S@KHK0hPK0h0 S X< ( R h{$ R XvT` Pg D@ QN 40S0@L 18SGEEE0F8@4@1 0@冡940!1ZsNK@D0 @Di1804 04 1`1Z\H1X!UsNK@D @D8P 1 40!G0 04 R8@Z ZK'P  0\ 7`0V P7 {NK@D @D0h I  T,0 S@, T;`;p;^; ,k;;;8\;; -LM( 0R@40 ,0 00  S, $P N0 X I4 , K 04 (pK0!=0 ( $0  `40`V0 Z>70  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0k4k -LM60 @ 0$0 @ tp$`KP 0 0 $0 $4Q: 0( S6 (K(kk;< -LM60p 00@00f$@ p PP(p  (KKP00P@@TP D(@ $K $([kk$k<(<4< -L Mႊq`0P60S 0 6 f)P@0610=S 0`61SQ0&P 0AV2pᧅP@0z0(F0F0F0v0 61 p 0V;@ 80@4@@!061S @0@$S `S0Td : @ 0@0@6@ 0 rHkL<t<<< p-LMd`0P60S 0@60&010P61S 0 06pk-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@塿pT 0s |匘00pkH< -LM⁁@P4 8 0T 4 8`@USDSSDSDSDSDSDSDSDSDSDSpSSSpSDSSSSSSSSSSSSDSSSSSSSSSSSSpSDSDSSDSDSSSDSSSSSSDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS^@Th00pW 0< 084p啃000<=(= -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @8#H= 0-LM@P@ .R r0\00000S0S0 S0 S K%PP 08# -PLMpQi@Q0T1* Rr000000S  0RQ 0 ?FP`F0'S"S $S `S \S`F\000`F0@0T:V00K\=8#=L p-L M`Pܬp P 17p 0@eb_om PK0  ` 1Kႋp@0DST 0 p= J5k== p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< )P@ PKW 0s ? lD0Ppk (=$!k -LMp@B d(P@ K r 40R ,Rk ! > 0-LMP@K  @@%P񟗮8\]]]]]]]]h]]]l[L\h\\\\@]\]]]]]][\]t]\](][[[]]\T2c0D> -LM@$`Kp7 A?@0CSP ABAQ 0($UP# :R :P $p l0Ph  $妅 RPD$: X>>>> -LMPp`$K 0P P ڼ0p  PP@ 0$l$P @T T @` V  ,P ;P @ ,($ > ,> ?(? 0-LM@PKu 0P 0?Pg {P `b _0P] 0 r }R oO 0@?kh?? -LM@$`Kp? {P : 7PP` !㹄00 0 0 U 0sM }S _ X10SWP+ } $P!p, p(p$pp  pp4p@W TKS ;P N Kp@?k?@> -BML M4%0P KL @,0 8 5`P P@Pd 4pP4H{>P ZZڼH劑00S 0AS B0C2S@@A$ALA -LM0pS`P P0S P0S  (K0P(僂r}P@ ({( <U00@@,P00Z00SP;P   `A|A> -LM0p$0 8@K 0S" ;}`V 0@0lP00<K0`n,P ;P @g d $0S $$ Ak0>AA p-LMK&Pz PU0 0`@T(<P" 0S0 % 000@ ␀0D0S |@T\O  Z<0D@PU,0D0S ? x'pAkB0  0-LMT@T@ D1 0R00$!00@0c!S0"c1AP0S (0s 0 (00$K0 0$ 1K2Kៅ@-t 0#S 0S |1[ \00S (0s1[ 0S 800S (0 kk kBK0C 0C1 BS 1Su@T ,0SH, k8Gk,F\nh#lE,(6-tE6k0EEP0-H0@0 80840400,0 kp]kt]\k]kk -0 0CS00LӤ0_ ^00# P 0 000t0 00p PPQ8 00C 0000]\kt]k]p] p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00pt]p]8#kk\] 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000]k|]x]kkk] -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000]kkx]|]kk] -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0p`G]xG] -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0]8#]G] -pLPBo@P -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h ]8#] G] -LM$@" 0eP阒* --LM @0| $xp 0S \xT ΝH ʝ<0S ,,($'ahghctHHh! --Ll i0T T$LD yD080S Nx$ 㚝 㖝hghct --Ll C0T Tl$LD SD080S (x$ t phghct --Ll 0T TF$LD -D080S x$ N Jhghct -L`@P pR %R0mS4(0L J6p` PD"@`PT@D ń R00餽 --L 0-LM@K0 R 0{tjoPPP rt .@To00XX - LM  .0` p-L MP`K@CP ʤ0P 0P 0000 0000`ifp :03P [;P VSp%X> 0-LM@PKG\\ 0 D=:0F0,$,!$#, T0X -LMRQP@`M pW$,KW E0 S ,K`\ 0P YB\p, WW Y,Y -LM`-Q@TpP00S xR@ Rr100000S@0* @ `RW B @R7 B/R0 BhR0&&SX0 E0220CVT T !X  X X X U U U 0f0fipfiOiU U U `!iJi($8#LYxY\nWXHXtX -L0MPTpKNĂ@PcT_080 BP@WTS2< Pv>@ 0C<0 2/P@\H+P@`@@T<0@@0 /P@5 P@.T*0D0 P@#T0H0 :P@P@T 0L0 :P@pP@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @YYlYYZ4ZTZlZZZZD>x 0-LPcP@4 9m0S0mm P0[ p-RLMP@` 0S(0 p000p[ p-LM`@ 0 cgPPhx u 0 0bU *Ho!0#S 0S uc 'mph$m[<[X[ -Lp`P P@TPtTF;t 0S 0#S h9h[[[ -MLM$0KA ,0 `hQR Q Q d8 SKAA ld8 S:qX lPP "cPP0 l(KA Al K+B 0d(0Rp8:spP@ cP@ p(~ll>K0C0C`#8 'qd8! SD5;<#fKA A`t(d8!M@S:rtP bP t( GKA Bxd(0@R:q|xP bPT x( )KA A#|(d8@S:rv|Pp bPpk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rGab0P1(> (PUڈ< 8 o k kkP(1S>K0CkPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S , [C4[[[ 1 P-L`( 1ȁ 0@Qd 01 00PVq` Qxh!0 }PTP (@ 0O  Q0 Q@L00kP 0@0CS0@0 0X( 00CS0p@0 0B(< 0Rk lll\ ,\M\ -LMPjPpC 0@ S 0 S`ev 0S쀟쐟0 UPP (i k`0$0O` bPg@00'(' C 4\ lllD\\\M 0-DP@L,000 @@0 0 0 0o|md0 S- L 0S S 0SP S  k\\ p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  J\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  lmmD|mD`_ -`0` LRTLL0<SS,0 0Qڄ0dm`mm\\|m -LMܠPp@* W* 0 0S@@T0TbW`BPP l0 R   0劥P 0#T 0EE@o|mp`tm -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00TP 0@0CS0@0 $0h00CS0@0 0`00P @@0@Ыlm8#^\X ,\M|`hm -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 aW5 P %Q00!Q`uTş0 R`l00SP 0 0CS`0e0 |80"00CS0D0e!0 0 Pdt Q`l000SP 0$0C`$S0d0 =|00S? h@OX3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000~SP 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000ISP 0@"0Cp8"S08r0 0 l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000RP 0!0C@!S0A0 x4000CS0u`匐0 QP\00RP 0T0CSP0PP0z Lw0$`lmd`ohmm ,\M8`] -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00o\mpmlm Xm,  -43L M0 00,  R W,T P@` ;PpX آ 0S2SU0@` T QڐR2 Q@L000QP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S MP@` @@ lxP|0p p0VM@ T隂,@P0$ lm@'\M`] -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| P `1 @ RD1 0o(0 Q`l00MP 0`0CS0`0 0G 00CS0@000 SH@P@(lmtm ,\M`` ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 Rp00 PP 0P0 P lm_o -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000LP 0,"0C@$"S0B0 0V 00CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L0006LP 0 B0R@ q@0k ho0lY00CS0@8h0SL(@00Pi0Flm ooo ,\Mpm \m_ -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0`mmop` o, -LM " P2 P@" " q ğ0S   ?KěPW"R 20R2 84bPU$0S4 {N"0S \ 2 1    ?K啛P 3 `d 0Q,V,K 0S 2Pß0SH# HN030 AN\ 0 0%rŸ0 QP\00JP 0"0CP"S0R0 W0P00CS00B0 B0 0o࡟0 Up|00JP 0!0Cp!S0Uq0O L0]X00CS0$b"P U" 0S  M0 K9P0x 0uꬠ0 Up|000OJP 0d 0Cp\ S0Xp0 0" 0Mtmoota ,\M -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000IP 0t#0C@d#S0\C0 n*0(00CS0C0W0Ȃ T`l000IP 0"0C`"S0xb0 30w<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000kIP 0\!0CL!S0D0 0,00CS0x0 `@0 dQ T2, 0@TP(꘠ Q000,IP 0` 0CP S0H0 e0 oooo ,\M -LMؐԀdP`01 ^, p@PHP@ @q0@0 A0@0,A0 00(H@@\`X\M -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0S @AAA00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0Gdo|mh` XmXpm,4a -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@GT`Xo|mdh -LM@` 먃0#sP 1 0#ẀpP H0@*SHDEEEDEEEDEDEEEEEEEEEEEEEEEEEEEDEEDEEEEEEEE$E  0 1 "P00Pp2400X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY J`1 }1@D}Qq+L PP*K0S0E= 0 0!Kpp-ݝ0S?T%w  r!0S 0S  BKy1: S 0S 0S BK`x0: S.  0 0 `Tf HT <rZ\n4o0oW6 1 R,0  !0S |XzXPH4弟pK[P  0R1 !P 够p PQXOX哟p|原CX?X..x@0Sa  (D,$t4o 5$6BK@@+Y P#%^*,6 (UKJKL(@DL@D0.S 0.  0 l b<00\5   %|%000X%X5{p@,<50Xq4(K0SzK(pG5pGY 40XS4ğ 0X0Q000 0SڼOH$0s8400 _~PgU pKd$hL00P0-S0S(0 ="0 x#,P@0K040 pɗ0 0@<0@ 0@0S(R&SŤoˬ0000P(T '"P@'0 5#0P@ @0p列Y@dolsp!pppLoTo\oq(q M-LM01, 0p`S  o*00S P' !P@ '0 ",0 txp `0pS  0S P@P@0 ,0oY@sPqh!sTqstq - 0LM@ ܷ눽qh! -`QLMY0rSwS ?RPPU Xڣ00G 3P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` <H0090o`0wS  0  P  0 @X@H@L@P@T@q -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  ]VO`O'<T@H@P@L@ -LM 0K# AAQAAq 0S 000  b0 QŒ00 , P080!Q,000Slchoh -0L0Shho p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#phhoQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phl0%0 0X00L0 0T00P0ck -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b;(0,0000004PcUP!f ;`V 4f };(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 9+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K ?9+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  9/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 8+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  8/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#V64p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK6x0 00 6P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K p5U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K 4 G0B @T0D```Vx010 jk@mmq 0`m$1 -LY1 -L4M@P &v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&\jpH0@ 0S񟗇4@LXxdxlxxxxxxx```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0Y@ᝇ0S0 t,0 R0 X@ 4@ PL WmPP ``nP@ 30C SLl||H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ LE3P Dd`0S @0SD fZP Z 0S0SPQ TX 5P ZTX aC@0<; oQ l`X0SE <`X0SP 0!R00Ss C4K8 K0K3P0 #80@ 080 Y`V+ `000CSކ,K@ zP@Ն0S ,0 R D@ @ = P =@ C†"00;P< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@=ᜪ\nssss(sL8sTLs`s -LM0@Sp oPdP`^0   K. R W0g=s -L M0@S D^ 0 K R 0D=s -t0LPd0 R X0XP PP00L+-@0( 4P000(ss h!lssss p-LM` `P0@0@\  0S 0S 0S pz -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` %20S0 0 (P  !0S0 R0 0  0@ f2 000'P0S d0 ,0S \,ʩ0S 0QOR z8zDzy` -l2LM 40p\ ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8(,0 X0000000S0S0.P@0S0 ( 0 X@0@@@080   0 0S}zz`0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00z8z  -MLMp0P@AnK 0 `F`F W 0~'U0 Ug 0S l 咨@R#0S D 08: S0 N `z``` -L@!x0hFSP7 !0Q0 0 : S/FH` dGQ0 R TQ 0S 00g0hx##P ht (WXP 4hzp``Lz`y aa(a@a -LCM0`,$0 (@1A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , 0U 0SD0 R0 0  $0 S $ͧ 8zyDzHa 0-(P, L@ I1P  $0 0 S0 0008zy -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ X0S3 R 0 P, 0S 嬃뤃0S3 (K 3P\4 4 XT @T40 @TP 0@: S< 0,0"P,0 S ,>3 2@=PP 2 P2R( K"\$ XD @A08"HX2 R0S @BNK@D@D P@6 qd4 S00C0 {y !0@00 000py `… 0000S U0,s 0S!PY 0 PQ 0 QP@ d0SE قB< @0S: U7u!PD  `PaLzybzphaaaataz za(b0bDbtlbbb\a -T0L8M<0 0  8 @ 4 0K0 , ( $   @K$ -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,2EKI I0 0`$ @( K@X d 8 \ P`0@0 BNK@D@D 0$7P  @00@$;D+ zbܮ -LMd0`\,0 pP Qp PP 8 @(0S  0 ,0 S ,崥08#P0 0"(( ,00h0O2 < 00 QČh \2 0P1OP5:\:00=4 0SMOK,-00004 0S@,-4 00L0TS:4"00<28 S0,  0P1OP59:\5:004 0S ,f-  1 R |4"@@ | P8P0, ,P( 0h0QO 000Lh08#a 85@0 L0T 0-40 0L T: 85@0 L0w zyxbLzbb 0)-L1!1Q@@ p딡`0(40PS , 04L0TB:0000W2 (A 00CSP00 0S 0tP00p@{tPp@`u`0` 000`0 ``< ,0 4L T:8zzzzx -@LMT 00C0?h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 @00S00X 3 0t/1E $$pWR`P1 ,0S ,壣 0{"jP  p0S@`1]WO  0W"F^Pp@0 `( B0B!O0p3s00 S k X 08  ZD@ 0(@_R:0S:Ph0S z|ccccz -MLM0C\p#, 4 @(  P@Yx00480C48  < 400TPo t00\E" $`P@00 0t 0OQʝP 2Rb L <L(0 S8( @*>K0C0CH8 R( 4 Q @(8@pWT:<(0002 ,0S ,幢 ; X  0000@@`P(0@000|&pv&0td0,Kc,000 0 40O 404h0  T0 RH H60 Xu0 0PzzzzU @ztz8zy 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@S4 &\$0$  00C00 yztz -LM@P&zr0㘂嘒嘢,0 `00"J\pl N0@+S_$8888888888H88888888|8888888$8h88888888H!000  0b`u1  } 0 tc`hh1`!` P0m\>01 D@!T  `,0V04 @@w!T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , p뜠0 0P,0`U0@T UP@XKP 0 T `,0V00Ezz DR.000 0. $0`F0V$0@\ P0 S00*fP ,@ R0 0  0R 0S R0R0S P  0 R tPd <\0 S00Hō$<<? z0S 0 P00S 0 S s S $#i P #   00C0 "VP  000 00C0  SV;;S 7 T"9(K00MKA@AKK@ $@0 \4  X$ iBNK @D@D01 R" 0̠  A0S0?0?00 RP0 @`r0̠ L8{ 8  0 0` xPtPR jPfP 0:0 ) F zjjxy${sslzjjj(jDy{aLz aa{j\nj4jaiLjhj -ML08M (8Rp, (`  Q 8 Q753 575$\C0S 5P bW0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK P$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍0$0SX ,0 S ,,嶕00  & 5 R E0 S % 00}P%00C0 0S$ $\NK @D@D0@SS^K PE0$L0%B5 R qJP $\00$0S0 R$ 4 R4 R$ h,P x0: S0   4$00^$\OR$ 0.SHc00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 @@\+0SP $00$0P l"00C0x">KMK P8"4v00@P \ P !^0l!00S 0S 0D0gP>KMK Pe$00$0 1  0`0C0 崀t$/v@kP_ %l0S 0x04P\0 R\ 0SY <00M0 Dz zy\ k8zj,kzDkPk1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00Tzy1 H!X 4,(<(,$<HK ,0PKK K K!(K!40(K18K1T@8KAHK@HK K˟HK0 0 (K 0! 8 @˟0 S 3 S (K8 QHK@K0 $08KAK KP HK,0\K0CQK8KK1Ab KK e$5S8k(K!pK 8K0K $  K,(00@S0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !\L5KsHKɟAÄpX3L Ϡ0.0CS h T T T h K000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^$ ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0K f(KHKA8K$P @$(0K 8K1HK$A (K(K0(K0(0K HKKAP3P B P5 R9 K8K DK,0QKR$PPL5Ks8K0@P5 rP|,0 S ,܏(KjP K40PP0K(K8K PPHKAXğ0 S(K!KT0K0(SHK@TT08K 6P HKAh6P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK XDBQKK\0$2RKHK\0@8K P' HKA4P K0S(K K\00SHKA\08K RKK0?\0<000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1  zPzyl|bt|Dzzss @zz8n|y|||Pz}U (}<}zLzP}l}xz}hnK8K(K HK@T0\ S(K KT00TSHKA(KT08K @(K P0@@fK@000| ~(K!p0!SKKT000T  000| N@Pd0 D0` @PEV(K!0 SHKA2X0000000$%R8=(K!?l>1 @  KK 0h2RK`00 ?> 00c# 8cW!(K!0K"0#>PK1(KTHK 0AO K0@ P54C0SPPr 0S 8KpP0@@?|`N A@?$%ARP `A?AP=L0@Po4D P  ;T3$5SDD0S Pf0S`rP Kt4 $ X\0  0 00 --L h! p-PLM@P`l0l R  T D0 Rp808l 3< 0  /lSn --L  --L  -LM@h h^ --L 㽌 p-LtM/Pdn@TK KP0: S p0`rSo | 0-/L@EnPU+D0 00/00(++00sn -LUMpPKPP@lK80S(0: S  SU P U@P P@0 R000K@P h1: SD kc$^h Jnnn P-L P $ o -QLM@ 6P T $o -LⰻP $,o -^ML M/?@, @? ?_K A?A`PᄊP5: S d\PP "4P4/0S (? R|  0S> rk0Si .@>@.䮟@@@ @@n0 0j0S P\.,P(0t.t<00ePIXn0S >@T ,0 S $,͋--K B BP Pd5Tt5x%0%#,0102Pd5@T͟͟-= jd5Td `k\= R0  V,0S 0$$ p , -0 t'#Po70Cȟ5@"%$pWZ0S0<cQ0L\Qڨ0Qx -0@@0S X g+0S~ /Pz 0K QQ  000S pg+0S^ PZ  00H0cQ  000cH00+0S Vg0S>x P:  40L0cQ T  400cL00S  0S fd)0S P 0(<Q t <0(5 )0S t f0S2h vP.  hH080@_Q! L X H0S.0O 0S f(0S VP  |hL0@0@_Q 8 L0-0O$(0S xf 0Sl7P 8 pX0S0,%R0S0L%rX P0P@& @?|N A @A?$%0AR6 `pǏ `A0?A`=L00@WO$ ppP0@@?|PN A@ ?$%AR㰀 `A?A=`L00&0S f0StP  x00Q x 003x0%0S e0SP  t00#Q  p00#1t00S eL%0SP @0S D5 R @P `P3Sx 0pVP085"d@00PgS0$PP Ve 00 pW$00/>10@c4PF p4dDW4P@ M4P6 EPh4\& 0T$@PTP4 @00D00*0$S P @33    =h5P`"h 2a2  2 S2  2 4|"t000X@0S? #0 00L 0P5?T5 V>X5pP0@@?|PN A@?$%AR㰀 `A?A=`L0\!\1bP 0S j0 00,%0S><0(5 H0S.0O  L00O1ZP 000D5Sd000<5SD0  40 |yHztyzQH0S0O L0-0O00P0P0P0P0  0 0  0 0001@@((P  0<0[LPP 00Ml(tt!0xS|~0f 6i1Pzfr)ca ~f!cY vf -LM␢PpUŸ ?1Ph2hb :P@r: 0P\%42R, ,Q}ڴ Rڒ S0A Rh0 S0 0B RRq 40A0 Q?>QlbeLzsS -L$Mp`P@u Pa0@S p<3@  0@T , q30  00S, ,2W>C 0C0 00 00 R R2!"9"0P4P `8`0p0 0D` 0, (] |00@W $,000, 808 0, 1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! n0!S 3S >0j^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^PzzzzU @z00c0Q3@T TX0X  0S  R1 018ĠPwtw800CSP P P Q P P P P 0S0 #Q00 #LQ0 R0S800CStQ Q hQ Q hQ hQ hQ hQ 000 10B0  2 R0  00800CSR 0R R LR R R R R 000 10B0  2 R0  00800CSR R R R R R R R 0S1 S20#B1  0S 00 -LDM@PP ָ@ <宸ZP ( 尸 㦯PP fY sY !1 1 !<p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL  U  0P ,P 4` L H00$~<h!HH)`|lY L@W `W hg j -p-L M$`K 0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0Y000S0 --L Ѯٮ --L Ůͮ --L M((K0(K ʮ0 R  -LM@uԂ -LM   K 0KK p@pY娷 -LM @ \K0   KpLY儷0  -L -LM@@0S  h\n -LM@p$ ZpQ~H\ -LMM B~KpGnK0pG`F+`F(0 Y+UrPÏ,PP"KAA NK@D,X  4h 0X X,[|,`4 0X $[`L$BpDa008 \P6KAA \p@X0S' T 880S@YT 0S 0@T8800 |  SplyT(0 SH(| $ )|ăH[ llY  p-L$M+P`*4@K  P 0` ,` 4P  *10AS1 0K(0 $@ ` x(KhZd\ {p H<0! [P8K [p@ 'X0S  gpRT80[S [@YT80SS S 0 0R0<0 <KQ`!40LLL Dp )Ą(HЄlY @j d)\n0l0SKt00S0ڐ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0 :K0  0K l \bP OSO*  ,~O"  oIjKPt Ktp 6*KP|:A}K(pGpGLP`)   㛜P `V:JP @`吜0Sr0@0"0S P  T N0`Vj?0ZOӭ  AO˭  9!1ۻKA7rp !h1ͻp PNK@D@De/ K>K| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , ꈽ | |L8# }8h!Th|T| J؈(Dd|0D} L`X\d||t   || ؊}| $ < X}xx | |  <Y  ԋp  }0|L }ht ض|܌^KPEPE!0%BNKK@D@DP(!01KQP!P1*KQp  YP>K0C0C``y11 K00aΙ1P=@1!Ta徙2P xa嵙02P<a嫙P2P\"000pa囙2Pb咙2Pլ(b剙2PչLb候2Pհpbw2Pէbn3P՞be,3P8b\H3PTՌcSd3PcPb|0S @3#P >P NK0S h_.0AUwʤ> >pf  L h> d>R`.`pT $0 ,50(5P ( 1D= @ M^00 00 Rڨ R= =$ $RӜշڰ$Rӌղڈ000 0400 B`40AP HL0Q 0 R$:R8R0H0400cL0 H0S.0O L00O PP00Z0\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڜʠ Z`00`0| P80S0P5 00#1t0`+003x0@4|0d0 |Z;ʠ Zd00d0JT;\` 4@8@帊@Л0P4@8@@00" 8 000P|0@}8@@x000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ 00 )1 @@ ` TBP 0|00  0  X@ @ 0 H 0S S0$5P㸀 0P @@ ?|`N A @?$%ARp0`A?A@T0 S< R{`P0@@?|pN A@00$/>AQ@0P[`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ o0 腟 80080`00`0 80Sڴş4 00RK 80080 `00C`040040 |00|0l0 0 E0 PKOP? UpxP开 0Eo0 50 0ЄD5P0`x@!@@^Y l 80 Si  Vg  \Tb0$K<4@ ɐ00 000@80080 `00C`00 PP0@ @?|`N A @?$%ARp0` A?A@TLßPp @ PK0?PcxP0Eo0 [500 0000000 x@43!R@@ऀXPʸPB B0kKhKP帀PP2 @B 0 aP <3 RRR0S JK聟 @ @d0 R0dŸ  Dp@ PK0?PxxP0Eo0 5P0P10`x@!@@8@Tڴ00i 0p@PK 0?PP0 @?|pN A @?$%AR㰀` A?A@Th0 Sd` R`ڣ?/0 0 \4$|||| }|4L  d | Dp }VUUUܓ@L`}||8Pl||x ĕЕ Pd|   }} āu ||T|  ! t0(`P0@@?|pN A@00$/>AQ@0P`u?P0@ @ 0P0i0p圁PK0 P?xP0Eo0 50D@ 0|H0@ `|%P00 T DHR0S T0T p 0@TI0I0S0p P0@@?|PN A@?$%AR㰀 `A?A=`L0`d 0S2$0@$ |0P| $ Q0°0Pè Ű R>3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X3/ X#0|`0Pŕ V>T5 @T50 \X5 =L 0OOT0T$0 $]I0 X3$@t,@UP,00,0@`0xQe0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@BP > I0| 0 0 I ,00C,0`@@`@P4F 0|!$ d$010ҰPcUcP#u  R  G  YP@ {:  9 E6+$0| $ G@$P4u/ *0,0p`P4d/  0p Gd`Ÿ`0d |P  B 80lcrG80|00(8P@@d ]G0!XGh S|0` 2Q@500h0TXdh0 0Q 0hh9G0`40 SHH.G@!@)G8&G0S n=WrP T?/0 0 Wq0h0 ,5<0 kC0 00Ϡ΃4 `>d|ܗ<p | Ę}<x -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|v/`010Ch0 h000h0h0$%10l0 @0`|Y/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  P`0 0p Pe<@6Pp Ri  00050 80 Y0 (00(0%540( 0l ( 048@TPp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 80@4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠  P`0 0p PePT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU 0X@@@V 'X@@@ 0|/`01d0@]%밁U $ -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400LpFt|(| 0A -0`A VLP|`A@00000 0`VpcPBO ` p     -L M0 d@Π , ` t3 R @@T 0X3 _R`0@P08_ P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 P`0 0p PeP1 pRU 0400C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04X@@@ ?鰁U ؙ -LMp%Ql0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**(0 0 0$@ x`0d C0XKB$PE 0x 00 6)  밁U Dp -0LM`pQ  X0X07!h<0@ L 0PrP "B||| -0LM`\0p l0 P X0XN0P@P ,0007 h $|||| -8L0@S%D l 0 0S0 #Q00 L0 R0S  Ԛh! -8L0@S! 4 t P t t t 000 10B0  2 R0  00 h! -8L0@S! <  < < < 000 10B0  2 R0  00 寛h! -L M@H K0s4 A[TP @TP@ht@ -LMP@̿p1儑儡`px!pP@4 "P- 0`0``p0 PbUA40Sh0:aX0W 0 Rg\n؁ȁԁ$́L܁Ё -,bp0LS2 R 2 pRpW "PPs ء#P@c #0B SPx x x x \ x x   0t0S@ dP $ 0S P  N 0S R R 0 R P 2AP 0S@<0Si0S@ $P #W<0Sm# RȁԁЁ܁؁T -LpMP@T `KP 0 R Y<0S m@0S@: S! p0S : S 0 R !P @P 0S  P (0 R ܁ȁ؁́, -LM쁟0Q@(0 Pp`i 0: S (0 S (d` 0S   Up` K!p 1 S!3 PpE 8@ IP P ?0  0 \ ,P P0 K P Pv MKP  t @P܁ -LM@`P  .Vp@0V U@0 @PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S `P$0 S $$_4KC@s+[ Q003 Kp?@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU~ ,ԁ Ё\n|h!  p-LMP`P @6@P0/S+ /@P0.S P0S@p0S .S0S`V d 00 Q P0S0P,N   @@P0/S ܁ě -0L 嵘^눽h! -L0M0`@/W@d#P000LP<H0K L0 AT0 P0 ST  T巆P@@:p'0p0Pphd0DSat>PphPhp(=0 TLX,ضLTmLm @T`@t`@x 0-0@LP R% AR@ < & x"t00CS00  ä0 H< <0h< $ $A0h<\Ȝ!̜ -RLM@p 0S   <Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Riy 0 Rd \q 0Rl  R R0R_ 8@! -40L R(0$0$   \Xh!, -L␌<0 R4   0  ȃ - LN T -LT -LMhq0S \\PPL @!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0P 0;C 0 0d@d @ˠ$0K $ @~8ec\< t -0LS \|0H0  00S_\-\0S 8# p-LCM``GOK0PL  `80 Y 0S b\p ĝ|̝ -LM$@0 S A00|ԝ 0-D0L R 4410P@@T00|؝ 0-LBMdP0FOK\0 P 04 0S \0 ܝ p-LM`@,0  PUph p-BMLM`0<@KP0 B<0[ES FS AS f R0r S00x ;K⨂0 S X[pCNK@D@D 0<0[FS 0   ,| -$0LM K YP [ p-QLMP`@00H@ph0PE S U@00p8` -LM`Puဋᨋh!UpXq mP pP P@(@  !0AT3 T`7 A@P0/S Z  1P0S@!`P X: p`:  @@P0/S Q@  Z\ntضL -LpM`@pK{7@6 00RPPMYP0: SU/00 Ĕ X!60S U QP x60S  : J -0L |~Z눽h!x -\@LM80(0( 0锘 -LMp 7P( X  Q Qq00  R(  R00#R@@T;Rt 0P00 p  (0[P`@@(Ȉ0S 0H00S (S 0S(0 t0V0 S񟗩 T P D  x X @ (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;Sp( \{ jSa  ,[\(0\(   Q Qq00  R( 0\S  >(\(   Q Qq00  R( 0S: % D(0\(   Q Qq00  R( (0pS0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00p#( pi4ے( 0p_``[(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S *%(| (0 ( P(   Q Qq00  R( 0;S S ( `IQD>(*(YP( `4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( `d  Q Qq00  R( Z l 8#,@hР ܠPȡ 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ 0`@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 ?W  @L -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R APS0 00 ךP \00, 0 S0`B 0V, 0S`1\Q&Q\00 S SP" 4  0bp@, 0ꜘ \ -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A 㸃pP@P@(S S (0(8 0 S  XV;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 ᆅ0PU ( p 1 0tpdl00U0P0_( 8#8` p -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SPB@?T 000S0S   0S(0 S H(U8, 8#  -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,=U 0S S 8#L 0-LM0@9SP$0S$S /S { 0P@  00Dk 000 K \S@\x R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ǘ \)0pS S 8p0 0 0 S S008# p-PLM@P& `0a0CS 8 ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ( 8 ( ( ( ( ( ( | 000@Tp 0S0 C0S40 # 긘 - P LR` 2P R 01@pT 0S @Tm0@00` 00 QP Ĥ p-LM PR` 2P RT0 AT 0S @Tp0 (P0 0p -\pL`AT 0S<P U@`V0 Wܤ - rLMP@`!p?@H /P< x 1`1`^ 0<TS00 0AQ0S 0S |0ap;P/PP n@ضh!L!X -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha |P@  00@ 0Q 0#S0nS0@0 ֚P0 @0  | ͖d~d0P@ 0X 00ha.噌0 0<d! -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  pD0 :0S 00,K}0@ @C,  0)!刁000 00CS0 0Ӥ0,pXqHQ$Ԁ0S P R" 0pW ` 0@ ,0 S0 ,M)0Sˇ P)|yPJK(@DP@D *0}3\ 40 sᎼ0kꄘ !X! -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@)0SO ) \}0Rx0R P(p0\ CR #00AP 0 C0 b\ 00`0\ PJ.,`0R@tl)`vdAP sfL$ KP2[S<00Z!8#XĥPht@ -PLM؀`pP@) T 0 S R@D @00U00  0 5"P P &D <0S1ꐘL̥ -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   4000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@괘8# -LM@P P`p W00  0 0  W P0-L@P 0wS! sS @T0 p xP 0 0'؅0 d[{Sp ^P00'必 0Cb00 0-PLP @T000 0-LP=P@0 0R0 @@0!Hꜳ 0-SL@p  P`}P@4 U@@V@H hꜳP @\0000Q005 -L,MS @D ||#lp LP ?PPP4#0SA $G H L Q 0S 0S"0S WP0 "PPe2p D 2`b`" L@ G82@ ?$2$ ; 00 , G00 080 4 幈ˉmdtl$0 -pDaL MP44!ep dP ?P aPtP`` 0PX(PKxxP@ 0 00 q0w xP@p 0L 000S W0꠽ȶt$ p-LM0@SP P `K 05PP 0 RPPSp?̶ -PL@`p ep nP ?P lP`pP` zPPPP 0P FPp F0PpSܶ -L@啇pPPP0S?` d?P 0P gE0 SU0S VE 0 -tLPMB^p`L  0@ P @l0 @ P  -LM@pTP 0-S c@#|dp lP ?PsPYxPpP7?`W00S!0(R00S ^l!?Xd R $@KaP $0ASA2 A$ R20S`?1S2 R hBxR` R PdBd`VZX??0D,0  P5?BQc U`, (` ,pKPB0 R,0 P$PV`U ,@0!@eWpp@R 0%S# $K/aP $p`HP`AT D| >>DP  0p00  00S& @wPp6 P`7dKP`2 ,<0gfffA 8# 0-@0PTL 0Qic@@0о0 -XRLMP"@dc?P 0A`V PU / 0S {0S >1 LPl 0S0@  $0 S  1SqQ0S 1R0Sl= @P@!c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00R0@ ;0 QE Kˀ0P@@ RV  0 㵀 @, 0嵂0=(̷о 0( -PL@p` bp lP ?PmPp`t 0P0 PP =00P0 0PPSD0fP p-0LM` P@|b?P 0AT K0-3\0 S0 1 !0l p$.=p)=ظ -LM0@P,0 #Gbp ?P SPP,0 S ,@3 AT #0 P 00LS!00LS0B \L <p\ p]  Qf` ᖄXIP@PR  Q8 劄P3 0X0C SxM L L L L L L L L L L L L L L M L L L L L L L M L L pM L L M L M M PI PQP'SP0-V +V ,Q@ DP \ \ =V1h0l1P 0a0CSN N N N N N N N N N N N N N N N N N N N N Ispmk@hXpVU @@K`Pp 0 0=00 b200P B\,0000D<ڸ<3  (04< p-(QLM !@8a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpGy P;P< (;pnyp0 0-PLM @`?P 0PPKPK@P 0@0 SR R 0 -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKH=PX Ln;sP uP`PX  L K<PX L <X;0T0 0P0 0!R40*X;$Xd?@P` 00X!PT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHKk[pP800c R8Ka[`Y U u P2 P$ R Xǰ P PX2 RP0\U00Su US 0"0  40VG 0S 009|0`71 R,4 }P# 0S$eT0S Xu XuX:<\00 000D8D<e  0d U0S4V  V 00S`FV 0V0 R hfPF\`0  @0 < Y@0p0H0 D 4:860X@ 0-lPLh @h_0?S L0M0< 1 00S(0( 0hW00T p-ALM!PB_?P4 0P@ P 0SPU @Zp: _:sP``V 0-S PpsP@P Dt0S,9p0S`PH\ p-ALM P^?P`p0AT K:\P 0 ! 0 rR @0S PXWa@P00`h0 R 00C8S` RV 0  z9T p-@AL M8!P^?P`E 0AT00  K \P: Q40 R 08SS#  R 08SQ 0S 000 0 at890bPW L0-9pQ 0`0029pl p-LM 0S@`)p KZP'0S !0P@PB OY0S0eC10C0@0S0$0 R0pp0 -LM`p ^p fP ?PvPpp 0AT W CzP0 [ Q~@T 8)P@ -LM\` PW  u`ONFd`@ePX OD%BddW_N( FVe $P @e霹h\nĸ -LPM@lPK`ᄀzdK 0hp 0i 0 0鸼|t -LM`SK@P lKJKG0S@ #3````0SS?KS?K0C0C0`|#S?K0C`VK@K(QK%m 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@l9bhX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C $?BtĹйع -LM]  -D0D L0\0 P E  P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 500H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0U$ -L -L -LZ 00 -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0St8# -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0*8# p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0T  -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P008# -hP@L` P Lp0T*0V  0S 0T*0V  - PLM@ pH 0 0  R ^T@?hh8#H -D0D 0L0Q0 P`0Tv -D0D 0L0S0 P0<^ -p0 @L 5`P00Cs0 U0 T o @R 00Cs0(0oP@, 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00 - L 0    -$0L; p -0L?( -0L6ľ - 0L0@* - 0L0 -D0L R80000 ,00@(Xľ -0P LU:0` pUh0P0@  `n p0 儴` `0. 0Rh?$ (ľ-000 0 0 bL1C 00NXľ 000 0Q 0 R L -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$v*U 00eU@     ,<L -pQL@@0 @dT` :%PP 0@DT*d0 XD0@帳@0@^S@D} (ľ 0- L^RP@ r6P00d0ᘳ RP0 -p0xP @L@b\`00YD0 <0 40,0 !$ -0L, -0L# -L -lpLMP\r\`  P0 0Rs 4"42@PTƯ 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 008#ؘ٘ P0-L@P T Z$|0 0h S`0 ! XT0hH$H0<B$40 ;$,0< -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lH#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P WjP XC@, < ,Pd00@TTPUX~WT$ ",<04 p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPUnP@ DjP80  p,xjP ,t0$0@-?>,1@LQ 004, -LM@Q  Q Q Q Q$ h0 $ p-LMP` R @0@0R@PcPbV6@pt$ -L0Qh0 <$ - LM0 0 p` P0@@cP0 PPRt 00p 0L0L H0@ @0@p`E<T T -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @T$0̮$0P 0S@@TPph(  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 MB0S0,0KpC-P00T0S`T XU U 04 -P00  0R/S \P(0.00( , PF( -\0\X0X T0L0 L08\000 5 h 0 -T L0LS00P0 S  0S0 p- P PP0PLM`0 0@R 0 R R00CRphp0DS T ̽ T ̽ ̽ T 00C000 p-LM@,`PP 0S 0U p 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P8# -LMPp0` ` K"`@T 0 0@0@ )T i` p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@\@pP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S 2PľULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs05000 r0 0  R Q D8#d" -LMtQlh0h @ PT *Tp0Q`LTP*0U@00  -tt`0@0LpB2@@PPm+ P4p0mMX -LM0@S`p P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` ~ $ (  p-L Ml`0P0@V0 $K 0 $0 9$ K 0B #1P P|p p-L M`0@0P3 0$K0 $ $ K 0B C1<@ S@  @ Pp -PL`M@ ` `   /0S 0S0S @0  00 , 00p(0p 80 4 P@ Lp p p p  `K 800c R8KB>PW񟗩 h d @ h ` V񟗜 X h P x x p `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , p004 080 PL=@` DA yA0@0@0@0T * 00 ᣪ  < @`DA XA0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh\  0 \  \ \ 0 0 `   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ]P 0 UPuX p=40UzOP  @0T*  0@8@` DA MA0@0@hb0`0  `   $00(   0 S 8  b R8Kw<P00 0S )00 HKPp c  000  $00(   0S 8  b R8KC<P00 0S )006 0 | dK@K 0xc000 A^0@S 8  b R8K<0P00S00  00@0 Qc KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S- $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $ 0 00 ?00A `@0  (CXUl4,p2Z C0  0A 0  00#0CSO@ @ 00)  000p 40Po]  H R000 0p 40P""@ 0 ]J]0p00 0 40@U  d  Xq 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D lD3[Sp<0D\F `A 6F`pN 40 U B GH0`VH0 `Pク ,M 0\n@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lY@-X=X ?X @4R44@T0@@Z0=X[/aP 0@S*S0]S =X Z[@00  #0HS 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2/ 0,0 0 4 WbZP 0/Z40 0`CA 2020@S@@H^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 t[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[y`P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080 Z0`P`ݥ@aYL0 0`S`Z Z 0  -`1LM`p+@Q``@NP`@ 0S $Kn $A@4P P   僴2@#00@0 R0PU 0S 00S 00` AP@P,0 UX8TX -L@P_@%Tp? #T U@` :P`T`T TU@ :P@T0e  m+8P@:p`p p:P`DT*P@: c:P@DT* p-LM 0CP`CA)P @0T *00 TpX0 @`DA A0@@0@`AdphC<  -0LMpH`C 0 0 R^ D 0`@VL@Q D0@ 0J 0!RPU7 ,0S 6 R /XP0H, , 00CS p p ,4 0044 |6 I/, 0@3,0 R,0 R @ ,0N00 ~040 0,0 0-PQH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00⅊P@> @48|$,,#0< <00, 0< S 0DS X X h h 44 4 c/ 0\/a,0 , 00, 000,,0 6P,00 3@  00 0@(M, 0T F,0  ,0 R  : ,0M.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0TS:SQeR$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` i0S00p000 PU  , ,0S,P |10,@TpоL0de c $0 t p-LMP`PQP@ 0ST 0S`@0 0@L0 $ 0 0@0 0-L@F 0FPP$ 0h 5ꔾ -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`HF  @0;` 000W IM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p锾 -LM`pE2/.VPP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(.0 00 OP2P 0 PQ000Y @ @ Q0000 $F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 kP 00000 0 PP 0`GOYPX0P 0 c0 E@R00$ p-L M PK`pFFP@  V 0 /R 0(00 0p騾$ -LpMPK`@PpP@U WV 0Sp : S  S pp@Ip -SLM0@< /0UP < P  ᙚH1  000 , ;00PT080 4 4 :4@TpW7 `eW 80 0c S8Kڎ-@ @ /0080  cR8KP|-@  <4 zP 0SPU4,64`,  Gp -x0tp00lL @`0PPy60D02 @L70000ؽl -LM0X pP `ጣ $ Q uPP0: S}$a{ ayI}ar0-S 0 K@ P`0Vl<0K I0  0S` `MrN8 @ <0KI P^ 40c T %)d  -0LMP8 ,0 < p AF/ @ 040 4 RO  z, ,0SG1 0 ,*★P@3<0S48 810Q8008 P  10  498*45p ,,寧I@0 U 0 |04 *,坧I4@ \P0P  L< 40S 4r5(3 X, %)Dd 0-0LSP@ @1SQLM0S9LMt lh(PHLM R 5P00P00S1006<L 0-LMP@ 0/80 -LMpPP`@ 20V`SP U@P0?Bc P@,, (0K(p $` @ 1gfff -LM@ 07餽 -LMp`PP@ 0UPS` 00 p-L M8a0@0 PR Q0 S Fp0S 2 0AR  SR $K0S 0 0dPU000PKP*00 R^:QP RP 00 RPP R H -LM0\ R@A 0 T  MЍM0L  0-L MP  04K@4 0@ (000 -L$M@L H 80KD , <@ 0@ ~(1P@ 0 R050( T+,0S&HK@0(S HKpHK@0(SL 0  8 [LMi(OL, LL'0@0 4  (HK  -LM0@00Q3   ( 4 @  &0BS     0 0z 'x0 L`0K 0 K0K < 4 , $  \ 8 -QL MP L@!0DTS.T, #T T&0DS``Q 0`T P 0`G 0`$S$ ; *!T 0`0 "T T 00c 0 0S00 A0 @`pDWX$01 RT,`  `0D S40 TT T 00DTST W!       0   @ P `      ( @      0 @ P ` p  0 4  R,  0   ,L`@0DSp`"01 R Y, LT  0R 0R 0 0R 0R 0R 0R 0Rô 0S 00 00n 0 S 0 S 00C 0 0S 00 00V R 0 S R &  0x 0ct 0p 0"l 0h 0pSpW 0 0 0W 0`0C 00%S %W 00 0 W`\  C 0S 0S0 0( ,  `\lx -LMPXp@ t00  RPTP(0 00+  @0 [T 0S 040&00PA ` (`+IPPl!7 P 4 _T 00#T0S @_T0 000#T0SA PE `'`{0<000 ` KP ⫿'0 0`V T  0`V )00 ,0 3P,0VP8#8\ -LM`p@FT 0 0@ 00C 0 00P@   4KX @ J -0LS  0 0!   0! Z\ -LM4@ ?0000  -0LS@ P0 R  pJ0S0e@050bI0 050`  -8LM$ `Rᬀ `ᰀ pᴀ 帀 开 r ا'+p{ 00ACS& & & & & & & & & & 8% 8% 8% 8% 8% ' 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% 8% t& 8% ' 8% 8% 8% 8% ' 8% $' 8% 8% 8% 4' & P>NPpᬓ|6@  & `C P3PPP  RP  (<   000 |0WaB YX@00 P 0S R P0S R  Pp  0H0S0 `=MPP 42&00cP@@X 00P0 P S R  Y PP R Y Z 0 S P Y? pR p W00W030"#P``S( 弃0 gA!B2@ QMP\ d0xx 2@ d2 RpGp W00W030"S /2F/pP`U pR p W00W030"Sc/pY G UHRX@"P@  0B.PP= K P`0 2 (00 20@ d 0Pڨ@ 0dSʤ00c0l SKچ%@ ;/00`+i$B x+/djBL $-2 RpGp W00W030"SRB Y "Y  0S  S0 0 R000Pľ<,X0Pl -`LVP |p ULP@  0S@00 T 0P0DP@!@P<X -QLM@< @0 W ᾑD <廑\1  000 , ^00p0@80 4 z`g0PP 0*8K @\0S 800c Sڬ$@D0 @p'< #@Z+}80`P cR8K$@P  4, `.r0S$ p-LMPK`@&P* P1 000c0 P*U OppPU )pVP pp0dP?SX0 b@@0@ vP 0pPľ( -H0H 0 SL4:QSC ľ( -,0,  LQľ( p-h0LM`@ XPRT`: 0DRC 0宻00C0 p(ľP$0DD0D  0aC1P  / 00 ľ(D -LMЀpPQ@Pl`ᑐEQT00? @AT, :0TZ,  o/P 0 AT:0T00cC>P (ľ -X0LMP 0 cBA- P0 P @ P  ľ( P-Lx@0lpPh 0af0lCQT a8 1@0:PȾ(ľ$ p-0LM @R! 0S`0PSpphpX0XPPH08 <0 B PPJPpLH<P@$(ľ -LM8@04S} $0}/ 区0 @ ($Ⱦľ0 -LP@" `5JP000 RTpP@01Q*`P嘺010CQ*00 010CQ:$<ľ(Ⱦ -1L M R!001CDP r"-P@ QP^\ 0y`aPG : 0Ip@ 0S 塴0SQ(pA60 P SPᇴ0 h Bx 0xpP o|0LPH$ <@ȾAq  RD9 h9 |9 9 9 9 0S Aq 0S     -GML M,q,1IKL 0 $ 4 @HPP" P 쀟BnK`F0 .-BP@ 2P$ 4P ᡝa$0 S h$*\0IKAP$ቝ Ⱦ̾H<@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER ; < t< < < < 0S  U@PE0S0 0Q : 0FS   `` `0 l0 h0 d0 `pľ( p-d0LM\@00cC1@QP 0`Qa0(S pľ($ -LMl`4 0 wDP@P+ n0 8 p`ˍp`  0䠟S8   400C0W000 ` @F̠F00K FD00K/K.K-@K,`K4屍 4 0Ww@00匌<@P -LM@倌}00< - L ٲP --LMT0T @0S4*po - ,ꈾT --,@L^ |- r,{* --LM0 @0 Sg*0 |0 R   h0  20L0L 4R$ H- >,-ꈾTl0ؽS --L@<<, ,--$ #,,*T$ P0-L@ 0P PP |0x-S ,T T@Q R 0<S08, 000PbGP XpS8 --,0L \,)T --00L R   ,ꈾD -LpM|KPt0: S  -H@LM |(0 x(0@D s( 0 鸼T 0-LPSP@00 S U\ - PLM @ ӖЖP@r0 S \ P0-@L@P UT  0h(0`) -L M@K {P0P0 R | -LM@h p-LMPq 1@ 0 00S  R pP0S T00ppho0`@`P 0%0P00S %10P00S00P00S T 4 P0000ppT08#0       -LM,@0SP 哚00  -LM4@ P0SR 00  -LM$@0SP o00 $0 0PQ 00  P0-Lp@ h@0S 0SPL000,PPD00P>00  -0LM`0V`PB@@pP,@d  0Pp +HP '$0  00\̾ -1QL@P` @Z0Ǡ) v8Vpp 0S00 &0 S 0S `P@†0 0 0V8@TZ0S40 Rh=hipp$d 0xD -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S00i;@Q0v㤆 0S S0 0S 0S0R`P 0SP ƆÆ\̾0, -LMRQ$ 0"Sxrxb@ hrhb@ 7@TZ 0S i= 0# @TZ7;=0QS 1 R R @qa@ 7@TZ0S aA0S P6P `1 00P P8ir0W: 0 M: 00~}0P0S  T7@c R0R *:t l00 :P b000|D, -L Mp4 0  x, Ko` LDP @$0``0($00:PƮP@ 0#SUP3 RTPPU @0S @Q 0@0 83 RT  40S '30030 4:U35C ,K 㑇    8 000  0S  )0`V  )`V ;(D&" K,K ^0S  @b@R@ s6@TZ0S@ @2!@@@ @@O<50T 0S K6 G6_QyP@  NᷗVL1f81 K(1 ` A 0,  0(  00008 P0P 0`` |m,K Նh`X@0| <DDTl\0P̾x  -LM@K @㯆8 R 㧆000"` 0-LMPK 㕆x0p\ 0d 0 P  ゆ}0 @z0` -L M$`K@  fpTpP, (KP 0PS  @ LT0d0 C =( R p0!h`0\ @0 0S \ 0S\̾0\ -L M$pK` P(KP@$  R 0S P 7 hNUU  ޅ(0! 80 -L M, KDɅ0K PPP 0S X0@ pT `0ŸS0``pS" @T~$W0 0qX 0SB0S  z0S pB h[PW00H0 U00 0S X 2 R0">0,K j gP1X`A00 R  0S AQ P ,K HO7 X F7 0,1!呚0  ,K(.70 h 0 } y0< s}9K,K lc,K T00 !H|d0X|0 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@\̾0,\n(08@ 0-LMPK@ ᛄ80@0S 0@S ㎄0\ -L M,K`PD p}V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  A 9000!(@\0 -LM pK` @T P0S 0@  00CS0<0@T@T 0 H@T0" \0 -LM@K 800 \000ڃ 0dh -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$dlph\h00 000S  0S$4 0S000=t̾ -LMP00좟000 SQr`p0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? "{ 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  @m 0  <8m40 `P0h;0l`0P@j 0`00@0000@00Za Q_M0|$ -LM^0` V 2 0S{ `VpK뼠K  PPhڸpK`V 0@T 0S @T`VH 㰂V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H n00 0S0 0SS0000000 \̾?Bt p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$ph 0xdl  -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@Si k k l lK@ \=V 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,4"0 SVt  V  PU 0S0 S t\h10y"x 0P@LDTn"l0[S (!T100l Kx` a" \" p0V"V 0SlK~ lK@ S"{0l0Kx @VT0 SS 02f 0lK2a R4P x X'" \DPX"`p -8#0L` %^0?Sam pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn pn m pn pn pn pn pn m pn n pn pn 0n 0n 0n 0n 0n 0n 0n 0n 0n 0n pn pn pn pn pn n 2P Z0010S P 1 @T 0S @Tᵁp1@PT 0 PX@TX Z 001@T 0PU p`P XPU@TZ 00Q00p @T 40S 0S @T@T 0S S @TZ0\ -p LP00 X R 0S R 0SRlꄚ\$ -L,,0@ S00 ҫ ꈚ$0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00\̾l`d- RR  RRR00Q00Q <R 0S  R 0S \ p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 6|20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RK?p Vt Lw ~  \ Ѕ , ̉ < = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 KBP; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKjp P\P ʟ 0S  00   00X    20c RKAp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKhpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 00)7P )K P 0@S " b RKp  00 R<4➨n0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x?)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`|q0FSGLAz@T *Xl (Q d|X0A0EA0US2 " / AE '2`A2&  b'P@ 0 0S 0S <0S 0( @ 0, <0喧 ` X08#($X` (AE #'P@  P0R }R\ h 300T*X 0S0 0 0U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x(l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S ̆ ̆ Ԇ (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P aOy000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:괾 -LM 0, !B0001 < 40 0 408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K\ @P`S UU( P\P 0P 0R0 P U<K U$ <  b R6 @P<00c R- @P8 0 08 @@0 `̤0 00C00,됚X --hLM 00CS0< 00CS0$@@ QX p-LM@@`y0DSp0P B    $ < (`8 , 0 4 p<408`^400, p-LM0`!0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  tX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 ta0,Xܽ 0-0LPp@ P0@0( -0@L MTP@ T F,X-0A,S- 0, 000 H d@TP0H , S 0 0ܽ,0 -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 n~wXPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄ꘙ ̙ \ ě  , D T h  X | ȝ ܝ  h B^KPEpPE0K,0A+K0+0Bv`XP@p86B^K PE0PE0&P5p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%,5pl"lRB^KPEPEl%0l"lEB^KPEPE<%`} 1 P00{RPPU B^KPEPE0$4~KpGpG+0}0PPl"lB^KPEPE0 }0@p}B^KPEPElv"lB^KPEPE0$B^KPEPE +0w~*+tB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDlD"lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPE.0P0p0"3B^KPEPE0)|P sP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl!lrB^KPEPE "B^KPEPEo 60P  10P B^KPE@PE+00 )*@)*u`90P l)*10P B^KPE~0KKpPE,0L+A$)* P0/S)*B^KPE0PE 0B^KPEPE0 30 S Sh8`8  p S \Sd80#pd8 h Y`00`8  4X8\0@DTH| Tp@4 J` 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV( ̠ <  ( L #U` 00``` 00c R&@P000  V[U(K8P/ P(0PS  b R0@00S(x0ğP\P L0 R0P0 P0 `Xh -1LM  0((0 $ _(0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `FV00X p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0ꌚX p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00p鐚X 0-8 P0@0L 㨞 @=00 -LM0@=C0 0 ʞ] -LtM 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@ꨚt0ᬚ 0-LpMP0@S|0lS`p0 TK  FP|0: S\0 0 00SQꘚ$ -LMp@:``KPP :-`PP%-P@ 0T\S T 00U0L0 R T?-@.s D;qꔚ$0 P0-L@ P@(T T0$ p-LtM@PH㴝08`KP0: S`0 0 0p$ 0-L@D' P(,0P0h+,|< -LM0S < " 00QOK0(dG/r00 K\(h@&&#&]   @ 0@S P@1PSg@0S P@1PSHgH7 0啀P,&( +(000-Pw'00  =6 ! P PP @0 @*0SƟ@P0PP |@*p"lk&`|'0@/SP< P @60S,06T  'Fp@R&:(N& '0US ?pUe%5Q00:&0@ 0S o0PP PD5P` ` PP,0S"P@T $@@$5p 0= oZPK;P2: St 0`@S@` 0XDSg$$02 e0L0  D$P0``P 0SK 0S8@T 0/%&| R$P PUY00 0Sp3  (00%&P  0X 0@T<D 0$u 0S YPw @$@$  $ 0 00 k$2op00  P P 0m 0X1\1pSP00] 1SPGh@=oTW&#+P  &0S 0S0S p!0SmKPKP!$2R! 2RTx+Pu pPptp0 @h+Pd@\ႛP ~PKD0`!  ;p$t|0H, ,̾PX| 8@,<D(xXhx\$T -TL$  @0 <0R4S0 h*%0~|4 -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1\P@. ,P,0 00S X00 4 0 0DSꌴ Ĵ Ĵ 1D R&0 R  @0S 0 @000 <00P8, ,0H 8 ,@ ,%,0@ L00S 00 40T -,0LM@ @@h -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2]\P@) 0@S񟗙꼶 <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  T$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 A>,LGy@  0 ` ,0XT P0-L@ 0S PP0 R @P 0S й й й й й [T 000%0S TT 0 -P`LpGlP@pPT P00 Q @ -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  hj`V#0 R!0 P0@CTT WU@ ah0 P\ }0P$ 0T, p-LMl`PU \ @0 @R#} T 0 0PU 00p -(0LM@T @T -,@LM0 01h驘 P0-L@ (P 0R @T0̾ -LM/@P@rV(P0 0P0H -LM0P0@cSZ bSZ { `K Ƒ 0pR R ṑ  0R `V  $40"WĂ d,(0 ("4S `P鴿 ?(D` 0-L@PP0雿 P%- X 00Q0000Q0  Q -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hP,8@DLP -H`0DpL0f@Pi00fiP@Ěd p-PLM`0P m@ᮗ@P p'0p 0Q0-@PL0 00h^0 p-LM0`S0 00@ 0PᙗPf0P00p p-LM<`P@1S@$TpH'Pp, 0-LM@4P,,P$ 0 00|t| -PLNMP! p0PH1 `AT P$UHR?K o{lQ?K-KAQH1`PH TP@<`0S 1<SP$U(,p 0 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0 0, -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`A @K$ j~P0 P_V 0000`QR r0̾, -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  goU<PP@ 2 V 21   N<"V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S G$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( p%jl@0* Pg%jLT@0@S 00$T000Ě,0̷ 4 0-LM@P K0 S  P00 Q0 Sp 0 0-L@PP 0V -LDM耟0QP`@$0 P$0 S $j0pjUP!P0dP@UdpK  %P40p 0e  -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |$P X pX Y X R0!S@ R0]S@p -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  #P``Fvp1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P" 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh G"Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?(00P000:S00P 0T HD0L0-SX^U0 00 \n$ 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0h`4\PYP0j -LMh4 4  , 00 @姑4q8 cPPP@cTX` U`V`P40cscp0S0W<0 ^ ~,@\8   00@T pWP8o频, 4 0, T < 0 -QLM@ OPp `PP*PU e*0S O0S0@e PdUp:0h0 -L`p 8PPZ 0#S|0@Pu@ -LM @pP 00 pP00 p-@LMTP` TP pU +fP0  P000[Ő` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ \d 0 SP/R/00040 e @0 bRP Dd8 R00 4e0 cR@P ,-d,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` 'eP0 Ulp cT X0T L0hPЏ0P@@ꐾ$ -LM@d|0     圏00 K 0  P 0P/0000 ` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /%P`dU VO V> 0/ c 0 0c RPBNK ` P@D7c@D` `P0`(K P/R P PP X@,0 S ,鑶0S 0.S0.S U0u/S U0.S^d`0/S  -LM@p|0`00 0,0< (p0P TP@20 P00S 0`` S`` og npsW@, -PLM`lp@82 T& V`0 0,0$ (` p ` P Wnꘀ[⊎x0\₎00@0P  p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA ˀA000 000P00T 0 $( -0Q0L0 7(0 0 0$(0S  0S R   -PpL]@T`01@T 1?A1cX0P`+ @ Tm|QU 0   @ Tm0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5TP0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0U@000 P@ 00 S00C0PP 00 0000CS 0 0P0 000CS0i p-LM0P~0`P@ 0T S0 0 R@0P@fDA %01p ! -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< o<0% 80P0 ) $ p-LMgD`0@TP _PpPP 00@ P -LM0!0Pp@ `0P W "P  TP`V @Z 1PPP TPT P K#P PP0 p-0LMR@`\0 @ P0  0S800 0S`p0 R(ꌾ4 0S 0 0 R CZT 0S R 0S 0  R Q CZ p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0d - p WL` 0S XX P< 0@] XX@0  p 00< ~0  @ 0 *T$ p-p0LMd `0`@` P0` 0S 0SPU @Zpꄾ 0-8@L P0#0 @ PUZ0b 0-@ LPP.0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000}$% 0 0-\@P0L  0 S 0P 0 0S  -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 P`( K0P(0 S  00 00% , 0- @ PLt 0 0 S x, `, |, , 0  000 000000   -LMp`XP 8C80C S?L- . . . / / 8/ L/ / @0 \0 <1 0 0 <1 1 1 2 ,2 \2 h2 p2 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S ) 0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\  P 00DS 3 04 P4 X4 h4 p4 T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P \4`x-dhptx| `0-0L@P^$,@0h'S^$!? -LP`p@ T5 5 5 5 ,6 6 6 6 6 7 7 ,7 W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S9 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 9 7 7 7 9 9 9 7 7 7 7 7 7 7 7 7 7 7 7 7 7 8 : 7 7 7 7 7 7 7 7 7 7 7 7 7 7 9 7 : p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G ^y p 0 S P 00P @0S`Ey@PP200P @0S`1y@PP00 P0 00000SP p-LM`P@ex phL p-LM@`P0 S< < < < < X< X< < < < = = 0S Td p@P0SVU@ PEP0TVU S 0-L0MDPK@ B 0 P= = = = = L= L= H> > > > = 0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjBx0@S P9x`00 R 0S0S1SP01^  p-PLM`P5 P0P 0@S 7xP1xP 0@S 'x0S x P phxxp p-LM`@PT P 0S 0Sw0S@pwww -LMLapP[00,Q, pm=P@, ]WPP VWP XWi[5% g[00x [@@מT QF5PpA5P@ iDS  -LM@0S[00 p-LM`P:w0 0P$w0@0S000 L000 D@H@ 0 L 0Pph -pL `L0P0A@TJ0S 0 @TZ 0 (Hvh+wj  vо p-LMd`dd n0PSpAW ,P1 S0 0ld$ -LM@pP` 0[S 0S@┐ 00  @ҟPv g  p,K0,  R* vU -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  H10 R 1! L0R'G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G 1 P 0?00 00<0 0@ PpL0PS !0[pS 000*P0<0(p!0[S(壽D,T -LM@0, K%K@p`@00  Q ! 000 TP 0@L@T " P  0 00  0000%0[S 000P0<0,TP\D -L0M\0 p(0 N@a<    0`7 (!(1+`K @ 0O#ODP0U0f PG00f GP@ U 0 UBa1#  f0E  f00f 0S-00f  \`(0 S @(40]} gfff -LMK @p ˼ p-LM@,50 R00SP`@B : 0Q(*u0 V0   0 00 0p 0 00` J 0V0 H 0 0㩲P  㑼T pl@ 0-@0pPL  0 000hI80/    ~0D -L@ P`rM    RG  0 !@Up0 00SB Q/ \Q\-Qp% #Q, 0 % q0  0  R0Aq0 0  RWAq0 0  R7AQ00?$QW@d@T00S$T@` R XRxR00  0R `00S _8# 0-0LM @KrpPh  0 R  R0P  00 t0 -L M`@I0P  0S082sp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @u00S  G8#T`d" -LM0p hH` eH0P00 s@ F@=  0 0c0 FZ o/s -LMP, 00 AP` 0[S =S `@3 R  %0U p[0  , RV0 xᏺV h3r,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   _0S0 ?S 0S ) I DP 4  00 00400Z  hr dr ONDP PIP ,0h  Y`@P  @QL@00  Q 0 峹0@|(d - L`p%60W00S PU 0@PqU 00WD0<0 0h> q q ! -PLM@ 0T0   R0 0Q [R P@-0S00 0\00 Q\0[S 0S0 [S ]SQ -LM@P0 0S00 -LM@P  0S 0=S   -1L M 2q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 "q0@` DA qA@,@ 0 4  xL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Y0<0  0 RD -LM@8 $P 0 d -LM@$ P hd -LM@@P:^ H^ ^ ^ ^ d^ ^ ^ ^ ^ ^ ^ ^ ^ ^ 0<00<00 b0 <00 <00S CA0T <00< <040 0<0pоȾt p-LtMPy@P t_ _ _ ` 4` D` T` p` ` ` ` ` ` a $a Da a BPt^00dpXMpp@ 42 p0<0d@ "@`@0<0p0<0y}pyp0<00<08C!0<0ܴ]pYyp<B0 ! P 0Ӫ0p p0  0 S0`P50@/S%NPKΌP0: S`pLo000<0yD0 b< @0<0k0$pd,\t -LM@@P-b b  3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-(s hs hs hs hs 0s Hs hs hs Xs s hs hs s hs hs hs hs hs hs hs hs hs hs ,t hs hs 8t pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c_> 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l $>0 0d c 00dR0c00P@$h@0S\0PpH0P0  c>0  A Pp̣ܫУԫث0ԣ -LMPP`0  @P0 04? R 0LyS{y x Lx Lx x Lx Lx Dx Lx $ Lx \ Lx Dx Lx Lx Lx Lx Lx x Lx Lx x Lx Lx Lx Lx Lx Lx Lx x Lx Lx Lx Lx Lx Lx x $ Lx \ Lx x Lx Lx Lx Lx Lx Lx Lx Lx Lx Lx Lx Lx Lx y Lx y y z Lx ,{ h{ Lx Lx { Lx { Lx Lx Lx Lx Lx 4| Lx | | Lx ,} Lx Lx h} } Lx Lx x Lx Lx | Lx ́ Lx } } Lx Lx  Lx ~ $ \ Lx Lx Lx Lx Lx Lx } Lx Lx Lx Lx -0S= R 0R0B00\=! R  04=" M  ╁P 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0  , i0PPS 0 ؋P 6P 0S  0R >@Q0 0cc `i  pK=00@Q@@@pp` :=8i @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P㹬PGUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P%@4<0 0P 0000MA 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P00040, $($Xh8#ltd"У̣q00  R 0P0QP HX@ 000 9  0 0 0 00P9 Pb 0P0 P00S@K -LP0Lp`tS񟗀 , \ T \ Њ x x H x T ȋ x , x R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%̣8# p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`ܫԣ̣-n$0 Q 07̣[P(P)P{P]P}P 0-4@4P0L 70 0 0̣ll, ,000 0 7̣ll p-\`LM@EdPAd ,80 0 p$ 0-@P L8 0 00h 0- P@LQd0hMd$ -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0c0 c 8 8 0 0bd 0C0\0T0T P0頾̣У\L@HDT$Pdhl` p-QLM@PpR `0 Q 0Q 0  6 000ppD`  0S0 c6 00 0̣ p-LM@`@P 0S d 6 0 e0b 0p̣p@-P @Q` L| T  0P 0 QL|VT @pppPẒE-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 P̣8#@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q ̣8#G-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R ̣8#A-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEụ8#0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0̣8#E-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dṭ8# Q-LP@,0 Q()0P`V Ttp@6 0P0C 0 4 ,0P嘩($̣ -PLM @`; 00CQU5 0U@@A^S`00 PpXҥͥ`P@6 0P0C 0 4 00TU (P(̣l -l0LM` `0@ 6T 2404 00 x x`T\D@d 0-PT0P0L@@P8P 00` r00c00%h`T 0-pPL0 0S0R@@0 P0 0B0@ ṬP -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`̣P -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S v000u@p 0 00S  R+@S<@P0S 0 1v@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWurP̣D@d0 p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPpv0S00@D -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0Y4,0 &{0S @TYP p300(Q 0pp̣( ,  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @+yPs Ve `FVV80S940q3`@M,03,0!0zP00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y05P PU48 Yv4ay540P``p6yx0 @ x00qQk D0@@ P[  00鴛̣ ( , -L$MK0 K @KK @xP@  vy6 0 RPP0 -T0LM @R 8 TT^htt@@$t@00P00 ȽHL -Ltht -LM,@0(S]00004$ -LMp@P_` !Bgp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K%P „0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S \nЫ L8#gfff -0L 㕨눽h! -L -GML M<2 88@Pp`, $"fp fPp` iPp` 1 @bTQo1IKaAAPp4: S TcRnBKHH+ P: LC;20Y/S/00@Tt p/މP`` 0SP :0/S$ V:0/S `FV:0/S`10 SU0@T4 P  /P40`FV:0/S  HPLL -LjM M(kKH0 H`p,0 FP;2Q :P2 R2 RVဉP,0 S , 餃0S  |巇6: S" KA AEP L6: S P $ះ6: S V O0MK@D @DPUuKCPKPTn:P KA AP]NK@D @DLE DO@ P@@1( K ! Q@10 `HP00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`!:PRL 8 HPL,M\n|h! b -0L$M@  H0 < J!H@PPD@ <_@-@!Pp hPb[0Sp h x@T UP 4@Ն@LP??@Ȇa{?D0SF/P=00LeP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , .PU?P @@噆<P$<吆@勆o0-S @僆L0S @{_H@@ 0 R@m@i0;0<`H0P0+PrX<H D a@N}@DHMbTdtH -LM0 4 ݂P= ,K rp# ,00#4 ʂP ,K _p ,0 #4 SS| |@0xx x0嗃hK@40(@4,8 ,0儃(004 0-,@,PL $ ӥ눽h!<\ -LM@*P 0> 0-@Lw*PU ]0Sn>000 -LM0@S h**p@-0PS00p-\@@T \ P`r00 P 0 R0ATap8# -LM0@SK P X* 00 -LM@08SK  -"p 00  >8\ 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  P2P eXT\ -L7 0-XPL0S S 0@ S0 00\T -LOM\0X,0 0P S ,0 S ,,OKKK`VT JTP W?K+:zPW?K \!QH1SD1 L1@j^0P S Tb818S \)<\00S#\! D`K 0  \ C0[SD[0 CR 0R P 00xQl垁0 pW@X D00CS00  ä0 Qض,! -0L 57눽h!@ p-0LAM @P` Q`p sP` /0 @bTQ!P +Pp GOK6PP V~.4PP: \Ldp -0L 눽h!| -LMnQ@0,T  h}00000 0 000  -LM0p (0 P@/UoKK/=PKU  S?K\ Z0SKK,L1 H1 D1 @1 <1 81 41 01 +,KcL0 P4:(0 S (忡  -LaMb>K0C 0Cp( @Pv$6: Sg  S$+PW(0 S (員NBnK`F`F|!|1w+0S+@aDxPP$[NK@D@D  AP92W>C R0 RW W9|0S *@EPPW dBnK`F`F+O0)0KW DedA -LM@X 0s o`l`i`T0t9at -SL Mp@P|00!1/P`!  Vx ~|0S@ 0P P* W@i|?00 \@a` X0P P* W@O|?00!\n` -LM@ K K 0K @@'P -LM8 < @ P`pm 4KP@h 4 0R SB $P`Z 4 (40@#YP0PS ,KL 'PP 0 P@ U10  PP 00S0 KvaP 0 R ;;S PP 8>P PP 0< @0T PPV $$!@08Lt -ML M0$ , p) P`:{?000!1 ,0S ,AP@ NP 0 7P q{0S08i{0S !0mBKHH F'0@CfPP- t0@S" 0S 0S+ 00L~ \ 0$ 0:1{?000, 06Vf$ P$\lp\( -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/z "00Z z 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUtz"00 P pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 Wq0K J40K5 B"0@Z$$ `JPU *0 K0 ZP00KU:@ K00K ,@ {V`})V`8#" -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sy"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0 0d|8^,Q@00 K00cPE: UcU pP/d<gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PM PPڌ@PEUp pT00  0<0S000PC r0 0  R8#< -LMp`#0P@ r \P \0 P@\ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 5Px 0 6P0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 ? -L Mp`@P@h <K4K0H0S񟗦 x  ( H 8 `   `  `  l H  `     H      T H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H x  ( H 8 `   `  `  l H  `     H      T 8D3#cX Q0@ 0 KD0  DK5P0S t!000PKp JGt!00CP3L#cX Q0@ 0 KD0  DKP0S s!00 'Gs!002cX" 00D0 ?0PKQ@  DKP0S s!00h Gs!00ŸH2D"cX 0QD0 @ 0 KH0S DKPs"00s"0020K00!1cX! 0QD0 @ >0PKA0S DKPps"00ls"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLfs"00Hbs"00D00K000 0cX @ 0Q@D0 00K DK\P,Fs"00(Bs"00$G!\dl@, #\@D@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R s!00 2Fr!00000KP0 cX 0QD0 @ O0 KA0S DKP01 R r!00l Fr!00x1a00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R r!00 Er!0002300KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R xr!00Z Eor!00Q200KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R Jr!00, zEAr!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R r!00 LEr!00200KR2"cX 0QD0 @ 0 K0S DKPq"00q"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R q!00 Dq!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R q!00 Dq"00v0*00KP0 cX 0QD0 @ 0 K@0S DKPY0 R oq!00QL Dfq!00HD000K,HPXlpx #\?G? 0&M@-O@d4xB 02d @-M0Ѝ@4=> 0( _8 -L MQ@0K00#  0 G0T0P00S00#0 -LM K K!2P -LM K K!&P -L 0KM#=' -@@L0MP0  0 L0  00S00 K( KP(d00ꬶ -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S W   0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  # 0S 00Q -0S 0  0\\00 P/ / / / / / / / 0 0 0 0 0 / plhd`\XTPLHD@<8t' <d 4T 0- LM@P K0  0p0y*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J2 @3 @3 @3 @3 @3 @3 2 2 3 2 3 3 03 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 4 \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s 8# p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  E@`8# -@TL P`p T0g0 0l 0 e@DT  * -ML M<$08,0  ,副PP^ P@cBnK`F`F sP 0#S   P< P  P33p 0PP( BNK@D @D 44S ?R0Sp  iPP  ٲ44S ?R0SpO/2 ,0S ,僅BnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 㑲44S ?R0Sp  PP  {44S ?R0Sp BNK@D@D +"< PP A0S  PP0SU|0S  0S  0Sp 0ST P@008  @ 4ptTx@u -40L R4P P00 0-LP$P P$@ P00 0-LPP P$@ P00 -LtM@0SK V0ڂP H K 0S x0L: S< `O00`0P0`! -LM@0S00 -h0L,M80 \0 00 T0@4 , (0 $@ " 00 8K 0  (`$t P0@-@P  0S ^ 0S^0 @0S SS00@00P0 * -QLM@,0 pR oP4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4< @,0PP`@,0PP`_0 0G *C * --L]M qPM?KC/`KK \1 4Q 0Q  =K0K00S cK|1 1  x p@ 1P|P 0S L /|1S00^ 000|1 B4 *yy * -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ ! QQ *vv * -LMP -LMl"  2 ,  " !H pX_0P2 0 PP 0Sb P լP 0S b^$481!`)!j]0`X0 `0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKnP"3@(K0SS SQ   Y0  S0 OK @DK0 P-?(K R!  0S 50?(K R2S "RK  K \0 4  MK0iPMK P+ 1MK P\ ɺb \0S \ L建* 41`\ԺLD / h\0#S \ĺ 场 R@]K 0{@,"|@B"2@@P 0S"2P  <%h!t8\(<d\n -L,Mp`@ KD0K< 8 @ 4 0 , ( $ 嬐PDP@  0`4PP @TDPDL8 -LMp@P `p08K8 (P , 4` p7K0 8K (0S (Q  -MLM Z,   4 `a V $ 0P@Q X1X1 - %Pp' B^KPEPE0$! @6ᦫ`0V INK@D@DP 4: S  R 0 0 ,0S ,Pt $R 0R\ 4 L 8j` `!(<d -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ x -LEM@pKK, 4! K081 ЪP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,~0S @S P K?K+`0S @S K?K+0SP @S  4.P`8~ 81S  K?K+ 4t8 0SP @S 8~ 81S  K?Kl+ 4\8 8#" -LM8KKPp <, PP `P@ ,0 S ,q~P/K%>KH D LB @B KH L @B *'':*++6*2* -L(M00K/0[0 [.[-[$(,<4&[%[L<,[+@[*P[)`[(p['[!4Č"< "% h..* -p-LMPU/ @0  0P0S0c 0έ`PU 00 00p@ K$ K(0K ( P @ PP$00P 0 ߿ꈽS77*88* * -LM^8K- 7<K@ K0 <0 !Tp` P" qPmDK@ V `@K~`]vD@K p @Kh0 8K |f*b*^* p-LM@PP! `@0  Q,00R0  0S 00S0 ^ @ 00p -QL0 M4 0 0Z000(K00) "VPP9 0 P0S pЀ`@C0S@ ` ;P p WW0S 4 R 4 000Z0 000S40S 040** -LM`t PPdq 0SL0HH!pվP0P00@(K P(0 R 0SMR- $GR R #@Qʑ T#ppx#KRdpKXpAkR gRmR,pF<\n t0S J "00V:`P@ `8%0==0` 0 @ a0AS"x @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖ꘔ d d d d d d d d d d d d d d d d d d d d d d d d IPI< @\  @ R  @0<@0 X V:H   ₑ H `P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H :P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 P@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 I 0@'͌@ wI 8#@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!!"* --LM p-P0LM@`P8 4T  尵 l눽h!S - 0p@L` GPP0S @TP@ -L 0S 0-0@SPL(( 00 00Ი! 0-0PS@LPP PP0P -LM0`Sp (KPP (QC 0#S@ S> 0 S RA(  #GP0e(0 (P@} ( (0PPřP@ P0 S S0 S S ᶙP0P0,K ™,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @uP@ PP 000  bG0@NG0@00P0嶗P 0V!긶0긶 -L>0S鸶 \\*;;* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ ̶ -p`LFPP P @P P 0S0S ̶ 0-@P@0LS00 $ 0000<!̶ -LM(@0S0 00̶ -LM0St (K 匔Q@`Tg ( 0 S RL0L(  S *](0#` @Rq #PU`@0S0T`ÅQPP `0 S S0 S S BP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\PP 00PgP@Ņ,,nPl!@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L8#H*AϠD* -PLM@` C00P,K0K 0, ( PPop VT000Pp  0 PPYp  *C0@C@* 0-! L0TT!P@CT @@ T 0C0 0xp -LMp`P@匀T h=0S0d0 @ȥXo00U@ <:("vCptx -LM@(|v@T0 @utp   B00! RA R0000000000000000Zg* c* --LM -L@`pC`0 XXP#T  88 $0:  g눽h!S$< ?0-1pQ LR@` 0S ?P @@ 5Z0@< &0v000S@% ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@% 0-LM 0xr.0l@hPTX0 RP 0 PP@ |0 p-LM@hP`k\ 0 @4aTp`0@ R 0-@LP 00J,@r.0 D 0h -rSLM"0@P` :Bp 0P B0p B p-LM@hP`M \0 @4 Tp`0@ Rm 0-@LP 00,@r.0  0h -rSLM"0@P` :Ap 0P A0pA p-LM\@0PSP`PP ё@0PPPpꏑPp! 0-LP(P0@P @0 p-LMDP0@S8`p$0P@@@x -@LMmhj -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KnD\d QR d喩PPaDD]DPP XK X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,9eUT@PPh@T P@K0h LK@Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @lPULD0LP 0H3LK2 P@K@P`KP: h0S@- h@ )R fP  T 崨P@ 00CS0 0Ӥ0 P p 0+S:P P P P TK~C\ d0@RSA00h ៨PP \QP!00 DQ0SG d0S7 ,0d LKP@K@ePPP LLP0T@KPT @Cx!?l0S3 0CS/>u@41 ,0S 4,)c KOp>0S   WKBP7KXKL00L0 60[S0X K60K#:>00Hp`> 0  8#"dtS 00 -L0Mp0P 0 `@ LKL@KD00D0 Q Q N>00 0 S 8 b, uQ Pt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd*KK**%*%oo* *R0S 0S0S0  R00 -MLM00  0PP q`@`@T T 0T,S 0S ɗP   0PU  0PP  0PPP p-LMP0 S0 `@0 P P0SH0X S0L@0Sp007 4 1 -L M̀0`Sp(` +P@# P\  09P x$ K10P(K|᷂P ( 80  $ TL@-0S@ @ 0 0 0  -LMha ^( @Pp$ < 0PD ( K100P= (P8U00T00S*0U0T00SW SP` "P 0 $@J$ 02P $ 03}$K;| T --L 0-<0@ PL,,hT 3 0hꈽSh! 0-0L@P 0SRP0 CR 0P0 00R P . 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``aMp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' -p"00@40S\00pgS \,00E0XSxS@`P8# -PL4MPL p` 0 Sx@P X 0 S o@P L0@KP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\)8#{} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u8# -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h tP & P0S1*8  sP+ 80008#| -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi !sP0S PP PP  000   PP0S  0PS8# -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , rP0 R 0S0px0   0 R PX 00p , 00  RP 8#"d p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4 8# p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Si)***P+P+P+P+P+**$+P+P+P+P+P+P+`+x+` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S  -LM P p0 0@W` 1R V>@0S P0 40S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ dP@ 0^?>1  ^0&0@GP@ 0@0p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`pa0 00R0HPU@  P g i鿋 0S  Pim- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!h000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0%P< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheE -LuMp0 (, 1 P`` PPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 孃uK %P? 1 pnP@ oK 0 ,0S ,E0 |10S H0 @iy 0`Y d0h!P0D -LbMȠ0JK(0 lp! @)@KHpBZ_K`H!Pl0 \ TjKjK11 P 0J(0 S (E D -$0L!00  -LMpPSLTHxPض8\ -L MR, 00 `[ Epp P,0j,0 +Re -R`-S+S, 0 , S00 0Rx%00pp%000T0ST0 RR,5 \ u- ! 5 -Q* %5  Dp00 Tq 0 0 a0b 0 000000!` 0S,'P @T0s ,$0s00 4 0S 0-S 0Q# 3 1P -Q  -Q3   :Q ,P ,0 0p@ l3d0X#0P@:T0w -T ,ކPp 0WT00Q00S 0;S> 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S !,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@FP`Lܶض\XT\nHPH -LM 0c -L M@@Y -L M@@O*tt**PP***33* P-L ht/00 -PL`0\p \=|# 0 0  R3 @ 姅h P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00S%0 0/\@- \ V t0j T ڊ>j1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ +h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ՄdP`a\ h000X0 WpGk 0002XpGH8#,"@ -LM0  mzQTh! -L M@ 0@]zAh!RR}*ZZy* -QLM  0K  0   0-LP@Ep PYp U T 0\ vpP Uh J -LKC/JK X1 0Q ,Q _?K A xA 5D0 bKd1 t DQ " 0S >p  T{{r*n* -LM@`p(PP< 0@0@@@@@@@@@0$` $0 P tP@5 mP, 03`P1ZY(ʐ \P ` 03$0 Y  < ?P$00$0e  `0S $ )@TD0 003$  3S03Z`` 0SV,0`@,@ ,@ 00|0 0\n\ -LM( Dp$ ` x/EPP P P\@ h(@00 00 0S p-LMP`P 3@S0S0@d3S_P(P#W$0 #10#0V@@TJ0pE20`P`$0%`4 -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` 8P3ա 03š0 #0$0@P$0 :.$0P3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P _ 0@Y@$0 @2 ux @@_Q $@ 0 0R 3 P0 3L00 ,P  *PP$0   30P0K0 8P:3 03 PU 0  PU:$000# 0B8S 3S  $0H rP3ԡ 03ġ0 #0 \( R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h Pp P{600\ -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z w:PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT0{ 40$0:$0?00puP  W $0 P T 0phTPֿ0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03P00 <0 |@H400420#4 0 BH  L ,0S V4 #1400( -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`1Pp` p 0 0p P 00 -0LRP@` V P  0P @T` 0@T000(00پPpPppꧾ -LM$0HPPp`_P@ 0 )$ 0I00D @0(`0 -PLM@ @wT 0-00L@ :0S00R?0 00^0偾PP 0S PN R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL00UP1S -LpM$`@P R K<Pp 0 0R, 0R p00V@@1p  6PP p-LM` PP p 0@0˽ ɽǽP -LpMpp`  KPP0: S g0 0 p" 4`P@ $0 0P $PP 0 PتD0@000MP  P`pP&7 y6 -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPkiTPP\_  `@L  0%0DPc`H0S[?=`@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|8# -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g8# -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0h8#G-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4 Ϲ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$垴雴ꙴTPPY叴$却 Nd@L  0'0D>P^dH0SVmk$id@0\ >PP-p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|8# -LMp, 00 Q,(P4 0 8 0 Y_0000AϠ0 P0P 4( < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8˴0 4ƴ0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X8# -LMp, 00 Q4(P4 0 8 0 Yw00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< UP ,Y 0 8޳0 4ٳ0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0Y8#G-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE11a* -4L|MHK0 @K0P㴄)e/ẳ@ \ \ R *0S0\  \ 0|S :S 00HH$@@@$@8: @PX0$0L K@X0pL0<P K@(0P0T K@00T0X K@,0X0@\ K40Pڰ\d K@p00, d0h K@80up408 h0`l K@<0kp6[>Dp K@4cp7[0(t K@4[p7[0 x K@4Sp7[0| K@4Kp|00 K@P0Cp00 K@T0;p0: K@03p0,pK:| 0ml 0Km` 4Km. 0 XRxR @@00 :S0-LP 0:S0@0h@0- 0 Sn@S -LM K"*vtOO+*'*$$#* -LM0`=S`pP,KP@; U鵭 P:0P00@S=S 0S=Sg! P,@厨P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q⿨P@ 0 0S 0 @0@, 0ꜵ p-L@`M@PK᫫P 0! 0S0 p霵 0-L M@>H0P (0 $ 00K K(0@  0  ,P aP 0t! BBy*A``s*##o* 0-LṊ@@-@0S  S 0Sd@(P*(I*Q0 %L 0!L$hh9*$%%2* -LM< 08 rSwS@T 00  㸧, ,0SZ 4K♛PTpPH P < 0rS <0@4噻,0@, P,00,  4ѕ@00@T 0ျ@T< 0rS 0w4P 80MW4g0@4cT L4Z0X,嗧,哧H` -LM☀@`T 0S `@TT $pK pP]0S V0000eu$ -0-LMP0 S@   R1 00 cQ  R!,0 偶 0S "0 x -0-LMP0 S@   R1 00 cQ  R! L 0S K"0  -0-LMP0 S@   R1 00 cQ  R! 0S "0  -0L 霵 -BMLMh#0P,0 0L4  0S 00,3 ,0S ,!/ePL$H$ K2P@@b00 cBK J JH eMK@DPpP 0SrH`0CK0A S A P2D4 H2@ K0C0C0  A  ᐵ100C=S񟗗`````````P``````````````````````````````````````````````0 S  1S!00 c0 p7C0L4 d껪PnL$R 060S3/ |t\H@-@^  0 S SS00N0 --L i! 0-LM@Pe0S 0}g0S ve0S  pe\ 0 @@P|a -LM@`PteP pWŦW0S `U @YT :0S U000@0PTP:@T TWPP  ȩ 0h! -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`YT < h000 ďY phYꈽSh!$<P 0000ӑd p-LM(0`S/ X   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ uv0 0 -L 不* -2MLM#0@,0 ]0/S  P BKAA 2+ cp Y W3*WY 0P/S00@83 ,0S $,/ }cP<P"P@aTnK`F`F ឧ0Z0pd   0 S/R  Rm/0 0 x2(K RW\mcP LhcP@ Y 0C/0h@+(Y!PBKAA(P@L<: S< S0< ?nK`F`F!PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +X Pp* +bp?00^ 0@C/Z0@h>00SZ I, D\+b>00S8 B>K0C0C+< b! \( p-Q00P00LMSP@`P 0s pXp[P@`;00p 0S Sg* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0ꄍP %T 0S 0S0 0C` 8,0 S |,/fP 8P@pzT|,     (@P\xh|iz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 ʵP MT0h,Z  @ T *000圌P d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `_P T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 5P XZ @&43@4 0qL9  00S 0Z0C0   0SP 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSa@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXo%P  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SFPPPPPPPPPP@00CS0000?Z  /@xeTET& 3NK0d@3Ks =K43@ 4C  43 43 K83083 43@ 4# 4# @x3KXx3.KXjP    9 S9XP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o 8#h @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ g000}P`dp@V W 0 f0 0  f5 -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K +0KP@@K 跉<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N@"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I8# -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 ۋ@K &@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S }p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `8# -LM0 @0pP `冀yPP @ Ỡ00@P0  PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0sP0000%ĺ 0-P@LT a DA0DSR0D@TP0 \([P.T.Q0 -EMLM@H$ 0r/, 喡'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l 8PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l o8Pp\DDPV `V)*9` VX !*9`V H*9`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$H妠D4@ cTH[D4 0D$ YYX^ X Y^ X P S@@ K@t XH@t0%<H$G Y[ XY d^`` Dd?PC3 WX^. `P! D4 0b3 Rd%D "d %o*3TP:hQh fdT4  T4 9`D40D4 D4 03D400D4 <K ƞ<0S80S40s@2 D4%?G9YDl?P%D4H$D 0 l o7PpDdPdd ``QD4 "0 ,2P^D45p#04P 5wz DpCNK@D@D 0F7Pp;Pdd ПD4 cPdp `d 7ZD$pl$ 0D4 P1PP*CNK@D<@D 07PpPd$ d$ D4P0P 土D4 00D4 啟D4 cP`p YD$p0D4 L0 D4< 0,00H4 D400D4 OY <кȺl( 0-0L@r/t剟P|80s 0  0S 00<к -L Mr/0P`S8p X X0c. 0YP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn ,0[S6 `S@ 0fS+ "bS @TV0S əP Ƞ 0.P 0L` ySX`{ 'Y,0[q0@T t1  0 D0S:R .R 0P.S  <P,Yh!hh1H @0 p@@81  :XPz0P.Sl  }<Pp,X < 00 @p@0 0x@v+h0K ^~/PP'\0 ]/00c0[<к8#@lȺ -BMLM3@0r/, K8 >7p XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn ߂2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,?㰘P< Ƞ@ <4k-PP&@$< 02Pp Q<Ҙ  ᝂ!0X0P 1 8$0  0 0 <崘ySX p  b0 W@tP. K`g0 , ![P@p PPUZ.0K gWpt00 0  0 @ [\`/00L00SS (  h <кdlȺ@t|D 0-8P@0LS((+?0@0\?! 0-,PLP 0@T 0;@ -L M0r/$븢4 0S ,K >P@ ,0 S R@0@,  S*h y,0`` @#R #?WP`,u@PP r` :P], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`D@PP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4@PP @, t:Pn4 0 ,  P H0 DD]>P W<кlȺ! -pL` 3P@ 0S);P PP !;P 0S t0 -pL `P P@ 0S 0S 0P -鬁L0M 0嘡0 0` px1Z>*p?P@P7 P X90 S S0 S S q?P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4=?P@ PVP $0W`4ld@ -L(Mp젟0 S( PF;P 0@`8PK P@YP00^XΞ    t@@0p!lL0\S@0 !$ 0^A(,+,,0+, ,<,lG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ,l,k,,[,,, -LM`0(K\p@P.  ᑕ($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ js -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ WP@a 01S @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:e p-@L$MaP2 ` 0( SX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S   韑 + -BMLMr0D`K@P ,0 02S0$S aS@ l,0 S \, @0$Sz2P 0KY @ P TKDAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 )STK ᴔ tK @TK  T:m 4+(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000$E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` 哐$H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, 岏 .P 00 0S$S 00R5:0PK c ᕏ 叏 K ႏ  x 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,(   0-PL@U !", 1#80!"$ 11PX 0h鯍0 -LDM@@ hK‌ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#*# -L P @ 0T `  p0S# @T 0R 000 00 @0pTP 0p 0 0R @ Q-L@ 0Q`Q p 0R /0t0 0 0R P  0R0Q 0-L P@ T @ T0  R 00d0R0S 000 ߊP@ 0 -0PSL`p  yP@ @P@  gT0000S Z~﵈*Π0ﱈ* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'LMMM@M$M$ML,M@M@M@ML0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 n0 SP:00X,h  -LM;rt0p Rd0`V @@TJQ 0PES@TZ`V*xT# 0-LtPM@KT 0K 0 %  @@徉p 0 S 00 0@0@  p-0LTMP`XK <@KhK0 0h0 屇0XK< K0@0 dK`0 \0 d0 奇uw 0 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PlCP_00 0@T0@Tlpk0@P0SHp0ToCP00,  +4(D| -)MLP|M0pU K,0 $ P 0:S /S .'CP PU  0:S0/S XhV ᭈ@᪈@@ T*BNK@D@D+C+8+8.BPP 㽑Pyp@+ )K(JdJ' J *KfP :K4S! K *K $(P2U ,`^ ^\K\P2P :KPP K0P0P@@T00<"  %# K *K0 K$ja0Qy T PXy @ T`@ T 0 0@Q_ T@T^ؕP` 0^- S@P0L00 SGT@ Tx 0@ T0 T5Q@]PX/ `0@T`P@T"^- KQ  0S 0@T @T^- KP 0S0@T @0LT 1 R@@@T4(K R K0j c@ KT$00 :K4@TXʈX KQPڠ3(K R4 @2T00 S00 X2> P 0SP @ß2D0  R P,0 S ,!1tPPP nP0\ S0 S3K0(AA 0LP2(K Rp" 0 02Sn-K( B B@0@T00Z,2( K0@T{KNPN 1@ T 1(K@T3K0(NN1 R @T1Sڄ1( K0T p \3KmK(N(`FN`F Q :K 0 K@$T0P Q0nK0(A^ A0 [0nK^ 00(A P:V^ ZtPU/APTr P0  JHq+[[(0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ ?P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \>d h0^@ `>@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  dۃ\@P0` ^!@d T Q, -@LM $0S h{ -L@08S 00PhdЋ, -@LMὃh麃؋ 0- LP@< P0S >P2 zPP%^@00 , =0h&l P 0:S H P 0 ,=00hЋЊ, -@LMbh_؋ -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  A,Q"  p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQ,h[, -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   h[, 0-4PL@"~h  W@~0؋h0 0 Il 0 0Cl@0  R J1 0Q R@Z, -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠ&p}0` PP   0@T P`;00P@@T 00 ,0S 8,g00 #Hp -LM0H @0$c}PH  h T -P`LV@ }p0S  SP@D -``LMwPp !0@ `0`VQ0@JDX {0P00SC/|`VX@E_ZX 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/q|0!ĺ! -LM:L@0cP0S @0cP0SP!e| -PLM\\`p@P0SpC/0p8|PUX`EOZd0 鈒ĺ -L0M0 @00 R/XȄЄ܄4@LXdp|̅؅ ,8@L\\0 (0 $ (K, K00Kyp, E0 0K{Pd 0 K0 (0 $ (K, K00Kyp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`vP{ 0 p`dvPPk 0`0`KX00S   00 R 4 40  1@ 0 (@\`$@TpPw`8@ X0pX L H T` Pp /XK/P* <0 0PS` 008.0 @d@ 呠 P"0 0d Kg@@ 00Q00U^vX[v0 D0DBa ,0$@(;a 00800!~fth! M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0mP0S0S 3`0K KP L  32a/@#b! ~P pj `@? B7c011N0 d 0!T 0 L0L " !/uEن!0!0"P 0-0PLr/8_l4@0, ,YlB@0S0<кԺh̺H -0PL4r/Dl0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S kPp 0@W0 0 R@ 0TP 0P<к -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $, P  -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S  -LMH L p r/0, HkH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢$$)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 P¼00D"nPOK?K@DH2L42  p70 l" UY# 0K00%\(K h (K0S tEoK(K0X% SP1\# PP(K0(K0`0(K R`0 Rk tP 10#x0Q0S 8d0S P@%.K DHL"0@P񟗟$$$)TU Pl hl0,6^00Sh o лl |x| dǻx"l || [S#0S0SSD"0S 0SD2 ՎPP3dC0  0S p"x2 0S ßD"wmP3 2HL"0rL2P0p"RX  eX X2S0X2 T 喟Kxlb ZP@ 00Ì 0{PgdUF d"  O00̠KOK \ @:mPP `0 Rd   $  K H0P 00SS S  0 t HT`1|d"xS| P  0S |x| 0S D 0HL"[L2Pq 0(Kl0(K0KK ( l޺,8@7 P% <к!!!!"! -LM4@0S w$ 000 !!!!G-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ8#" -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ" -OMLM@ 0r/ , f05 - 0fUT U U U 0O`= K AAH !~p7 To!4oS* I>K0C 0C000S000@S0005\ =000@Q %eY/0`00n0`A ` 냹P@ \ `Ppa  H D< (K OKAPPF $ R*EnK`F`Fd4@@ ;P@(K R  ;P&+(K0 S S %R0P S S \ \ \00\``V`@, 4 P`e  P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS}D PW *(PK0 S SQ\n0P S S \ \ \00\@@T\`, 6 * P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  xPx((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  #N.K B0 B0C P0S  R4Ec4 R2% % P kcT ,d P&(@K0 S S U UP 1115  \ \ \ \ 0 SS} ;S`z 0 SL KP ;Q Qq6  0P NKJ J  FPE %4!@% h1 %P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt P`#(K0 S SHY?P  E " GI`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D[PPV:00P0:0 000,0 S <,U0jbPP ENK@D@D+P./P ,`2PbP@ `p,(`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0Sw1S <кԺh̺"!@$L@(088#%D $;P\hl -0LMP0r/hc0pSD Y@ S S@0TP S S  P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0t P0; X P0; < P01<кx8#؀<4<("4 <1QS0 g 0-L@PP@]T0] 0-LM@ P K 0K  P @@(`p0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S `@^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP8# P-L \hB/00h -LMP@`T,`K,pK 4P 010jP VX`@TX ,K K`0V0.T00S` X  -$"L$M0P@ <K ,0 Sa0:QK 0CPcT RL K0 A ,P@)t W~ { 0  HP`K> @u>K 0C1Kc@@2AlA H D< L @L ^Kf07S  K A 0P@07S  0\KclA18 A 4< 0 < /KmQ T00%Q00S  `@Dvr `W!X< PPD@`PeX  0˩ 0  P PJ `81 K@@+ 0| P PJ ` 1 K@@#@  "!!! )Dt!!!! -LM0@s Lf0000 -LtMp0|@ $0 " 0jP`KS  $0S $Wth KPK叀K 7[pPfPs|p a| "" -PLM@R  ?  000 -LM@e 0 0 0P0 -LMI -LMp@`P0T@$K P,0 P00g Z@ꐼ -L\M `\, l Pt 0%S U 000S,0 S ,&@zThhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh @\dhhhhhhP\thhhhhhL! hL!hd!x!!!!h!h!!$","D"L"\"""`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdK!0 :hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A $$"l#$&*($#$I 0$Qnm4$t<$8\H$TT$ -LMTp,@KP` 0    0S  \$Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Qd$& -L M@KkPT `0 -L"ɠ2l3c13@"c1MP 1K0  F C -L^M⸠p`OKPC/MK@( h < 8 sSVat0V$KOK`?cKpG 0@FfKq q A A 1 (0S ( h$ -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @P$"(0K!48<#8 S*S 0H T H0L P J I@O  LOh@hA Hp\ zL0p4Slgp PBNK@D@DhL!L1Ap@) PpPD0#SEKEKALK 0 LAIP4 \ X T KQX4P$0P _hP__p$RhPV0 $$,"("$$_`h!$%(%4% -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000hK -LM$@0 S K0< -LMPp`P@b ,K0,px!0p  P @\T`E,0S 333333p433p433333333( 000,(0 $ p P@T` (pP0P (0L 0 (0 %t%%% t& -Lh\h!P0D%( -L  hB<h! -LM`TPpP 0 S S 0d f 0 0 @0$ U@5t$( -Lhh!P0% --LM  -LM@$ O0$0KQ \  0  K 1S015 -@LM z@ 0-LBP|@ 0S L| 0SPeT 0S \00LS `000zO0 -LDM@ d _JP dZJP`} 0Sh 0S0J0@ @@`KԃKLpP dP00 H XP L T@ fXKP0SVdJXaJ ^P0P0H0STTA 0@81H  XtP SP0@ 0000p0d  N X%4 40JJ  `0X@\4 0000 00(@,4 0000L>l@0"th!) -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 P@ @dH" -80L0S ( < 0 @ 0-L@P4  P@>00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0\" 0-0 0 0LS@P 00S 0S 0S  0S 0hPDDDDDD000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ "t"@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 ,J<4(<"4!<0  -LM0@SK C < 4 P@O?K  8GP@0!V@ 0 ,0S ,YT` K?KU .KYP`  M?K Gۜ.00001 00WZ>P 08) 3h! ; -LM@pP`~P  R 0S  RV  -LM0@S`pP7 S3 KP RpW :W =00<PU 00 =PP 0 ,0(U B 3h!  P kkkkk k(k0k8kj@k    -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*O00Z 0P0XR00S @( K @  0IZSt88t888888ttv8xuv84xDxDxDxDxDxDxDxDxDx8888888888x888888888888ĉ888888888888@xx 8 8D48Љ88,8.(K0S 0(K0  00A SP cX˟1  UPb #U0PB 00@ S $P7 2S"12 202 2 02 PP ` " " ] 0 0" 2Sd P ?KP +e02 Pʟ,0 S D ,Pb\ R \ 202 b  K).K?K b+ >(K *Y 00I SP 1UPi U0PB00I S$Y@2R SjK).K?K 6b 00A SP =ɟ0! UPc0U0PC00@ S $P 2S"12 2P202 0U@@B\ R \ 2PB  K).K?K P1UPi IU0PBF00I S$YR   p 2S"12 2`202 VZTB   00\0S㬀K Q. :Q  ?`>(K VR  "202 @"PaUUژ&0 "2 0RPEK2 " pUT6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTc PfUU[E00@ "2 0RPEK2 " pFU0 "2 0R2 " p3ʬ" `` "2 0R2 " pNʬ" "2PcUUğ00 "2 0RPEK2 " p/Uʤ! "2 0R2 " ʴ"1Q0lQ g2S 0K 2 KP 0@ XKP PK KPKeYV K/ PPQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCU}UC00@ "2 0RPEK2 " pU0 "2 0^PK BKPKKPK"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 t1 0 2Q02  K4PCK/PK <AK&P5K20 "2 0R2 " p!ʸ0 0 20Q2  p K 0C0K@ "2 0KPKKPK L# 4"\8"d 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q^KPKPK \AKPKKPK2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0KEPTK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " PK ,$CKP%K00 " 2R0KPKPK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pxڠKPKqPK lDKPKa^ K00$0(0K0 "2 0R2 " LKPK4PK# % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 \&0h0 %`PV P00 U- >(K Pu`  2"S 12 2`0" 2  2S12 2  Po " y2 "  2S 12 2 Po  d"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 6" ^   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2"SK1 2 2`0" 2  >(K t@ GYgYT@ 2S"1 -K2 2202 -KP K/ P- >(K ` -KP㔃2̌S 3KL -KK K2 +GYgY |\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K N2 S``2 2 KS12 2  2@02 ʌ lQ  " O Q 2S12 2  2 g@ 2 KS P12 2 202 S  2 KS"P12 2 202 ?   2S"12 2 202 )  2S"12 22 /202 ,40402S 12 2 2  02LS1x2 2  P`" 0" 2 q2 0Y2S12 2"0X T "  !P`h`8P`̌:@ Y K >(K`2S0 2 +KP % FK PK0S"t 00z -LM4j @PK  4pK, 0 p 4K3K2K1K0K/K.K-K7 K 0KZP*ڸ0@%SP@D0p! @ 0BZSX,,X,,,,,,0X,X,X`````````,,,,,,,,,, , ,,,,,,,,,,,,,,,,,,,,,,,   p,,,М, ,,,0000C S`K1Q,0!cQ00C& 00B S$R 0X0  0Z|KK0̀ Q0  @Z0̀jKK꧉ 00^ 4 K^ 0\00 f,0 S ,  *R 00B SF 00B SA000C S`"x1Q0!cQ00C 00B S$R0Ѐ Q0  @Z0ЀKK 0ş1 Pb0P0C 00B S$R0p  0X 0Z KKW 9  0X KKJ  0X KK? 0X KK4@ 0X0  ZKK$0X KK0X KK0pp  0X KK   0X KK  0X KK 0X KK@ 0X wKK0X nKK 0X cKK0X ZKK0hS0{@pH0lS0pC pA  0X BKK 0X 7KK@ 0X ,KK  0X !KK  0X KKt  0X KKi0X KK`0X KKW00X KKL0|RZ  p`0 5ppt  Pd0Q0S(((((((((((((((((((P P>P0{ L# 44 -LM0@p`P*W10S 0 5pP  3ZP  bX5pD0 u5p ~p -LM @`PfT40 p ETeTpG/  P090 ,K0K0RgTGTp400  fT@ o P0@ 0 R*00SC 00 0:0 g 00S 0@8  P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  h gfffH4 p-LMP 5 0Ae10T0d1 P40 00p <00c1S1@0`/@T\ # -@LMT( 4  10Ah4T\ -PLM @ 0S@@ 0-@LP0 S0 0S0U 0 0@2 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P`n !@ 2p -Lp B/ bR@P`0ڃ0RN V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@00@ -LMp`PW, `pP 00 R0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp3EQ ܀`V@" P @T `c3@T \3Z@S0ph@K3<?`@$E3 0 1pꜳXq# -LM0b 0PUp@ڂ U R0  R00@ d 040 Q2 :RP 0E0 0Q0: P!0 <01R\3# -L@PP`9 @P``p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@3 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@94Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -LDM< |0P|C00KHP L L  q0 0  RLL 0-S +SL0L0 0 SY 0S L`/RP T` p9RTW1000CT0 10W0`CLp /RL 9RRDp C @EReR@@ 30 0. L +RL @0 -R- 00B SL #0R! 10BSࠃ@ L0B0 /RL0 9R L@10 0C/RL@ 9RL@!0aPS^@ `@ W D @R lT@ D  T@WT0K ZD0KHL " VP@0 0 K0W`0 @@0jPU6 0K 0KPd MU4"000`0@KP X5\3d1`/h-<@TLH^ 0 K00K8#NT4 # 5||@??ER+ U@LT`@P 0K 0KU`,056C,0 0@K 0K, `0`V0V,00 56,0 ,0 0 PD T0H` l `0@K`0\  l! !/4 K80KUX @d \ P48@ 0p!`n`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQdXd @XX@ VX>X X\\ U\2\ Wd,d \Xv0h 0d1 hdE/O P@sP/O ZP@p`p`AP/O p`,  3PT _ T0 S3.O 5P /O  Zp`p`0Kr0 0K0 0 K,0c`T0S X\dh< 0 ZP@00S,046S / P/ Pڷ/ P00K,00K56C,0 #0 0K0 h0 K,2"0S,056,0 2Y ,0 000 x~Z %N0p`h00S,046S 00S !N0!nX,0S"0 Ku`0S"00cr/ P m/ KP@7N0Z1 ,0!46S! 00D Z0 K0@K0 0K0K- KP10@K0K0 0K%00s, 006,0 0 ,046S00S, 00C **0, 00 Z00S,046Shdh P5?55?5???|45T4A8Pe ,0 K 00KP+ ERU`U@lt`@P 0K 0KU`ʄ10K0 K0 0 00K0K O P`0 o0K0 K 0 00K0@KM/O P0,` 00 !Pp@@T #Tg@0PeʔA0 K @ n@ l0K@A 0@Kd0Kx0K [0Ko@~E0 KL g00Kc/O !P@+/O  PWL UL 0RL L L L0W L0 60R- 10BSL0BPP QP U ETW! pT 1W`^WT p1Ѓ0T0 W1Ѓ`PL0 L0 00B SL@P 0RL@ 0B Q{L@0 0SL@ SQL H L E -LM, 0 0 S0 J 1P,  4 pO*P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LdM@K4 \ 80 ̳00 0 1#:@":SZ @K/ gP  @K00K, Kp ,:ც᪪Z K0K J$6E0ƄJ l KY/  .  W/ P@ R/ 0  p` P RPP 0RX0 P@K 5PP 0 BP X0 0j@SP`@ U@dB@SC<@ U<@ E` EQ`0 0@ d `0 40 S0S40 0C40 4@\ @Q#8`@h?aCoc?`(?yPD?8 5T4 PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `$hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh$` 0 Q 2RhF0P13P1 <2 x5-(0(   %,#4#P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp0#4#(# p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD0#4#(# -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p4# -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";0#Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  4# -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 <#D#@#H#! !M0( 1S Ѝ0SM0D #2::S Ѝ046S0S Q0 R0 P0000S00 0-0LS@6 00S  R011( 0PS00 P @0P 0 00DP0000 00D0PPUl 0 0 -LMP@ `l)\0 p 0p^) -LM00@S  R 1S01P 00 0 0 S 0-p1L @RU 0 P0#<2 %000S 0 $0P:0000 0@0 00 0P0P00Pl 0@0000 P @0P 0 P<0S0 8000^ĺ  p-LM@ P$K, ,0K $0 (` ` P `Rp -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000P P*0P` 0PU:P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P 0 0e 0  000P E  P0g0,0 j 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000ĺ p-L M0K K@C 00p!`iPUhC 0 SP P000pP` 0 0 p p-LtM@PP`K*P0@: S  Q  SL  p( 40R p; 0p0+ 0 p -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 #Pp0S# P | T# -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 p@ 0E#1, 0@S| T# 0-LTPM@KT 0K  0  @@pг 0-L0MpP0 @0 V&0SDK@ 0S ,Ӎ00@@B& : t,@ P-L 0 hUi 00h*| p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`!R @0S R Mp-LM0`0 @`p p-0LM`KPP $ 0!P@  R 00RϙP P0 0<0@0@ $0, 808 `(0  ph0 0T -LM@TPP/0:0 p-LMP `@0 : 0ph; -LM@pP  0:0q0:09% -LMp` 6%\0 P@ uP@$% -0LrS aS >h0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wyPPN 0X1A  ep  V KA(P`O\ K 0SJWH  P`P5 Z QX0a0 100410$1$P@ 1!01 ! 01 !01  P0 g0`g`g`U}$g`Z 0S 11 !A/J@}t AT O` 0R00CS  @0P0(P !D010CS1!N1 fg`cg00\ &  &p& *$X#a: P0-PL @[0 -PLM0 0At 08g00 -X1LtM@0 00 8p̠ 40$18p` DP @ V KÉP H hU P0S400S 10SQ l `0QQPf00B00S 0X# p-LMP@4KP+@0 H$0D @0`D 6R@D0C ,0P0320<00@(@&0 03S0php -L4!`yPpGP/eP W& 1PU@8PP@UPP pD#W0kf0pywu1`fpn10Cs1 1!0C1c10Cs1\Hfp -QLMP @4P  P P0 *f0 0 -LBM`4P0 0  NKQ@pS0A/pp AP@18!0R@T,JP eO00e0,1a: -LM@S0 h;e00,1 -LMSS@0  \h!e00,1e0 -LMR@ 0 he00,1e0 -LM4  4< 0 @ 80  0 \PpZ 0@00P`V R0b<0lP @`V0P\($($(\( 4 80oP00000@ < =P 0Q[()\(T)@ 0S 800 0 c 000  80rP  zP 4 80+P  lR   R< @0P`p(Kp!   ,  0Pp @ P`~,p~ -LMSS`p@ S$!S00/ 0(1 !$! \Z (0 RP0 0P > (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0:P 0S( P0U(1( Qd0 0,1 -LM(0 p7b00VP(pVAv %P! @AP 1!0 1!( 0P1D!D, W00  ,0i -L`p@ PP   d P -0LM@ ,0( P00 0-@LPIP UQ0<P Q0!311Qc0@"c@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 `P@ $ PP    P@ 1S0C1H 00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT  0;P @-0@0 @0!00 Q'  0R!:; ;;:::: 2 2 2 2 2 2 2 2Q 0S !0S: 0-PU@L P :^ PP * 0}` 0 0 -LM@PU 0 0 000 0\0 p`-p  0P 0鈴 -LM@PU 0 0 0000000000 0\0 p` p  0TP 00鄴 00ሴ 00ᄴ -1LM@h p R 0#P' X R 0#P R8 Q5 0#P: 0#P  0#P* R 0#P*  R 0#P:R  0#5S  R 0#P:  R 0#P*P P0 0 S0 0#P:  R 0#P*( 0$ p-0L,M P@ w 0< @8 p 040 0@ k 0,0 (P f \0`@K $ 0 ` 880 00AR`pd 눽,tp`#H 0-0L(M @RP#0 R0 < 6 |08 4 0 000 ,P + 0(0 $@ & @0 <K 0  0`#:Lt -L$MSF`2 p< ` P0 0(6,& 0Q4 80 P8@r n x"4@0Th2@P,K8 PhP@P P@P @pWm,P X`pBU 0#V < F* 1Š P,P @,0p, ,0 R,00,00,P V0#03V00St 0 0 V( 4T!L   000 0V,P @` Vp,@ P@0Y:0 <@i 10,P UP0  V p8@ 0@`040@ 0 d"6h0< P@`0K p< 0p4Pg1o^ 00<  \g^< d#(x,$  -#LTM0,0 U^3 p R`V V @TQ 0SN 匣p<0C>S񟗹FGEGGGGGGG GG(GG0GGGG8GG@GGHGGGGGGPGGXGGGGGGG`GGGGGhGtG|GGGGGGGGGGGGGGGGGGG000@ 0S`VLB0S<2  02 P@0 2p' 2. 2Ύ 000 0 00S 00 6 0]pPPl1 ,0S ,|] 0000T1LQ:0@1 14101,1(10p0p0000000PpPt p~lpK? P@`&yV0@  W^Pqp @  | \#`#hl0$(::Td#`L\Pd:; ; -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  ? Z&fQ *6 p,K(2,  R 2Pi@0T1 *aP,0@ 0, PT1:0S QP,0 0, P11 0F0 Q 000S P!0S0 0 v P  , R0000@ 0f00   R,  0#P R,  0#PR 0#P L\0 0 0 ,0 `4d#T( tXl|,; -LMp 6P`J 1PPW WK0p0@0@0001300` P1@P" @0d!ST 21 @!T &6 ` K?0 @ T@0 0@xQ 10 Q *02'70 p ` (00@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0w &P`VP@@`@P3P0d#l - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S  # X,r[P 00T bH|\`#hH; -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K72,P UP2 2p\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 c0GP@ 0 ZR Z 10 % r P :#:S `5P PU,P ; @$ET P, UU` !@1SpWPU,P   @$ETP,p U0 00 SR0 :JR|0 R0P@   H\;\|;, (;Pl;;;< -0LMR@0 0 80 t R h:#:ST,K0[,@(< <00010 pPP,`,0`V,`   @$ET @`,` 00PVP" '1 S01p7@Pp,`,0`V,`   @$ET `,p 7 F RǟW0 0d aQ0  0 6 Y01 @0D0 6 R6 RvP 0<& 0Q@0 \600LP0D 0 ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@ThU -LM@\Pp` h^\QU0SD R 0S=W00  00CSlllllllmlmmmmmmmm mm0 0>T00 1 0 0 ;00 0 0 R 0;S< W  4 T 00 T 0, @- 0-LMPK 00%0 @( 0ST 0S @S 0ST 0SST  ST?00 h#100*2 P@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10蜵 -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`@0S  0Sb RCA 0\R! B Mp-LM0`0 @`p22**"*xx*JJ** * -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b} Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ (PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , ,@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40PoP P0 00S"P@ 0S 0 00S 0$P  Q p-LM40@SP`$ 000`!H 0 +Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pip  P eNO0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1  wM001  nMd@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S4= -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h%}` -LAMp0P 0 MANK0AnK @D `FS@D `F) \0 0  ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostname(PX< h@@ẳ -@@ 0cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of input̡ء userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix please̡ء mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track  LHXļȼ мؼ   Yp:  (08@ H P#X3`#h3p2x33#@@`@@̿Կܿ $, 4 <@D@LT\dlt|  $,4<DLT`lx@@@@     @$@,4< D `C$LCTC$\Cdp|  @ @$,4<discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.14 2006/04/25 04:38:26 deraadt Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.105 2007/02/24 03:33:27 ray Exp $H`tt ``\{sƑOJ˻qKIc%*d'`wX\+5/`IIljwt9{~q߽x'yt^d(1<;A9`J;?~]8 PMhumn;^^mMy۶4>dN>`6bh,{sV'2:^ ̋Uo`U;|ب^La5þz( ,:jT^L f`FCn,/sKi;Lun٘n0[fjO/iܺ-X|2g, kJ O Vz+Wm];G)# ĬWm;ءWL1UָjK8F(6.- v0<$L+Ȝto׽ڒ4fxu !0c2b;kOi'єuVkGQN \JDE3v%nNZK6Ap>o`NGLcS̰xR[e9"-פ,<(G~^7f*tN,m0W hHkTz$s2{|c( ڞf>_v~j8󫳫eJՒvg3vK $vT/\Pa e0v S8%jFS0 ~ YiPhla % / *JtW/庹3}lPTotwf$7ш1&jahVKŗ'9c7CQN6$aێ57 J&Z9X\p$w6oُI I ބ䃫U5:jvPAjBb00&b9zen)` ̫THy(5`, \0Vf`@dQ>6k-Lwƚ^ո^邻ZmӸ"}m -cKVbm85-퓔w#(b?yצ)unnWrekRZ8¸Ť8z:pSԃI<|4 2谁-Xdv;n5TZb&3CC_6WE!QPt!N'G9 (Bc i՝/..CEe@Vld3h-By,g-L y.[כOyY-V(LUTXo>Q/^o);vhR0S#KdezaH rX7?($Q3OQKCC悯 ijnB06lMaLQnUEHGHxR6X.4grozYΡ}i$ppuJA`y@ ĘS gY_.N" $&WmjЧOVg0H:@lP7ÐTG<4E _kOҏh) /"X?14]d`SzlXq[rV|N|%!N9e`"GP| Cjڶ`E35b%Gp.FiS^cI6۵Gc]~.qt8!”KCq4 nWLjNٯ ]Ȉ16{e`f|*(b~M0B^hq"k[0*Xk9ނ6&7\n=LFh&9` Nv J/񚄦7`KflC+XsgT*fn=RjXu'3k_Y Yz<ߎǖ sZ5.fK3 q:n8;'909^`0.0BJ3u"Eoh ۍ >}X,UAox>Ks#qB$ms ?0ױQ^2RO+h:I<=!4m-,=az Ugv(PO)pf- Ԥ:Мu$OaC&PAZPSKh`%g7Qt=NHXh~HC2p(: 2d#.5c$a毜TN gKxz hM°B!,~s8G{ WqC @[YNߎ oQU@_Bֵm\mq[ynhZ*Pu`Ѽ6:eb=@SjȍܬiX7,\=9[3|eN8z.geT 2?p -yzn~pIY8Qp3lfhc0P+̹|qx޷9> EKH{0`9DN;ye M7vfFqAH]F9"^~ }9[OQ6͕$fq;7`gAFZ"vXA3Ҳ䰉@Kz@0zpFji~8 _n40O*SDS,.h4SH"r4KlXxP@>Ռ8JSovtHW!\j)&t]* pQ)ynr6oF V;{( 4IU8Dт:Q=Zz#e@vפ~J.l)%驨WϷ=aLx\ɞB̨QڝlL nK~6bD%D»- +ކQmD״'oX_)b:U#N;Wj1WEF!AK550`8l*+s2 7~&堘p`^c t7RXz'*l'OnUjGM.WF}l>L\5d҂Dav&Bw|5>hIm`ޥGy)UOJcqd@W&,T#E`|Za@T8"W(:ds#ŻB]@܂)-Oti E˼áZ\:[(bC rUynvn#y.j g:э~< 6IV*TzJ󐯳s-v'v6)Jqul|$ Lj ID[.pr :sYo`~NGeݠ*9i쯒8^r8L܀jM-On&kN*K:&/Ĩ, H ",4*8 &~D?(S3Z%> S=w殽Z4&NYcڲ*udާR}.&I3#v̿MAL@/4l9 MbcGl$ZQ^ϜH[:B:_NBhvӎuIcCL# 0}1n1^h/XC?\g+0&I=.,0)]^˥5s{& S"1Z5eK>Sc]KGBr#>s{i[cv nb ~؇3{u9("tvݙ77è//D8^2Cp [T41A#l}vyi>ȵROP’dZ{lǓ|SN4n}t~\ơJU/T.A*ukT@!,A \KWIM(c׸ߞ=W1)Xkʱu[`ށGEy!Jv*inW+ޙA[y v&ѩNi3&#OɤPYp,§cN0uBhdUށj݈uqZ͢l7?k"7cN/Mgh$Vz؂@iAKrcNtraMmK>4 iiVpm *4 TQݵI=.p {gZR6]m )|;Ze{i|o"c(}zzu.KФ\}ьܬsf8(7un.=.C.)q7S9R]z,)-_4a\:u_&܊ CUY XxetHHjMcV# rL4zZCB4߈>)>Z0>P| $'QdlMBpq I#I1R$~shɂOPcdẸÖ /e q{PWܱ=(_JquWߙf3y_π-=1Ny8RL $s0O:ُz`-OƯpeXn|ʡKZ8= :9Sp|J J3X `c֝W0rK1kS;kqA EI4ݤI~}{]|}'DS=O|:VJc'mO&4|3KqnK]}fљB™l髹 o΄"Q#C w]a4YjUВkgi@>Gś[~/LYoMvpӊ=&p VG}N/PsyՐbA> [*XS+ϼޣY>1hݍf挒6<̡(]k MO,jrs/\2=n?X$o)yI>ڒ }Gn3d60YmP- 7k5؋&z:5G:k b֋ QtϠ@澌 ejڱ5.L"ޡy4 ӪŔuNCsPvG7xw< /ch8]!OHx`t@,;>8jPF< >S4FiS{FGr7;,U Qxm(M!E^QjLHA ;Kfz2{o"-x,u}7JRa%qWlm[L/ %>,C?Юεrhf L䩏rz@2γiؑ똂Mo[ JÊ^ ,0Omz >#@nZ2.{&;)䴔Kx`#p2$77@\rT]ZnܺbCyJ]qQZ5 &o?p%ϥ[v=///߇^b0~ĝa]g\̜pNY۠ž.YD7t8K(5}k#,vRbh1?ߟO([ CFTa2J-s uE::gϾ*(?t!5IܪCyʒtG'pbBB3ނa_>&Hݱd2!${HCb32/uQo̊kI"IxP${W&NܨUv[7Ad`UlG*=<29C%%`=WB$er9U;xGty9n&+g(6{t$"<-yv=noѱ=!/VL>Bb!nWe]c-,RjD([p0'l.jӺC京9(}Ѹ߻~Ӷ9NXU3|@,[é6vOъ ͳ5rEm[Dt!=<tgh&K^O'#e1؜?EPfadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABEL/usr/mdec/unknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelabelErase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)can't read master boot recordwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFONONEbootstraps: xxboot = %s, bootxx = %s%sboot%s%s%sbootBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dboot overlaps used partition %cmarked as FS_BOOTwarning, boot overlaps partition %c, %scannot install boot programcmplabel [-b boot1] [-s boot2]usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.31 2006/11/17 08:38:04 otto Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.27 2006/12/26 20:58:25 otto Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.67 2007/02/24 09:50:55 jmc Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.24 2006/11/17 08:38:04 otto Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdiknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d ̃k@1kjj̀kЀk؀kk jjjophhn ou$u,v4v<XwDXwLyTy\@zh@ztzhi0llllā(ĺ8lԁLm܁lfkk kk@k kPx( 4h@hHPi\idlitliLhj|pPi i@<Hi ix(  @@ `(,4@h #H#P#X#\$d$l$t$x%%%%&&''(Č(Ќ)،)**++ ,, ,$-,-8-<.D.P/X/d0l0x00112223ȍ3ԍ3܍444CCDD(E0E<FDFPcXcddhdteXexĎ̎Ԏ܎   (,8Dlx |  d ď ̏@ԏ@@@@@``$(08@L T\hl| `@dtrailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwid-nwidbssid-bssidnwkey-nwkeychan-chanpowersave-powersavepowersavesleepbroadcastipdstanycast-anycasttentative-tentativepltimevltimeeui64destroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrdescriptiondescr-description-descrinetinet6interface name '%s' too long%s: bad value'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRSIOCGIFFLAGSSIOCGIFMETRICprintgroupSIOCGIFGMEMBSIOCGIFGATTR carp demote count %dprintgroupattribsinvalid carp demotion: %scarpdemoteSIOCSIFGATTRsetgroupattribsstrdupgetifaddrs%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCSIFDESCRNote: trailers are no longer sent, but always receivedSIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeyinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleep ieee80211: nwid chan %u bssid %s %udB %u%% nwkey %d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_aliasprefix %s: %s%s=%o%s=%xusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%lld%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFmemory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a usage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host kernvmnethwmachdepddbvfsbooted_devicebooted_kernelconsole_deviceallowapertureapmwarnkbdresetztsrawmodemaxspeedlidsuspendioctl SMODEmmapsysctl/dev/ttyC0open /dev/ttyC0/dev/wsmouse%s.%s=%d,%d,%d,%d open /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off̡ء H X@@< $@,Ԩbgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s8~eWjlO6Ul|6Nfc^*!8H-AQ~&9}X n/Gc|ڨݵBŭLR凚~2~g|>^z[[xȋb/֞~ʼn}Yld^Eb-PLC%6yλO}7 ;T[oGB/3/y̼ۙx3/yj3O LYy+LY< <zyt*O<ڻ3w B@ѽw4>X)c!HdxʅU\(s{BW _d !< 9OX<Q u fi2ibE[o qC=PBoT/ߴ\ρܑr4:>pB`f/$3"'%L̕$HEU>jfϩXh}zAC蛛Ow"d[WV,ē+d,qV ߨ|TBL1wggK2?p;0l]ͼO33̻: =k:8kE0E8PDT\aᖬ9^; #!@'d~VVJvmA$ I" ;R7d9كv!@*T|smx-M҆Jtg2rɽ?"qc:Ku zozi{çסFVI ,BD !qgȔ66X#6 uK EcU`'sݑHxRF%C?zk=kUCZk1vPOFf?H@;!OdVZ۰ɛ,j yDQO6F~D`U3LZ 1%6nj3%{x1J G5%vM8gx>f. 9I#m]x|CehMt C1.*}f R|B8@ހ ȵ>x^ f'p 9.Vg5g0Xib jCFCوS*Ăvl9 1 ӳ?ė4؇#E_O,-s Dj>o0o.aم[Ӆ1s9j鋝ta1!x8|6d #ĩM/h? \pG[7L@ /ǎ,K$a"HC!r2 ͡X7p4fy.̯xjA719 U4܆Kv")~t@2'ӌ) neRT3)+ $G'EvBıұI@of߼L@^ȝv}"vfOh<>8ٻp`J5[QpP0SvgenJ XBI-gWqFBx1 ql䴢lon)Vi].Q#FA+ rH0!? cak48T{j nYf(1MF{=.eVX#9Kf&}Q:JV36qj.NRZ@O!0UK59GsNvK:@̡mI81yxD W\>?U&(+W\u-P[YO?Bqc<ٺـsUoN즨b4\YJ X[-[u?!=a 9"9 iUBt<3vUsgZe՜YihYᬣ,zv߱ѧuqUP:s֙tޤq8,G؀V_w7v @n6jNo/̮ ] Y;T gFH)q+gE.C28,YBTݭh}5-L+hlWʋkڷf}'g$J>A GXWk43\ձa:-݄JAȫNf6cpu:c6,_fnއPI? > %F9mПb˫mBGI DxA:,7bc΄?=&.rO#ڲVXu &QPËl0OƠ Q0'}uzG9tǯ>>8Xx8 y鏆yf UضN/5&?=v XӚdx{;ofxII?'3x<ΤFru;/L S|8QڢͫT?768,"lQDj&7s-Vh.oi$Ί揬\R{WdKBoTj7>?BbbV<#8Cʃ+ֻһ}y5:r`6"/KŬf>i"BzS5xuROXU;X">m.Wj.~dG)Z+6jqzbrmuPM|N햹bm dphSk _KeS8Uϧ%/1n1Jn:Wb066 2LQ#JwgEiP4wGu]5뒪eG!=fĚ4Tֻ-qi8+ll ۴+X%GdONrmۖkvp#ռ\QZ2~ JmZa ģn*JFܣnJDZ#L*+N?ӠN* 1[c) 6Y\\>yK=Fqĝn9_GShoH+UZвnRW}eBت1 %/} נvYJoH$KP?ڔ,Bͻm|lJuYY55WfGnjƉ0Ѽҵ,sZ.{Z)tmdlwbWݩi{dfOQ5کuZn*8F(WRw'4F3-VQNF"{ƕ V /%,_ ŝ^YM?ҕhAA RP%_BAQjm?{6{X%a}gwF Dq{NelH=Ƕf6]/h7w<6$߫ܫCS=7>z| j6ZPާ[?>\C f E#L\3@Qo{q4+Ңku.Q8@8'4/oJ=Pcդw7i@qJTxbu 5 ӓ3&͏F=L&:y\GaBOtl@MCsMXO17YE4{"=0 :NE *tڷ[h1t刊tc]8 p^ K\ÂwtIk\81r2.vb4>G!/(D⇟ Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFOBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]̡ء sl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p  `@dUGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [ -T tableid ] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, table %u, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' Too many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s:%s): Name (%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] ̡ءh@ *Preloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node ,0"GGGGG%^HH H  4H& 4DH#LH$TH\HdHlHtH  H H!HH W\nJJ J$J J4J JHJ J\J JhJ JxJ JJ JJ JJ,JJ,J,JJ,J,KK4KDKHK`KpK)KKKKKKKLL4LDKDL\L)pLLL)LL,L JL JLM J M J4MHM,XM JhM J|MM)MMMMNN,N0N)DN)XN,pNNNN,N JN,N,N JN JO JO J O J,O Jpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory lntnxnnxuwtp `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@drtr\nr rr(r~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %ld, offset %i, size %d blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZEILLEGAL FRAGMENT SIZEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKcatchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)and ntrak File system performance may be impaired. rotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.23 2007/01/09 08:37:44 otto Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.10 2006/10/09 00:23:57 tedu Exp $$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $$OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyX`H8 P$! T$0 P& `(0 l$ pG |0@ |B ? #P& % (0 (0 8> ,  A  A UI O J e Y e Y V c X ȺJ кX ܺL[ J $^ W Q Q e J \u $hK ,P\ `d -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$(htfc,d<sLl`mpn)p  D \ pܸ <    н  ġ h @ @  pP ` ( 8$ Dܶ P \< lܫ  x ԭ  ا ę  оH ܾܙ (    ( 0 < Lt h@   , Ȫ  lL ̿H d\ |    4 , 4hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD<|6++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():XdpIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }||(@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $xacei\k$lXLmCnfb u (prH^s4hv @HTdtxlet,4<D H  8 P X`Yd{h}(lptx| ||&&!()49>AD]]<> ,@|HJ X d d tlx@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s $@PlResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uP 0 (08@DLT\dlltSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2H`4@LT`htnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem,<HTpx 4L\t,<HTpx 4L\tHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanf,b0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call8<8<8<gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8<DHPЉ;T`d    <@ T\pxT, @,P\8<PX| !  " ( D L h X p x   d  e  f!!#!$!PError %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log"""""""""""## ## #"(#0#8#@#L#T#`#l#p#t#x#|################JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding(&8&T&p&&&&&&'('D'h''''''4(H(d((((((; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH0+D+\+x+++++++ , ,<,P,\,t,,,,,,,,-,-L-\-l-------.4.T.t....../,/L/|/////0$0@0\0x000001$181H1\1p1111111 2 282T2h22222233,3Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium type,<HTpx 4L\txdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZTLX8(IL\8(I?nx8(I?n(dx8(I(M\MPh( ?(܎lx\Ph(Ih!8L.? ɚ;` ...@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.15 2006/04/20 02:24:38 deraadt Exp $X`dlt| X$,Ȅ4<@HP\n\n\n\n\n\n\n0\n\n0\nL\n\n\n\nT@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.17 2005/04/05 01:18:53 jaredy Exp $4TX\`dЫ8Ȯ$OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.28 2006/04/13 03:14:18 dhill Exp $P.$OpenBSD: print.c,v 1.24 2005/06/15 17:47:17 millert Exp $$OpenBSD: util.c,v 1.12 2005/03/24 22:53:15 jmc Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.dAȨبZ|o~/>~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg ltx؀|؀\Эح "" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)a8b@4TBtcȹdA(<XepfغF gDdhĻHAi4TljJ!ȼlHL m 8HXn"d|pHPqr",$Hls!ľS!$u"@0LVw"dx(|XA4 4yTlz0"~!?|#<,.AL\P (press RETURN)... (interrupt to abort)tȯ381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUԷz@|hqw,0r(L`tD\{d 4{8xs#y z4z<ȼzpz`|t,$ԷA$BPC̟D4EDFTGdUlVTatbXcex]fhiLlnqqrsv wx$u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.18 2007/01/28 16:23:58 bluhm Exp $$OpenBSD: mount_msdos.c,v 1.21 2006/12/15 12:48:29 jmc Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $`\@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.15 2006/12/16 08:49:18 jmc Exp $F(08< D L \ ܗ T`d|hlt|$Lx !"#$%&'()*+,-./\n0D`<\|  pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL JpЉdx,)T,\n(GdfS,0"p!L8d!RV>P_ܜ,QSHV؀0=@PCS|84R P"T<\+;<$8Է,4Rx! ?,De `LC4`$ A<|E/MD|E "Hc4De $P$Xd C`pXhV)<Dep^x=::hT"KȼRN+*HI$C_RMd _ ":PO(c$3"^lx`!8,$QJ\:S`$|""" 4@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.28 2006/06/01 17:22:14 dhill Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $4( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.17 2006/04/25 15:41:07 deraadt Exp $k$OpenBSD: cbc.c,v 1.14 2006/04/25 15:41:07 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $^$OpenBSD: main.c,v 1.30 2006/04/25 15:41:07 deraadt Exp $,,_H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.32 2006/04/25 15:41:07 deraadt Exp $\n$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $lppptpxp|p` ... ...X`dlt| X$,Ȅ4<@HP\n\n\n\n\n\n\n0\n\n0\nL\n\n\n\nTwwwx@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.39 2006/06/22 00:25:22 deraadt Exp $lY $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.52 2006/03/09 13:35:02 pedro Exp $̡ءh@ @@ @%s: can't read disk label; disk type must be specified4lčЍDt܎4dȏ0$OpenBSD: mkfs.c,v 1.50 2006/03/09 13:35:02 pedro Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.20 2006/03/21 20:28:52 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.29 2006/06/14 02:14:25 krw Exp $    (08Dt@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.18 2006/03/24 04:17:26 ray Exp ${}abcdDgGhHilnNpPqrs tw xy !:#=<@ P||  0@Ph ܜpP 0H $  _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.17 2004/09/16 08:35:49 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.33 2007/02/16 09:04:34 moritz Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $X`dlt| X$,Ȅ4<@HP\n\n\n\n\n\n\n0\n\n0\nL\n\n\n\nTBKMGTPE@5MS7) xxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuuxx:xx:xx:xx:xx:xx0<Xd`0< Xd x  \M  $0T`\n \n4<\nt\n|\nP\n\n \n#<\n\n<\n\n\n\n\`dhlppEtx             < $!8"H#T$`%p&|'()*+,--..//0B1234567$8,98:4;@<P=\>p?@[\\]^^__` {,{@|P}\}p~xP9T990:8;?\nX`dlt| X$,Ȅ4<@HP\n\n\n\n\n\n\n0\n\n0\nL\n\n\n\nT  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzl0123456789abcdef   T!T h!T  4؎X܎ $:=4=L===BABB$BpBB FhFG HXHhHHFF@GG HXHhHHF<MHNN`OOP0QQW 0000000000000000}x9|:::N$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt$44N%e+l#l#5p#>pp#C# J#Q#Z## _#f#q44~#m$a  un}of!NI u p + & H  H _hoststated*YYHostState Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X S   nobody*Unprivileged user/nonexistent/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"yt:5 _ Z  z u , ' _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hoststated*YYHostState Daemon/var/empty/sbin/nologin1_hoststated_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 [ V   E _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_hoststated*YYHostState Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 J E   p k * * _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=41 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -g0123456789abcdef K^)8,n,o,, K^))3),|:)>) K^,( )!))8)') K^--t--d- K^:v,-t--d-|p,,, K^<a, K^+d!- K^,b, K^)8?)--d-L) K^8?)--d- K^---d-|-t4H^ K^'@\A,A,@2X Xd$`K^K^M^M^M^M^M^K^K^M^K^K^M^ ʚ;5ym8@ E82(@AAA==(A*TK^`K^dK^pK^lK^K^xK^|K^K^K^hK^K^K^tK^XK^\K^K^Q M^M^ 5 c4 c5 c5 c5$ c5( c5, c50 c54 c58 c5< c5@ c5D c5H c5L c5P c5T c5X c5\ c5W`@-5W`t-5W`-dO^t5t-O^0--05 --8-- -L-p-$3,3<3L3P3d3333$3X33D3L3\33t333333(3\33Ĕ33,3`33ȕ3303d33̖30t--p5Ԣ3p3x33333H33P3P3X3`3P3̥3T33 3 3P3H3Т3h3Т3Т3D3--43-555(5@5P5`5zaurusQ.R.ʏ#######0+########################################################################l0000"0,"0#####D!/h?/l?/|?/?/?/@/8@/@/@/A/A/8A/A/A/A/A/A/C/ x{x8{45  _/l_/0 -44ddd[[d[2d[2d[(Pdp[p"CRd5pX//c0' c'c055$s ?/ 5w^x^5tx^x^=w^x^=tx^x^(4y^y^(y^Xz^Pz^{^Uz^{^z^{^z^{^5 5<5t{^{^D///>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy50000000$0000,0,4t000|000h0<0D0t00 05$5,545<5D5L5T5\5d5l5t5|5555555555ħ5ȧ5̧5Ч5ԧ5ا5ܧ555555????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 ^wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpؖ^^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް^^2^)C^al^^^^^^^^^^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~^oF^^^^^^&^!^585<5@5D5H58N1N15< 1L1Н101  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  |551x11("M45D5*55# # 55t50w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-\5{{ 5<522l2 24222222$2255P335`&3&3t5*3D3E3@3@35PI3|I3@3@35hL3L3@3@3H5LP3xP3@3@3d5tS3S3@3@35V3V3@3@35l\3\3@3@35^3<_3@3@35pc3c3@3@35@g3lg3@3@350i3\i3@3@35tl3l3@3@35o3o3@3@3d5r3r3@3@35t3t3@3@35y34y3@3@35|3|3@3@3,53@3@3@3t53h3@3@35333#$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident  ! >(6(.^>4^>S9>D>9A>KD>q  @@4F  6^^  76| H$4v$/\"8:/EbR!]2$f+D 2D6@+6<ܼ-،%/'!tܫ0ho^"(+/x#,72LK#l^- k6'y 8+h}^?6$6381\"E6P$2dQ^'I$0$h?`-6UD6d]'\wp -l=6$#\!2$&6b2x](,'p3 %De1% ,d5`a#XE,6L/Td{#xnb{p^ l3T<_3d/?6-x !0/ `j"\b1Ld!'<!1,2m)8B"hM'] o q14(c 3<P%p.6$$ @-i96X1X3/ `2 *S"@%U h5<6> <PA,D`4,6Pft0<u!< "$0k'4x3&s0d/-% ^ t(p p1 H^&$ .& E6: \1pT V!g pI0\t "T / Q. ;64 |3  l1 Lr,` %D ! DbL# D/0.H;4#B + S 3ha<]&n/|.pv(H$63)i1Tp&h"@0f(U! 1d $*(3(3lY+CD%R4 3``<\/h "t;,16$+8 00%  b,6'D#d%T\r&l " w!8#' B `LbX^b XpV+[1@91`#d/`aY4H!3@-c$K$<{+$(0,3X3p:.#PH3ND 0\XY0j0*v'}|?/%"0U0a|^ 6XO1$/H3+$h|'#x2x5\/c>@/cN\F-tX0/e/"c 2"cLx1x?6t&hć1$l"\ 8$2"X2H11>X1$S@6]2k42||R1'L|0 $".D@+ t36D"$!1T0A-X>+Np}1[1l &d&}"l%'6#ttbD3x%.\b0"(xL%@lW/$+k!9^FD(cU̖3g\ar !8\3tm1Ȭ'd6L2<0`^T06+ ̿"00.^1Fh cW -g$1x,#q0$*'Td]"\b a\"a"%ta@#6"p7p*G"PTm.H \$3kV/8~8!tA6X'"$68'86 .4j.@,6 L T/h%Db4bPBp/TU b^h*6h2r0/P,u^?6@6P-$a. '*L()LB6J(+%58-JT#Y$6`Dbkr& xa&0#x4.y308c ./+da<3+@ |&T1(@&<2b0;aG&6Rt2\\<6fܫ3n!xz"c"/0@\i+be22-40`1#Q^,T!;^F^O$"Z"cd!oe#y "d61A#@#M^ (tl3,3w$( ah"h?/*<4+; (4Ip#].Dlha(| (1e!@h8!26P 'xY2"`]/db*"<0`$9`)HD# LC0Zc!Tg]1pd0"c$3bP^3ua h0)8Z%h0,,s2l8% Bd(8S'8id~"(y6 xP.L34()l//38?6\/x16$\h1L0(,TY!=L2Iw( ST&\8<0<h$6wH2#/dH/܏&h=/#}$ |,#l%!h.X 24 ,#|# +. b7 \66H %6X (!c 6q 3 "*  $1P T.d T& TX.t h1L b S%!X%% !Q^!L!` !#`)!$ 3!*C!@&O!L1b! ao!lp3 }!^!TK^!*!^!B2`!Hb!24!-!! "$2d"@96 ""\-" 'x?"g1(Y"(/,li"L,(y"0"+("("7!4"Q0T"%"D^"6"3"-<# !#c% # 4#\/2A#Y$K#%6\#"cp#F2{# 0'#A%L#2`#@.#b#$ ',#xr^# #@3`#u^$D3$08-$@.T5$D/6I$t>%(^$(0i$v$t$#$"$ !$+$$3$G",$b$*$$6$,"%1 %.p!%d)/%x.3(<%D0N% 3f%d!v%"8%0j+l%&T%t&%+c%b%dJ.%K^%"\%Џ(p&ܽ3  &/X& %\&&. 8&&\E&8!X&2$e&i0py&h+&X\18&Ā/<&T!c &`c&.H&`H6&, &|$6& 3'+'h<"L('! @'z"M'D"@W'.h'16'q^'+'l cx'/c'&`'.'X.'b'<6'<6(|^( b'(0%1( D(,*Y("ck(*v(0($'c(@3(Xb(6!((6(P^(`%()(>2p(M^ )l$)$56+)t!X9)2@E)P/@W)x&h)>%{)\"8)$B*D) 46)^)| ")Dw^)%)pu"`)b):/)'*A/*$@62*T"G* X*-n*|1*" *(%*d *`&40*4S&* *`7,*40 *ԍ%*.6+|$/t+&"@)+!5+#D+2$P+;/d]+K^k+M*x+/$+0+dO^+ +s"\+-l!`M-1Z-%8g-8"r-d'0-(*-L1H-t8,-R'\-f!-Y/0-3-% .+6.P2`+.'6.Xo^>.T3Q.L1_.\3Le.,$ n.Da#.74 .<%.3.M!x.2.PH6.*.P62.X1.^/TE6/8*8/2* (/%06(H0@!!pR006\0"h0 h|0.\0&0%0$&"00 &60$,h0%0+$0*1/1!1$ (1:/@<1T#E146O1,$4b1L' u1 b|1pl2\147!01-01q^1Pi$1?/d1Ⱦ0(1\K/1&1%X2~"P2w!$"21H12l0$>2?6N2xbX2,u#|e2-(w2ܜ$ 2N1$2hQ12x'p2p&2`/2x$2P%2ȕ32 u*@2, 3`% 3%x3b4 "3@e4*3 53D-F3}"tR32c3:0pn3+{3,h3(p3 333 b3a(3 3 3m23%<4t#h4e$!4@6?4%G4$3\\4L*i4h)6p4d4Au4ā!4<^4e0x4&64A.(4K+X4 / 434Ta4,r"4x!L4,_4  5b52#5(6*5(8095]96O5Hm#a5K^p5'H5r^5*,5#5L%5^5L65r0\5H^5'.6b4  6t^&68"36e1 B62T62c6C+u6T0L6q^`6l 6!$636h}16 .6%62 6"6|26$7) 7`?67!H"704x.70!4A7|.K7&H[7 0o7]#}7E278967pZ1L76H7Tp"7oa7^7$6 7xM!7u$|7 7Q^8*8P4 '8-c28P@*;8 |C8 %N8G3[8x#i8#\q8ģ2x808f%8 08808*838P28l38tg#8أ#8Hu/ 94 ,9|92 9'4 .9-@9 ,2K9/b9d4 l90"p|91939\29X/@9W"9b9|:) 9U#9-c89-(49dz%d :`2`:1X':i)8:'hR:"\:l^&Pq:D%X|:b:^ :B1: (:3:a4 :^:+:(/:d)#:@#:TD";dI2p;|/L6;l'TM;6X;!c;bj;1v;\$~;w!0;P$3X;+c;(6;ua@;t !;j.;P1x;Y!;,# <a<8c!<d&x7<0\A<x96M< aU<f$Z<(\$e< _/Lu<Ԁa<2<0`<.<0a<$<D*D<$x<%<H#l<n$t=-=)p =Н1,=x+<<=h.6S=4-6k= 3 |=/h=)l=$0=X.1x=^ =>64==1=3= $="\>2>x/2l>.`!>4|#D0> ]%;>^00K>@6T>(_>8N1po>%\z> @6>Q!L>(>#>_"8>`!c>.`>oa>X"`>d4%?3?1?pO2.?- 1B0,B^B0B,:,B@,( B8A/pB3C#hC$ "$C0t>C#ICXaQCD/`C-qC,6yCDX.C 'Cą!xC'0CcC(}"\C#C"C | C )D|2h!Dl/(/D.'=DM^MD``'aDT#$fD2xwDc8DbD!<Dr^DT%Dl3D}3DP,cDT_#DT/dDH3D k2 E!E'0ELb7E$! CEtaQE_2l]ET-nE$wEȌ"tE.TEH26EaEK/TE(#$E#HE1lE`,hEl*\E03- F "F4-)FD/c.FZ&>F-"lRF ',`F csFX!tF$F!4F8k&F3F<+2F="FX0F'F%$ G "TGh!!GS3-G 09G/8NG$`XGt^bG\)loG @wGl2LGX(G@u^G*\G+-G$6G3G+3G0G26H H(#Hr+42H)" GHbNH),_Ho3,jH4A6xH 'HaH8&H(- \H/HbHL~^H%HP$Hl66 Ipr%IU-(#I}/h2I%:I&JIa2t\ID*gI3wIh"t~IX*Ip0(It"`I2I3IPA6 I<"LI\2dI!<I%!8Jl\3xJx3J%)Jax7J<-|?JP$KJt"$UJP%^J$h3 mJ06J%@J4y^dJD@(J$$+@J^JDp%JH6JdH6J4,$ KaK&6K/.K,/0?K0lNK"cZKx18lK"(yK/(K$6KK^KF6K&K^!LK3K"LKuaL((4Lر1-Lؔ0p:LL'@ELЕ!<WL`*XbL<"qL,y%LXf0dL!hL3Lp. LQ^L PL)<L,z1L0 M(MP(c'Md)$7M|V! IM"HWM"iMi.sM@&4 M<cM:', M(HMx/6$M,"M/<M=6NH6N1 *N/D5N^IN$?6VN9(XkN`&8yN,aNhK^N؅+N`H/`Nt$ NX#\NPV0$ND'N\+OS"O/&$OF.:O&LKO[1tcO/oO+~Ot$tO#DObOP#O",O!\O6O<0 Pq0P(b)P/c5P" HP']P@cfP2(qP|-~P$0PD!3PhbP̕#lP<3+PhV!P#dP"P@!X Qt+QO^%Q) ;QD"IQR"TQ"`Q.sQt&}Q`2Q0Q(0XQL-0Q,96Q,o$Q(aQ4G6Q4$Q+R,&PR\a#R$3:R.XIR3SR(28]R|.0gRs%uRk!R cRA.Rd3'PRH&&xR^R!3PR&R8h$RD!R-R%DRD'S83Sb-S h>S'lQS2\^S,"xqS) }SaS8^S^S1S#Y|"+Y03h!Yx'85YT)2@Y'PSY%_Y^fY_/lrYO^Y6Y6,dYXl%Yԟ$lYV3tYxP3Y$v0tYuaỶ!Ydj!Y|0.| Zl&XZ("3H$Z,3Z*AZ&RZ( x]Z/3LiZ0/xZPb}Z<& ZaZ8+ZbZh*@Z>.Z1pZ6 Z3Z-[0a[!H#[Q(/[1p@[%6O[r3[[L/6$i[X.p[e!D~[S/[-[#)|[-6[ k+[2[H0[A/[@+|[j.@\(=-P\0@3\lb>\aG\,' W\i0Lj\2u\a*`\bX\"8\ *\\( &4\g"T\s3 \P38\L#\̖#\ 4\%6 ]@6]H*6-]b'<B]# P]b)MbT6_bl!,lb-}bM^b(`b$4b(b&%b`}2 b&db bw^db$/Pc "c`^chO^'cxt%@9c42$Bc%0Mc8 *\clb%XfcM$tmcbvcH-c,V*Tc7)ct^"c6 c/0cbc@%cH-c)d2\ d\adh3( d c1dxK^Bd Qd+cd<>0ld 0dȑ!4d (Dd81dh/d8*6d8x.dh, d`. dY2t e/ #eP26$1e"=el.8Ieh 8Xe de`o^ke@Z*|e!e< ed3e.e'(e@H6e s e^e04eT&"f,<6@fd60fi%dHf~"8Xf efL1sfpcf3f8!f`a fXbf^f-cf2-f&fbf\)fz$f8@/dg-6$g/h8"Fh6@Wh@!3nhh.~h02,h&Lh.6$hN!$h0h3 h$+,h/xh4 /(î1!iM1)ib3i"cEi3Ni&[idw1pihx%xi*iXw$il1i id^i4i*Di,%@iS)i00iai2, jD "djV!0j= 8jhe%x=jC!@Gj@3[jt'\qj0}j&0j2&j%-pj"j\3j{#0j /j6j&! k6k-|+k 06k3%k!$k\^kt3lܷ#l4a#l 1@.lK^:lL)<Fl$Pl*P]la#hl/$~l<.l@'+l@%tl\ #l0 Dl/cl3l1hl^,,lb%l+mL /m(*m!h5m#L=mB!Sm3[m2<kmZ&ymB%mam8= Pml-m&(mdw-mԞ1lm<6m0/0mT+ml_/ n6n 0Hn'<6nD.Enp$Nn bn,&jn"@xn\3n@K.Pn3n@6n{+n cn%6n"ou^Po|66(#o1 3o/Do5&Qod$Xo 4#\do8b4 qo 3o/ o$o+o&Sx_1T`*Tm,6u%D2# ~1&u^ *|#dR!D)(0E3p- T0600pBg*Pu^(^)mx $}X24)&le&X%@€l^#t΀N!^'\1#P"#)`%5hm)E!QaXL 2l/|/&6Щ#t44p&ʁHj%LсP.Hځ<<.8A6T'A6T"E!"}$ *0hA3L\-8\6p&<vA1\ 22\<%<p/'ʂ0тr&߂2h4%PԆ^ K^4 @2 -8"A(/U+Xf3v0ě#l6P|Y'H'Ƀ3`܃Y!/oao96%b/*8t16$I!'Y/e%\s( )~С'<!D2HxbɄ!ք{+߄X!!'$`6%0 b)x ;0J 3b%6j'0vK^$,30,6$bh^҅`$'@ܷ݅3<P!w1L%)@A6"'\)d&80.<*6L/]LN2$fP3{'(!DP28#p0-*6ˆܠ3ӆ4#$0ކ!Px)@~& H&+r&H'd6 .3H22Axd1Zd*Xh,3tY.,P-4]!pܛ$4,/tg%tŇ"c܇$H.|A6" o1P**l$691I3WT3l1{ /'b3h$&Ȉ[&׈a݈4'$LU1 b/HH/c,)9+(pH @TV3,_LP3,j8t^|Dv!S0(&T/61׉&6@a) , 343 F1`*2A&6RP!f0k1x$606$74 \/xJ18e2\ʗ,e2dؗL)/ ` c0H#a <.hG$%0$5'+CA6V 6gp/lz5&,3,,TP!XN3ǘl3Ә"c/ą.( p^0,1=aG1Pt3`))$k $uhbHL!xH2LD$4`3Йp*6יP1P.@0co0 !&Ѕ#<7b@'H\`"deasv!T/ Pl0,&0%e*HȚ3ܚ3D|3!P3s0`)\_.8K^KN% T'D\%<i6lP30A6 31d *)pƛp&tٛ `.x]3D1%ua*06'|}^5+dI@2W,6a`* s`30}%$1t@6v%H#(ˡh&-pP^C2\5.ad1\j1/8)9.$L$UDE#ax"k/}3bt0,/4͢!TԢ$ߢ3.,xH6T##0x"4 L t>a$H2xS1kf0X}3XA2L\/.܀a1ţh-ͣ 6<& 6|2\%t p04%PL*L4TJ%?$H`0\,pk&x%4t(8B6&`#"q^Τp"ؤK^0*0c@|%L1 \!/-@'Bp^LH$[#c/cz' 4v##xH1Υ*|*8)h^1P^x$&(90/0L4G.$_3i1}H&bd# \u3 t^0LΦвa֦03T $l0B.H'"c"b0P&6=H.P-/^8?)tiT 6(r3${PI3,@6TD6dh#`<3ЧX 1#2a #$i#`!-4,I"R1H_t-4p.|}-ht)`3M$3ͨhL3,ب'3dc'd!0؍1L.*P="K&0['6iP,s }3D by%p$L3ȋ2ũ,0DЩ/۩bx(& p/xM^<)$,8X+X?e#G'\*64g61+lX.Lb,^b3ƪ \תT/ad!c,&C196* $x2 /XD)$\M^Wdbc%6o8!4^,^ -cT0@3˫'6ҫ2<ܫ?6.-p t$06l3143G0XV %Ta1#4l1uC1$ L' 1H}%d096Ƭ. $ԬHl%ڬ "c )lTZ!$,u1l(hB*64 A@-T<*Tf , d@(/6 a0H K%|̭xP1߭`A6b8%$(\$$q1:PG1(KX*6[3Lc<6v(-|.@K^$&&H(2p;0^%Tʮ1Ԯ)8 #  %H86 Lj1\#&3%6?h 8T.0^ bh {1 3 'h3+˯r1Tٯ,(D &"h&(0t&3(/X&,=!cG!c]3+Lnlp$wl&"'6X2Z0\dU34h#`İ&4Ͱn#۰$!02&4Hr^$P (6v3 D ~#TP-#\$j,^vLH6t1`dR)\8%@L1dƱ#ӱa߱p3(`%h8$4̧1c(`~^8AaxIebR0,e*@yp%ܢ38%@P4 /ɲ6ղ"*޲P_4 63L +7!4r0,8L&Ia W/\j&vb,"dxb$a$T~^!Pt/`%ͳ ,ڳ.*?6SR2\o0p38w0^& "L64/L ȺT&6$ܺt`!8< 6h!4 606 $`'-@6l%0?Б#Lt'Da"Hhau,2\0!c@%$3@2Pл*#,޻a#0|\.Tb `b t* .-FPg.O,V \`'tmbul0\|+@Fd4d5$lY4^`!P^ȼe3(ּP^߼a/8/L/c"/ Lb.P36$>h%DG6,`^"*h)Lub"8)0R"\^i1\ʽ*$(~^02%P6D3((+h8p(XG_,XE3Hf1$o/H6d)6lg!(l.`.t b¾"<о )۾ ^,B6/  3x-*(<'6L0"$Z8&f,(v&4H */`e$&d$06$ҿ$8(p$@h$@+(?6%# x#P0!X@V! R4R/ f}+r W/$'8*1dba08t ,2$l}2 34PXY1/B60C,^Ly3,WH/k/0xbu2|%/*<,6PL"l3+@b# )l7%%/4<-E+N&3Z1e|c'}D$!3H*8&da'Pl&^x/h|p,P@71.-:P3M0G$T[#o@1H}( / +(L@a&<0d4b`a@+8p3, h, (b00"@C8!M6U|3e ^w /De($D!p, '^I21%<,b4 +06$ؠ0 $/#0>Lr^DX/\)sT#~0\t#h3d#$x/xL)$t+!t"Hx^\4^,420(!.@3 CLl1YX*/hK({0H /$px&6$"H"p1!HT1| bc/ &(T7aH,6R0^H*l01|L,\DD*D1r0 `%F$"|D %HG! x(,T(Y!+И263Il1d] !i1`z0d>,|y'2L0HQ^M4m.(@#p+ ^(#4Ȋ%t?Hi1TV.^U!q zp/`"$1 %3T %xX1t.6T6 )\3,&b-4^4D#0F`4 RĠ&Xb)n-lr^ |18bt-M#(0p `!T_4 4,X3T*'HH#d/a2A1 K!c[p'gx!Xu :0D.6$:3t8(-cO!pA/4W$ '$'8 l>%"A/4D00OXN0X_ 0iQ^y$#4(Q.\6*^3'3"c`38,tv#Tb`1%Tb0 DP/Tе1X^HB6i$dr:+*p|1P bbԀ2H#*Hī%HR!&T2О/P'`6,<6^?3D.K̴%(W'/].elO^ ~ cLU' ^0 b&+L P3b%@h1Pp+(/,6s$XA@ 6K*Q$Y $]t%g"$u4 34<3 m+'"d$B6A6ܛ2p@ L6) L+6'9,X4Ĉ+@T24Nx.\x|#h0{ -`6a'bX'`,  b.6$X%2.6 3 2h/% :Y3TH0Q3 V^4xf0dqh)lt#4X3 ^!@)$!0  (L%*#,6T3'b1\7F$Gl*+`&6$v$26$g.@3x"<!c/6 R)Hat.`#h!c234="K W'Th^u/(n,LC+@d cQ^$#,/(' Hz&d"&l1h5*1HBq^Rt.b7-lpA6wd -6$ 3LM3 .D304<X'L@J.$H2|!c3a'm1`Bk(L]"ZK!0i2`|P'2h% X0T TS/<B6O"^/\\*h \A,x|q0.t0;+@B^P-tb$.0ix%w&@%3\ b!XLy* `&\*Ȩ3=%%!@%< Z1 'L-ds'=#LLhA6X* fbu043[1T/H$8D!<2t^  q^w"h06$ t L1T%);ܽ&|K]"4Z63Dcds^@vK^+D>%/<8V/"4/dث#/Ll?/"65/$E-U0. b,/ln7.{4t-\0X*2l/ct/'" !@&|̶a'"c4t <$L@,810'@32J1U'liL%$pwT*4X.\a1\2XT$1T76 ^ t\+o.6{.$h@*,3!)L/$aB34S)#-6$&\/,&|'.|2M+B-PR"*]%(6`#`G bVS1a(bnL_!|B!02Ԭ1xl0̅^P!U!# | 6a\^ 34T XB@+\O 3Ld^<q@0h|w+aP./$#/3L-$\x#(%L bu/01'P%#4*^2r3=/VX+0d:!{Y4|, (D100\t0/h2lX' ,a- $, ^|2T4h. 3 x;6*<%9 (F&HY@20lj96&6P$T74س1tE6/%<-tp2^$\$G"@w!LB%<Fp%QL$[&!8n, &|Db' T;6y# $r^P0P0t|>/V!*l<6?%I Z1PN@/`` blr$Xud2ȅ^d+A/( bT/$31`1($&6 g.</ t-00)d&$:$EA!(\A6q4%|a ^cK^[3\2X!!" #". L0"t3,<",R"b ["/6q"x bdy"`^"`J&"f3T")L" <6"^".".")"d%"l1", # $\#/*#h68#!`B#.PN#&0W#*6b#"\p#`[/{#`1 # -#H1D#M^#H6#x$#|)#$1H#23#hK$0#\6$l#$l X,$,:$3D$!HS$$I1$_$%dh$k2w$(1$ 1,$E6$T13P$V1$c0$)t$%$4$$0-$tK^ %"(%Ā!!%& 3%O)TB%+U% b_%L&m%.(|%4?6%(#%3%L3%2%Т3%d!%@3<%3%0` &D)6 &60&64:&82 G& @6Z&?%xo&! z&3&^&p"3`&+/& %&3&~0p&l+c &4H&&6'\a '/H't/.'L&:'aE'0cT'*a'+6$l'pQ!$z'/'%|'a'a'3'<6'[.'x!' 0(1(*#(t 3H3("1LE(h#N(a4 [(@3k(- (p3$(`-<(11p(l16(%(/(=1d(`G2(i0 ) #)`0)$0))31) l>)&6N)l$W)P2j)(r1hz)/)$3)!c)')a)Z.)*L)T<")lM  *x))*3#*l3/3*8%=*4!DL*D34Z*T^h*%q*$*"*/6$*s^*F1d*"c*H.* +4*&*"$*D /**+D'+ 0!+b.+{%x>+,&J+'0V+b_+am+HZ dw+ +A*+)&+tH +0{1T+a+%+p!(+@(6+t^+&0+%,,,,Df$,m#|',^8,0\1([,li"e,X!Ds,+,2p,$3 ,(" ,Pb,P-,!,#8,D&,L!D -T00-:,1-/HC-y^\h--Lt-a}- -` - 6-ؒ+-(9,H-\c-<.6---) .6.6/P".1(HP1\(t[1&&(d16q14/(1t&1Z41ԁ21|3,1c1! 1/1Ќ31H0h 2|b2p'*2#52E"G26(0Y2^f2T&r2l%@}2(2'216262,|2c96203+|3x^34&3@73l((E3L',Q3D%@Z3%Td3al3/}3"3|F/3 p3*x3Q^3$J 03X%D34*L3$*(|3 0 4+4L#,42D94p"L4"W4cf4?6r4d%T{4Z+4L)4$W#D4+2\4&04|.4D't4D_!424,s0h4 -T 5\1x5465<.05x+c 95v#R5D/H^53j5T+$@t5A65v+|5ī1`5=65"c5HA65;- 5;65b62 664%6 0/6";68B3pD6%TP6bX6D#Le6-636#(6}!p6*/6 b60x6|d16XL,\6b7^7g08 7X337Є^B76+PP7p !d7\K^r7@az7(\17/7!P71<7a)7?67b7 6L7T1(8 b8!`"8 b*89&98&|G8%6Z8#i8%c:j+r:1'p:$': 8':& :d/:1:):bl:0B6:|$:26$ ;0,,;'"<; N;3([;'g;^q;^x;*;h^,p;&8;8&L;8B1h;Ă% ;H(d;3;L'l;$8<%,< /6$ <!)<d3;<,z-(N<T66d<(-w<'p<]&T<(3<&h<'4<p^<,"L<16$<-c =b"=P6>e1P7>6)D>43O>|t2a>T#|s>L#1>(d(>06> T>Ta3>DB6>X,0>t*6>">|I3?Z-?w#?H6((?)t1? 3B?T+Q?(!Y?G*<c?#n?@3@{?a?ua?tr^?|$\?,&H?Y"?1?%?42?.?"P@b@b(+@.c@>@$LI@ !@Z@.j@3{@1D@b&@N!h@$@a@J0@&|@"c(@,4(AX"A?!t-AD3,8AL2BA3^A"lAL"uAX/cAD&A%A]1A//Ah0PA'$Ada A3A1B DBj3 %B2|4B$3>BaLB ![BZ#eB0<uB6B^B`#B`/B$HBH)LB.@B\;! BQ^BQ^C$4(C^!C#$.C*#t