ELF@404 (@@0L65P xHP rHP nHP jHeHHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H H  H  H H H H H H H HP EHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H5P  HP  rHP  nHP  jHeHHP  ^HP  RHP  HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H H H   H H   H  H H H  H  H  H  H  HP vHP  HP ! HP " HP # HP $ HP % HP & HP ' ޡHP ( ڡHP ) ֡HP * ҡHP + ΡHP , ʡHP - ơHP . ¡HP / HP 0 HP 1 HP 2 HP 3 HP 4 HP 5 HP 6 HP 7 HP 8 HP 9 HP : HP ; HP < HP = HP > HP ? ~HP @ zHP A vHP B rHP C nHP D jHP E fHP F bHP G ^HP H ZHP I VHP J RHP K NHP L JHP M FHP N BHP O >HP P :HP Q 6HP R 2HP S .HP T *HP U &HP V "HP W HP X HP Y HP Z HP [ HP \ HP ] HP ^ HP _ HP ` HP a HP b HP c HP d HP e HP f HP g ޡHP h ڡHP i ֡HP j ҡHP k ΡHP l ʡHP m ơHP n ¡HP o HP p HP q HP r HP s HP t HP u HP v HP w HP x HP y HP z HP { HP | HP } HP ~ HP  ~H ġHP  vHP  rHP  nHP  jHP  fHP  bHP  ^H H HP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~HP  zHP  vHP  rHP  nHP  jHP  fHP  bHP  ^HP  ZHP  VHP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 5P  HP  rHP  nHP  jH eH HP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H  H  H  H  H  H  H  H  H  H  H  H  H  H  HP  HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > ;8;;;;; ;(;0H )@`  > !  > ;8!5 > 0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >  9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->  %)> # %"+/> -> +cP> "`""#t@>  h;x ;"`;" @1@ l6Ҋ@@2 @ 0P -@ @ @"P/> P->  %)> # %"+/> -> +cP> "`""#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @1<t x ``-`܁ @10 tx Ӂ )>"@"P -@ @ @"P/> P->  %)> # %"+/> -> +cP> "`""#t@;x;;>"" ;`#h#l;;;;@ ``htx ;`#h#l;;;;@ ``htxr )>) P@)>) ́ P -@ @ @"P/> P->  %)> # %"+/> -> +cP ;`@;h#t;x;;;;;`@ ;`htx, /> -> +cPۜP -@ @ @"P/> P->  %)> # %"+/> -> +cP ;`@;h#t;x;;;`;;@ I;`htx偌 -?P @c-@-P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P;x> "`""@;,/,;@ ;`,;h)> "p#p 8% 8H  p@ @ `E < 0x  +?P`-- -?P%-?P0P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P;x> "`""@;,/,;@ ;`,;h)> "#pH  p@  "`@  0@@ t@`x) `E <P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P> "`""?P * * ;`@;h09P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P> "`""?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@/`h ?P `*  P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P> "`""?p " ?P "  ;`@;h@ s`h ?p " m @/>  @̀->  $)> # %-> +cP->  VP @ H ,@`#> c$` (08 @̀;)> #0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> %- +cP ;`@;h #t;x;`;;;;@ s;`htx -> & 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%>  $!> #`8 (0 @̀@ @̀  H ,@`#> c$` (08@̀⼀29?@ @̀;'> 0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> c $`!> #`8 (0@̀ ->   @wP-> "/> 4ɐ  ! H,@` !X (08@HP @̀> Ԓ `?* `"" * `@">   * `@&* *  ֊@* "``'1@'0@ )>+>%@#' $(   c     c  mt@ >   >  @@   >  @@ #>%> `@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@> "# *> "#!`> "#H(  /  > ==> СH > "#>  L> c@ Β"@!> $"0H``> "b( !>%#!>'!$ $ >&  2> " > " > "!> "!<>#"">#"#>#"#X>#"#>$""4>$""\>$"">$"">)"!8>)"!@0>*""@ ]@d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%> > > "  "> >@ >  #>&c# #>&c# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >  >@ *>  >' @" > " > "   > 4``6 > >:H"(o  (5D`!4"j j ` *@  ( !> !,` (08$2㿠@ ~> c` Ъ@@>€"Т@: H" H*/  dSh> >'b" `2 `2`2" " ?" ?@>'b" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J?*> c>)(` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >) "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@> +?  @ 3 >  $ c@  Њb@&""""  > a@ @> b( ``44: " longjmp botch `&"`㿠>*@#`6 0㿘``@`€Ő  ``€  `€ <`㿘``€  *`,`€ ``€  `€ >怎㿘 ͖  Ȗ Ö   ``€g ```€ _ ``€Y @€` ```€ L ``€F    .@€` 2```€ 3 ``€- 耤 ``€$   㿘M e  ` [ V  Q L ``€  lXlXlXX(4@Lxxxxxxxxxxxxxxx$Pxx\@@@@@  ,8DPP <==?@ @@T@x@@AhA<A4AMN0KN0N0N0N0N0MN0N0N0N0N0N0N0MN0N0N0N0N0N0MMXXXXYQhQR8RDRPRlRYYRRRRRYTUV$VVWPTTYYYYYYYYTTYYYYYYYYYYYYYYWTTTtThT\XDYYYYYYYYYTYYYYYYYYY[4[4[4[[4[$[$[4[4[4[$[$[$[$[$Z[4[$[4[4[4[$[$[4[4[4[4[4[4[4[$[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[4[$[$eD[\x\_H_`@```aa,aTa|aaabbDbxbbggcPcxcccd$dLdte\f4ggggggfhfhg$gXjlLh h0hdhiPilLlLlLlLlLlLlLlLlLilLjlLj$lLlLlLlLlLlLlLlLlLlLlLlLlLlLlLlLlLlLk k klLklLlLlLl`"  ! ." `2N!!!  €aS 2!!`€ ` 2 !!`€  ",!! _ !` H ! `@ А@ M $  ?7'@.@2 !6!6!6!!@ &!! _ !`  !!`  ! `_`P 2? ( /` 2"$6!! @ > 4! _   $ ( < @&!&!&!&!&!&!А?А /     &!&!&! &!  &!&!&!&!! _!` H!`( H!`  H !! `@! ` L ` 0"> 4 P  > 4!"> 4 ` @> 4!> 4!> 4 " """""> "a! _e!`  !`! !`  !`( !`  G `!> 4"> "aĔ <.!("(3" " d! .!> 4 " 2> 4> 4##> "a""!    ""  d! .!> 4 #0 2> 4> 4#8#> "a! `v€a id> 4#h@> 4> 4"> 4$#@> 4$> 4$ #H> 4(> 4$#X @@ !h @@ !    ! av€a  ̀id> 4$h@ > 4> 4"> 4$#@ > 4$> 4$#H > 4(> 4$#X h @@B } !`!€  ?`*`>+#( €> 4 @@* > 4#> "aĔ ! (> 4#> "aĔ  (> 4#> "a > 4#> "a  > 4#> "a > 4#> "aĔ  <.!.!! `v€! > 4@? $ ;$! ` €!2``  > 4 @?ڔ <($.! 7$!*`"  !@ +.!  !>!>!`"!@!  !` @? d!!   " ! B  z _Z@!  0!/  #@?ؐ !`€ @2 @ ! `"> 5@> 5@ 1 @? d # @? !`€?!   !`€ `2 `) ! `"> 5@> 5f !`  @? d!!    ! @  !`  ` #` € "%!@?h d?< !! +> 5`@€&!!  !`  _!`€ !   !`  ! _!`  ! _!` H!` H!` H!! `@@? d!`  ! `_  #?  `@? !`€ 2 `"!! `"> 5@> 5X h`! ( ` € @  `! !`€ `  ! @`€ ` @!2 `-(! #` .!` @!`€ .2! !! `.! `0  !! `.! `@ !!!!  0! "!?А / !  @! `@ !` !!` !!` !!` !! `"!@! @ @>? dР##> 5@>8 d?<!! `@`p@=ߒ 04!`€ А@ @ $ '@*7д2!! 2 _G@ * $7b </)!77Ґ7777'77@*Ѐ2!7"@2!/#@2 !Di!@"!! `"ڟ@> 5#`ҐԔ#\@=z 0!`$  ! "! ! _3А /3(`v`_t9> 5$    @=V   ] ! ` % 8%8 "X4!5 ?#??!2  + ,, @*` @* 2 @ 2`    @  $ "`"b2  07А777777'7@)7@> 5 @<!    "! * `А /$ 9> 5   @<ۘ  _ ! ` %  8%- 2 8 8 "X4`?#!2  + * 2  * 2  @ 2 *`@ 2  ?@  $ "`"b2  07А77777'7@)k7@> 5 @<!, 2  @! P@  $  ?7'@)K7@> 4 @ 5 "@<(<!@  $  ?7'7@(Ѐ@> 4 @<'!!  &!* > 5&!8@< @@ p $!А"@ '_7!6`2 7Ҁ 77֐ 7րP2 7!2  77Ԑ 7`'@(! P _@2!@< ! ! @ 2 $ 4! ?7'7Ґ@(@ % $  7'@(@2!! _7"@2 !> 5 @;P!!2  ` Ҁ`  %6!6!6!6!6!6!> !`!> 5!> 5!!> 5!p#\!#` #d@;q! _D@!!* *`!  ! 2 > 5ܔ2 ܐ@;X !*"!* #!* "! _! "! "!@ "@!  "!!  "! "!  "!@2  > 5@; !> 5! " !!!@; ! _8!@ h $  7'@'Ґ@ ! `?@0;! :6!!> 5 @:۔@(" !  `."  `       !@2   &!! @)ʒ !   @) 0@*Ð㿘! !> 58!@:$ǐ@I !@ ?"@! 0"!2` `! _@Ő0@<0@h!!   2!`!2 Z! ! `.А@ Β $ 27 7 7 ` 7 ` 7@'/'5@  $ 67 `7@ 7@''Ѐ!@  $ 572` 2` `@ 7@2 2   ?7@&'Ѐ> 5@3`2 23`#\P   `@:  @ v $ 37 7 `7@&'Ѐ > 5  `@9 0ې@ \ $ 177`7@&'Ѐɐ@ɒ !   2!@ !? G@ 7 $! S `7А  @!"d "f 3 07ސ7777'@&7@ڐ&"@  $! R `7А !$ 2 "b"`7ք7777;'@  $!  `7А  @!7"f "d7'7@&L7@Rڐ&"@ ђ $!  `7А !$7"b "`7'7@&+7@1&""&"@  $! J? 7Ѐ 7Ґ 7!? Ґ 7Ҁ  '@&@> 5@9 "  0." h.*  !* Ш@ v $ 07 .2`@  7'@%ے@> 52Ж  71@8 ,* ` 2``t`! 2   `@ C $.,  8@77Ҁ 77 ` `2 * @7> 5 2 #\#`Ԑ @8 '@%#@  $ 8@77Ҡ'77@%zЀ*@*  72!   @  $@ 977 7 7@%X'@2! , *  2  " 2 "  *  `@." " "   `@." 0 㾐> )#H'D!'d' `@ ' d/D   1  ᯀ ?# @1 DD@!!* *`!  D  1 D ᴒa2 1 `?# @1 D!2 ? #ߒ @1   1 d`* 2 '@ 1 `> 5D'8 @7$$1 d *`  1 d> 5`hD'@7  1 d*`  1 d> 5 D'@7В  1 d ) ) D!*2` 2  }1  `1  `2 Daa* *`a  D  1 D a ?А /ODD  Ḑ 1   @   D @ 0 @  1 @D ! 2  ?# @(1 ?c 1 d ``D @  1 @) CD!  d  D D  1 Dd` "D D 1 DDaD* a!*`  h $@ '  ' 87jD7h7l@$7nh@dD ᜒ ) 1 < (?P }?Xz\\3 X'@7 X'0T/`T'$X+2P'4'* 'D/ 7`@ D'L04\P'<2 P*$*`3 ' ' ',@   X'   P3 37`X7 '  3'H7 7`X X7 7`  '8'('' 1 O> 5) ?) /) ) ) ) ) ) ) ) ) ) T\#\_)  ) W) ) D@6':PT@ P> 6D@6 > )T 2*   7`/ 3   *`  2 ?Ж+ 7 7`1 ) ) ) ) ) ) T W) ) > 5D'@6t D ` $ $!  1 $> 6D' @6^ D ᮐ ` ! ! @  1 &> 6D'@@6H D "`2"d D "b3 "f  3 @5  D1 .1 (1 *1 ,1 01 21 41 6D> 6 '@6(X!h2`  > 6D @6'D@'ahd! 0D@B;'h@ y $d `7h 4@@7l 27trp c'd 7n'7v  D> 6@5 D@"ʒD!hh* '!h > 6D`Ж@7ϔ ` > )D'b'b'bb  0/b > )#H > 6@l `> )#H'D!Hp'D' $@ &'d  'd 87JD@"7HH@LDa2 D 2D?# @2Dᴑ2 D? #ߒ @7 D` 7` @ ' 1D * 2 '@1 D> 5`8D' @5q$$1 D*`  1 D> 5D'@5`  1 D!2 H $@ 'd$ϐ 'd B7bDH@"*7HH@N1 D`! \D`!*2` 2  }1  `1  `D \ ! \DDa ! `    ` "  ` 0   ? ! ` `    D 1 XD> 6' @5  ` ?! `D? D*@Ḁ` ! d` @! dD!(D d ! dD a1 Z (?0 }?8 z8<*8'$3<' / 8'47`0'4* 2''܃+7 /` @ $',<'02`* '2 ' '  \8'   03 37`87 '  3'(7 7`8 87 7`  '''' ! \/> 5) ) ) ) ) ) ) ) ) ) ) ) 4<#\?)  ) 7) ) D@4_':04@ 0> 6D@4S ;> )4 2*   2 /`7   *`  \2 + 7 7`! \) ) ) ) ) ) 4 7) ) > 5D'@4& DD  `1  !$1 &> 6DD! ` ! ! @ 1 $> 6D8@3 ;> )D b`3 bd bb bf2 \  `3 d5 1 .1 21 61 81 :1 ,1 01 4D> 6X @3'  4*`bd4 b`*bb(bf,`#\345 #lD> 6#`#d#h23 3`@3 a  > 6Da@5 D!h2`  > 6D' @3(@D"ahD! 0@ADH@  $D `7H 47L` 27Tdrp  c7N'd'h7V 2`(*`D> 62#\3 3`@3r D@ OHD!hH*  '!h'"'"'""  0/" ;> )cH > 6@"㿘! `,` 0@  ` 2 `` >+#@*` €`0 ?   0@  `0 ?"`0`a݀` > )#H!' _ .`2`@ .`2`@[ @ u @ ,! R6/ `?$4 4 44 > 6b( @@4 2!!h2`  > 6 @2(m!@&!h!! 0@@E@ B $! T @77 47 27a   ''7@7@ `@@DJ! > 6b8 @@4 z 1> 6P@2 q??* @*`\@ >+#`*` €> 6Np> 6K> 6H3` > 6#\Ж `@2t J > 68> 650> 6P @2f : > 6> 6&> 6Ȗ @2W - > 6 @2N ,  ,> 702 @2A  > 7`> 7@26  + > 72@2, ? 2!h*@&!h#H > 7@ pА@  $! o72  $77.`76  7' '@7?@` 3>+#ܓ*` €> 7ҐЖ@1 1 * +, > 7Ӑ2@1ْ 1   > 7Ґ@@1͒ 1 > 7x@1Œ 1  , > 7А3`@1 ЁpА@  $! q72  $77.`7a ?b''@{@  > )#H!p'@  $! d`_7p#7 7r!@2  $7r7.`7r47t 27| ? ` 7v7~''!h2`  > 6 @1V)C@&!h@.p@ !h*@&!hI?! _! 0@B7?.* *`   6&    0@@^?.* *`   6&  !h*@&!h H > 7@͘!pА@ Z $! j72  $! _ $7Ҁ 7 7.`7Ґ 7 ? '@@?f?! _/Ԭ ܻ3 ֯0 /`*`0-5* ޚ     5`- 6@   -4`, @ @ -`,` @ . ܺ ֮3 /`*`-5*0 ޚ 0    5`- @   -4`, @ @ -`,` @ 6@   @ 0'D!> )'cH> 7'H@0S!D> 58!@0M)D   )> 5B#8'> 7 #8'D@\' 2  @"@ 2`@ `D!@0%` 2 2`  2 2`  4m #8''@0t **"@ " *`"@ * " *`@ *  *`"@ * " *`* #@ #+`@ +  +` + @ > 7D#\x#` @/ $e6А"?@" b@@ b>e6@ ?D ;ʀ@@ #-@ ?D e6;ʀ@8@ @ ے#&n @2   > 7D@  $̒  '7D@v@m?D@2  23 D a  ? " 8  *  @"? *`  *   D"` `2Dᢑ* *`C %     2     D a _ ~'D  2D  ? "?#@ ?# o ? "o+ 3`@4`, +`  @5`- @  ,`.-` .`     -     ?  2`*   4`,  *`4, ,`@, @ .`@  - @-` @  @ @ ? ??  `0*`  ' ? @  ' 2/   @  @  D'  `_@   @ D  > 7D@.!k? ?"??c@  #D !`/4@  $̐ ]`7 q'D'@P7@"  D> 7@.b @  " D> 7 @.R  "> aȑ*   ?@> 4D(  @.<!D!  (  , #\ D> 4 $@.,!> 7D(@.'! > )H > 7@#@ >,* > 7#P> 7#`> 7#x> 7#> 7 #> 7 #> 7#> 7#> 7#ȁ㿘!2    > 7@- ?2`  2`   2`@ > 72`   > 82`  > 8@3 > 8@- °?> 8@@-! 0'$- 2 + `0    2   ~> 8X @- ,` `*`>, $ € $ @+X  ? ?*  T  $ * ? @ $ o  ?  + @@ ??  @ @ $ $ @+, # @$ $ R `$ @+ *  ?# @ @ $ $ =  ? ?? #*  @@  @?@ #$   2 /`0?*  2@`$ @*5`~"    $   c $  $ > 8x@- @/,`2 !Q 8($ > )'D#H!''2`  2`     2`   D> 8/ ~- D> 8 @,є @ 0$"@D> 58!^+> 8@, D> 58!T+> 8D 0@, @/=DD> 58!E+, ! 0'T#"4 > 8D@,? 7+ 'P`2`@D ᮀ  PD 2    Pء2 D  @2   D> 58!+~@,fD ?2   D ᮀ ؀D 2`* '*`'?  2*5-@'* ?2+ @ @ '|' ?x ?3`+'@ 't+`+?| x3 +@ +`+  ?t?p |'l+`+ l'd ?htl * d'\?` d\ +?X-\@@ + @ ܨ@ ??   @@  ?  0@?ܚ# . ز@Ȓ ?@  ?в@7 'Є @ 9?Ȟ ԀЖ`?  P `?3`D> 8`?#\@+ @.D?   $??#  `*`   $$> 8 DX@+o!Y!  ?`0K@2H ̀@2C  2? 2; 2$  @ 22 ` @> 85D @+/!? ? %   @ @ % ??  @ * @%  ! !C2   2 !` @ 2 " > 8D@* -,  0@ e ?@? ? #@  @ @$??  @* @$> 83@ДD!<< @*T *` 57  0$"> )#H > 8@b!H)> )!> 8#H'@* @  `4#7Ц!q 4 `0 3 4  ` B 4 ` B 2 ! 4 4 4 $ 4  @A@  $ n 777 2 7&%77'@L'@ @?  #H > 8@"(> )#H!''0> 8(@*I ! _ @ ꮒ @ ,` )/ 'Ԅ ?' 4` $`4`4` 4`$` $`$4/@$`(o@ B $`,$`0$`4` B !$`8 $`<> 8bH @@,/@>ܒ@ v /  !q!,`,`4`/@4` @FE %/P!` > 8bP@+ /@ Y @@ U $ T @77/2 7`/7o B 2 7o B  7'@'@$?@ 8bp @@+` > 8@)  ?! > 8b @+' H > 8@8"@'D> )#H> 8!'!'@)2`  2N?2`  = 4G 2`    pА&"@> 8D6Dh2`  > 6D @)^,D@"h 0%D# a`_  D   0D&#!h*  $!h @ 0D"$@h* $h2   D!h?*@%!h 0@!(D '@A  @    "!D> 8@)Dh*@%hВ pf &@І< ?  'Ē(7' @    Ȓ`a'ȑ*` `ȑ* `> 8D8@(ϒ > 8D'Ĕx@(ǒ!'Ā 5ȕ,` ` *` * @@ '̘Ā +  * *`  ̐ 2 Ā đ+ -,,> 8̔D@(!Ā''Ā@6/DȔ (  @ * ` *`  '> 8DВ!@(t?̐ D> 8 > 9̔@(`!`0`0  ' ̐  !'Б,  0@ ``@ %?̐ !+-  0'@D @2` ``'݈@ 1? ?#   ! @> 9 ? %@̔0D@(! 2`*  2*@  '- '| 4, ''5`,@? .'t '̭7`/ -`?*`?'?*|?x@''l?' 'd |t @ ??p??t6.`@(. @  ?? .` ?/`@? ?.` d ?  @?h?` ld?-*  а ؒ @   @  ܨ??/?̐2  @   %? @"  %?  #\#h#`#d#l#p  #t #x > 3#| #'D@'-!D@ր  ? @ @ ? @ !! 2   D!h> 5* %!hD8!ɖ- 2`*   '\0(*`  4`, \'?X  ,`'4,5`- @?,'4('L\'TX 4 0 ?0(?-`4','$T ?P ?(@'DL@ ??H?@?\ L+`$.`D?  ?@ @ ?@'? D  ?'<.`?, $,`<-?8.` +`   @   @   @  ?? @ D D D> 9X @&Y'??  @ @ ?@  !!  '1 ?ܔ ?# 0 2  *, !   @ @ D2 D`> 9> 9'Ԕx@&!! ? !'Ԕ@&! ? !А 0 " &' 0??И c"  (   b2  : '    А 0> 9  #\̔ @%Dpb > 9̔D@%ǒ dȔБ- 0D'@ր 2   PD!h> 5* &!hD8!g.E 2`*  2*@  '- ' 4, ''5`,@? .' '̭7`/ -`?*`?'?*?@' '?' '   @ ????6 .`@(. @  ?? .` ?/`@? ?.`ܘ  ?  ??@*ܢ  -ܖ  @ز@     ? ?О 03'2   -`В@@ 2 @  @2 H@ 2  @  @  '"% @ B'?1?̖  ! @# @,9 *@ 9 ! > 9̔8D@$!TГ,@ 2  ?":#\#d#`#h2> 9 #l ̔XD@$ 3Р`00? ?# @ @ *@ , @! 2 DD> 9̔@$t!@ ?  #@> 9̔@$i! ? #Ġ 'Dh* $h2`  D> 58! .D!h> 5* %!hD8!-@$AD  ? pА&%@> 9D@$3! -> )H > 9@ΐ"㿐!@2   (@??c% @2   D4  !@2   6: @3.6@,`2 W 2!    !2!,`> 9 @#͒ 5?262 . !@2   2!? > 98@# ?@?."  #\?> 9. `@# ?(> )!#H'@  <!h`4 7 `"!4` !3 4`  a B 4` !a B 2 4`4` 4` ? @ 4`3 2 4`` 4`> 6 @#Y/!&!h! 0@:8@ 㸒 $ n 77 47 27&% b ''7@7!h*&!h ? H > 9@Ő"(> )#H!'!h`02   > 6 @# /&&!h@ p @ , )/   4?'!$  44 4 44$$$o/@$(o@ B $,$0`$4 ` C  $8$<@7@ @ 4/  " 5 5 - - ? @ :`- ! : -  @ - o@% @>ɒo@  @  $ T @77/2 7`/7o B 2 7o B  7'@k'@!h*@=&!h@5=! > 8bp @@$j  !h* &!h> 8#`@>!h  *    &!h> 9@"X!?  > 9> 9@"M! @"G ?H > 9@#㿘.`?2`#@ a @ 2   * 2  ` * 2  ('a@2   *2 (*2  " * 2`@    * 2   `2 `0  ` 6 8> )cH  *'$$,`42 L 2   > 9 @!Ւ A   ,42  > 9 8@! )  ``V  /(0 h! 0-  > 9h @!a -` `2   g h"*`0 $,a e@  @   . , ,4 , @%` $ *2` `*@*  ,  @ @ H  : @: @@" > 9 5 _ @@ ᵐ   , ,, @%`$ , ֐  2  :  `` `  @ ᆒ @ ,` _  ,@   ,@  ,@,@ _   J@ "  `?",` "   2 J`   $d̑- *  h"   4` ` `  $d" ,` ,`54` _-` 04`? @ 4`0  : ,`2*`2`!2` @,` ` ` ,`2 `2  4`  ,` `4` ,` ` ,` y@ #* `4  4 _!@84@!  > 9@ e  $,1 f$``@ g"@!ԐH$, > 9J@ $ 2 $  #` @ >#\` g$ 4H > 9@ϐ#pТ@  $` >, <.` €> 9@  ]? ! _> :  7 ! `7Ґ 7 !   7 "  2`* "  *   7В`," '@ @&?> :8@Ւ  ? !#`_ @> :K` ` :`!@2  $77ґ.`7 ..` 7   7'@ 7@?> : @ "  *2 "  *  `@," ۰  `@  2 !> : _> :@} ư? " !2 ` 2  .`77  7 .`  @ .`$2 . @7  ? 7'C7@  ! ?`  ! ? ! z?8v ! q?/m ! ` g`_e b!72``$7`'@ @R?P ! JHi C >?: ?"6?04@ ǒ0 ?Ð# ? 22 믘 > 6?3#`* 62`2뚘 `@逢@"0?㾰> )#H ' ". U',:.!" `B 2)>!"( 6",  ", !`€.4@  !  <"F @ } W> )@q!.> :2@p  !2`@Q D> )! . 2` @@2 !" 2   2!" 2   > :4@K ! €!Ĕ !! _!`  !! /!`€!"@ ',> :"H@# ,&"!"',!  02%!! 8!! !`€!!`€!Ģ@@$!@> :p@ !`€!Ī,&"IG! _ ?А /8!@( d!`€!!` ` €,'! /!`€ !`€   @!> :,`B >!#\ @&"" 2L!, &" @4`,! "\*  .@  ? ',`'(@ ܔ! @ _ `@((! > :aȐ @@^ ```"@'! > :aȐ @@JJ`$@)K! > :aȐ @@:  6 .@  . " *!6"  @, `",, > 3 3 @#\> :a@ @@ } @,` ` `` `'(` % > : @H! > :@ `  > :b( @@ߖ ` > :b8 @@Ֆ !`@` > :P@* 2"`` > :`x@Ò   @ > :`@  @@ #!`,!E,@/ $ , " $2` `$``" *  ."  $ ,!   _  ``  `$ `  ``` `    `_ `$`  ! `` 2, X`>, t*` € (! `> :  $ 2   #\@H  $ ,! _@( ,@Ԗ( , 2 ! X 2! $ ,! "()$ (  $ d!̑* *  @ "  " $ d  "  ."  2$ (($ ($ ( > : ,  $ ,  4 > : $( (@ @. $`  (, X$ , , 2 $ $ ,> :@Ӓ ! 2  $> :c@@ @ $$ (> :cP@ @ , 2 $ $ , $ " !! `! 2  . ,  X &" X 6   W 0  . ? ( $8 > 4 2  $8#\ ( #` X #d#h ,#l@{" "/ "?6"/ 0" @ ܒ @  ,,`!`,!!`€!"&"@&6"! _ !`( H,! `@!`  , &"&" > )0.@ !B@=>!.> )#H > :@Ð#hp!   2 '! ` €'ԡ.`4 > : @x@?ߐ#@`H >, *` €"  ԕ2*  " *  `@."  @" !   `." ` !@ 0"@! ?"" 2    &"(6",@ @ ?> :)> :&!`€!> :ԔȐ@ 0h> :Ԕ@ 0a> ;@ > ;[0> ;@> ;h@ ! `€ hd&.`7> ;@3.`> ;@{ !@ ;"@! 7"!@"'"@> ;@i !@$"@! 7> ;Ȑ@\ !@ ;"@!("!@ ="@> ;2@I "  ԕ2* "  *  `@." eԐ!a'Ԑ!N^'Ԑ!['Ԑ!X'Ԑ!U' > ; @%"`B I>"!> 5@ ?"@!8ઐ 0!#"  ``." @ !淒  @֔ !@2   ' !  "T*@ "!" ,!&"T> ; @  " > 5 `!`."  ?#!8@ΐ 0!"@@ϒ!z I " > 5 `!`."  ?#!8@ې 0"@@!a 0 " > 5 `!`."  ?#!8@ 0"@@!H  " > 5 `!`."  0"#8@!2  @Q !2`   p$""> 58@l!  @6 > 58@\! "   !."   ?"! @#> ;H@C k! `€> 58@3! ސ, 4 `&>, ؓ*` €> ;`> ;@  > ;> ;@  @ o?> ;@  > ;@   @ΐ" `!`."  ?"!@ 0!"@! _> ;(  > ;> ;8@" > ;H4 @ْ Ԁ!2  ԑ:  ,`!  .`2@ ``! ` `ꀦ`$" %> ;آ@ @` " &6" !`B >!㿘`T>,"*` €> ;> ;@ # !`B >!@ΐ d@@> ;@> ;@t @A @ @i ?㾰> )` #H+'>,#d* €` b2  > ;`$`2 ` @I , cH$ &,&*` $2` 2  > ;#\z  > ;`$`2 `@@> ; h@ً` a> ;x @ق` "> ; @y` $> ; @p` (> ; @g` @> ; @]` @> ;Ȑ @S` @> ;ؐ @I> ; @C``> ; @:` > < @1` > < @(` > <( @` > <8 @` > <H @ ` @> <X @` > <h @> <x @ > <`$`2 `#\ @ $& > < $ 2   @u  " $2  d  " *  ." ,`2$ &,$& > < $ 2   @S  " $2  d  " *  ." ,݀` > <`$`2 ` @7 , cHϐ `> < &(`$`2 `k  > <`$`2 `@a  > <`$`2 `hW  > <`$`2 `M  > <`$`2 `C  > <`$`2 `9  > <`$`2 ` /  > <`$`2 `P%  > <`$`2 `x  > <`$`2 `  > <`$`2 `  > <`$`2 ` @ N, > <`$`2 `  > <`$`2 `8 ! ``2 " $@(,   #\> <#`> <#h#`> 4$˔@,&( > 3`$`2 `  > 4`$`3` ` > 4`$`2 `h > <x@\ , > <`$`2 `X #\@M  (.X&, > 4`$`2 `  > <`$`2 `{  > < $ 3`   `@* ! "(, `$$! `?ȑ*` *  *@ 2  `* *  @ "  " $ d  "  ." , "&,cH > = $  3`   `@ ! ", `$$! `?đ*` *  *@ 2  `* *  @ "  " $ d  "  ." _, > =`$`3` `H `@ R,` (> => = x  > =  @!@2   @  $! b72``$704`'4@  , +cH'  > = @ , cH  > = Ȑ@u , cH  > =` @i , cH &,cH > =@!h``0>- *` € > ;`$`2 ` @ > =`$`2 ` @; , > < $ 2   @.  " $2  d  " *  ." ,` &, > < $ 2   @  " $2  d  " *  ." ,ɀ` > <`$`2 ` @ ,  &,` > < &(`$`2 ` > = 8@ے , 2$ &,$& > = `@˒ ,` # @ 2 2` `` ` $    #\> <#`> <#h#`> 4$@@ o, &(`$> =`2 `x` #\ @ @#`, "^&,0\` (> => = x  > =  @!@2   А@  $! b72``$7`'@ , 0 .&, > = @Y , # !&, > =  > = А@G ,   &, .X> =`@9 ,  &,㿘.`6``)@ > =@" 0@ $$ (  , X! " """?6""B@>"p"D   4t  &q 0l ",@"!6"Fd? _ !`( H! `@!`  А@ < $"D "P 00 0+"H 6"H7@`$7"03@"H``6"H7"H"L@* @7ҕ3  6"H3  7"H"L"0* 3@7ҕ3  6"H3 76"L`"F&"P?6"F"D`7'@  㿘! > ?!(> ="4!@-     `? o-  `  ? ` ` ", *!  2 45@ `! ` ` 2!6"D&"("  ." ! _ !` H ! `@@o#p> )!#H `'`> ?!( > ="4 ^@  > @6@%(!-     `? o   " `? o``   > @6@@@ H@ b6@ ", /> @*@ X@˖! @ @4@5@` !   6"D&"(" ! ." `_ !` H ! `@@.@ @ @0 %> @* ",p*`4@3  @` !   @}" ." `` "H! > #T> Ɛ!`2 @> @@’ @@A  @"*` @ X@UN> @@"@%F> @@"8` @,@#8> @@/ @/0> @ 2> @0"` ,> @*"` &> @$"`  > @"` > @"` > @# > @ #(> @ #@> @#PX@Z  > @h@ H > @@#p! !@ E $ i 7'@@ *  @$@㿘"    < @,``"  " * `!*@  ." .`*  !* ??c#    2` А @ > @$  @w`@  $ 2` А (74'̑2` g 87 ?!a @4  @7@7@"    2 * @7 ? * (@4 > @ 2 #\#`ԔȐ @F'.`,`@7Ғ'@2+`̀ 2 " 2 "  *  `@."   $  $ ֙.`ԑ2,  *@ * 4 $ '̐ @ߔ̢``y  *  2` 2`  `" "   `@." 0` X.`*  !* @@2` @* *@ @8* $@!l  * @$@!    $@ 4`! ` $ 8!  4`,` ,`,` ,`   *` `  "` ` ! @29@@ @ $@! @2-@А@  $ % ?7'r@@  $@`* @2  *@ * $@ 2  * * @$@@!> 43` #\ ` 3` #` ` > 4#d ` x#h@ ` #l "(@] @> 43` #\@3`2` `#``3`#d`#h "( @G `???ì#c !)> 4 4  $ , 4 4 !  (  # ``2! 2    ` 2!`  !? : @(     * 0 *   , $ , #\ 2  #` #d "(@ 㿘!2` u@* $!    k, $4 4 4 , 4 !p! < !p4 < (! !4  ?*@4 ! @#  ` @ 2`   $!c@&!&!!" > A!p !t@ ! !:   $2 !> A @ !!p: !! > A!p !t8@ !p (!:( , (  > AX@s !p!:(㿘!  > 5!@b8  C" 2   > Ap@S c!!2 "*!ԣ" 2   "  @." " 2   K> A@6 ! _ !`  =!!`  6! _ !`  !!`  ! ` !`_!`  !`! !`  !`( !`  ! 6"&"T,@ @K @b $ " $ (!  $$ ( $ ,@ ސ!*"T㾐> )!#H_' @ !      =   @ݐ `!S@2! P" !2  j?`> A "> A@ > A@| U?   @ ` > A@i B?> A@_ 8?!  @! * @ $ `   @_   ` @T@P   @= @$ cH > A@Ð!㿘!!`02   ! @`   I  S> A`P" !> A @  +??2  c  ??2  *  *` 2  2 @  `> A@ Β ?@ђ㿘!   @  !`  @ ! `  `@`!2  2 ` f 8`?`f a `&56* 2 <   !  @ Ր !`€ !`` @ Ȑ !`€ !` @  !`€ <ӑ<6 *`6!  @  !`€   6@  !`  @  !`€ <!`  @  !`€ ?# @ `*`2 @6㿘! @   ##   `@ ] !`€ @`?!` ? ? * *@ 2@ 2 @&&㿀` 8!2 `  `@ * * @$@!(2``  @$@`,` `,` `,` @` ? ` $@!   4 `    $@` @2  * * @$@` 2  *@ * $@` @2  * * @$@` 2 *@ * @$@` ~,`` !> 4` *` 4``"8`*@ 4``> 4 * @3`$@ `#\ ` 3` #` ` x#d ` `#h@ `#l @ w @"83` #\@3`2` `#``3`#d`#h> 4  ` @ _ %> 4` 2  * * @$ `, ` `*` 0 $ `, !  `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d 8@   <2*  *  @$ , 4 ``` 㿀.`*  !* 2`8 `**`  $!( `  * @$` `,  `,  , `  `  $  2  * *  `$ 2  * * @$@2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> 4#` 3` #d #h> 4 #lx ` @ Q"8> 43` #\3`2` `#`3`#d"8#h  `@ :  +> 4  `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d b8@  <2*  *  @$ , 4  `i 㿀.`*  !* 2`8 `**`  $!( `  * @$` `,  `,  , `  `  $  2  * *  `$ 2  * * @$@2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> 4#` 3` #d #h> 4 #lx ` @ "8> 43` #\3`2` `#`3`#d"8#h  `@   +> 4  `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d b8@ d <2*  *  @$ , 4  `i !  $  ( ,2   : ( $2   ( ,"  (:   $, ( ,'     22  (<??  :  (     2@ : (㿀` `/``+``(` `  `-   5`@ 5- @@@-`4,- @ ,` @ @  @ᜒ > A '@@ɘ7   @ >(ᮀ ?А /E<?` `/`` +``"(`! `#  `$-   5` 5- @@ @ -`4,-@,`% @ @   @  > A '`@~7    @ #?@ > '` ` * @6Ḁ$2`` ` * @6`.`.Ḁ(2``* @6@2` ``* @6` `*`  6`  ` , ` ,`` (, #\#d#`$ > A @('> A``*`  `+ `@ `+`` #\@ > A`'`&*` 6 `+`**@ 6 `+`*+ `'@ `&*@ @   *` * ,`   ' . /`' ' '? '*`  '?ؒ ?? !?' '' Ը ?? "3`؆ '*  3`̄ ?ț* '  ?ԔП3`(3`(  '' ?̨ȃ4,@@@?@  0 ( @ *`/  !@ /` + @+`  #  @ +  @'D "*! , #`@ #d> A@ #\ @S'> A 1P 0*  5 2* 4+  6@ -*  , 7+` @ @ .( 3+  @ + /,  @*+`#`D @ #\@%  -  . +` (      5` 5- @  -`4,-,        6`" ?`( 2 `"?`(  ?`(  . +` (  !  "-   5` 5- @  -`4,-, #       6`" ?` 2 `"?`   ?` DS'  *`7`DḀ$D * @7`D!(D  * @7`Da@2 -  * @7` - ,* @7` 1 0* @7` 5 4* @7` x88x0 `H8888㿐" > ǐ  @>i." b &!D 0&!|&!xP!@$ 0$ ($ 4! ` ! !$ 4 4 !>i" `` &!@"4 4 "! < !(-< ! 4 " 2  4 2 ! *@6!p  2! P!@"("0"4  2 2"$2` `2 2$ ̒ 2  *@6!r! @' ˔!    `' 弔@BI! E @&%b@@ @ < > '<@ !    @ )  'a<@  㿘 D?#@@& D@m㿘 4 !  >  `I>j!h  0#!@C#!h$2 (@*`@!*` @ 5(!p: .>  `<!h ?#!h a &`;# `?Ȗ*`2 (* @ @ " 2  "   " *  `@+" * 3@ !x""!x!| "!|"@㿐 >k 4bPl@}@\ a  =  b 2   4`ah a _ a` 0a` w b 2   ' a   a`   _ a`    a    @r$,@0  b a  @,b ` a`  ah ` _ a`   aha   ah2`  @ 2ah@vah `n@> A@ p  2` /ah$ah@fah `*` ? Y$ah⬐ f"-ah g e"N 0L h"4 0G  l@ #>   @Ð $baT 1b> A$aTb @m 0'> A2  ``*` ? $ah8@`  > A   H@Tl>la@@O  $ @㿐P f  g e 0 h 0   @  "`5 "  `!@  ^` 2 @V#蠄?2!`2!` 2  ה "`,`,   &`,㿘 @  +&    4@> l *@&  @> A `4h@Ԓ  * & @I!h2`   $!h> A@’ @t8> )#H '4@֐@ "a  > A@ 0p@ > Aؖ@ 0f & a@    > B @ @*@%& '$> B O $` > Ba > B( @c@ * & & ,j0LH@Q  @* &   l@ ʒ#>  S @  & @ɖ " @o+#H@& @ Û @ , /  4 $ ` ?, @a`a$b0/> Bp@  @E#H > B@ 㿘> B@ 㿘> B@ 㿘@ ! _ !` 0!` @㿘  4@ f*> B g e"L ,0P h"0 0K > B   @  @ l>kbP@ @ 0#>   @% @ ah2  *  $ahJ0> B > B ( @ l>la@ǔ@   &   & ,@㿘@!h!x ? `&!h &!x@  "@!x "` > B8@S 0@㿘!h `!x  &!x j"@!x "` > B8@3 㿀`+>h#.` €! s!/n?>` , * @  !.`* @@*`@ ' `%  "" @"` ` 4*`` " P` ` ` *`0  (  ! *`@ i#   " > B ( > B "P > B "P!> B"> B"(`.`* @ > B `#\#`X> B@ 0 > B@ 0!h> B2  ``*` ? &!hx!h! ? @@` &!h>lct@Д!h &!h@ϒ > Ba?*@&!2 6!> Ǒ2` 2!`0   "`:  (*`24> B 0*@2 ?   @*@ &@K @Ր?##3 4` !t  > B#d?> B ,@ #\#h#l#p@&#`%0 4!t  !> B#?> B#`, #\#d#h#l?#?    * ? #@-&!2`А" o0:  *` 2 2!> Ǡ!t 2  #> Bc8> B#d #\#`#h#l#p> dž 4 t  !> B#H> B#` ?#>  44  t / !> B#P?> B#d, #\#`#h#l#pb 4 t  !> B#`?> B#`, #\#d#hI#l?#*4 (? , 2&2> & t   !> B#h?> B#d*#\#`#h#l#p4 L>  4 t  !> B#x?> B#`, #\#d#h#lP@5 01> B#> B> B##@% 0!! `€!     ! ` €* * , > Bؗ23 @  㿘'P'T`'X! /@ > C @( @@P> C@" !h2 "!h H(!`"!`"!XH !` "!`!X"!`H㿘 . > "#8* * 沔a  "#81M"`##8" `@ "#d#`沆;``*  ( (( ( (d( 8  B  #㿐` a""F!h$ @ # ;(&!h !> C@:!h@a "P@ !hb"`!h$ 7*&!h @:'!h @  !h"} d d!h""!!h"2!h`@* !h"$> C `> C p"D> C 0 6@!hb&!h㿘!h("@ː"P!h"&!h!h"!h㿐@ w#'#@ Y* "@*`@*`'@ )#H'> Cx6 (/(  )> C'> C/( Ŕ @`  Ŕ@ `$/(cH > C@ > )#H'> C  @/pp)> C'> C   @U`@2   @/pcH > C@ ȁ㿘!2 U'H!@2`  H2`  4!ݝ  > CD@2`  > C2`  4!> C52 - ݁ > C !(  t > CH!  g > Cp! @ /(0> C y!?8!?#`0 ;> C9> C7> C5> CЬ> C> C!> C> C> Ca> C> C??> Ca"??????# 2 > C @> C  @ 2  #\#`   * +#d > C @#h ( * #l  @#p  #t #x #| @#`a 㿘! ` ;`_!`  !`  H09!`  ! `@!`  !`! !`  !`( !`  0!`  ! `@!0 @* `* `* ` ** `* `* `*!0 @* `* `* ` ** `* `* `*!0" @ `㿘ɔ!2  "``?# ? ** @2@ 2@ &!2  `. ` ..` . !2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` `?# @2 *`@`` 6 `$   * ?# ??   !2  "  *  *` 2  2  !2    *  *` 2  2 #`$?؄㿘.!2  "``?# ? ** @2@ 2@ &!2  `. ` ..` . !2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6` @ /* 㿘Ք!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6` `. `  . ` `. ` . `6 *   '* 㿘!2  "``?# ? ** @2@ 2@ &`.` . !2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6 `(`,`   * !2  "`$`$?# ? ** @2@ 2@ &$?# ??`(  !2  "  *  *` 2  2 #!2     *  *` 2  2  ,`?؆㿘ڔ!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6 `(`,`   * !2  "`$`$?# ? ** @2@ 2@ ?&$# ??`(  !2  "  *  *` 2  2 #!2     *  *` 2  2  ,`?؆㿘!2  "``?# ? ** @2@ 2@ &`.` . !2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6 `(`,`0` @``* !2  "`$`$?# ? ** @2@ 2@ &$? # #?!? (!2  "  *  *` 2  2 #!2   @ *  *` 2  2  ,!2    *  *` 2  2 ` 0  ` `Þ 㿘J!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6 `(`,`0` @``* !2  "`$`$?# ? ** @2@ 2@ &$? # #?!? (!2  "  *  *` 2  2 #!2   @ *  *` 2  2  ,!2    *  *` 2  2 ` 0  ` `Þ 㿘q!2  "``?# ? ** @2@ 2@ &!2  `. ` ..` . !2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6` @ +* 㿘 !2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` ??# @2 *`@?#6` `??@ @*` @* 2 @ 2` #` `?.`.`.`. ??@ @*` @* 2 @ 2` #` !2  "`,`,?# ? ** @2@ 2@ &,!2  `0 60?# @2 *`@60`2.2`3.3!2  "`4`4?# ? ** @2@ 2@ &4!2  "`8`8?# ? ** @2@ 2@ &8!2  "`<`<?# ? ** @2@ 2@ &<㿘!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  "` ` ?# ? ** @2@ 2@ &  `4` * !2  `0 60?# @2 *`@60`2 .2`3 .3  * 4㿘???#`  !2  "  *  *` 2  2 #@!2   @@ *  *` 2  2 # `ؚ`㿘u`` ?!? ?#  !2  "  *  *` 2  2 #@!2    *  *` 2  2 # !2   @@ *  *` 2  2 # `  š` 㿘9!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  "``?# ? ** @2@ 2@ &   +   * 㿘!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  "` ` ?# ? ** @2@ 2@ & !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  "``?# ? ** @2@ 2@ &!2  "``?# ? ** @2@ 2@ &!2  "` ` ?# ? ** @2@ 2@ ?& #`$$ ?? ` @*` @* 2 @ 2` #` 㿘͔!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  "` ` ?# ? ** @2@ 2@ &  4 * !2  `0 60?# @2 *`@60`2 .2`3 .3 4*  㿘]  . ?#`!2  *@@ @ 2 *`@3 `*2㿘!0@.`..`.!0` 6?0(6!0` 6?0(6!0` 6?0(6!0` 6?0(6!0` . ` . . ` .  ``(`0` ( !0` 6?0(6!0`.`..`. (!0`  6 ?0(6 !0`" 6"?0(6"!0`$ 6$?0(6$!0`& ??0(?6&(  !07@0(7@` ?0  !07@0(7@` !0`8 68?0(68!0`:.;`;.:.:`;.;!0`< 6<?0(6<!0`> 6>?0(6>!0`@ 6@?0(6@!0`B.C`C.B.B`C.C!0"`D`D?0(6D㿘a0 @@?0(6a0` 6?0(6a0` 6?0(6a0` 6?0(6a0` 6?0(6a0`  6 ?0(6  ``,`4`<`D`P`h` @  (  @  (a0` 6?0(6a0` 6?0(6a0`  6 ?0(6 a0`" 6"?0(6"a0`$ 6$?0(6$a0`& 6&?0(6&a0`( 6(?0(6(a0`* ??0(?6*,  a0@60(6?`?4  a0@60(6?`?<  a0@60(6?`? D  a0@60(6?`a0`L 6L?0(6La0`N ??0(?6N P  a0@60(6?`a0`X 6X?0(6Xa0`Z 6Z?0(6Za0"`\`\?@1?@.`(6 6`&\a0"````?@1?@.`(6 6`&`a0"`d`d?@1?@.`(6 6`?&d h  a0@60(6?`!0@ 2?0(2 ` * `*  +     +     +    +  !0` 2?0(2!0` 2?0(2 ` * `!*!!0`" 2"?0(2"!0`$ 2$?0(2$!0`& 2&?0(2&!0`( 2(?0(2(!0`* 2*?0(2*!0`, 2,?0(2,!0`. 2.?0(2.!0`0 20?0(20!0`2 22?0(22 `4*4 `5*5!0`6 26?0(26!0`8 28?0(28!0`: 2:?0(2:!0`< 2<?0(2<!0`> 2>?0(2>!0`@ 2@?0(2@!0`B 2B?0(2B!0`D 2D?0(2D!0`F 2F?0(2F!0`H 2H?0(2H!0`J 2J?0(2J!0`L 2L?0(2L!0`N 2N?0(2N!0`P 2P?0(2P!0`R 2R?0(2R!0`T?0(2T㿘!0@ 6?0(6` .`. (/ /!0`  6 ?0(6 !0` 6?0(6!0` 6?0(6!0` 6?0(6!0` 6?0(6!0` 6?0(6  . . (.㿘”!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` ??# @2 *`@?#6`  !2  2 @ 2 *`@2 !2  @2 @ 2 *`@2`?㿘!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` ?# @2 *`@?`#6`  !2  3@ @2 *`@3@!2    @2 *`@2` 㿘!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` ??# @2 *`@?#6(,0`  !2  2 @ 2 *`@2 !2  "` ` ?# ? ** @2@ 2@ & !2  "`$`$?# ? ** @2@ 2@ ?&$# 5??`0 !2  "? ? *  *` 2  2  !2  ? , @*` @* 2  @2` $ !2   0 @*` @* 2  @2` !  Ä 㿘!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6`.`.!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  "` ` ?# ? ** @2@ 2@ & !2  "`$`$?# ? ** @2@ 2@ ?&$0(# ,??`0 !2  "? ? *  *` 2  2  !2  ? , @*` @* 2  @2` & !2   0 @*` @* 2  @2` `$@  `Ä 㿘s!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` ??# @2 *`@?#6`(`,`0`  !2   2 @ 2 *`@2!2  "` ` ?# ? ** @2@ 2@ & !2  "`$`$?# ? ** @2@ 2@ &$?# #?!? (!2  "  *  *` 2  2 #!2   @ *  *` 2  2 #`,!2    *  *` 2  2 #`0  ` Þ 㿘j!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 !2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6`.`.!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  "` ` ?# ? ** @2@ 2@ & !2  "`$`$?# ? ** @2@ 2@ &$?`0`(# !? ?`, (!2  "  *  *` 2  2  !2   @ *  *` 2  2 #`,!2   @ *  *` 2  2 `#`0   `Æ 㿘!0`  @@?0(?6`  !070(7 !0`  ?0(6 ?`!0@60(6`!0  ?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0  2 ?0(2 !0  2 ?0(2 !0 2?0(2!0 2?0(2!0 2?0(2!0"? @? @*`(2 2` "!0"? @? @*`(2 2` "!0  ?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0  2 ?0(2 !0  2 ?0(2 !0 2?0(2!0 2?0(2!0 2?0(2!0"? @? @*`(2 2` "!0"? @? @*`(2 2` "㿘@` . *   *  ?#`!2  *@@ @ 2 *`@2 `㿘@S  ` @ +@  .  ``㿘@1  . 㿘@!???#` !+ 2    @@ *  *` 2  2 & `㿘@` . *  %$,<@`i * ` .  *    !* a$.$  !%*   "$*   ",*   "<*   "@*   "`* bh.h  "i* 㿘鰔!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 `.`.!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6`.`.`.`.`.`.!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  "` ` ?# ? ** @2@ 2@ & !2  "`$`$?# ? ** @2@ 2@ &$!2  "`(`(?# ? ** @2@ 2@ &(,  ,* 㿘”!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6!2  `  6 ?# @2 *`@6 !2  `  6 ?# @2 *`@6 `.`.!2  "``?# ? ** @2@ 2@ &!2  ` 6?# @2 *`@6`.`.`.`.`.`.!2  ` 6?# @2 *`@6!2  ` 6?# @2 *`@6!2  "` ` ?# ? ** @2@ 2@ & !2  "`$`$?# ? ** @2@ 2@ &$!2  "`(`(?# ? ** @2@ 2@ &(!2  `, 6,?# @2 *`@6,!2  `. 6.?# @2 *`@6.!2  `0 60?# @2 *`@60!2  `2 62?# @2 *`@62!2  "`4`4?# ? ** @2@ 2@ &4!2  `8 68?# @2 *`@68!2  `: 6:?# @2 *`@6:!2  `< 6<?# @2 *`@6<!2  `> 6>?# @2 *`@6> @* `* `* `* `* `* `* `* `* ` * ` * ` * ` 2 `"022`" @*  $ @ ` * `  * ` * ` *   *   `"㿘@5`` . * `   "  @* `* `* `* `* `* `* `*`2` 2 ` * ` * `* `* @* `* `* `* `* `* `* `*`2` 2 ` * ` * `* `*33$33322333PY<\\\\@bTbTY[bTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbTbT\\\wpw{Lz{tttDt||l}}}t,rPTts$s@    2     2 㿐> 0`@{% 2%   @D &%% 2%  @D &% % > C% 2%<> C@W"0P > > C#@O 0H!* %4> C@G#8%4 @   `.  . %4*"@ *`"  *  , @ ~* %< . . •`   &  ` & @.%%:  6 h6 R6 j& x& p& |@ O  H'>< @.> `  0*"@ @{*`㿘  @!> !!> C#H @!, А .% `  !! > C#H@!- .%    !%<` W> C>"*` € В    А`  %@` &%@  %@` &%@   %@  А  &%@. .     .     А` ܟ  А`   А`   А`  %< @#X А` ܟ  А`   А`   А`  %<  `  㿘 @> C#@V > a!> C#H @M!t  .% `  㿐> !`> C%#@8!> ! 2%> > C Pc#\ P  @  $!% 2  & & &  @ U$ Ԗ D!"@ Ԗ`@0< .%6%  "`, @  Ԗ -*! #   $ ,  "`, @    @ $@" ,@`,   2  Ԗב*А Ԑ! &% &%  ؒ:  %D   ; `!`*%G*** Ԁ@`! .%!> C#H @! В .%    %<  a0 Iɐ#0Ɛ"0 .%@/㿐` `,  ` > !` > C`/#`M`N@r .%`` 2%<`А"@ >  @ #> 8  3 @ # @yd`%< 2 !!> C#H @H"w А .% `        ޔ     * %4 @ q ,`"* %4@ i* &`%@  %<  2`   `2 %@"?%@  %@     Д   Д   ` "r`M%@ Y`/`D &%0&%,`'%,%0 @ `  А`  ݀ @2 %<  А` %<  `  %< !!> C#H @"  .% `  !!> C#H @" А .% `    @0`D@6`/!!> C#H A@" A .% `  A0۠  %@ "    `  ` `D`M.`,`,*`N *`D  `..`.%@ p 2o  &%0&%,' %,%0 @ `  А`  ݀ @2 %<  А` %<  `  !!> C#H @" В .%    `!%  @6%.% !a> C#H @"ϐ  .% `   !!> C#H @"ѐ  .% `   @0E @ ! > D@ؐ (!!> C#H C@Д" C .% `  C0)`!%  @6%.% !a> C#H F@" F .% `  F0!!> C#H B@" B .% `  B㿘H /d * % >  P@b&` H 0㿘> 0 ` `@? `H / * % > @  PH 0` P@ >`c<@we`  &`  㿘  `4!> ! `> D@F 8! > D   P @<``*    @,`   4$  @@S  2@ S$ > + D<$ H /d * % ` $ ` "` $`` $ ,` " H 0m 2$ N  $  $ D $  $ H  /  $ D $ @ $$ H, LH /d * % $`$ `"@%`  $ e`@`H 02  @ " @ @   @ 㿘> !`> D@ `"3 %> D @ "`H /d * % @ H 0` "%  a @gx@ #贆2 а 㿘> !`> D@T %`" > D@ `` `*    ` @2`  @? ` H /d* % ,       &> +$  @?J   H 0@@ B$  <$  "` $$ , " > + D$   "$  `      `  H 0z@=,`M  2 H 0k@ *`  *`2    *`22 > D@ ؒ,  , *# ,`NH 0      , @``&   ᄀ @``"`& `?@"$@$`` ?$` & 0 "@> D`!@_`@`2`㿘``/  *  > a  > D@I!@   .`/  *`,`,``  4   #&`D&`@&`H&` &` $,        2, @ђ , $  @2 0 &@ " & &  &`` `&` % 㿘`` *  ,      Y> a  > D`,@ې!(@v``L (2 `, > D*`4 !H2@̒ `, a`L,`X` @  $`, $`,`L > 2`H`H$`(Z0c$`(a "`(`"`,> D@!x`,`2> D> D `4@!@!@K @2 `,% &  .%.`, 2 `  2`  2`4 , "  `"  "`  ? "$ $ @?O `ɒ %H /d * % @H 0㿘`  `*  ` 2,``  ,`  2  > D> D> D!@2`M*"`M `N*`  ""> D!@~ ?*`  ?&` @``"`& `?@"&@&`㿘!> ! > D@" !!> C#H @$ В .%    %    㿘``> D0% &%(% %(@@5"0 А@€ %<` * ,`  '>  А@€ , &  瀊 % `   А@€ , А@ € %(  '>  А@€ , & %(@&%(ᄀ  > D`"P> D"h> D"p%(@o ᄀ "%(%( @ > D!> D% "x@a %(`@ *% > D@Y"%(㿘!> ! > D"@M!   > D#> D@@Bbx &@> D@;"  А`@ %< 2   А`   & Ё㿘e<   e e8  e * * > D"@ `!> i ? `*   `@*``       g`` `    ,eݰ `.@  > D"ؔ@Ӓ`!> ,e$` ````+`e4`@  . "* e4@ * & e@e<  ` 2`` "?e@  `  `Д  `Д    !> ! > D#( @}%q!!> C#H @u%q`А ,e `   e e @ ` @! > D#( @^%s!!> C#H @V%s`А ,e `   e e @` ,e 4e@ $dH>$d! > D#( @:%|!! > C#H@2%|`А ,e `   e e`@ ! > D#( @%!!> C#H @%`А ,e `   e e`@ 4e,e  㿘> !`> D%(@#H%( 2%> D#p@ 0!% > D @#% &%( `.% ! > D% @ې#% !!> C#H @Д% А .% `  % %(> D @#0%(` > D#( @%!!> C#H @% А .% `  % % 6%`A3.% % %  %   ` ` `  ( ` ` ` `    `  @`?`!!!> C#H @g%ڐ  .% `  0"> E  @W % &%(  > E"> E ` %  *  @ "N>#* €!"> E@2 $ 6  @>` $> E (@& &$ ! $ $H" ( .%!"> E%@ @% @"{ !%L!2%> E`  X@ !b> E@ !! > C#H@& А .% `     ,`    *  2  C  M   N*` ",N" ?*,N,M *U"> E`  @ % `.%  ,  %@`  В   А`   А`  0%> E`  @  , `$,!" > E@ %!"> E  @y %!"> E@q!  $$`.% !$ !"> E@_!$$@$$H!"> E@T!(@&$H&$!"> E% @G!@% `  " `G!"> E ` `@6!P% ` O! `,%   `,,%D "  " `|("%4@-` > E@!p% `2  , `,! > D#( @&s!!Y> C#H S&sc Ԓ@ E , "* %4@ =* & , "* %4@ 3* ,@`  @ +@ &!, @*`@*`" > E@А!% `21  %D@6 %G,   ,  `,! > D#( @&!!> C#H &@ А .% `  % % @`.% 6% ,% .%   `+ %4f @ ג ,`"* %4@ ϑ* &`%@%<    2  "? %@      Д   Д   %> E @L!% ` 2L,  @, +@ %4 @  ,`"* %4@ |* &`%@%<    2 `` "? %@      Д   Д      ,@ ` > E@!!!""> E@!@` > E@!! > D#( @ݔ&!!> C#H @Ք& А .% `  % % @a`% 2> E% `2 > E" S%%  > E"`@ !6%   @%"@ ! > D#( @&!!> C#H @& А .% `  % % @` > D#( @}&!!> C#H @u& А .% `  % % @` .% 6%% !!> C#H @\&  .% `  !!> C#H @L& А .% `  % .% &%(㿐> !`> E%"@3%% @% "=%!!> C#H @$'  В .%    6%)&% "> E! > D%#(@'!!> C#H @' А .% `  % % @%.% @ 6%# @'% 2%<% %    * 6%6%6%&%@"%% є ǀ"%% "s  % ” "%%     % *%*`* %`* %*  %* % `&%  , ހ  , %4r @  ,`"* %4@ ۑ* &`%@    2 %<  %<  `"?`%@  `    Д   Д   ]%    `%* *%*`%*  %* I&%% > E#8 @@'9 ` % 9*@ > E#8 @1'B   M%* N%* (&% % .% *@ ` *    ` , , *@   %  *@ *@  %.% *@%&%%< 2% %%!!> C#H @'  .% `  0U%H@8 Д% '% @ `  А`  ݀ @2 %<  А` %<  `  !!> C#H @' А .% `  !! > C#H@' А .% `    @x> !`> E%@#X @ 2 y  € . @€ %< ` .  А@€ .  А@€  . `$`" @ 䀊 2! &%ᄀ > C #  @H  䀊, @€  ᄀ! > C#H@6' В .%    c % > E @%#x^   > E#@  0@Y  倊 @( @€  ᄀ! > C#H@' В .%    0 %  2  "`, @"-% %  .% ߰ % > E% %#@% А@€   ᄀ! > C#H@ʔ( В .%     % ` .%  € "A  @?2 > E @# @ 2  倊2* % "& % 2$% > F%   #\ @  倢 2    ?H#\> F%@v X 倊 B> F @o %`ᄀ > D#( @d(Vᄀ!> C#H @\(V А .% `  % % @` > D#( @H(Xᄀ!> C#H @@(X А .% `  % % @`.% 6% 䀊` "%6% ᄀ > F   @$ ` А@€  ᄀ!> C#H @(`  .% `  ᄀ!> C#H D@(g А D.% `  D%?`s>#̓*` € ",`  *  `? 2!  2 4 `8*`` " `"  "`  "@" " @5 `2% "> F@` > F@ ` % *  `.% ` ,`% 2> F @! `> F@!0ѐ> F@!@@k7  T"`,W& %?`h>#*` €> F @x!Xt %  > F@o!> F@j!X%%   € > F @Z! ?#> F В € @Na ?  􀊠 %6% 6%6%.% ᄀ > F@7!@k\ 쀢 $ " & &  $ `$ & % `.%> F @!SG   $% %< "%  > F  "%#\@ : .% ᄀ > F"`@ ` "%@% `.% ᄀ!> C#H @)*  .% `   % " %%< 2%%  .% % > F  @Ȑ"p  0  2;> F2> F@."`   *  `$>#*` €ᄀ!> C#H @)T  .% `   ! ` 2 % M 2%> FU" > FP" ` ᄀ > D#( @@~)cᄀ!> C#H @v)c А .% `  % % @`@.% 6% ` D %G,`,`%  .% M`ᄀ > D#(!@S)kᄀ!> C#H @K)k А .% `  % % @:a > D#( @7)mᄀ!> C#H @/)m А .% `  % % @`ᄀ > D#(!@)pᄀ!> C#H @)p А .% `  % % @a.% 6% t&%%@ " %0 @€  f @€   > F "  #`#\@ ᄀa> C#H @۔) А .% `  ᄀ > D#( @˔)ᄀ!> C#H @Ô) А .% `  % %`@ 6%.% ᄀ!> C#H @)  .% `  !%@ !%0 > F  #0  ` #\#`@ !&%@ &$H.%u&$ #x @ ᄀa > C#H@x) В .%     % W  `.% > F # @]  %(> G @S % %( ?,L%(% @ᄀ @ > G  0@B > G ! $ $H" ( .% @@. &%(ᄀ!> C#H @%)  .% `  0> G ` @  % 2> G2%> G@~ x   "0 @z @ > G!! > G!> G!ᄀ @> G@ &%ᄀ @" > G@ܐ  䀊/%<  瀊 2% ᄀ!> C#H @Ȕ*  .% `  % ` .% ᄀ! > C#H@*  .% `  $ > G% 2 %> G   @ %%% @ ߀ .% ƒ`?   ! @  ]&%> G /!8@D А@€  ᄀ!> C#H @r**  .% `  %@ W/D &%0&%,`'%,%0 @ `  А`  ݀ @2 %<  А` %<  `  ᄀ!> C#H @/*8 А .% `  ᄀ! > C#H@*; А .% `    @ D/ᄀ!> C#H @*?  .% `   &%ᄀ @> G$@!Xᄀ!> C#H @*E В .%    $%H@8 Д$' $ @)&%> G@ϐ!p%< 2$ᄀ!> C#H @Ô*N .%    $%H@8 Д$' $ @ &% ~$     А`  ݀ @2 %<  А` %<  `  ᄀ!> C#H @~*[ А .% `  ᄀ! > C`#H  @j*e䀢   .%  Ѐ   `   @S  @> G@P!% `.% ᄀ!> C#H @E*k В .%    &%@9 r;0  .%Ӑ* @%4@ s 2В@@@ '"@  ? @ 2 @ː@ @$  $ а 㿘` 'А @&`&`  @ ;% !'!> ! > D#( @*!!> C#H @* А .% `  % %`@ 6%.% А"@@ #@ '>   >  '@ #`@eВ0 _x  ``4*``@  В € Ф  @ > G!> G! > G %!#\#`%#d%#h$#l%#p% L#t #x@ HH /d4 * % @  > G@v"P2 0!> G@o"X $,j   % @o> G@Y"``  ؒ`*  $ ؑH 0㿘> + D}H /d * %  Ԓ @9 0*`  -`?6% 2!  2 4 `8*` " `"  "`  "@" " @/  2 Ԓ@̑*`H 0@eŒ <㿘 А@€  . @€ %< ` .  А@€ .  А@€  . `$`" @ 䀊 2! &%> !`> C #  @ | |X((㿘#6#D P # ( 4"" +> G.`4 @ {`, 2 .* 2. 0G +> G@ڐ@c#@@"> G> G@y#@u# ?%#4# @( # %2  ?# @2 *`@#(`# !.`2 2g".#Gg > G ##@> G# .#G .#G2@5'0> 4bh@d:  #G&@:@??@ # @2 *`@&@:@?@ 4 0֔ >>>? c" @$t$x$4\$$ $@ɐ@#(`#  ">>t 3 @&>>>#D!Ȓc0&"&"&#&##G > G@ݐ##D?`6*`>#, €#@@(@k#(`#  2#@@???@8 "쀢   " @ @ " #@   #@#@8#! (@# !2 # #  ( 2 @ : # X# 2`@ / 㿘#@@ P"Ȓ?@ϙ?"@?@#@ 㿘# "Ȁ #  ( 4  ?# @2 *`@> Ǫ !̢ 3> H/> H@  @ " @@`  @=(  `` &#@ +  ?4 @א     ?# @2 *`@ 2`, > G* > H@ 0> Gd, @i㿘# "# (#2  ?# @ `*`2 @#( `#   p5> G2 4`5   3> H/> H" @ѐ`  @ΐ(    @  ` &#,`* `@> H @ ,`> H p> H > H@ `> Gd@㿘 ?# P# c# %     * 2` 0   `@$@n#F  #(@ #  2 4   !4 #F 2 #  ?#4 #(`# "2  " , ``$ #F?   `* `$ ## #  ( 2`@  # X# 2`@ ߐ #(@# !2#D      #G&@:@??@ # @2 *`@&@:@?@ 4 #D 7 ( 4   ? 2`*    ? 6 ?# @2 *`@44 4 #@@"@{# ( # !2 6 *  x 4  6 *  p 4  ?h 4 @"А@   4   H4 @\`@ {@U5\#  P# (!2# # R`\ `\!?0(R`\ `\!2㿘"@I 㿘# ( # #4` "   @4`# 60  @4`#%  X#  2`@# # (  2@`#   @4`㿘# ( # $4`  ` ?# @ `*`2 @`   ?7?# 2 , @4` ' . 4`&##@@k(#@# #2 #D   `?# @ `*`2 @`  ??? # @2 *`@4`  @?# @ `*`2 @@  `?# @ `*`2 @`  `?# 2 *@ 4@ 6 ?# 2 *@4`#(`# !"2@  0#(@# $2 `;>#@.` € #F   *`   4` &#D  4`0   ?# @2 *`@4` ##D  ?# @2 *`@4` t##D  2D## (@ # #2   @?# @ `*`2 @@  `?# @ `*`2 @`.`  ?# 2 *@ 4@ 6 ?# 2 *@4`-# (@ #  2   `?# @ `*`2 @`?` *.`? # @2 *`@.`4`##(`# !2  㿘#@#  # @f""&`"g&`" &`#D S O P> H#1 (@# ##2 `?# @ `*`2 @`# (@ # ! p2> G#d* 2&`#(@ # $2 &`@  ` ?# @ `*`2 @` ("#`  &`&`> H#D @T 0#(`# !2 㿘 \c $@ @fc !Ā !! 2 !! Z  2 > H@ !€ @U @T '!€ " " `e$ `B > !Ā!! 2!!    &!&!$ !?&!@M`  ?# @ `*`2 @@ 0  cG`:@??@ # @2 *` cG : ? 5  \$6 \ % ?@T !€ #5 !Ā !! 2!!    &!&!$ !?&!  c::`@??@ # @2 *` @c::`@?@ 5  D @y3 H/` /cD`   6?# 2 ,@5 ?<#5 cF %>  2  %  ? @ @-`@Q 2   2  5 ` ?-@3 2 -2H 0 `B >   cD    cD    @  ?# @2 *`@ `@ΐ!@  "!@!ā㿘# ( # $2`  `?# @2 *`@`#(`# !2 2   " @v 㿘#9#   ,`   薂B@b> +#D`` #<`B c> #8 %8%&#<@M#D"#< `B > @ H4  ;6   &#<#D    `2#D㿘?# P# # ) &+  @2 *`@4`  @/ \ {4\  @ "!h 4`` @2 *`@`  2㿘# P # #D   ?# @ `*`2  @#D    @@2 ` g@~ 2```B 3<``D`B <` @w @S  a #D   ?# @ `*`2 @    @@0B  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0   $㿘P> #Ȁ` > H`@v 4* @ "@   @(H`4@\k  24 `  ?"@$4 & `& & & H/` /D`  `O @N82 F> H@ ؀  @  @   ? /@ *@`)@  2 @"@`@ $ 2 @2@` @ @ *@`@ @   @4  ?c?#     * 2` 0&  #  ?#c %     * 2` 0  ~ `@$H 0㿘 H /f * '  ! "* \! <0!50 !61 \ 6 \ ` %А@Q P&`4 @"@  2 \@L \ ?6 \ `@` `4`4@  P`4  \ @ @  H 0㿘H o*@ g H 0㿘> H  @ݒa B< 㿘#@# # @ϐ"#D 2 #(`# !2 4 4   4   @4  ?c?#     * 2` )  $  ?#c %     * 2`   " } `@$#  P4 . 4 # (#  2`@K # X#  2`@?!h 4   x4   p4    4 @㿘#.@} ? c  . 2 @ 2  @ . 6 㿘?###  c)    * 2`    `}q d2`2#F> H  !   > H !@@# 0 㿘#D  "Ő 2' #` # ?# @2 *`@2  "# ` # ? c *2`   㿘H /f * '   4,# 2   @W( $ 4@Yؒ H 0㿘H /f * ' # 4   "@$ @ZʐH 0  ? 0*  ?0(2  ? 0* * ?0(2#*` 2`# ? (0 #  㿘ʒ  ƒ  ?㿘  * ͒ @    >㿘# # `($2# 2` ˔  ǔ Ô  x u T o  * 2 I  c  , { *  2 8 Q 0 #(`# !2 㿘#! # @($2h t  p l h  d `   #(@# !2# ( # #2  ?(0"" ߒ` 6 ? @0*`2#(# !2`㿘 ?#c #  `  * 2` 0 `{p  $!X!`!h!!p!!!!!!x#|#####t###l,l.`.`.`.`.`.`,,,,.`-H.`--.`.`.`.00..0000..../0/\//00000@h> )cH #'!&/  0@&< 77€Р ""> I@!H Ԕ xw@N@ > I@p  `xk ?& 0 4\`$&%$x`  $t`( Ia@ "> Ia@ #> Ia @    d6   6)+)6/6/6<6#H& 77Ȩ 6/6/6/6/6/6/€ 2 6/?# @ `*`2 @6/   ""    _#E [#/ :@b_&/`&/be@"/ &/C!/#`@&/#'&/  c  @/$2 !&// &/  aj $/(&/&/  b &/&/ !@"/ &/$&  #<!O 77€  !̀ "`,/ &/!`,#@V#@   T #<Ɛ 77€ $?# @ `*`2 @8   6/>>#> I%> I    6  D  6/>>#> I%> ID@ɒ   @͖ ! @Ȗ / $ @ / ( @ /!" @  `#  @ ! @ / $ @ / ( @ /!" @  `#  @ ! @z / $ @r / ( @j /!" @b  `#  @X ! @S / $ @K / ( @C /!" @;  `(  @1 ! @, / $ @$ / ( @ /!" @   @  @.@yⴐ$`@R4d@~Ða/&/@  ,n#@@  cH > I@Z!/  /Ā2d/6 ? @0*`2/  /Ā4h/6 ? @0*`2㿘/  0`\    / 2d2@ /Ā `4`h/  ?<#2  / 2d2@/` /Ā 0`@?# @2 *`@/Ā 0`@  /Ā` 4 h/`67 ߐ#p2  @֐  /`4h/@  !2 @n  /`4h/@  "2 7 /`  /Ā` " D@?# @ `*`2  @ /Ā`"D  /Ā` 4 h/@  (2/؀ @(  @e  /`4h/` ?2 @  /`4h/@  $2   /Ā` 4 h/@   2  /Ā` 2 d/`6 *   2a  @$ /  /ą*` ?(0  /ą*` P! # 0`€ /쀢  "*` g @  f  @Ѳ( `\$ `  @ D Q? Kc *`2 @ '2%> I 2  " <  > I   > I ,,  <  @|!0#, D * 2`   @|!0 ( # ` @ $ $    @ D 2`4 #?c 2   @C    @5( `ߔ(   $"$ <$ / 9ܒ  * 2` >  > I  2`*  @|"00 DtB < <@  <@ǐ > I@|o"`$ @$ 08 *  @@>?@:?c * 2   > I 2`*  @|="0p$ $ s s  s  #   @ D *`B@l<`0|?c 2*     2`* > I ɔ  $ #$   @ . ,``B <`@ 1 @.H * 2)/'    @Ȑ  @% $ > I"@{͒ @``B *<` @ߖ @z?/ 2 `D@ `D @m] /쀢  "`@0@  0 \`2 \2 Z @:  @: 㿘#@SS < 0 \d%H /f * '  #<@  @ H 0> I#@{\ 㿈 # 0`€ * `2  @ ?a# 2 + b.   + @ 0_`] * 2` ?  #B ?,` #c   /$`5@  @ `*`2 @/` / 8p@ @2 *`@ 8p@7<@8 7@? $@ˢ`      >`㿘/???## /` / @ `*`2@ @ 0 @ t#??2/Ȁ    > I#0@z  < /Ā`  /`6?#2 .@ 2 /`/`6?#2 .@ 2 /` /`6?#2 / @2/` /?#@2 .`@a "` ?#c2?# /@  /Ā  `0`  2 /Ā  `0` '  @  * 2` @ 4h 2@  t@ ??2/Ȁ 6   > I#X @y <㿐 ` / 4 #tc?? @   @  6/> I#@yђ 0`&/% ?c:  #< (777€㿘  `#//  * s //̐#*@ s㿐  `?` @@! #< `(` < `# 77! # @` !@ 2հ ` @ 8 2Ͱ /@   /Ā` 8p@?# @ `*`2  @ /Ā` 8p@$    `8p?# @ `*`2  @ `8p`@  6@6``  ` 8 p*?2` / 2`?@ /   "`@  $]6` `X?`@"`  @<*@F 0I@BD@D `?# @ `*`2 @`>!P*` €         ?#  *`2 @a?# @ `*`2 @ 4@` !*  2 !4`4` 4@`4` h`? ` * 2`    "  777 ?`@  @. @i@"X``77` @ `*`2 @` L>!*` €          3* <`( 77` !*  &2  `  #H   ? #/ "??#  *`2 @7$ 7 < `# 77`-7#L`*`  * 2 #` Ȧ̐@ w/ &   7Ȑ|$7ʒo`€ 8```[ ` @X 8  Q  /Ā` 8 p/`@?# @2 *`@ 2 /`8p/` `?# @2 *`@(2@`  ` 8 p*?2`/Ē  2  # @`!!@   㿘68> I      @wr#^   `/đ* /`6?#@2 .`@ 2 `/đ, /` a?#2 .@a" ?2` #, 70/`/ @  * 2`  `0 @ `qS 2/Ȁ` < 㿘 8    ` 8 p7 ? / ?6 㿘n 6 2   ` 6 l7 /Ė 3   /Ā` 6 l/`  "4 2 /`6l/`6 V"x31 6 "/M @    /Ā` 6l?c * 2` 4   /Ā` 6l@"4@   `6l?c * 2` x  `6l"x@r 㿘! #@  @ > I #@vMs a"?c /` / 0`@  ( 0`@  `pc 2/Ȁ`6/K <`  /Ā` " D@?# @ `*`2  @ /Ā`"D & / `4`h/@  (2 p 6 4` @:  $ / 6l2@2/İ 0 d@ u  0<` 177  \@  #`€01 \"5 \"  ,*   @  mf `  @ tԒ d c,  7㿘`?  0@ 0@"` @"W4@ ^ 0?@"`@"`7 @"`  @o@"\`) @@ 0!@"X`ఐ-@"` C%@*@"` @Ő@R 0@" ౐@%@"` @Ɛ〢@"` ` `@ lݔ "lٔ 0` @  `*`2/0@ `  *2/&  * 2` 6/ * 2` 6/` * 2` 6/` 2`*  6///@  * 2` 6/` 2`*"ݒ 2`* " 2`*# @3` * 2` {6/` * 2` q6 ` * 2 `f6  * 2 `\6  * 2 `R6  * 2 ` H6 ` * 2 cD=& ` * 2 c@2& ` * 2 cL'& cP l D0   * 2` `? #H&#H & *`2@ > I#@t7  `> 0    H /f4'Đ* ''  0H 0ā K !뀦@ B a@"F> @">  !@ꀦ@a @ba@qa@"B> aҀ@gaـ@0!@  !耦@0!@/0a؀@ "za@ "ߒ !@ϐa5@aҀ@ ϒɔa@"  a怦@Ba瀦@0!逦@0 !6@c0!ր@u \ 7 \ `  #@@@0 4 \ ;P \ P䀊!P 2< ! 777#   䀊!  <   77#7`€W \#@W \ @"W \@ W \ Y$@R @f$i$ H 4" !8@ "D 4 ?a!7@0 c#〢@@@ W#@B R##j T +N4@  @ r. DE#Pj D= 4?# @ `*`2 @04  4` @ * &4#H  @ `*`2@  44 ` !" ` *j 4#`€i8$Ȱ`0`@  € 4  @Ԑ$i $  4 ?`-g+ ` !7"+4 ` #S`% O+  ``CH`E s#`〢, k#@pwc * 2` 4n  ` <@  @ ] 4`€T!  `N J 4 \ E#d+ 2 ?@- 8-@ @1@% *%@C #C@(@ +`  4 #`€ `  4 \  @$hc$  4 \ @  ` @ U 逦 4hR$`0`@ ܀ 4  @$h:$ Ѐ 4@ Œʰ \  " `h, !  @ϐ$<A" 44#`€  ?c  * 2   @ !  2 *@ g !>`0`@]  4  @ !g ! w 4@ ?)"  `"@* g 4@@  Ƞ  ?@ pw &4 < `77 "*`7 h # \`C 4@= 4>`0`@ 5 4@ /@ +>`0`@ $ 4@ Ȑ@ ֐`0`@  4@ Ґ@ ' >`0`@ܒ  4 ʔ  @$<4?# @ `2 *`@4A 耦 4 \  #@݀ 4 @$<!" 44#`€ 2ɰ ?# @ `*`2 @6  @Ґ$<B" 44#`€ 2  . . . . . .>`0`@q  4  4 \ !  2 `2 #<@  @  @$< 4c 444#`€ e 4""Ģ>b@GH$!>  @ p d*  @ p~ * @G> > J* "*@@!@>`0` @ 8 4  @.- @A$"<4 4`!"  *g  4 2`€ 2    >?# u&@ o |  4`  4` `4` 4` 4` 4`  2* 4`>4`@  2,`R,`S   2* gy,`  2`*  4`\  @ `2 *`@4`^ <   7 n      ,`t,`B 2 2 ```C `B + `B` `,`B 2 `B ,`x@}r  2 `x ,`x@f | ` &* "`|@ ` | @ 2x`q@9 n 4 k 46(e  @y$< C" 44#`€ 2R ?c * 2` D E$  A6>`0`@ : 4 "V3 (/* #D $ $ < CD77 ?# @ `2 *`@ 7 `€ 4@ @v0 4  \ @  @ `@ H 0ā 㻐!" `c(& `"# /$2 <"77€ 2  2  > ` "Ġ@ n * @E0 " > J@n !"@A&X/ 0 R'H /f4\* '\ @ @ɐ| /!?# @ `2 *`@ #<777€7/ 7ڐ 2`*  77/<`  2`*  777/<  2`*  777/<`  2`*  777/<  2`*  777/<`  2`*  777! < @ `2 *`@77/h#D < @C `2 *`@777€/ @ < - @ `2 *`@777€/ <  @ `2 *`@777€#bh  ?@ lݒ &<*4 b7j7l  neT7h € "'#/`"  / `# @ ?@ l &< 4 * 7B F7@e.7D €!/#c  &@ l ?< 4 * 7c 7 e7 #/?#   2 c*< 777`€#b  ?@ le &< 4 *7 bސ 7d7 € ̖<77 " d˔ dƔ  €/` \!< !777`€ #< 777`€ج/ g%@ !?# @ `) 2 *`#@<  777€7ȐL < @ `*`4 ౒@77 ȟ€P<తR6 #6     - ) c!4 !777 € ?c  # 2`* <* 777  # / `@ ` &: > J @@l^ &/ &: > J h@lP /@ &/ܐ@& 흒`@QH 0\`@ {#5\@D <x> )#H! "'  "@"`& &  &  " " ?>?c #@& @ k>  "L 2`T2`* / //?c 2` ,   c〤   ؒ@/.@`.`.` * .`@wӐ8@/Ɛ4`4`4`, , ,  ,@/ #H > J@G& p> )#H'T? @ jݴ``T`2 @* // /?c 2` ,   cI〤 `  ؒ@/[@/w@w{@8@/m @@4``4``4``"   > J#\ @kZ ? H > J@F P Y  \$U!Ā @!! 27!! I  &!&!% !?&! =@ ja D(7؀ &   @ ? 2`  \!2`  @ve> J@k !@Z!Đ!€ ը@7ْ Ѩ` h h   5@!"݀@2 b   ( 77Ȑb `b #@`2# "`@`H`( 77Ȑb| bx  `bq ސbm bi  *?b#777 ?7` 77# @7bL!? #bO  bT @t bHܐU%    * 4 7ܤ  D @ ` @ <\ D#bH  @H?# @ `2 *`@! 7ܠ#  D @ `?@ D5 D?c 2`*  7`##@` bH> J!0@j) DbH  @ ! #  D @ ` @ . D @[ @W \ d 6 Z6 \#@!  @ > J!`@iP/ < `@ i D/ܐa ?# @ `! #2 *`@(777 @ D`@ <@!  @ > J  @i!ﺐ 㿘@</ #@AȐ 0  # /` @  \4 Z {4 \㿘> J @i!ϐ #`€ `B > 㿘 @"/Ȑ/  ?&/@@ h  #<!  77€?# @> H `2 !t*`@ < ! !t@"   " @2 `  &쀊    > J&  &!   &@ hW #<! 77€?#  @  `*3 *2 *`3` @ 777@ h2 # 77`€? @ ` 2 +`@  2`+  ( * ("@* *`@ *`*  2*   777`Q&#v"2I @ g &<a$ 77€ 8 O @3K .0 K -, K ( K K*`KА Б* +`K" " (* *?А  *** +  *@  *`K ?А &&    > J! @hh0& > J"@> I!!  ##\@ h#`#d#@ j@ h d#h d@ j}#l> J!@hB㿘/?`#`  @>!*` €        ? ` ``" ` `"   / " `@ 4`@ * @//@ @^6/6/  㿘/ /b/ /  `2` /6/ ?c "  O "/ F " /A  6/ 6/ 6/  6/ 6/1 /  ``>!*` €      6/ "//  / /@ #@/`@ð < x㻐 2/ &`f&` 2:/<!D &`" 77#`€ , ?# @ `*`2 @`"```  &` `  &`` &`  &`` &`` &` &` &`/   < <!C" 77#`€ ?# @ `*`2 @` &`㻐/  ?  cP ^U D?#  `  ]t f-   * 2` 5   < #5` 5@ #`€ 2U@ 2O?# @ `2 *` @<  77 7 #`€ 23 2-?# @ `2 *`@ < 7 7 #`€ 2 "   "   #@ 㿘/P`4 @L&` > `0&`` @Y ?`c    ,  ` @ `*`2@  "\Ӑ `  㿘`6/ ` `6 #@ /"` "`㿘`2 `/@ O  2//*@&/   &/` "6 ! #N2` @ 20`2- "V`    ?"@ *`:`! #*`2` 1 >@ "   "V> J"H@e̒  㿘/$! : -# >@ 0 @ "/,` /Ā`  @?# @2 *` @/Ā`  @` *`:`?" 6`/@ &`&` 㿘  .\Ԕ    2` >*` 2H" 2B" 2<" 26" 2?c 0(2 0(2  (2` I2 c2?#(020c 2#?(0*2 c2?#(02c c 2?#(02c  (2 2  㿘`  ` >"X*` € T" "z6`?# @2 *`r@ E" B" ?"`?`#   2 3 **  bb 6 b6 N6 `?# @ `2  *`@* "6 "6 "6 "6 "6 "6#6#6##6#6.6 # )6`?# @ `2  *`@ 6 6  `?`#   2 * c *3 c  6 6   2 #`*``8*`2`@ 㿘@ @    ?[@"@&@@$@㿘**`[` &㿈!> )#H' ` / ` * ` * ` *   Җ #H > J@?d"`㿘   `> J"p@c@ c"/  4!&$ " p!"? x$" >͒a@:ٔ㿘  %@o> J@c"%H@ b  6`[t "` [o `[k ?#2 *`@f6 㿘  '@n> J@c"'H@ bŒ 06!?#[C " [> [: * 4 f6 㿘   `> J"В@cb̀ D4̑H /f * ' @;w "$'> J@;p  @cC @ @$ @! `$$/ > բ  a  ]\ 2?H 0㿘  H /f * '  {  @u?;c#c? 0 M L$  ,   @n@> J@b#   4 ` "`$ "@$   4 $$ "@$ @:/"-  @n> J@b#@    4 ` "`$ "@$   4 $$ "@$@\  @2 0  @@9 H 0㿘   @H /f * ' ` "`$  ?"&&  6  &" $ $& "Ѐ  > ` "@ b @9XH 0㿘    4?Ϣc @:\ < *`a  **2 ` "`$` ?"@& & `"  "`   "@& &  @ "@ @ aА?$aЁ㿘` ```   @ d, q D @)  ,`E !ԓ;` ,`  g `;`*  `2@ `g;`* ` ?* `@ 0 6 4& & "$ `&  "` "& & !В$!АYt >Β`$@8"@9|㿘` q`` @ cՐ *   " ` `  `` @  `?      'L  'P 6@lʐ`> J@ap#p0.?#  @ `*`2  @*2  ?'L'P`P` L@l> J#@aKx  P`  x   " 2-"!̀   !Ѐ'  > J@a#БH /f * '  H 02" z @8ϐ-`2   "f  `g  e   4 "b ` `W   'P @     @  $@ " `  @F@"@x$   > Jx#@`|2   @`' ` @     " `x   @`` @@|4$@ > K @`2`  " `   > K @@`}%H@ _ ,6!?# X.  X*  X&  @f2`. 6* 4 'L2L,`'L2`L 'Lx   $&VX> )#H ` ''L'P* ?# @ ``*`2 @ )'LP'PL` 'L'P Ș ! /  > )  "@kU`> K@_ h"2  "@mϒ ` "> K  @_> ) 5    8 > ) ` , :, </"     " : " : " :  < `, : , < : < `, :, <, < , :&    : < , ; , :?  > K@_ <  4 6  4> K #@ "       > K ! 2   > K!X@_]  4 > K@_R!  `4 @7  !> K!@_C!"H@ ^v '"f6#?'Lc V  V  V L2`/` 2L.``'L2`L * 4`'L2L'L &> )#H > K@:r!㿘  `N    @jD> K@^!0㿘  `3 2 ` @j)> K@^ϐ"0 ?, 0# 2`㿘 ?`,# @ `*`2> K@ @^"H` l 2k @> K@^"h` @2` ` P"=> K "+> K 0   > KI`$ @'> KC`"4> K & )> K8`- 0> K2`> K@^{"pA`@^w"=`@^s"9`> K@^n"4`@^j"0`@^f",`> K@^a"'`@^]"#`@^Y"`> K@^T#`@^P#`?# @> K2`# @^F ` ` `2 *`@> K #8@^; ` ` , `< BđH /` * ! `?# @2` ``P( `` "!`0`"0`` `"0Ȕ 0  0 | 0 H 0@C㿘B "   " "@5 㿘 @ .- H / * !  ` "@5``;> ǐ"` .H 0  H 0 㿘`?c * 2`   a@ 0 \ T@h`> K#P@]0K` "@    `" `?  \ 3@hȐ > K@]n#0+H /` * ! ` " \` 2" \  @h> K@]M# H 0@Y @5 ``?# @ `*`2 @4`8H 0` `:` =` 沐 @D  4 "6!!@!`@`$!#  ; B< ""& `B < &! 2" $!!$! $! \d!t@`? > )#H>' 0   ` @  0!Հ@ ݒ` !Ӏ@ "| !Ҁ@F> K0!׀@ 0!ր@> K0 @  ~cHPS3  vcHH /f * '  2`  `Ȕ ` ` KH 0LcHPS  DcHH /f * ' ’ 2` 7X`4 7V`67\`87Z`:R/^H 0cH@ C cHPR˔  cHH /f * '  " а H 0cH'  H 0cHX6`@3`H 0cH@  cH<R  cH> ` ?@4̐<'<J  Ru cHФ '`H /f4* '`& h  "@`S `47F` 7H`67L`87J`:d/NRO@  @`h@H 0 zcH R5r &H /f4* '`W  | Sp@ Zɒ |` '`"7"7"7/777`47`82 //`6/7`:   //`:   / ,`:   / ,`:   / ,@Qݔ |  &@`||@H 0cH@[9#ذ cH > L@6 㿘@  `R >>>?&%!̒c" b&!&!&!6 > & 0!Ԑ &!Ԣ  0&!T@UԐ@f" 8&"" @!  @ @" #> L@ @@@" > L@ " > L    &#&# &# &# &#&#"@YI @f("> L@ZΐH#> L# @ZȐ X# *&## *`&# *  * &#$&#(&#㿘H o*@ g@ H 0h ! 77""+`"*"+ "@ "  77ސ 0@L7"&##&#@#3`7&#S&# ?* "@# # 3`7S7?* "7# # 6#  #$, "#@"3`: /7Ԑ7/7֒П # f#  0#(, "# @"3` /ː7/77Βȟ # f㿘"  㿘"  TO d"Ā`""@"" l#"  ", 2"4  T2 d"  a" "€ !"?"€ !" !B 6  @ ;6 @ǐ 0"> L @YӒ "Ȁ`@㿘  2b@ΐ @IJ@2 ; <b" <㿐 @0  2 = @ 08 0 $ $ $  '􀦠.  @   쀦  @( `  ( ' $ 8 $ " $&@֤㿘% 2  `B >  t`B >  @J  0@b 㿐#= 2  > L @Y2  > L @Y+  `B >   , > L @Y  B > #$@*`  " :/77 # " #,  "  " @&#㿐Y# `@ ;=6  @> L!@X  @> L! @Xْ 0@h0Q "̀`"@@ В`B >  > L !0@X  ЖB>  Ȓ`B > Ȁ`` `"  В`B >  `B > # " #?&##  , #  " `"  0@s&# # "6 㿘"€  ?Q "  "  @  Ȓ`B > ( `B > ( > L @XP!X)   > L @XE!p B>  $> L @X7! ȐB}>   """ 7 㿘> L  @Vܒa Bb> 㿐 \ $@ @ic+> Lc ,@b  a \d6 \c@Wc!Ā !@$̒ ! !!€ ! ">$c  &!&!$ !?&! "2$c D ",@I ,@c(*`    6 Z0 /77b b  Hc " c  $c \$6 \$c㿘 H /f * '  ! "# \! ;0!5*0 !6&0 \ 6 \ ` W@$ 0%`4@  2 \B \ ?6 \ 2 @A`4"Ѐ  @ޔ" @_  0`4  \ @  H 0㿘 \!'<6`6`6`6@"h @e   @c*2 *2 @  *@ 6@  2   \ = 6 \ \<"6 \6@6`6`6`㿐"'N@㿐"'N㿐"'@ V'x> )#""###H'2#@&##    > Lm!  # ?.#D &# 4 @ .#E& 4.#E H I.#F>>ې"XaT>>۔&#|&#&#&#" #<"?&#P `-&#H#? 8#\ ", , #\#`@$ #` @  *` ,@ `` N3  ,#`>X"x&#@~ > L"@Vd  #X * @#H*`  &#TH > L@1"( h> )" # #x#H!" #'&#x Pu#,Pq !,Pm# `' !2]&#x `X ",  `/>  P[ d  c   , ,  H,, @, #\#`@B#\#`@☒@c " I,, , #\#`@$#\#`@☒@cД 2&#x   ,&#xH > L@1>"8㿐` "b @c> ,, , , , >,  ,c` d`"g`4` " @? ` +@@`2` U`4 /`D/` "=@`0  /  3@   /   2  3@  / ׀> L@Sؐ"H"@> L@SӐ"h`2` " `4/ @3@``4   @ c Oz   @> L b@S`@}ܐ㿐.2`#L@ ""@####N$@,`4 #\#`@+#T&*6 #\#`@@㿐# "##\"#`@#?# @ `*`2 @6 \ "*@ 2 *` 2 *` *`; *` ` *@ 2  3@`0 ?  +@`㿘\ "`.@ @.`.` 2.` .`?`.`  .@ 2 6 0 . ` @  cNؐ ` @㿘@j㿘#    " *`N" *`N?<""* 㿘>>ܐ!a>ܠ" 8"&"&">Y>Y&"&"@l @Ԑ???@ݚ "Ԁ   " @ @ "0@ 㿘"?@m?㿘@ː" 㿘@""&`"&`㿘@"㿘@"" " `@(㿘# > L"> L"Nǐ㿘# > L"> L"O#"0"(㿘>>ܐ#c>ܠ" 8#&"&">Y>Y&"&"@l@ ???@[ "Ԁ   " @ @2 "0@/ 㿘"?@?㿘@I" 㿘@m""&`"&`㿘@;"㿘@r"##(㿘> LbNQ㿘> LbN@HT`l㿐 0"@?& 0##P#\> #`" #<`$    > L# @Se 0# cp ,#P  > L#P @SS ##T#\     > L# @S@ #`   #T > L# @S. z#d @  #(#\ (   7,``%` #X#\#(#\ (    *,``%c@^T"> M@R `# @## ! ?c ? **` 2 2 * # a  *&  @a?0?>>>`"!<ܘ#4\$t$x$$$ᤐ $ᤐ( @ | >>$$"c> %`4%`8>>%`<h%`@ # $#  P"@@ #"$ #&## b?# ?*  *@2@ 2@ # # ? ??@ `$ e#!/ ?#&## b?# ?* *` @2@ 2@ #@#    ? ? ??@ʚ `$ 21`$# ,$#`P#  " #$ T# ` "#$ # ` @>>" "b%`4%`8???@ `$  "" ! @N @m !"@i ""#>%>瀢``     2@#$ &#$@L@]|`@( #p@(0D> L#@Qߔ#<> M (@Qؒ#\ #<,```# €c,`#h ,```# €`$,`##T€ ##T€  ##p0 ##P ( 㿘 0@ #\ , @` # €#, #h #<", @` # € $, ##T€ ##T€  ##p 0 ##P ( ?@?@t?@] @L㿘# 0 # !@?c ? **` 2 2 !@ ! @?c ? **` 2 2 ! @ !@?c ? **` 2 2 !@  !@?c ? **` 2 2 !@   @ B B< <  !@?c ? **` 2 2 !@ ! @?c ? **` 2 2 ! @ !$@?c ? **` 2 2 !$@ !(@?c ? **`2  2 !(@  @ B < #@ #@#@  #@#@  #@$#@ (#@ H /f * ' @"H 0"@(7 㿘 #?c?#`@?  **` 2 2 @   J{ d??2# 㿘##H /f * ' @z@@` $    > M p@P H 0㿘#d  "# `  `(@ # € @J$  #h#d& #l& &㿘@(" \6 Z ;`6 \@"@*@X #X "`# `  `(@ # € @&`c #`#X#\$ $$ 㿘# #@]# $  C 2> M @O IԐ# @ $`  , > M  @O  㿘# #@d# $   2> M @Oo I# @ @$`   > M  @OW  㿘#@ #  4?c ? **` 2 2  4@ 4` ?# ?*  *@2@ 2@ #  4  㿘#@ #  0?c ? **` 2 2  0@ 0` ?# ?*  *@2@ 2@ #  0  㿘 #p   * :@`@ :# ` #T@  #p   * :@@@ :@ 㿘b"/ h`@"* `` %  > Ma> M0 d> M0@ @ > M0         @N! 㿘## H /f * '  2@l #`@}@P@``   ?# ? *+  2` 2  $` #T?`0# ? ** @2@ 2@ #T 0$  ` ? # @ ? @ +`+  2` 3`  $ #T?`0# ? ** @2@ 2@ #T 0@ $  6?7#7 #$ $` @$` ??#$  ($+$# `` ?# ?*  *@2@ 2@ $ $  `? # ? ** @2@ 2@  $`  #+ @   : `:`*` ? # ?*  *@2@ 2 #*@  :` : * @$ !` $ @"` 4?c ? **` 2 2  4 4`?# ?*  *@2@ 2@ $ # c`"@`!ch ?# ?*  *@2@ 2@ ch$ "@$  \ @ ;6 \H 0 ##  D#@" "H "P @"T<@ "X "\ "` "d"  " 0 " "((( " "("  "  " " @" 00"! @""""" " 㬐 #" "" """"" "$"(""#''# @ ? @?( @*`2 2` "  "? "((( " "("   "? "((( " "("   "? "((( " "(" 㿈 0'# '# d'l  #cd * ` *  #T @ # F cp #? @  (?4`,  +?  *- 5`1?   # ,`.6@ . 6`@-` @ )? ?@6 5 6 @5 @  @  @  p  @   N# ` ``(@ #`€ @ '@d     '  B@:`    $   *` C 2:$ $ $ D @=  @TȒ  d ` ` O'! #l'@`!#h ?# ?*  *@2@ 2@ #h "@ 㿘 #h#d {@ "㿘#d.`@ 0  @( (װ 7" "'#!   " #> M!@ @J> M@Il!p `  `(@  #p.` #@D  #? 0   (?4`,  +?  *- 5`1?   # ,`.6@ . 6`@ @ -`)? ?6@ 5 6 @5 @  @ @    0 8`# GH,    ` '?  @(?4, /?  @ @*-51?  ` # ,.6@ @. 6`@ @ --? ?6@ 56 @4  @  @  @ H*    8@# `#T  @  hd   `  `' ' 㿘> M> M !@J(ᐁ # #$@$@ 㿘# 0 # ` ?# ? ** @2@ 2@ ` ? Ӑ @ @p 0א   @?c ? **` 2 2  @  E "U  @?c ? **` 2 2  @ <  `B =  @?c ? **` 2 2  @&  `# @?c ?*` * 2 2  @ #& @!U!㿘 0\# @T# @  ?c ? **` 2 2   ?c ? **` 2 2  !4?c ? **` 2 2 !4    @ @ 㿘> M @Gɒa B>  ? @? @*`(2 2`  ?"?  @?(( @2 2` " 㿘..` "   ?2 6 1?#'?" c$  B  ?  **` 2 2 @``c> M"@H 㿘.#?.`@@# " `@@ ?*`@ .` 2 6` ?" c$  B @ ?  **` 2 2 @@c> M"@HO 㿘 0# # #$Bz"@ 9 ? @?# ?*  *@2@ 2@ $ " % a   2 ` <?# ?*  *@2@ 2@ $ # `#+ ( >܄܇* $$ $$ 0 ? @? @*`(2 2`  㿘`# M# $ $$ 0=  $085$ $  @  ?#?*  .@2@ 6@$`$ 6 $``@`T  $ @$ ` @$㿘"`(  `$ @ 0 @"㿘@""&`"&`㿘 H /f * '  ! "% \! 60!5*0 !6&+ \  @6 \ `#`4@[ 0`4  @ 4`44  `4 @u"@NВ 0`4  \ @ @  H 0X# 0 #  4@?c ? **` 2 2  4@ \ ǒ =a3 \"p  b!3 \F`D`` "? 6""h     @R 2 2 *  %-@ $   ? c% !??  "  *  *` 2  2 #@` ` 4?# @?*  @ ,`@2@ 4`@%@ 㿘c`6`@+ 0,`#XcX "# `  `(@ # € @$`B <`?&d #X @2#X #`c&\ ;4\ "4Z@ h`\ $@ @@#\@ cX*`' aĀ Naa 2Daa #\@c\''c* @  ''ȟ!̀ Ȁ 2aĀ ''@i ̀ c  ̀ Ȑ#X@ ,@ c&c €'`\$0`\a'̟€ '@ ''@ ̐a''ȟ€ ̸aĀ aa 2aa " `D   a a' a? a`D ''@7U c `  (''Ȕ @  ,''ܗ*''' cp@  'c`DԐ 0 ?  ?  @0( @ `*,` /?1?  ( @ ` # 5-.6@ @. 6`@ @ --? ?6@ 56 @5  @  @ @ ؐ 0   ? :ܐ 4 *      ,?@   pc@ @'? ?0(  #?*-?,, (4`  . 6` @ -5 @ ,`?6 !?@2 5@4 @   @ @  :c `  cT''ȟ@ К` 'd'''ܒ` ,''Ԗ`'؀ #'#X@   '@ c\@ , *`" " #@ c`c ?#? @ @ * *`@2@ 2@" \'@  0`Z@ *` "Ta0*'@N ̐a'̟€ aĀ aa 2aa     a a' a? a@'``B 8`Lll\l4ЀЀ $ p p p  p 㿘"`"D? ? *+ @ 2 @3 @ @ @ @ *`* 3` 2`D@?#??c# D ' #?!?@#"@"`D @**` @ 2 @ 2`  *`*   2  2 `D@#`D0@" D @**` @ 2 @ 2`  *  *` 2  2  D # D= "@"`D @**` @ 2 @ 2`  *`*   2  2 `D@#`D=֐ "@" D @**` @ 2 @ 2`  *  *` 2  2  D = # D y@"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`6 ""?D# @ *` @   D @ "`D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D㿘" `"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D& >`"@  "?`D# ? ** 2@@ 2@ " D> M"8 ` `"@  "?`D# ? ** 2@@ 2@ " D> Mϐ"h """@  "?`D# ? ** 2@@ 2@ " D> M"h`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D9 """@  "?`D# ? ** 2@@ 2@ " D> M"@@L s `"D? ? *+ @ 2 @3 @ *@ *`*@ 3`@ 2 @D*@??#c D ' #?!?"@"`D @**` @ 2 @ 2`  *`*   2  2 `D@#`D:5 "@" ""`D 2  2 @ "  D@ ""@"@" D @**` @ 2 @ 2`  *  *` 2  2  D # D: <"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D. 㿐 / .@  ʔ ` @ 㿘O?` g'@( " "x?. 00xg' h``8""&? @? ?? ` ( . 6` 0'@?` 㿘L?` g'@( b bx?. 00xg' h``8bb&? @? ?? "  ( . 6` 0!?`4?`   g"@( b b x?* 00 x g# h 8b" ? @ #?Ӏ㿈"Ѐ ' "> M> M> M""Ȑ"@=Ԓ 0r@\ϔ m 2 @?#!?? ` @*` @* 2 @ 2` #@   2    2   " 8 > M#\  #`#  @= @~ 05D  $  <D    @D   $ 0c 4 (_ ,"`" ?# ?*  *@2@ 2@  #!D@I  ⬓*⨀ @? @? @*`(2 2` #g⬔ ?⨀ *"% 2㿘@b/ b`@?@1?@.`(6 6`@ !'! ?? ? ?b/ b@ ((@6 @0@ 'g?bb?1?(/ 6 7 &e 0@h> )"?#H 0' b @ Hbx"ؓ*`@  ?`U> *` €2 `."``> M2> MȐ@ ; (@ِ@  ,`k@<@k2<`x,`k@<  +<`x"Ӑ#@@< &2 /  > M #` > M#x> M#@ M #@ M@#p> " ' 8"Դ@ =Őܔ #\#`$`$ @    > M @<# 7 "@ =$`,ܖ؟     @ = > M"c@;a 7 "@ =$@@ = bܔ#\$     > N  "@ =n$` ؘ    > N @b& > N X@;Ē ' 7ؖb& b&   #@  &   $ $ @ܔ  ܤ"@"`&`a `. "   "#"& 2" "Ԑ"  "Ԑ"  # 8"Ԓ@ = $0؟"Ԓ (ܰc c # "# *    *`  㿘!> N@9 " &@ <8c@!(> N@9 "+  2?> N@9 " # 2"> N@9!  & # "& 㿐'P"ԒP#\ ( (   > N @; ! Y  " € "P.` $"  @     @t(`(@97 7&  @&"Ԕ  P  *' 7<(& &&@ *"P.`"ؔ 0 " 2 2 P`62 2 P04@? 8 x@" > N!@@9% 㿐'P"ԒP#\  Ĕ  Ę   > N @:! C  " € "P.` "  @   &  @9&"Ԕ  P   7 Đ<&& &"ؐ"ܐ"P.`@ 0  "2 2P `622 㿘' @ܒ  D 7ސ @; 7:&& &<?`#> @&6&H&@&D&L&\&X<#:&&H@ "ؐ"ܐ.`" " b .``0@ "   # 3 3  3 3 㿐   7$  "Ѐ 2 "?'`"??# ?*  *@2@ 2@  7? #%"6 㿘 "ܢ *`  @$"@€ $@"ؑ, @ 8` 㿐 V 7$  "Ѐ 2 "?':`"??# ?*  *@2@ 2@  7? #%$"6 㿘"ܠ #` @$"ؒ @ 8 ` 㿘   7  "`"??# ?*  *@2@ 2@  7? #%,"6 㿘 bܐ"  %`  @x$"@€ $@"ؒ @ 8T`  㿘"z 6 "c  "ܢ @ " "@Q$@" &$"ؒ @ 8- ` #  &"€ @Ē  2㿈""#$& "6 6 ) 7" € 70##"& "#\ c: (     @  "" !& 㿈"' ' 4> NA!X"` "@?# @* *`@@""`"`?`* # ? ** @2@ 2@ ``*`@#&' 0``* @ '''% 0@8V 㿈"' ' 4> NA!X"` "@?# @* *`@@""`"`?`* # ? ** @2@ 2@ ``*`@#&@'0``* @ '''ז 0@8 㿐' 0'\ =a4\p $ "b4\!'0g@  "?%# ? ** @2@ 2@ "%@  @"#%  n &@١  2h   "+> N  @ܔ  @6ap/_ $`&2   "`"?# ?*  - @2@ 5 @&%6 ? \(\[   @0*UUj"&6? @?( @*`2 2`Uj   / Uj⪀( Ѐ2#  \?c ? ** 02   (*` 2 0 \# \ 㿘 ".""` ""@"` "!@2``> N "!@`> N @6!xҰ "`"@? ? + *2 @ @3 @@ @ @ @ *`* 3` 2`@@@ @"`"< @*`< @ @ > N0 ."А  ."@6!> N !@6 "Ѐ 2e""`"@? ? + *2 @ @3 @@ @ @ @ *`* 3` 2`@@@ @"`"D? ? + *2`  3  " * *@ 3`@ 2 @D" D"`"P? ? + *2 @ @3 @ @ @ @ *`* 3` 2`P@ P"р @ "@ "  @ " "& " @ " " > N  @6!!а b  b v"`\ bЀ#b b \?c ? ** 02   (*` 2 0 \# \bb \?c ? ** 02   (*` 2 0 \# \bb 0 b  0`6b 1`"0b`+`0` "(b``@#bb ?c ? ** 02   (*` 2 0 # bb \?c ? ** 02   (*` 2 0 \# \bb \?c ? ** 02    (*` 2 0 \?# \bb@"&""$v"`\""@L"f㿘" 0"` @"""&"`""0``? # ?*  *@2@ 2 @ "0`` #&  b`0 `"x@  0 `0 "ؐ"@ "ؚb"" p"&("ؐ!6 @ 00  "* "'?""f,""" "6`0"ؐ ``" `"ؖ% 0  00 !$  0 ` 0" #:@ 00 !$  0 `0`"ؐ @  0"Ѐ 20 "0   0 !$ `0   0`"8 @ (0 0  0 "ؒ@`" ""`"h"z@@ 3""А `0  @0   0 !$ ""`0 "0"Ѐ`"z`0 !"  0@"ؔ`" " `` $@ "`"# @ 5 ?c ? * *` 2 2 # @ 5 $f0"`"#?c ? **` 2 2 ##&4"`"# ?c ? **` 2 2 # #&8"`"#?c ? **` 2 2 ##&@"`"#?c ? **` 2 2 ##&<"`"# ?c ? **` 2 2 # #&$""&d""e"`"@? ? + *2`  3 ? c @ @ * * 3` 2` @?# @ @ pU  > N4"=I > N ("" u   > N"(@>> N@3>P"Ԓ#\ #`> b  $# `   > M #@3( 0"Ԓ ,`ܘ؟  > M#`@3 "!"Ԥ"#\`      > N @3 ""Ԗ`   ؟  2ؒ` @ 2*&" > N"`@2 | # &# &#'&##  @& #& &?>>> 0& 0`̖8"\c,!4\$x$t$$ $ $  `*y  0"$$>>ܖ@`<"Ҁ " # @` ! # @`  & @`ܖ  & @`ז  0 @`Җ  0 @`͖    + @`ǖ `+ @`   @`  @`ې@->@>> >"d@  "Ԑ" " 0"Ԓ ( ܁㿐"b  @ Τ 0 8"ؓ*@  : * #6`6b` : * "b6* @ "@ $ `B <ѐ"˔ 7k    @P `\`B <@+b` : * "b6* @  ""@  " d2  = 76 `B <1T"بb` : * "6**@  ""@  " d2   7 `B <,"؀ 2 > N"@0! $ $ B<$ ""D  4 &4 D @# 8*   $ 4 $@: " @ 7"Ѐ #"` ""?c *`* """Ѐ 2 ""@ '"` ""?c *`* """` ""?c *`* "","Ѐ 2 ""@ '͒0` ""?c *`* ""$㿈+"ؚ @b  0 H  "ܨ b, @  < , `B <"@ @?$@" ` `(@ "€ c $ & %$  ? & : * #6 4Z"ؘ  @+ \ ;4\㿘"ؚ @"  0 E  "ܨ  #"z*"ؐ  `*`B <"@ @$@" ` `(@ "€ $ &%$  ? & : * #6 4Z" @\ ;4\㿘"` 0"`@2   " @`2"& ` @" \ @ "Ѐ +0_""% \`@  ! @7 㿘"  `"ؤ 0` @"$ @         <" ` "$ @ 㿈#c Ԕ   k 7c$! ,"@ 4_Ԁ 1#ܓ,  +   ?? 0'`6` 777`&"77,   R ,  !`, `"?#b ',  7 6 ` ( @ ," c  $  "ܐ" c$ ,   $ &Ԓ € 7㿘)#@` bԔ@   p 7#$@!,"@ 4dbԀ , , b , zbؐ "@  "6& 6 6 6 ` 6 `&6 , `@ ! , , bؒ@ 1"@ 0,b-z  `2 b `( @ b `"@  @ ,b" #@  $@  "ܐ@" #$, @  $@ &bԒ € 7㿐""ܑ*@ M'!Ā  ! 2!!`B` "Ѐ ܔ €!@!@! €!J 2= \!Ā  ! 2!!`"  D` &!&!"`!?&! D `@  "ܑ* `"!Ā`""4@"?# ? ** @2@ 2@ $6 \#% 6 Z㿘H /f * ' @R  > N"@.j H 00H 0㿐" 0`" ?# ? ** @2@ 2@  #&\""`#>"`'ؒ""` ""?# @* *`@"""`"?* # ? ** @2@ 2@ *`@#&'"Ѐ 2' 7> N@,i"E"Ѐ`2"""f"6@'"""%`\`@ {4`\  @$ $ 㿐" `  ` `>!*` €"`" # `# "H"`"2  `"L8"`" ! @! "H""fL %" @"H? ? + *2 @ @3 @ @ @ @ *`* 3` 2`H@ H' ""&H"`"  @ "L ? !"`"L? ? + *2 @ @3 @ @ @ @ *`* 3` #2`L `"L? ? + *2 @ @3 @@ @ @ @ *`* 3` 2`L@@ L !"`"L? ? + *2 @ @3 @ @ @ @ *`* 3` 2`L`"L? ? + *2`  3   * *@ 3`@ 2 @L L'r    "" Ӏn " " Ӏ%6?h @? @*`(2 2` h Ҁ "DDD6?l @? @*`(2 2` l Ҁ@"@"@"@ """㿘 H /f * '  ! "% \! 60!5*0 !6&+ \  @6 \ `#`4@L 0`4  @ 4`4`4@0 `4 @Z"@3 0`4  \ @  H 0㿘> N @+"@ h `B > 㿐 0`\ ;2`\""` @"@'pK"" "ؐ` ""ؒ`@" <"6㿘.D.T.d.t.../.㿘`M   : ,@ +ݒ 4: ;?> 3`+  +`@ b * 2`*` B *2 *  `C + 3` ; 2`*  *`%@ :@ (`B :  2@  B * 2`@ , ?㿘 >  . ` @ 6 >  4>bd   4 `@ 0 2` @$   @  8 @f<@F <@D T l@a 㿘 H /e`* &` ` @"(  ` ( @&(H 0㿘> ǐ  ` = * @`7H /e4`8* &`8  @e$`8H 0 p> > `$ $ Ѐ $ l$ p@^А> " # c$ $ $ $ $ `  $ ` @  $ `   $ %$ H /e * &  ,` @?@c ``cd`$`$`$`$` @ ` . .... `. `. ` # ` $ ? ` `` .` d.$ d.$  d ` ".0   ``,` ,` ` .,`. `  ,` 2  p`2 p @" p p $ p ?$ p@ h H /e * & ` ` p   H 0M <,`. ` 7H 0> > ѐ"$ p !@d " ` p $ p `` @bH 00 ` 2 p  @ p > ёH 0 h> ѐ!@*` €㿘> " . @  0 8 h> ђa@* `@€H /e4 p* & p"    < `. ,`@N  p@ p ?$ p. H 0@Sѐ 㿘   8.  , , `   d 2 d. ,  d, # # d ,      0  ,  , , , 0,   * (㿘> " . @> 8@ h*` 㿘> " . @> 8@ h *` > ǐ * 8 @ 㿘> " . >  8a@ h`* @ @ 6@V  ]@ "h `y@"/ `x@- 0`z@`{@ 0 k@ -  j@0\@V 0sl@m@ 0k  @ , ,`c   ,  @, ,`R  *@, ,`J *   `` 2`@ 2` 2a D 2` ` 2`/&` ` `2 `2 `2  &@[   2  @ 2 2 2 2 ,  㿘l> b * `(  & `$`"``(@ `  # `@!   "# ```` `2` , , ,  `$@@ %, p +> N |`$ |H!c@b͘  | ??$ |p 2 |`,,= ,,  , , , "` 2 `$`,`$d ! ,0$  ,`,`@@   2    , , @-0), `$$`($`$   @  > ha@* `@€  *@, ,@  l> )> #H b'*  H /e * & pN 2S  | 4O  @@"V "F V  H 4 p & p@ H@:  H "5  p & p 2  , ,`    H p @u  ,@ & @ &]0 H @u8 H,@H 0H  , ,`H 0H > N@q#H4 p( p" pH 㿐H /e4 p* & p& x t& p& tH 0  > N#X> N#``2> N> N#X#`#\> Nc(@%| 㿘 k  @f 8H /e4 * &    H 0 0N "$&  $#& & & p 2 H 0 06@@    . *`H 0 #> > Ѫ"aT   "  p x `& p`& x T@) <   h @ * €@* 㿘 8   - @ l 2  *, t x `& t`& x T@ <0 ,   @ࠀ@ . -  &  @ 1@ ` ` ` `@a .  2  h> ђa@* `@€    *@. -    @ࠀ@ > h!@ *` € p  ?$p |`$> @bH> h!@ *` €   H ` @ `H 㿘H /e * & `  'ϐ ` ?.@`  ' ` ?H 0㿘H/ / .`.@: .` .`.`.` .``H 0㿘 . ,   , , ,  ,  d   2  "     .  . . . .  2 `,  `   ,  `2  .   `,  !,  2  ".  , ,  2  ,   Z,   `, `2  Z .  `A*`>#x €> N@$#h0:> N@$#x06> N@$#02> N@$#0. 2  &  > N#> N@$ِ#0  2  &  > O @$ `. > O (> O H@$  @`. & > O@#. h@/     . &  ,   T, . > b, @>a$ <@> c4 @ & l> O @# (  &(㿘 L ,` ,` ,@,`,` ,` `  ',` ,@ ``  'Р'  `  ?  d `  'Р'  `  ? "  @@`  > O  @$<&  㿐> O@$3 `a@"a@> > ǐ#Tc@! &`X&``6`R6`:6`P&`d@ #V `0'><@5 &`㿘  4 Ā`     > O @ @$0 `@ @.* $` @$@$`"@$@@79@h`  %> O @: ` ` @@s  㿘 & ,H /d * % @wH 0 4Ā  㿐? 2` > ǒ @#, a# @Ȓ @ `> Oa#\   @ @ a|a$a$aa $a|@s$aa@p  $aİ 㿘? 2` > ǒ @o#, a@/   !@a@! 0) !@ " !@  0 !@  0 @0  @U0 @0 @r0 @s㿘@*!!|`@``"`&!`?@"$@$`@Q!`2` ' #`  `&@&`&`   &` $&`   @ h@ &`$ &`$&`$$@!$`!"@&! 㿘!  @     2 2 1  `$@@ (  @h8@ 0      `B` `B` `  $ 㿘!  @     2 2G ` "`&! ?"$$   `$,`X" $`(` " $`,4     $`,`(`4`4`($`T$`,` H /d * % @uH 0@$   @( 㿘?  2`> ǒ @D#,`A  !@5!| 2@i `A@5k!㿘?  2`> ǒ @%#,V`?>  #d&`8!&`<@!&`&!@E 㿘 <!@! $!2? "& @% 㿘 <!@!| @@ 㿘?  2`> ǒ @ܐ#,a$aĀ ""a|?` "`$a "@& &   ` @U& a@`a 2a|` a!a?` "`$a "@& &  ٠ ` @0& a|@na| 2@%@@?`R  `@{y `R  &`@Ő 㿘`  `@*`  a"` &a"` 㿘  @ ! &  > O!8  '> Ǔ* @*`Ȓ@` @  䀢 & > O!h@!D`0r!!.` @p ! &  + "@@  ȑ*` *   € P ? 2@@ $@ 2@@*@"@"@@ ( ! + @      *@` ` ( 2*@"@$"@#*@    !  + "@@  h> )#H '[! K?> Ǯ#Ȑ*H @ @$j@$@$j@&- @?$j  .$`XА@A @̀ ,̒ ?@ϖ !j@. ̤?$j €?" ("2? *H @?> O!@ m`?H > O@Ԑ!Ё㿘?@2 `@6`2` @ ` > O@ }`aX@ }  > O!\ >'?''0''''''@r܀ > O"@ % @2'`x "`x'@#@h > O"8В @ ܢ ܀ @㿘a`   > O"x@0$  @!  * @ 2 *@@  \ \@ )*@ 2* `  @   @ 㿀> )#H'@ @  *8$ < (* $ X@.  8q  (`2*@ ,(*@ (*@ 2*8@  (8  (2*@ ,(*@ (*@ 2 (`< 0*@ 2< 0> OcH d "@{ cH > O@"㿘! `v c,` r a m M A R C ,`,`,`,@,`,`,`,` ,`,` ,` ,`,`,`,`,`,`,`,` ! 2`2`2`,`,` ,` ,``   8 ` `!* `"*`@ *  `# ;  `0, `1* `2*  `3*`@ 222 ****`H@˖ H)\@ H  2,`(,`),`*,`+,\ d), , , @)& `0㿘H /d * % @  > O#@ޒ` &H 0H``> O#0`> Ǒ* * cȮ   @  2 `(> O#X@߰ ` `)*  `***` `+@  6`6`  6`> O@##@j %`X `,` `* `+  `( ` `+` `* `* ` B 2`2`2`2 2 2 ,`,`,` ,`,`,`,`,`,`,`/,` ` `!* `"*`@ *  `#   ! , @ \ `   `!*  `"**` `#@   \ `(,  `)* `**`@ * "* `+ *   `\)@) `(  `)*  `***` `+@    ` `!* `"*`@ *  `# - ! ,  `X4 4 4 - $- %- & ` `@- 'j  X> O `   `!*  `"**` `#@  *"P` @  P '@'@  㿘  @ ! > Ǒ* * cȢ!     @  X 2y \   $Xn \  *  * +` @ +  *` @ *  PT "C2V@ܘ!m2Q@ @Y `R?6  1 \ ( )* **`@ *  + > O@א#'\ !* "* *  # * , $ ,   )  `*  `**` `@  2 \d ) \@2X@ `@ `> )#H'   > Ǒ* * cȐ     > PD * *+`@ + *` @ * PT "C> Pܘ!m> P$ 0 * *`@ *    > P X`@ט H@ ``@*  > P @Œ`H H > P@* > )#H'@ 0   `!?*``# @ ` `* * @+`2 *`` @ `* , @ߒ4  `> P= 4 ?@Ӿ X4e `e ?@# 4 ?@Ӽ 0 ?@ӷ @4`@4  @  !> P!"p @  2  > P!0> P!`@N `) %@ %@ , `2s`?*  -@*@ @z4 4 ?@d 0@D > P @! 4  *  * +` @ +  *` @ *  PT "C4ܘ!m 4 ?@C @4)8 Ė 4  24  @ $$& 4 ?@ @e4$,`@ @ cH > P@+!8> =a0> )#H ' ' '%> P#> P 2   @)  b  @) 2 ޔ  2 `'   @'`   2 ?"$@ `$ `%*` `4+` `5*  `&+  `6@  `'* `7*  @  ?$@$@w' `@)@  2$2J  ( @y  y> P `4` `5*` `6* `7* @ $ `0 `1* `2+  `3*  $ `   `!* `"+`@ `#+   $$      $    ( 2 $$$$$% $   @@` `   @ @( 2$@$ $@$ $Z @  2> P"8 @   > P"`"> P"@Œ j?2$ 2$*H @  !  @ K@$  @)  `< `=*` `>* `8 `9( `:( `?* `; *  @    ,,<8,,,,,, `< `=* `>+  `8 `9( `: `?+`* `; *  2`2`2`2 2 2 ,.,(,,,-,),*,+,/ `< `=* `>* `8 `9( `:( `?*   `;*`@ 3`,43`3`3 3 3 ,5,6,0,2,3,7,1 @(`8 H@ H ,[ D,X,Y@,Z <  D& < $@*@ 2j@$@"j@ L `@& L$2W@ F (?? "$?' 4`C ` !  `@'  2@@'@`` ?  **& : `"b+ `  `$ `%* `&*`@ *  `' ,?$@a > P" @? , ` `*`* ` `* `+  `*   `*`@ `  @ 2!@  (@@,& ` `+` `+  ` `( ` `(*` `@* @ :@`2 `$@"> P"@q  7*`7'@'@  @'$2O "'    $  @5 2@/  2 `   @@# 2@'@  @ > )#H > P@#8j !> ) #HXje'`e ?@л 2?,` `2?   @ B C? 4>j8?`#H>j8 #H > P@^#P㿀> )#Ha''H  @    ?  > P!@     ` j @ > P  *  * +` @ +  *` @ *  PT "C2gܘ!m2b $` %*  &* '*`@  &$` O    * +   ( * * ! " (+` @*`*  #@   0 @&]  6> P *  +  *   +`* *` @   "j@   2 8j@  j@`2wj `  > P##h#@2`@ ;`6 ! -> Pj j@> P@#@: h@` *  * +   **` @ *   @ `-  "X`Ѩ  @Ւ > )#H > Q@U 㿐#\   㿐#\   㿘> #D` @``2@  @ "@"`#D"`$#D㿘> #D !2 #D   $#D 2? "#  @| #D "$#D0 2㿘> #D ! @    2  㿘> Q` @a`4> Q`D@]`(> "#D!>&`<@%# "#> Q 8@\`> Q&`0> Q@V `>> =c"!@  㿘 D@ 4& D@㿘 $8 㿘 % " Г* @*` @S &&"`  @ @["` * 㿘 "!"?`"`""@"" 2! @ʒ H4(``"`` ༄ `?`""`"` "`H  H(?"""""" H 㿘 !! !% !,`& *  @ &!&"`!&"`!&` "` @ @`"`?`P 㿘 T!"?D`H"`H"HD"@"D"H 2D!"?D`H"`H"HD"@"D"H 2D!"?D`H"`H"HD"@"D"H 2D! @ 㿘 H /d * %  <  > && & (& ,& 0& 4> & 8& &  < D?`"`& @"@""(  <2& @& <& D@ & H"@"@ @ ?$@ > Q@9 h@S@ H 0㿘H /d * % !!@!?@ ` D` H"`H$ H D"@& D& H & @ $@> Q@ $@ @@ @$@H 0㿘H o*@ e@h H 0㿘 4 X* @` Ho oTH 0 ` !> Q @F{`! @`  @> Q @8pm`} 2& , $ ", "  ,@". ,@"8 %,@ "3 "9,@M,@ %"> 5 "+  / 4`0<"2"\  `04$`01"'"P ( *`0'"  `0`0"L@@ `0 "T"X"`"d@@ ``", @` @ & , 4 } @   & ,8 㿘 4@㿘@4 40" @- 0"%@ 6 0b$@Bb#@*@ 0>"'@1 090 "&@&0"(@* 0-0""@ 0"!@  0#@%@I@@y@  @v@ @ 4㿘 X   + @    !*  "**` #@  @ + `@" L &`L@&` 㿘`  ?* X 2`a&`  < =*` >+ 8 9,` :@ ?, ( ;(@+ 3`@+` >` 4 5* 6* 7 *  @&` !* "*`@ #*  &` 4 5*  6**` 7@  C2` 8  &`` 2K *` * <, = ( +  ,  >( 8 9  :+,`+`*  ?@*` ;@   26``(6`e+ 3` +`@ B * 2`*` B 2* *@ 6 c" 6`` `p@! `0`@$X* <  2*@&`  (* 2@ * ?>`  &`&`` @! `0@!   㿘  ?* X 2`` @8` !* "*`@ *  # ` a + 27 < 4 5*  6**` 7@  C2* <*8 "& <X&`(` + 3` +` >`6`6`* <&` (` + 3` `+` >`6`6` @!^    `@2*@` " X㿘`   c ` ` @Z ? X *@`2`2 H ">`   > Q<`=> Q8`!  `    ` 2@  3> Q @ 0b   Œ   ` > Q!@p0   @ !0@ 㿘  / `X"% ` `!. `"((`# ` `!. `"((`#.j  .  ׇ/ `<`"  j 2j@`X`2j  㽸> )#H'(Җ    ' '  2> Q> Q!X!x`@()@^$ > Q!@`$ ?@B $He`e` ?@ɦ   '$ ?@= @$ , @ " > Q!`@(     @ B @  @ *H$('*'*  @ 5*F66   66 ` 6 6// / (/ ?*8/ -/ ./ 5/ 6/ / / / / ,/ // (/ )/ */ +/ 4/ 7/ 0/ 1/ 2/ 3 @   8 Z  H@L H / [  / X/ Y/ Z@  c r a m M A R C .........  .. . ......... . . &.        .3.4.5.6.7.1.2.=.>.0.<.?.8.9.:.;. .!."> Q.#a @@#> Q> QaH@o > Q X@i !"p @g  $ !$ $ a$@   @W ! $ "!$'*@$H  > Q!`@( `D@`< '`< '*@*@ 2j@'*@"j@`L`@'`L' @ے  !  @ђ @̒ @ǒ `$ ?@  @j$> )#H  > Q@<"㿘@㿘  !* "*`@ *  # @  ! ,` X`"`@ *,``2 > Q" `@p0@) D <  <j8*8  *@ **84*@ j<*<@8*@ *!! > Q"H`@mp />  H /d4* %   <`  D`" ``2`2 <  <`  D`" ``2`2 Q @ ``w$  > Q"`@j8H /d * % @ 4* @*  2`L?"`L*@ %@2@@?*@"@$*@@ג @ 4H 0@ D> )#H   ''0 > QJ"a  > QA#  `> Q#H@p, !* "*`@ *  #  ?a +  X`2 (     *+ > Q#` 1 @Ւ4 > Q#@󀦠4 ?@ƹ 4@4瀦8e`e ?@ ڴ , > Q!@dπ̔    @ B D44`@ 4`, @> Q,` #@I4 d2`* @ *` > Q#@5   `  !> Q!x@"! ! * * * * * * * *  -@ 5"*  545@  " @ `+  `* `*  3 3 3 -  -- - - - - - @V 444444- )- *- ,- -- .- (- +- / `4 `5*  `6* `0 `1( `2 `7**` `3@ *  3`3`3`3 3 3 - 4- 5- 0- 1- 2- 3- 7`8- 6 8z  H@l`H"  ܒ  " > Q!@ > Rp@ (!& >(#<@'04 ?@ז @!4> )#H 0> R@ P㿘! +> R@   @k``@Δ @ h> )`cH '  `   @  `` R!``!  @j"p$@G` > R `!2   @ $ ,` $`@,`H#`쀢?$> R ` 죒 > R @ 0` ) @ > R @ !`  @Ȑ > R@ ! 0 > R!P  G!!$ ` *  2 2 *`6*`7*`4*`5 5 * "* #* * ! 8` "` 04@ 2Ī#`> Q a@ @> Q @ Ր H> Q  X@ Ζ `` `$_ 1?!  > R!pp@   `@  > R @ {! @S > R@ t!0"  2y. > R=!@b > R @ Z!`  @0 > R@ Q!0`"   S  > R"(@ :p  4 5* *` 6@ 7* ` "> R"P@ % 04@ / 2  * *  *`@ `    2 2 2 ** * * *  *`*` @   2 2 2 ** * * !"$@!` "(  > R"@ ؔp0`!П@4 4> > ǐ#c $8$@42$<$D40@  ",'̐@   H/` /& TH 0 ><@– H/` /& TH 0 > =!0` X`$ 2`` * "  `@ ? ,``2 `@ ,` $  4 4 4 * 0* 1* 3* 2  p@ǔ 0  p@ܔ  > R p@ M"4 4 4 *`1*`3*`0*`2 p@ @v  > R"@ 5  ! $ * 3* 0* 1* 2  @ p쮐"@ & B> >'Ȓ @<"!! !$ >(#<@!ܐ $ Д떖 > R  @ @`#" #H > R@T# 㿘    , X ` p@T 2    $ ** * @* 㿘    , X ` p@* 2 "€㿘`@ "&@%*  *@@ *  @Ɣ?@*@` `2*&@㿘 2!"`@!  " @H   " @A   `X@: `X @   $`X* " @& 㿘 L`IH /d * % !!!܀& > А"@p @ݰ  %> R#>  `   *`" * @l8 #2@m!  "!@D !i H 0㿘` `` ` 0`C" 0@~ 0@  0@ ,   @ (  @B 0@NP'> )H :' @   !///// @`@@ @`H@ @В`X@  ` :H > R@#@ `> )'#H  '` %; Ȑ@    `8 `9+  `:* *  `;   ? 2 2 ////  < =* >*` ?@ *  3 3 3 ////ː /Ĕ //=/?> )'@    `< `=+ `8( `9+  `>+` `:@ `;( `?*  2***222/ѯ22@ Ĕ /////////// > )#H > R@v#P 㿘  !@ "3(@", p(@ ".(@"9 "8(@(@  "3(@", p(@"8 (@"."9(@(@ 㿘 ",`4 @      @" "@  @2  "@ 㿘   `?H /d * %   $#> R1>   *`"  @ch #2 $H 0 @㿘> #Ȁ` > Rcp@ry    a& D ` D& H`""` < @j 㿘 #> R@ Rc  $8#> )cH'@W@c@cH > R@䦐#㿘@L    ` ?`@ . . h > R ##     #\ #` #d #h #l #p #t #x #|@ #`> Q@  `㿘 X` ,    `@      ,  !  ? 2  ?㿘! !ؒ  & !> R #@& `  㿐'D @ `' $ 2 @@> RL#     *  *  * J 4     - /`+`(     5` 5- @@ @ -`4,-@, @ @   @ > @@> S `@VpM   *  *   >D`;  $8  8 BDB:  @ < =*` >* 8+` 9@ :+ * ? *` ;@    2'D`$('b3 (@b, (@b. b8(@ !b9(@ (@ 㿘> #Ȁ` > S`8@q  `9  @4,H2  $@8%H  @4 H2&  $@8H& 8  D88 28"8& D & H "@#  `B  : @2  㿘@ h>(#@ @ > S P@> )#H'D''` ? <' =*` >* 8 9+` :@ ?+ * ; *` @  ''`BD , <4 =*  8*` 9+  >+` :@ ?@ ( ;*  <? `E D @(0@8 * 2  ,  +` @ ,,`(  *(@ e?xF3`+  ;       'X  > S @'X  iD  ` `*  `* `<, `= `( `+  `,  `>( `8 `9 ` `:+,`+`* ` `?@*  `;  0 `(.De+ 3` +`@ B * 2`*` B 2* *@ ~ c" a @X> SX@@ @ D DD X> S p@D!Ԓ "  @@?'`А'D'\'T'`@   D @   ?@ x?@  D  '> S @ߒD  '> S!@ԒD@  \@  4`,  4`4`, , 'p'P @ 2 2 2 'l* 't('h'h /'dt 'l''|/hd4 p4 \4 ///'////////'H'L'x `  " D"D L @?8 K> ST@ E `@ B t /''l h'd///p//`'8'//////'/ T "" DL @  "`"8H /d * % Da " D` D" H`""` @H 0 ` 4 4 4    > S` @  `"> S > Sp @ D@ * H* L* P* * * * * D ` `*  `* `<, `= `( `+  `,  `>( `8 `9 ` `:+,`+`* ` `?@*  `;   `e+ 3` +`@ B * 2`*` B 2* *@  c"   D DZ   D > QaX@ p'D!`;`B ?    D`  * * * * * * * *  !* "*`@ *  #   Da  + @`X*D  + D    D @> QX@єp@ D!"@@ΐ 㿘!!``@'   !H !L&  & !`p@ !X !@ʐ`P   >+cܐ@ $`P@ 㿘`X@㿘 X           .`"` " D D " D D D88 D888888``.`㿘>-$4& 3>, & 5>,a& 7>,&9>,d& ;>%#& \>%c &`>&&T>&" &db>&&X&>&P\&>-L\&>- $& & &. 㿘E> S a @v% * ]* _* \* ^ \> ]*  ^+`@+  _  2  @  @ 2`2`2`2 2 2 , ;, 9, :, <, =, >, 8, ?@ \ ]* ^* _ *`@ @ Β@ . &  㿘#`a \@ ]* ^* _*`@ @    !*` "* * # @ *`& 㿘    2o 2  \ ]* ^*`@ *  _ ?&  㿘 " !| 㿘H /d * % !! .`  X@)`"" XH 0a .` ` > S !p`@Ě"$@ >&L  @ۘ H 0x !  !* "*  *` #@   "? 6" !  > S+ @X` *`p`@@    #@ ؐ @ ` ( ! > S!`@hp&p@> S`0'. 2   `\ `]* ` ( `!*  `^+  `"  `#+` `_*@   - 5`   ??أ-` @Rب@  Bظ  @ @a@1@B(@  E$ @:b  2 @   `  : &`4-`X2 '뢐 {ԗ5` -  = ;`x>. @8>#`8#`#`D#`@#`H#`P#`<0#`#`4``8(@#`8#`* #`L`8j #``x "`x#`#``@`#``@"@d(&`@جEB2 `4 (`4@`4E  @e4 `2``&`4H /d * %   H 0  > S"@`@p 㿘  @H /d * %  8(`> S x "`@ < , `$ ,  & " @   (> S"@> &  0 $ 0 ( 4  U$ ( , X !$,$(@ `1 !@@ ? 2'`D D` H"`H" H D"@$ H$ D 8  "  8 D` H"`H#  8 H D"@ 8" H 8"`D 8 `؀ > S"`@|p@`@`@H 00 W$,H 0|Dh|0¬ˆ,, 8|88| 㿘>0$<& 3>/ & 5>/b8& 7>/&9>/& ;>%#T& \>%c &`>&&T>&" &db>&&X&>&P\&>0Lp&>/ & .  & &㿘> Sb @V 4`4`4`4 4 4 *`;*`<*`=*`>*`8*`9*`:*`?&    @!  !* "*` #@ ( #@ 㿘    + 2醐 " 㿘 " J饐 㿘H /d * % ! .`  X S ((>/  €`5`!3! ``!,! `!'! `"` !&``!H 0a .` ` > S"p`@Ș!! "$@ "X @  >&L  @٘ H 0x !  !* "*  *` #@   "? 6" (`!  > S+ @X` *` p`@@    #@ ؀       䀢   ܀  > S@a#@`(>/ @ ! ) '!   !    !     > S#X`@.p!  &>  @F 㿐 > S 2 `PB ?`   !* "*`@ *  #  & 4覐 ` >1$8$c8 @$8$8 $8>/!*` €8 $86  !*  "**` #@   ˨ > S#@#`kf ! - `X`\>/ *` €8$8  4Q& 4$  * j $L @ 8*@ $x "x$$ @$ @"@& @bH /d4 * %      ̐ SH 0   > S#`@p 㿘  H /d * %  8(  , $ ,  & "     (> S#`@ &  0 $ 0 ( 4  $ ( , "(> T x`@y $ < <$ @ "L$ @ v 0l x> T`@d ( l$,!$,$( `8 ! ? 2.`D D` H"`H" H D"@$ H$ D 8`!  , " 8@^  8"  8 D` H"`H$` 8 H D"@ 8" H 8"`D 8 `р 2 > T X`@   @  $ @У@QP``@БH 00 $,  $ @Ё0@Q/H 0㿘 "L < <?`"`& @"@""  <2& @& < & @ " 8> T@. 2 <рќ֤֤㿘>3(&Ȕ &5>3 & 7>3& 9>3& ;>3!& b`>%& \ &>%`&>&T &>&d&>&X&>&P\&>4L<&>3 &>4$0& . & &㿘=   2 > T> T` @  ` @    * ]* _* \* ^  \ ]* +` ^@+  _  2  8 @= 2`2`2`2 2 2 , ;, <, =, >, 8, 9, :, ?  2 㿘   z 2Ր 2  \ ]* ^*`@ *  _ ?&  㿘 " 懐 㿘H /d * % ! .`  X M "``0 `0*`!(! !$!  ` !! ``!H 0a .` ` > T p`@ !! "$@ "X @  >&L  @ H 0x !  !* "*  *` #@   "? 6" (`!  > T+ @X` *`p`@–@    #@ ؀@  @     䀢   @ > T @!`&>2#L@ *    !    !     > T!`@rp!&@'D > T'P'5 '  ` `!* `"*  * `\ `]( `^+   `#* `_  @  '?Țć8 ' @H*  $2` * 2@ 'ؚ''`: ;* '''`  ' '> TĐ!`D  : Ĕ@'ȰؠB  @@:@  Țb@B(@  B   2 @   @\  @`@LG @ g4 5` 2`5` `D 5` D- @   = @@KD;`@@BВB?@ DB :  ,` `hL X`@>2#d*` €#\`#`Dx#d> T@!x @  @" ( ;`#hD#\@֚  = X T> T!@ؒ` X @K ( D#\#`#d#h@ ~D#`#\#d#h@ q#\`#`#d#h@ a#\`#`#d#h@z SB@c??@'H /d * % 쀢`D D:` ` : @"#@"#`8"D! `D#`H "@" D` `   G DH 0  쀢 /  㿘  H /d * %  8(> T @! , `$ ,  & "   > T!ؒ`@ &  0 $ 0 "  P@i D " ( P@y& P ( 4  $ ( , "(> T x`@!,$ < <$ @ "L$ @ { 0q x> T`@ϐ"  q$,$,$(! `8 ! ? 2.`D D` H"`H" H D"@$ H$ D 8`!  , " 8@a  8"  8 D` H"`H$` 8 H D"@ 8" H 8"`D 8 `р 2 > T"P`@   @ $ @  k@L``@H 00 $,  $ @0G@LH 0㿘 "L < <?`"`& @"@""z  <2& @& < & @ " 8> T@"x 2 <㿘 \5`  ` d@ dF?$ $ 8$ >6!D @$ 8$  8  8$ 8 8 >$ 8< x$ H$ P$ D$ @$ <0$ 4  .` j $ L @  8*@ $ x "xh$ $ $ $ $  @ $  @"& @ 4 & 4 㿘 %)> T-> T'> T+> T  `@"`@   Z .@⠢ @b : @"` 㿘 @ 㿘@c 㿘 !  ) ! ?? >>0;<b$!>8a>8! "!>=;b>>!4>>!c@>%!\# >%!`;>&!T9>&b !d"7>&!X5>&!P\3>?!L`1>/ !#!!㿘D &*8` ?@Ȓ :` @- 4&*8  & ` &` ) #@ $` > T` ?b @X ! 444444*`=*`;*`<*`>*`8*`9*`:*`?@!& 㿘&*8`   @L /&*8`  `$`%`!I(  &`  #@f `a  !* "* # *  @& 㿀'D   'H'? H /d * % !*<@:'䀢 'j@3 耢 "H 0 "$"@  $@ "@$  "@    *  *  * A 4    - /`+`(     5` 5- @@ @ -`4,-@, @ @   @ ?2$  *  *   ?$ H`:  @Q J +`2  @  *  >  2$ ?1 $ & & ( < 耤 ]& 4",  $$ $ $ $ `   0!$ $  $ z `B ? 4 08 @ڐ耣  D@ @ @ H /d* %耢 `@^*耢 @XH 0 㿘8`4  @RH /d * % @3<@0H 0@㿘     $ "5    / @s  $  2  @2     ( (h  "  c@  ݔ  &   @Q@ 㽰  @}!  : @@@~ @ ?@+!㽰  @}Ӕ!  : @@@}ݐ @ ?@ !p'> )H'@ 0@ В `@@@Ȑ@@ @@Ò@ @ݒ @ڒ `H > T@ "x> )#H) '  #+  (? ()@U  @( #@ @ #H > T@ϐ"㿘 +& @9$(!#  & ( ;&)) x(@z( &  x> )#H) ' 5ب ( @b  .` 7(?$ Q()@  ` (? +&) (9  `(@4@ߒ @. `@+ @( H > T@W"Ь> )8#H' x W     > T#`@Ȕ @ 4 > T#8@` 4 ?@ 4Xe`e` ?@R   4 ?@ @44퀦 , @   > T#h`@  @*H&* 4&* @*#  >*8`4 5+`6*7 *  3 3 3 . . . .. . . . . ,. -. .. /. (. ). *. +. 4. 5. 6. 7. 0. 1. 2. 3@  8   H H  . X. Y. Z. [@y   m M A R C c r a, ,,,,,,,,,, , ,,,,,,,,, , ,, ݔ        ,0,1> T,4,5,6,7,3c,2 , ,!,",#,<,=,>,?,8,9,:,;@e@!> T> T#H@( > T X@" bp @! %`%a%#%  @H   @ a % "a%&*@%!#@7 ,(,),*,+ \. \ d),`,`,`)t)   > T#`@ @   !   @  @ @ 4 ?@ۖ @%4H > T@#؁Ь> )8#H'     > T\#@4 > Tb#84 ?@ 4Xe`e` ?@   4 ?@ @4`, > T#h @>`  @l  2> T/#M > U& ( f` `4 `5*  `6**` `7@  ?> U ` @S`*H @>  2&* > U @ F`4  >*8&*`귔 \ `( `)* `**`@ *  `+ > U@] ) \ ` `!* `"* *  `# * , $ ,  @ꑔ) @`* `**``@    c `~  `@ 4  ` ?@ @B4H > U@ ؁`> )#H' > U`*<#\   @ > U*   a#\@ #?? ,@; 2x F q ܐ j @ $  `'Ȁ`"] !'  `< `=*  `>( `8,  `9 `:+ `?( `;* @*2@  ; 3#,k ,'Ԑ@ܔ ! @?`?"! ,@@]??@,;@ ?2@    (ӓ,>@;cذ cH > U@l!㿘 2*8=  >@@֒ >@c;# @?`?#,@@@??,:@ ?@  f* "+P@3*<+P " @-* > )` cH 'H0S``"PH`8LH+( "F EH``"AH` < p  7Hp`2t /8  )Hx`$| !  H2 2H! )@ ! d) \)҉ H > U@!0㿘 @ ! >?!$ @$ 8H /f * ' @ڐ   ,H 00@% 㿘 ,  8@ "`,H /d * % @6 8H 0@㿐 > U@D p` `PB ?& 4   @@> U!P`@pZ`>@ @#`8#`;`x $#`D $#`@ $#`H (" `4`8 #`8 #`P`8#`8@#`#`P>#`< 0 #`4#`#` @ * #`L@ `8j #``x "`x#`#` @`#` @"@& @H /d * % 蓐 H 0  &`, 㿘  @H /d * %  8( > U x@l!p , `$ ,  & " @   (> U!@̔ &  0 $ 0 ( 4  k$ ( , 2$, $,!@ `1 !@@ ? 2'`D D` H"`H" H D"@$ H$ D 8  "  8 D` H"`H#  8 H D"@ 8" H 8"`D 8`؀ 2> U! @ (", b >@& #d"@"8H /f * ' @ H 00@ H 0㿘 > #Ȁ`> Ua@Xؐ $( <   " N 2 ٵE@`@`@C㿘 ,  8 "`,H /d4 * %  H 0       ؝㿘@>A"(bp&!>A &">A&" >A&">A"&">%c&"\>% &"`>&&"T >&&"db&>&"Xb&>&"Pc\&>B"LcT&>A" cD&>B"$`& .  & "&㿘9 > Ua @ 7  * ]* _* \* ^  \ ]* +` ^@+  _  2  8 @) .2`2`2`2 2 2 , ;, <, =, >, 8, 9, :, ? &   !*` "*  ( #(* !" 2 㿘   L 2ק 2  \ ]* ^*`@ *  _ ?&  㿘 " Y״ 㿘H /d * % ! .`  X M "``0 `0*`!(! !$!  ` !! ``!H 0a .` ` > U!p`@ݘ!! "$@ "X @  >&L  @ H 0x !  !* "*  *` #@   "? 6" (!   > U, @X` *`"0p`@쓖   " ؀@* @%  " 䀢  @> U "P@ '> U! ,  X@h &> U@_"x(>@#@ ! ) '!   !    !     > U"`@,p!&('D > U'' '  ` `!* `"*  * `\ `]( `^+   `#* `_ @   '?Ȓ  8?' @ *  $2` * 2@ 'ؚ''`: ;* '''` 'ר  '> U"@U`D  : @ȨؠB @ @@ Țb@B(@  B   2 @ 8  @ @Β`@ C B? bB?АF??Ѐ@  2ԀD 4` 2@DD4` D, @   < @闒@D;`@鏒@??BB?@ DB ;`   / @-  X " $ "   @`А Ԁ@  `@2`= ` =  Ϙ  (1` `#\ #`D#d_> U@y"> cH@  @q (#d#`#lD#\#h#p@*  `/C  @"( Ѐ Ԁ@ > @" H @ ` ( #p#`#d#lD#\#h@  =  ϘJ@ ̐ G؀`> U@#> cH ( @ @ > cH @@ ' @#\#lD#`#d#h#p@ e#`#l#p D#d#\#h@ S `6B  @"/ Ѐ Ԁ@ &@!> @" #H @; ` @#p( #l#`#dD#\#h@u  =  Șŀ@ Ő ؀`> U#p> U#x> U@돐#H@   B @" @" ( ;`#hD#\#l#p@5 ܨ =  ޘ@ ې ؀` Ғ ͒ > #H@ @ @ @@ @#p( D#\;`;h@ #\ D;`#h#l#p@ D#`#\#d#h#l#p@ޚ #\`#`#d#h#l#p@̚ s#\#` #d#h#l#p@ a#\ #`#d#h#l#p@ Q@Bb?? 'H /d* %쀣` D  ;`D D;` #@"#`"8#`D! `D#`H "@" D` `   ▐ DH 0 쀢  ~㿘   a& D ` D& H`""` < "  @   㿘   H /d * %  8(> U @P# , `$ ,  & "  " > U#`@谔 &  0` $ 0` "` P@j D` " P D@m@@  &  " ( P& P ( 4  $ ( , "(> U x`@#O$ < <$ @ "L$ @  0v x> U`@# v$,$,$(! `= ! ? 23`D D` H"`H" H D"@$ H$ D 8`&  , " 8@f  8"  8 D` H"`H$` 8 H D"@ 8" H 8"`D1 8  7 8 `̀ 2 > V `@飔   @ $ @* Ӊ@<Ԑ``@H 00 $,  $ @0e@<H 0㿘 "L < <?`"`& @"@""Ҙ  <2& @& < & @ " 8> V@粐 8 2 <㿘 \`hlPp V`d Nd$ $ 8$ >F | @$ 8$  8  8$ 8 8 >$ 8< x$ H$ P$ D$ @$ <0$ 4  .` j $ L @  8*@ $ x "x$ `$ "$  @n 2?  @  2" "?" "$ $ $  @ $  @"& @ 4 & 4  @ * 2 > *H   @ * 2 @ > > HcH  `( (#(* ``"#cH > H* >  H `> H* *`>  H 㿘 > . "H`2 ! @  &?> > #HcH + @@@  *   +  㿘>  > c> V@F P0L#> > V   @`  ` `(@ 2 > "$a ."a`x@   >   >   " 0> ##  @C > `"!> V@ 0 ?"> #`""a > #@#`#!? 0   ` >    㿘#`a `  > @  !> !a@ " !a"  " @8 @+ ` > >    ` ј ` a ff8f8ef8ef8f8f8f8f8f8f8f8f8f8ef8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8ef8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f8f$l4lllmll4lqt0ttttt0t0qrrttqqqqqqt0t0t0t0t0t0t0t0t0t0t0t0t0t0qqrrt0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0r(r0rTr\t0t0t0sDsLt0t0ss$t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0s8s0Ld`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @>ې  &` &`&` &@`6$ $$@  㿘  @> &  㿘 @>   "  20   " " "     2 0   " "  ``0"42 0(2<(,",4"< 4, 2"4`(",`( 00 "`00(2 , (""`("0  "4"4(,"(, 00 00(2","("> ," (42( 4"4"43 2"4`,"(`, 00 "`00(2 , (""`,"0  "4"4,(",( 00 00(2","(" ("0`0"4"0 4ݘ  2l4`,42( 4"`4`,("`,( 0`0 0`0(@2","(" ("`0`,(4 ,,n4"k 442`42"4 4(, (, 00 "00(2","("", 0`,`4 4"`4,2 4`,("`,( 0`0 0`0(@2","("m ( 4"`4`(,"`(, 0`0 0`0(@2","(" ,"`0`((4," 44 4 A0",42`4,2"4 4,( ,( 00 "00(2","(""( 0`(`4 4"`4(2 4`(,"`(, 0`0 0`0(@2","(" ,"`0 "42`(2"4㿘`(2`,@`, =( ", ( 2,04"0 "& ( 2# ,# (0" `("(`,",`0"0`4"4`0`"&`(2"`,"`(`(" 0`, 2" 0   0 2 0``0`4"0 "& (2# ,# (` 㿘@   @<  ( ,&`4&`0&`, &`(`6$ ,$ ($@  㿘  @<  ( , 㿘 @ $"  ,2 ,",",3 2",`$" `$ (( "`(( 2 $ ""`$"(  ",",$ "$ (( (( 2"$" " "(`(","( ,ݘ  2l,`$,2 ,"`,`$ "`$ (`( (`( @2"$" " "`(`$ , $$n,"k ,,2`,2", , $ $ (( "(( 2"$" ""$ (`$`, ,"`,$2 ,`$ "`$ (`( (`( @2"$" "m  ,"`,` $"` $ (`( (`( @2"$" " $"`(` ,$" ,, , A("$,2`,$2", ,$  $ (( "(( 2"$" "" (` `, ,"`, 2 ,` $"` $ (`( (`( @2"$" " $"`( ",2` 2",㿘` 2`$@`$ = "$ 2$(,"( "& 2# $# (" ` " `$"$`("(`,",`(`"&` 2"`$"` ` " (`$ 2" (   ( 2 (``(`,"( "& 2# $# ` 㿘@   @:   $&`,&`(&`$ &` `6$ $$ $@  㿘  @:t   $ 㿘 @:`   $ $"  (   2 0    (" ($" ( "  ( $ $ $2 $0 $  (" ( " ( ` $ "@0 @ ""`" `" ` " *` ( > +D(" "" " 㿘> + D  $@ @* & ܐ@ $&  & #&  @ `> )#H '@̤ .```\ $`\ *`FҐ dc耢`" d`\@> H `B : dc쀢ѐ > H`B :2  dct> "H  !xB` : > V`@g `` &@ @֒ , &/ &     /` '/`'`'`'`'> + dtD@i`d $NkH`> B:`!2?V  & `&K `   ` @2 ` `@2 ` `@2 ` `@"! ` * &  $`@`@`@`  d N`  d + + \+ D  2H!x`> V @H!x`> V@  *  *D*\#H > V@e > )#H\' 2// `"''> bH`> B:`Ȑ#@p& 2hcc`> c܀ > !@y!&> H`B : 2c^? `c`*`y* x" 0" 0  u` n> ݐ# > #` > V @Ma @֒ > V@ܘ > @W!'?> + D"`p 0`> cܐ "c> "H !pB`"!p: Ѐ`  X > H?`B : H > V@!0㿘 X *> + D t@ % 0`!cܐ?"c 0cЀ  > c 2> @M > #> bH`> apB?"ap:`ؐ!@ |   y 2 㿘 |  %>  " |"& |@ђ`X?&`X`2 㿘.`   > V> V> V!HaXp@H">   "Z$`8 P%> > "H ` 2E ` @2@ ' 2x D ( x \ (x*D*\/  '> V!> V!> V!`@m   @j> V@۳!  @] > V@ۦ @fB? 2 @].`" >  T@5 2$ @D,?>  `@  .$`  <$   <"@ " <`   8 `$  8"` " < "`8  8$  @z 㿘  @"&  @   @ 㿘 .`@ 7  8"2"`""`"`<?""">  T@ `8 2$> m `@ 2" @ D 2" > @Ӑ $㿘> @Ӫ В `8"`< "`8 㿘\!` @ 2 H  *  D@ I $*  D@ H`  0* 2 I  2*`2  E,`' D,`& @4`$@y D   @I     @@@;@6@1   $@( 2@ $  @@@@@ 0@  2@ @&u! 2 H>  @<3 *  D2 I*  D, H @*`2  I* 2 E, ' D4 $, & G 2&&@&&@> #` > Va@ @ @> V@G  㿘> #Ȁ`> Va@D0 @ &1 "Z?&& >  @L?  ϒ A?@3>   > bH!`>!|B:!`&> !  > bH!x` > V @١a> V@ ?`L&`&`""`bH  !l B#!l@x; @ 㿘> bH`> B:`!㿘 $?`$c F &A>  `@<>  `@7>  `@2> `@2-> (>  ` @#>  `@>  `@>  @@>  `"@>  "` @ >  $`$@> 6 > #`02> V> V"p"x &> Vb(@   &@!> V@c" "  &@#> V '@[b`&> V@W"` @`&@Q"`"`@`&`'@Jb> V@G ?㿘> "H !xB`: > Vb@  @ > V@-  > 0 ">  @ ">  ̲ -0  K  0" @0&`@"&0`8`>  ` 2 @2  @@`2` 㿘> bH`> B:`  # 8 ``   2  "  &怦`   㿘> > "HcX +>V)> V'>  c @"ȑH /* ` ! l`@}@b @ @7: @S H 0 㿘 ŀ ?  @  > V> V> V!HaX@ǔ$=(  d> V> V> V!HaX@׽$>* c c> #X# `> ccĐ#X> #c# @ $  @,$ > + D0  㿘> #? )> +'>  X` t D@ @}h `ꀤ > @} h㿘 | %> #X |& | F  `\?"`\ `X?  "`X d#Ȁ"#> + D @ "t>  @ѳ# | 2 |h> #Ȁ`> Vc@A֐  D 2>    4  & "   8#` #\#d#t#x#h#l#p$ d#|#@#> ! €`@@А . T㿘> #Ȁ`> Vc @A @  i ŀ "  d> V> V> V!HaX0@$cА?  "c dc܀ 2 h@H͐  h`"  `cА? "c h@H  ` #>  `& ` А?  " c܀ 2@H @(a ` 2 `@< @vY  `"  "`> " P ? "& &  "> @I> !@> Hl`B "l:㿘??3 > `d '  d `ŀ  `> @| h t d? > +`D 8 ?. d> @| h a d?? $ d` d>  L`$ d> @| h㿘`$ 2  @m &` `?㿘 $   @mW&  $  2" Ȁ2" ?" 㿘.`0i> V ` 2` @ַ#P.`2``]> V@ְ#`0Y     `* `2 ` " "@ " @$     ` ` *  ` "@ " @   %> V+> V `   @rh2`@mh `.@gcp8`@bh` ` 〢6``> V@W#x㿘 @ 㿘` 2 ` 2 ``' '   ?`9&>H#*` €> V@'# > V@"# > V@# > V@# > V@# > V@# > V#@  `0 > V@#`> V@#`> V`$@#` *`&> V@#`"`#`& > V$@#"> V &> V@א#&" @ϐ# <`2/ D> V 4 8# @@ < E` > W ] "> W> W @ն `> W@ղ 0 L P X@լ T E`  ]`> W @ՠ `@՞`0 D> W \@ՙ 8 d > W$@Ւ @㿘  > V@Չ#؀  > W@Ճ H  > W@} P  > W@w X  > W@q `  > W@k h  @> W@e p @ > W@_ x > W@Z xؒ"? 6" #h#h@$= $=@ ؀" $9" `b'$9 $9@ ܀" $@" db'$@ $@@ " $A" hb'$A $A@ 䀢"  ," lb' , ,@@g  耢"  (" pb' ( (@ - -@ 쀢"  \" tb' \ \@ 0@> 0  "  X" xb' X X@ ] ]   " |b'" 2k#h *`   `  `"  b"  `*`㿘 $`$@2H `B> W>I h*` € ` @2:  `@25  `@20 @@2+  `@2&  `@2!  `@2  `@   ` H H  ` @ @ @Q   * ( (*`00*0?# 3   +  + 2 㿀c> )cH '@_ݔٔ 6@ H0R  `*   2 66@ * / `*  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2w6H > W@ 㿐 ?'L*  * @' * * * LL `2 `2.  `. . .L@?L @ * 2 B6@㿀#> )cH'C ? `2+@* %2 * 2 * 2 * 2 *   2 *  2 * 2 6@cH > W@ 㿘 `&&>I( &   &   &  & 7@0@ & !7@ & #7@ & 7@ & 7@  (~0@ & 7@ . .  ( .`*`@@+/`.  * *.  .@L0@ & F7@ & A7@ & 7@ &  .` .  ( ( *   *  + .   *`*/   @@ .@ 0@ &`7@0@  &`7@0@ p\> )` H d'o k4.``@@*`` 6@/ @24  7@@4 @  ` 4@* @2  4@   `"0S *   2 4 @ *  ޑ2 4@* 2 1  @*  ˑ2 *  ő2 *  2 *  2 *  2 *  2 *  2 4@I``H0@Ж * 2  35Р @ґ* 2 ԑ* z2 ֑* t2 ؑ* n2 ڑ*  h2 ܑ*  b2 * 2 \4@H > W@ ȁX > )2 , cH?Ȭ '  D`#\  @ 7 2 @[ I `  0C`E?4 $;7 `@/` /`/`/`/`/`/`/ #@ Đ "  .@.`.`.`.`.`.`.`ϲ` $ @$ 4 @ @)0cH > W@z ؁p> )/]x'L l'PH*g'Xj' 7^  `  0  ( @%q  t |`: .`:|6`8  &`(# > G`&`4&`,> G <`&`   &`&`@&`"` ` ,` L4``$` P@$` L ,,,P ( c-   $ , ^\4`4 $ $  4   , , ^ H O> )b#H@6M4 @ @@ /*@@ $@ ,`> # ]` 4``4`> #,`],`4`     X @&1> )`X  '//'   4 ؒ  @# > )  (@I4   @ `,,#\    @~ > )#H > W@ 㿘沒 @'9   `:"`( *`:# `"`4"`,  0  ` @ǘ 0`@T     `0&@@```` ` `  " ``@ `?  4  / @+ )   8         @            ?/>I( ( %@     `? `? @  @ @  `?@ @ `? 㿘.`.. 2`2ė2㿘     㿘     2 d> 8" d> d"  d2 㿘 `2 `h! 2`P`T "`P P`> #`> W @Φa> Wd`@!> V@  @nFcl`42 8`42 86" ( 㿘 #p"d' ? > Wa0@| ".& 2"&> *  &@a"  &  dM " & cp$? @ !  G*  `"$ " $ 2       #p"d'@;  $ $h&@ @&0 ? &2&&@ p$`2 < "  "  < "& "  " 0$@*#@@*#@`*#``*#` `  *#`  ```" 0 "  " "  "" " " 㿐```E?#&`&` &`" `^?`O>  H>  p  ` `$ `$` `D  !*>?@*'*`@2`'2@? 2#@`@' @ 2 *2@ 2@ @ 2@ ? `&`@`&`@`&` H> ).#H6' #\  @0  Ā$ @   " ` `` 8  ` (  @&#H > W@!X@> !R> )cH. 6' 7#\ @  Ā$       Δ   (  &#H > W@o!hX> ٤ > )aP#H``'` `0+ؐ@! * /"@kڒ  @l -,`@  *   / "  " " " @k  (,`< P n$@?* 2  * 8 Ր?"8,`.2 2`@8 @ * H > W@ !x㿈 d'& $H  &   "0"ؒ #\#`  #\#`  l @s7#0& > )#H)> !' %> !>  @5 @Uw00 @U  %!0?0 P?x`    H  ( 0 8 @?x??????????ؐ@Ua ``@U\ `D  ` @UU `$@UQ  @UL `$@UH @Uv>  > a5> )"pH  #a> W@!#􀠠"##2`#"#|#2`#|6"@ $: ` *` $@" $F $K*` $F2*` $22`$`2`㾨`> ) `D`?d'D'Lhl'H `  H'H''''x't''''훔  `D`$@ @ ''p'l/_/W'|@&א  > "H 8 B: 87 `E "@  " `DM'p :+ G'p 'p`7C7` 'p 7;7 9` @/_ `_/W L'l `'p  ` @/_ `_/W 3'l `'p7777> 4`04`2)> @'`Dc@Bch:c@@j = 2 9`' d' $@`  @" $A h' $A`"  `E@ l' `$    @% 2e  $`   @ 2W  $ @ K `$ 2 ` @`f @ `$ 2 ` @k" 5 `$ 2    ) `$ 2' ` " 2` 2` 2 ` 2`   `   `," `-`pR'  `*Q`(  tE' `T    @ 2Y  T  0@ L `T 2 `P @_ A `T  `P @j 6 T  @0 * `T 2( `@ "  2`@ 2`D 2 `H 2`L  `@ `0C   `\" `]`x'  `Z`X  |' $B`_@2"" $C`W@2" $J`"$4 `F@2"$4 2" `E   $E ` $D "' $$`@ 2$@ $`  $0`@ 2$@, 0(` o$` @? @i'd  Xcl  M#x`" `E F@aB@bx :d 2'cp 6 $8 > !@3 "H"|"'|g#\@qÚ?D"H D"L"H'"D@ $<`D"'  D L'H''$8 "H"#\@q~?"H"H7`B ="H' d:  `#d#\#`@r|   d:  `#d#\#`@r 2  $8`~$4` { `E Q` O ` K ` `4 `      *` (" @:  "H H B: HI7 ` 2  2 ` ` @#\#`#d#h#l $I`@#p`#t#|`$#` ##x(   $*   2  $`@q  : $*  2  $`@]  $8`  "H ( B: (7  l@g*`@  ,`Jl^| d? Zd4  `D`  #\S  "H h B: hs7f*2#d#;|H#lp#p#x##`#h#t#|##\#xt@m _tx + `G   `I `H*@*`@*`*#\ #`@`#d '!> |'|!@Ò || `p@H@ %  € ! > )@D H@!   | !> |'|!@ || > )H > W@ !`#dl7\7p|#Ѐ > Hx`B :x ``B :`7> !@@!  > $ h$ d `A  dcА "c dԐ " h`"  `cА "c hcԐ "c ` Ȁ3> +cА "cԐ "2$G "$4  4 $4@"$4  4 $4@"   4 ? ,  4 4 I*`#@ H* #@ , , 4  , Ɛ 4 E "`  V W O :P Q $ 44  $ 8 ` ``2$ <$? 2$ < 4" $ < $ < 4` <` Z  % `   8`$ 8` Dt2, E``*  E 4 @ * @?: 4 @ `   8 $ 8 4 X, D$ P, \ , Ő   , , D, , \`D`D$ $ E 25G €!  0@+ H 7>  €!"$G 0  0 H#\#`#d@,  > #`> Wa@W > W@Ƨ!> V@Ƥ Dz G, #\#``h뙚  > "H ( B: (7$4@@t>  = 1 . &' > HX`B :X7x> "H"@   4> #@ 2& ( `B ? (7B h`" dcА?"c dcА?"c ` cА?"c2@ " |"$ |`X "`X``ȶ `-`@8}2 4 E 2p `  2k $? 2g  @ , D$ 8` D2* 2 D * 2 D$4 B 8 ` @#\``#`#d#h BD#l@#t #|$#p#x## > Hp`B :p7/  .` `u`.` ! @+* h`" dcА?"c dcА?"c ` cА?"c2@u 㿐 D $@  2 E $  @ @  @   . J E " D  " D Dm :"9 D~ D  @ !.2 (   @. @2  @2  2   (.@2   3` D #` ( 8 #\ D  $@ !/ 2 , $  @/ @2 @2  2   ,/ @2   D 83`#` $ ,#\0 D  @ !.2 (   @. @2  @2  2   (.@2     D#\ 3`#` ( 8 D  $@ !/ 2 , $  @/ @2 @2  2   ,/ @22    D#\ 8#` $3` ,0$  @ 22 D   @2 @2  @2 " D   8 D  $@ 2/` $  @2@2 @2 /`  $ 8/`2  \ " / 2    2` 2  F   @2  @2   @2  "  D   `  D  $@ 2  $  @2 @2  @2    $`v 0y `  "4 0r   88  D  $@ 2 8] $  @2 8@2  8@2 8 H 8  $0A  @2  @2   @2  " D   8$  D  $@ 2 8 $  @2 8@2  8@2 8  8 $ h> "@?`D%> \'`'''''耢`"c@Bch:c@@b’ = 2 9`l'耢 dd' $@`  @" AhX' A`" `E@lM' `$   ` @@ 2d  $` 耦 ` @2 2V  $ ` @ J `$ 2 ` @X` ? `$ 2 ` @c=` 4 `$ 2  `  4 ( `$ 2& ` "耣 2` 2` 2 ` 2`   ` ה`   `,@" `T`p'耢   `$ @̔ 2X  T  `$0@D K `T 2 `P @X`$ @ `T  `P @b`$ 5 T  @0`$͖ ) `T ' `@ 耣 2`@ 2`D 2 `H 2`L   `@`$o`0   \@ xp' J`"x`F@2@x 2<`E   - 24 ] 20 `   - 4 ] 0 E , `  : @?#@2$`@?`?*`@` ('d   "'p &$% ' < 2'耢 R y'''7H`B H(`B :( ` "` 2`@"& ` `` " ` ` d "@ 4 ` `!`  ` T2 DX .  -`` 2 *@  `?2  `` *@6`.` ` 2   &  .  ` `* &  -`* & & -` 2  8!6  ` ``  "@` `Q `L d "@ 4 ` ` `2  `  2`  "`` ```   #@` 2   TX9 d "@  ` *" ?"%A`!ۑ*  `      "@ B 2`@ d d#d#\T#`X@&` 2  -`2 @ *6  $ 4& *`  & &` `     .  ` " `    .  ` "& ` `   .` `2 `  |`" ` S `` 2@> Hh`B :h2 `  .` `  .`. > + D"`  (  `  6*`   `  +*`Œ ``(` ` *` ( *`Ő *``? ?  v?"% qA!  k> #`,> Wa@ a ` #\#` G#d#h> W"0> W"8#l G @ 2> W> W"@"H#p> W 4!@̖@ d d#d#\T#`X@%&` 2  -`2 @ *6  $ 4& *`  & &` `     .  `  .`. \ +> D '> `  ` ` @#\#d#`#h#ld $IP #p @#t #|## D#xd P $ 6 & & ]+> "HaxX> WbP@  ` #\#` G#d#h> W"0> W"8#l G @ 2> W> W"@"H#p 4> W!@3 @  1 ` *#  2 ?"% 3 A!ۓ*  4 $ @  5   6 #\> W"`@`` 2@bHP`B :P 㿘     .  "    .  "A ` `  .` `26  |``2  +.` ` . .``| " ๐   7> Hh`B :hA  `2  2 ` ".`  .`. > + D"`  (  `    `   (``   `(  *`Ű 0\> )`  D `@cH/'7'/ $77  $77 v& ŀ r` d dH d9 2 d9 2  `@2 @H0H0 I*  D` O @` " 4@`8  #\ #`#d#hB@#l#t#| D#p#x##d $ဤ`w`8 @q`4 @k`| "̐  ` 4@> Hh`B :h  *`D D` ž @A  G`8 @A`4 @;``* 3@ P`2 I@"`P I H**  *P*#\#d#`#hB #l#p#t #x $#| D##adt`  `P @ ` 4@> Hp`B :p * 3X " L#\ #`#d@#l#h#p#t@;x##d $* D I * H  *8*`#\4* #`#dX #h#t#l#p#x $ #| D## d 4P" "<`L`8" "`TX4 "8`@`L "`P*E*]* D* \` 4@> Hp`B :p  2  ` (  > #` > Wb@ U > V@ * D* \&€  ؖ #d#`#\  " @ I*  D@ H +  #   +    @ @2  2  @2  + @ + +  D  #`8V#\ D   I$*  "  2@ I$*     @     @ @ $@ ,J D` I$+ @ 2" `+ $+    @2 @2  2  @2 +   + +  D 8#`$#\ $ &('Ā @  H > W@b"`\> )cH `D ```@'/7/` ݮ`$ݪ77` ݠ`$ݜ77⑖ & `ŀ ` 2`d dH d9 2 d9 2  2װ  ` @`0`H`0`H  2  *  > + + > + D"`      *`  @ `I*  `D@ `H` +  #  ` +    @ @2  2  @2  + @ +   `D+ `  #\`8#`" `D   `I`$*  "  2`@ `I`$*     @     @ `@ $@ ,`J `D` `I`$+ @ 2" `+ `$+    @2 @2  2  @2 +   + +  `D `8 #\`$#`潒 $&(@  H > W@2"㿘`D. &`E. '`d `@ \hl6 $ p`H #@`H* 2`I*` 2 `I #@`H* 2`I*`2 `D 25`H1"`H2`I`H?* &`H *`" `H * "@`  `H  *`# `H* * ?* &`H *`" `H * "`H *` " `H` *  &4`I`$*  &.' F& `ŀ B  d dH d9 2d d9 2 d `@, d $B`&     > ?> #` ,`> Wbؕ2@Ԑ > V@"  ?`\> ) E '$`H':    'ؐ䀢 ΐ`#\#`#d#h#l#p  {> ) D w> )쀢`2t#H#d#h#\#`#l#p `> )> + D " *`@Q I* @@ $ ,J $&( D  "8 H? H * @  8  I$* @  8ݖ  ,J *  9 2`* 2`@    *    2 @2   2 @" I*ܒ` ϖ I$*    2 @2   2 @" * `寖  ,J”  D@`?@  7// / ";  #\8  @ʚ >> #`> W @a> W@#> V@  ?@ 24> H`B : 8D A* HB/'p'tn'#\Ȗ ( @ > #`> W @a> W@Ґ#0> V@ϐ a Ж> "H/?p' 01> W 3 < +" , 7``4` /` 4 `B < #\0  @O !x  @?!> W@#X> V@   31 *  * @0/`````:#\  @  > #`f> W @a> W@U#p> V@R  7* p //t* *`2 * 2 8% `ŀ 4`2`d dH d9 2 d9 2  2  ` @`H`0`H`0   `     "@?   €`6>   > ` *"@@ +> > "H!x`> W c@  D  > W@ѐ# D $> W@ʐ#u> W#@Ē 4 P`B < P#`> W c@^  D  > W@# D $> W@#N> W#@@ I* @ p( #  p(   @ @2 2 @  (@ **8#d#\#lp #`#hҚ   t*  "  t*     @     @  $@ ,J $  &(t*` " t+`   @2 `@2 ` 2 ` @ `+` "  `**8 #d#\#lt#`#h f   y  @  @8 @ڔ  (@ՖȐV 0#\ @p > #`> W @^a> W@#> V@ = 7* p /^/t* X0*`2 2* 2H % `ŀ ` d dH d9 2 d9 2  `@ @ I* @ p( #  p(   @ @2 2 @  (@0 * 8*#d#\#h#lp #`0㟚6  t*  "  t*     @     @  $@ ,J $  &(t*` " t+`   @2 `@2 ` 2 ` @ `+`2  `* 8*#d#\#h#lt #`2 26  @   @ 8 @   (@ Ȑ0% #\ @@ > #`> W @.a> X@~ > V@{   P'h0#\#`#d#h#p#l > )@ I*   @p* @ )䀣 p*    @  @䀢 & *   *  * @ 8 #d#\#l p#`#h⁚   t*  "  t*     @     @  $@ ,J $  &(t*`  2,t*    @28 @2 8  28 @"8 +`#\#d#lt #`#h    @   @ 8! #\ @; > #`> W @)a> X@y @> V@v  P'h+ #\#`#d#p#h#l  > ) D > )쀢#H#d#\#`#l#p#hj > )@Œ I*   @p*`  *䀣 p*   ` @ `@`   @䀢 % *@  ( * @ 8 #d#\#l p#`#h\   t*  "  t*     @     @  $@ ,J $  &(t*`  2,t*    @28 @2 8  28 @"8 +`#\#d#lt #`#h    @   (@ {Ȑ /7* p  /t* 77 [% `ŀ W` d dH d9 2 d9 2  `@ǰ @ I*   @p*`  ,p*   ` @28 `@2 8`  28 @8(#d#\#lp #`#h  p   t*  "  t*     @     @  $@ ,J $  &(t*`  ,t*    @28 @2 8  28 @8+`#d#\#lp #`#h        > )@   @ 8 @   (@ z > )#H > X@ ph> )#H D` E @'/7/  $ 77 Ȕ  $77 & `ŀ `ڰ 2`d dH d9 2 d9 2  2°  ` @`0`H`0`H  2  *  > + + > + D"`      *`  @  I* @  > V> V> X!HaX@02  > V> V> X!HaX@% 2  $> V> V> X!HaX@ 2  D> V> V> X!HaX@ ࠔ  " HT @ H* @   8  I $* @ A  8 ; *    @( @ (  ( @(  @  I $*    +`@ +` +` @+` $ # D / J @ $@ / J $&( cH > X@ 㿘_``)E * 2    277;  7`27@> H`B (: @   !  @     *`  (   7` 7@> H`B : @זp> )#H'@ ` ` `"+ + >  /# `? @? N? @? I?@F*  > ` /  "  " " " 2 >H  h`+ @OЀ`$%`    < h`T "  @J ` "<@P   Ѐ``8 ?"`8H > X@א p> )#H'@ `` `  * /"*   / "  " " " H@PK @O2 Ѐ t " 8 ?"8H > X@ ЁX> )#H' ' ` > X 2 ;> X@{  `*;'P&dH` `沔 @"  I'd9 @ `? ?#H'  > #`-> W na@  ܐ ,` /$`dH @O?؀2P> [b`T  "`T`B :P`4 1</`0 2$ lbؒ #\#`  Ș @V_Ā  > #`> Wa@W > X1!0Ȁ 2$`c0     2$`   Ӏ! @ "dH > #`> Wa @'> X!@v> V@s 0 @  " !$ 2@W`0`$  !$  H "@\ ? $c"!$  H " @K ? $c 2 $ l 836 !$ " H 2 > [$`2$x "x `@ݓ*`6  $ > aa,  "a, > `<`0 "`0!p 9dH@> [" L`" LdH=  l @ &dH@ -'  " !p @'2dH> [b`D "`DdH 2&#H؀`"#H`8 ?"`8@dH@N #H > X@!PP> )#H' ' ` > X 2 ;> X@!`  `*;&'dH` `沔 @  'd9 @ `? H' '> @ Ԑ ,` /$`$`  $`dH$ $` :  *:#\  @\ٚ H 24 lbؒ #\#`  @T  > #`> Wa@ > XM! `Ā  `Ȁ `̀ ` c0   ` p  ` t ` x ` lɔ  ` ` U @ L "DdH '> #`A> Wa@ > X!@> V@ 05`? ?  ? ? ?@ X4`  l @x dH " dH"0`B:`dH    l@1 dH 2&H@dHH > X@!؁㿘     0 :  0z  @ !  `$m 2k `b`@ `@\  "$` [  ` @ M"@`$`$`  @`` "@$`$` ` :@  '2@&* + `$ 4`$   0$ : 0> a` "`> `<` "`> Zb` "`> (`B :( `$ 4`$㿘"@ ”   㿘"@   " @ f    @ @ m > "H!h> cX'L'X7f '`'P'\A `h  ??????????`T "`P P`P2"H!x` > W @ia> X!@`0> V@ t !2q L 2> X@ " &  : 2b "H] !``?@ f@ W `'L @`.`` `  7V "H`B :7fD`` ''''''  ` `?@  ///// ` /`'?@K`(7`?@`\#\#`LXʚ7V `    Lm :ΠL#\L' Vf 2 "@* "@'܀`" '#\ L'А @t* 2``7Vf#`L#\P헚* ` 7V@gPPd'Xh'` P P> ["`\#d#h#lL#\#`XP7VPX$L@V #\L' V{f B  L"@ `  7V "H`B :{7f'Ԓ'#\P* `N7VP jV> ["`\#d#h#lLW#`h #\ 'L V;f fV 2O0M#`L#\PZ* `7V(P 7V"Hax 5> Wa@ > X@b"8> V@_ +VP* ` 7V@gNPPd'Xh'` P V> ["`\#d#h#lL#`#\XP>7VV ,P @  (P "X €  X $G`P 7V "H@`B 7f:@x  > W @a> X@ "h> V@ PL @{ P ȓ*`  L`P P  X $K$@c $FXL|`X X##  VP "V `L" 0V  򒒠L" 4L"`,   `L `: *`:   L `: *`: V X$d`VL  L : *:Xdd2XdT"V ,X$x` ,L X$x2 7V, `4 `X $:``\#\#d#`gL X@S P`   ` Vf  d:   `#d` \#\#`L@S  2 V `    `  @  B@ :V `   `    `B ;@VX $8`V X`?* H`B :XX@ B  ;@`H`B :`X@ B  ;@P "LX |`P`H`B :` 8@ B :@`2`P @ * @ `B 8P@  B ;@P``"X`H`B :`#X@ B :@`2`X$  XP2  Ȓ @? `X d8 `?#\ `,#``?@?3 X T  P2  ̒ @? ` d8`?X#\ \#` P`?@?V "& X dHX dH@&L@& 7V PV> "H!h'L> )> HcX''L'` 7f 'H'\'P'X I `h  ?Ѐ?????????`T "`P P`P2ऐbH!x` > W @a> X"@`0> V@  !2 L` 2`> X@T" '4 `: 7V bH`B ': 2  L @ Of  7VL`'L  * @  7V bH `B : 7f@`?   @ '/'//''''// > *  ( '?`H % /Ͳ`(@7> W#> V̀ 3u < +"( , lc\X#\#`L`* 2``7V  `B < 7f̠bH!x   @ > X@["@Y` 07V#\L  f bH!x   @> X@A#@?`7V  `B <  ̠bH!x   @ے> X@+#@)`7V  @`B < @7fE#\L  ̚f !x   @> X@ #(@ ` 7V+ 3 *  * @/̀dH L'H̀    Le :Lߒh#\L' Vf tj2 * "@"@''L'#\ @ $* 2``7Vf#`L#\PG* ` 7V@cPPd'`h'\ P P> !x\X#d#h#lL#\#``Pۚ7VP`$L@L #\L' V+f `  L"@ `  7V bH`B :7f''#\PT* `W7V`P7VbH!x`n> Wa@ > X@C#@> V@@ dL #\L' Vf  ؀      #\LV͚f  fV 276Lf#`L#\P* P* ` 7V@bPPd'`h'\ P L> !x\X#d#h#lL#`#\`P7VLHV@ V (P% "` € P` $G`P 7V bH@`B 7f:@x  > W @`a> X@#p> V@ P ` @cLPL@^ FP` `ђ`ȑ* @L׫  VP "V `L" 0V P` ` ΀ L`" 4" 4L" ,Ҁ @ ` `  ` L `: *`:Ҁ   L `: *`: V `$d`V=L L : *:`dd2`T"X"\"`" V ,`$x` , L `$x2 7V, 2\` $:`\X#\#d#`gL `@O P V `  f  d:   `#d\ X#\#`L@O  2 V `    `    @ B8V `   `   @@ `B ;@V` $8`V ``?(H`B :`X@ B  ;@\H`B :\X@ B  ;@P "2` |`P`H`B :` 8@ B :@`2`P @ (@ `B 8P@ B  ;@`$ `P2  @? ` ` d8 `?#\ `,#``?@: ` T  P2  ` @? ` 8`?`#\ \#` P`?@:V "L ` dH ` dHL@OL"7VL@ L"@ 7V LNPV> )H > X@P# @ " 00`0:  8? y `y3 x `x.  0'` # ! ?`  ?`  ?`   ?`   ?  ' `'a & `&\" G @P  N?`I 06` D  B?`=  ;?`6  4?`/  -?`(  &?`!  ?@  ?`  ? `  "`"$`$" @8 2@ `8 @8?2  ` (  ?`   ? `" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @   &` &`&` &@`6$ $$@  㿘  @  &  㿘 @ Ԓ   "  20   " " "     2 0   " "  `㿐'> > X#\c✒   @ #> > X#\ca 0  @ %> > X#\ch 0  @ !> > X#\cА (   @ > > Xc#\    @ a@#c✔ @  ch @ 0 (cP @ > `"`" > `"`" 㿘> +> `D"%> 1> #` > Y @`0> Y " 8@E> Y@B H@ ` >  ! "  (> X> X> Y#c@ > > >  bH'> X)> X3> Y-> Y+> Y   @Ȓ0 "`8@> Y@ H@  @2 @> Y#h@U  @  ! 2 (#`P@F (x㿘!> #\ *@! > bH!x > Y`0@ #\> Y @ؒ"@> Y@Ր H#\@'> >  ` "Ḥ @;#\@  @ Ḓ *@ "H!x` > Y`0@[ > Y @"@> Y@ HḀ@>  `  @Ḁ@  @ 㿘 ! 2 , , E?%> '> ` "` "$ $@ @5\ ,? $\0+)?#> %> X'> X)> Y`""`"@"" , " >   @8> !@  @  (a ,?$a@_ ` * `2 "` " `" hȒ  G> + D !"& ( `>  "`>  "   ? "& & 耢 &  "` "`"! `>  "`>  "   ? "& &  &  "` "`"& 㿘 ! > > #`7 `"  "`> "  ? "& & > !@0#d  `"  "`> "  ? "& & > #h@r㿘?  3 *   <@"*`3  <  ! "  > X> X> Y#c`@ޔ!D   "@ & & @ 2G ,!> !@   &@!@ &@@> +*`!@2 $@` " @`" @ ` * @`2 " D@"`(@" ,> @ #`@>   耢`"@ "`@ # @"@"` /  ` ` ,2`*  ` @  ` ` *  $`` `> X> X> Y#c@f!o2 2 2@ @5`# @+  ,* @ "@ 2@ %+ @" ",-k4 @> #` > Y @`0> Y!@> Y@ސ H 4@% @5 * 5  T/  #-,2`2  @*@ $G@)> "H  '> Y * !x` &> Y`0@` ,`2`@> Y@ H ,` 2 * #@#@ `"  "` ?"$$ > @Q"> c\?` "c\` * 4@5$ *2$`@ `! *`!2@@ ,`&@ ,"`@"`,@ , & &@" %@&@ `! ܖ , `:)> #> Y` @` * " *$2 @ & ` "H`` * "H!x` @ޒ 0> Y`!`` * ?@ `$@"> Y@ H `2`"Hax ,> Y`0@ @> Y`$"@ 4 > Y@ H@4 `$  `,2 > X> X> Y#c@H!? c *  $ ax  > Y @`0> Y" @> Y@ߐ H@Q `&@!> @P&@"> c\?"c\  @@b#\?$#\@:`2 @ $ @ $@&@ +  4  @  " &  &   @& "H!x`> Y @=`0> Y"8@> Y@ H0 > @F"> \@"\ 㿐'`-> @  * ,2 *`H!` *?Ж*  4`` 2`  4` - `"``@H!x`> Y`0@ > Y@?"P(> Y``$  H!x`> Y`0@ܐ > Y"X5 ?@#H!x`x> Y`0@ʐ > Y"h@> Y@ HlH> c`ݐ` ' `! , `$2  YH> "@  >  6H(`B c:(c\ "c\$ $ H!x`> Y @`0,`> Y"x5 @ۗ2> Y@ؐ H( D& " ! `?В @  *4`` 2n 4`  B  )7 B 6H `B : H!x  > Y @O`0> Y@"> Y@ H   6 `B <  h@  ' @'  ( ` 3 3 < +"  ,   z  w2t  #\    3 *  * @^#\   ? * c@` #\   q耢 2#\5   ۚ b h耢 !  * @_#\  Ú J *` '7ԀJ (  F &#\w `  * @"Ԁ 3 (  $ 0C  * @(Ԁ & #\ؖ  ꇚ ?ږc c $?  0" 6> H`B : 6> H `B  :  6> H`B : 㿐\    2G> 2    >> 2  8> ( 4>  2` />  2 2`   .  *`*&  2`  6    `    6 6  @_   "H  B: 7 @> )#H'  > > X> X> Y#c@#E @֒ ' @S D  "      *` "l  2 (g  bD#\* 齚 X  2 .쀦 P?# 8  " 3  < (- ` @S2`"` *  ' . . . *  ' .` .` .`""` "@T  (& `   4 cH > Y@w"㿘 0`" H> @a  H`> @[ 0\> )`'D'Hd H '  @ 2 D> X> X> Y#c@˔#D  " `D  ` 8*` *` D  ` 8*` * 2   "@  2 D@   D2#\D*H   2 ,`쀤` u?# ]  X  a> "H!x`> Y> Yb@ û> Y  @ *`  ' , , ," `" `  `  6   *`  ' , , , @`" `   `"  '      ($@ `   ` 4   &@ H2*D@@>`")@` $@"@@  > > + D`b" > #` > Yc0@: 8> Y@ H?c  2@` ` @"@@ > #` > YcP@ > Y@g H@?c  2Ԁ`Ѐ@`̀` Ȁ` Ā`d#̀@> #$" '`" 'Вb@ ??# . **"@e* ` ` @ > ` " > `"4 "@ > @<4> "H!x`(> Y`0@ @> Y#p    0` "   1 "@   2 @  3@ > Y@ސ H"Hax > Y`0@ !> Y##@@ǘ> Y@Đ Hax > Y @j`0> Y#@ > Y@ Hax > Y @Z`0@> Y # @ > Y@ Hax  > Y`0@I G  > Y@ H 6`0`B >`0 2C4 `2?4  24 `  44 `"04 ",4@`"(4 "$4` @> "H!x` > Z`@  > Y@S H 6 0`B < 0g 4 )% `  `@2`2> c @    > Z`H@Ӑ ѐ” > Y@ H: `7> )` ! 2> )@ ` <"` ` 2"` "  `<"`` "``  `  "``   2`> )#H > Z@t8 `> )#H' 2 ,쀤`*D#\` v 0`0 2 .2 @ (f 4`@4  @ﱖ$@`cH  `ݴ  cH ր cH > Z@s  㿘`   @ ?Ж*@ *` 6  2`' 6  @ @  ` .  6 @  . *` 2`6 ? @@ *6 ,  4 2 6  ` ** "`" ` ` ?  ` @@ ?`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @l &  㿘 @Z   "  20   " " "     2 0   " "  ``"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @    㿘 @    "     2 0   " "  "     2 0   " "  `㿘 @ H&& &  & & & $㿘$ @3@  $@m h> #4@4 0 㿘NN /" N 1> "ې  $h㿘N  1> "N /" ސ "$ @3   @-$@F /  ,Ð  8@$L`h> "H5> Zr7> Z2-L _@  ?Y$@h#R$ @2Ɣ  L ($ $@ @  hh$@> Z`А@$$@/> 4C ax ) @-> Z  (@y h@w("$$  ax   @> Z!0 (@` h@^(4@4, @4)  !$h$$  ,@ / 2-L  @4 $h㿘 :> "#> 5 81$ - ) @ % D ! ` $` 4  nc4 8` " 8ܐ $ 8@3ג  $h̀㿘&#p.$L.$MN $  @2  2N  / @7$V.$L`8`" ,J`h `h,@'$N .28LN .24LN /20L> "H%> ZL ax   @g> Z@!x> Z@!(@3 Q @ / ",.@$L .$LN`.2 LN .2LN /L > Z`@$@$@ /  > Z@a  .$M.@@3O `> `8`2&#p> #`> Z @`> Z@i!> Z@f!( d  "d㿘. cp " dL $ > Z`Д$@cp`h@s$ddM @1e  2 8l ``h,@@$dL 6cp1> Z@ / "*! @P$dL  &cp@w h@ "cp> #`> Z @`cp> Z!Ȕh@> Z@!(@2֒ - @X h@U cpL@ hi@J @$@2 dM  N  > Z!> Z!@$ 㿘#p`d ?> #`> Z @o`> Z@!> Z@!( &#p "d#p|$h&#p㿘 h@Œ`h   ?㿐!> Р#> > Z#\"pb $  @ > > Z#\!b0   @ > > Z#\#b@   @ > > Z#\!bP ؔ  @ > > Z#\ Кb` H  @ט > > Z#\ Tbp   @͘ > > Z#\!ܚb   @Ø > > Z#\ #b  @ @/> @-֬@(> `(`(  @Ö > b(> ":@ 4> a"$ 4> "#> "c4> "> "`""`"`> `""h"> > "!">  L" L"` x %ؒb%D ?T""*""#|  <ငp#  - Z %% %4%L%@%%%$%<*$8"$%%%% %,%0%8%(%H*"*",* $H* T!> !@"H"H  $!@U$!x$!|>"@& 㿘>V> Z#⠒ @& > Z@6"?  0  ?  0  㿘 $cЀ 2bʐȐ`0ƐbpĐbbct "b@%b`b"b& b?b"@&b&b&dcЀ Qc܀ Mb I@d@dcc@@@ @>c@ `0@@1@1bp@1 b@1 b@1 2cl~|zxvct "cl@$cl@-U ch@-R b@-O b`@-L c0@-I y> "p@ 㿘   @S  "7 L  , H,``* `H2 @"@,02`#P@ P @/9    @d @ L4 H`` $ L`$$ `" $` H  $ L$ $  "@&  H㿘`.`2 `H2@`@< @0`2`H㿘.`6``!?H@L? "L`"`& "@"" @0 0`2H㿘> Ȓt p* 2 㿘. > Ȑ p2`> p`* `H0 `@``H2@``L"`L㿘. > Ȑ p2`㿘 $ 2  @43* 2 & ? 㿘 $ @4 㿘 $  @4j  > Zb@ 0@ 㿘> Ȓ x* 2 㿘. > Ȑ x2`R㿘. > Ȑ x^2`㿘> !@ $ ? `" "` "`  "$ $ L $ @\ > @ِ# 2   > c>  "c$ " 㿘> !` > # > + a $ ? `" "` "`  "$ $ L $ @\@ > @# 2 %!㿘> !` > c w H /`  > H 00h* ! > a> > @ !" Ȁ #!J"a'> L $ 2 @[   @I   2L $3`" "` "` ? "$ $ L $ > ! `@X@[p  "@[Đ  ">  > @# 2 H 0%!㿐@|  ( !  @Yu! ! `` ''H /f * ' !@ZQH 0㿐@L 2 " !@ !@Y 'H /f * '  @Z'H 0㿘 2`$ `" `0 `$`,`$?&`,@``0  &`0&&`4 㿘 `4 `0`$`" &`4`$`,`$?&`,@`&`4 㿘`$@ `$ "  %`( `(@ `%@ @ @ `@ @ `(@ `*@ `,@} `-@y 㿐`0`@@i`@@b`@@[a@@Td7@N cx'@G d'@A d'@; d '@5 d$@1 d('@+ d,'@% d0@! d4'@ d8@ d9@ d@@ d<@  d=@ d>@ d?@ dA@ dB@ dC@ dD@ dE@ dG@ dH@ dJ@ߔ 㿘 "I `4 "E `0A > "䀦@@< 7H /` * ! `$` &``,&`$``&``(&`,`0&`&`(E&`ې``( "@-a &`(&`,P&`4H 0 (> )#H'@u ( " ,@-D  ,  & (*  @+  & (   $  '> $ (* "@" @$ " " " #H > Z@f"㿘@* 2 8     㿘N " &@@(̐ &@ @(   㿘@,1@> 3"> )cH ' 0" P@"|;0'@"v`U@"p`@j`&&@@"e0 0 `W@"Z 0 @"T0 T  2`Y@ G`Z@F0 @C ° 1`>@`<@20B @"50;`0@,`/#@0j @"( #1`;@`:@`I@ `G@`E@0`J@ 3$`@ `@ 0D   q1`;@5`:@h0  W@"e0`'@"_`@Y`@`T@S0 20;`0@ `/@I0 @E0" P0B @>0j @; I 1`E@ `A@%`<@ +`>@0)`I@"&`G@03$ @ " `J@" D # @"   D    !> @. h!> @.x hH /` * ! 04 @ " > 0'@"N`N@  `@!>  `@ `@%>  Ͱ `*@ > `&@>  ° `+@>   0 \@ " s>  @ ">  V`U@ >   @" >  @"@"  @"  0 2@> 0`Q@" (@T@" e  `S@"@ 0 @"N s 0 @"L0  Y@ " 8 Z W@  0 `@  0 \0" O@   P0 [@ >  O @ 0 J1@@ ",@0B%@ " <0;/@ ">   )@|-@ 0 /1@" ,   @ % @ ",1 :@ ">.  ;0j @A>   @"^.  >@,$(H@ "0,D@ ", B@,$(F@, ,3$ @ "O.  J@ ", M@& 0 ے @ "N. 8  @"6.  а @" ˰ > "Hh`> + ð  D ` hd  t D D  8`x  > Zb@i > Z*""Hh`> + D"h"tx  > Zb@W > Z# "   2  (8  `0@2  !> "p@6 " :$  $d 8 d@$d $cp$ch$cl$c$c$bm"p`$ `"$d $d `$ "  `T ` `@ch 2 `:cl 2 b4bȀ 2 bP.b` 2 c (c0 2 c| $L`@& " L` "La``  $cLa "$cݐa $c La` " Lana`* `4d La " dHca* `4d  dH " d: d9 "  d: ",d; d; 8  `0| " d@  d@ 2  d@ 2  d@bp 2  d@b 2  d@b؀ 2  ے 2 La  a@ $ct d  "d ^  "p@~ǒ " ~˔$  $d 8 d@$d $c $b"p@В /`ch 2 `ޒcl 2 bؒbȀ 2 bPҒb` 2 c ̒c0 2 c| $L`@$ " L` "La``  $cLa "$ca $c La` " Laa`* `4d La " dHa* `4d  dH " d: d9 "  d: ",d; d; 8 % `0  " d@  d@c 2  d@\ 2  d@Ubp 2  d@Nb 2  d@Gb؀ 2  2 La  a@ $ct d  "d  0S  ONx "   @ 2  `4 ¶ H&a|@B)0@  > #&  &> !a? "& ` ``    `" & 2O`" '@2G $@2BD &( 9 &tHyX "2E @B "(u p r "N " Nx`dJ` `@q 2Nx `@gx 2b`6&Ȁ  1 @1 ,@\ |ޔ *`* * @ R' " @/90   > c.`* &! @%2 >  L $ ŀ " !.`@/{t! a`  .` ŀ `* @*`@ (.`* &Ԑ"H|!@&0̀ !> > #@ 0Ő#8@# #8  $ "H@ x> "@ > #@ "H> + D!L!$!t @&ƒ 0 'K`?@ " J ` " `2      ` " `` b`2K 2K 2 K 2K "h K  2 @D "^ B "Z @`>K/7/  /BJ/ ,4@D,4@` `6 `/ @ &  @6F &0@$6H" `8  `2 2 &> #ؕ*#" > cX* c@&> #X*# &*> Ȓ@  (*`  &`Ց*` > ȗ* `( "  L ې" *` * &#8 `" " "@`˔  :c@:cP:cH:c`:cXb`2:c@0!@%>  L $ 2 ~ " H>  "a H!x`> Zb@^ > Z#!@%>  L $ 2  " H> "! H!x`> Zb@@ > Z# @> Z@"0}> #@ x > #@{" "  n {# L`$ `$ $`ܐ㌒@|- 0[> !$`@ @Ҕ  2 L $ 2  $`@Q @|0@> !`$`$`"!"`.!&@` >  &``2>  #&>  @ 2 > !@`  ```*``  z 0 @  > ! @ '   *  @Q  .&  "۰ & 8  $> #4+?   &ِ 2 0?  `B& 20ﴐ  . 8  $> #4?쵐 "#N   (@ @N^?    (@ߔ @N zx  u D@ @s$<mk D@ (8@0b$(_ D@ (<@0V$(S D $(@$0J$G D $(@9$0>< D@ (8@03$(0 D@(<#\0@4@8#   D@ @ $< , D $($8@G$0  , D $($<@($0 D@@#\#`#d$($4$0$8@ $< , D $(@ $0 xݰ D $(@ $0԰ ,Ѱ D $($8@ Q$0ǰ, ,ð D $($8@ $0, ,D@#\$($8$0$4@p$H@K@/$2   @!Ȑ$  @!Ð$(> > cX$xܐ#> #8@  @F  w$ @  "!$L  8@$ @#I d@$( $@$ @ߖ  @#7 Rw  @wϔ$ `@@#  ;$2:   @!d$$( @!_  @= w$   "!$L  $ @"  @>$( $@h$ @  @"ޒ =  Ԑ`@ɶ@"ϒ $2   @!$$( @!   @C> Ƞ wR$ @  0L` > !`> #d@  0` `D `<d 0` `4 `0d@`@à$> Ȗ (  L ``  @:> Ƞ w$ i@  " dd @"Q l@$(`$@ɐd  @N  @"> Y` G`@̠$> Ƞ (   @ @zі 9 `$ ` > #X> cX# %>V.` $ :`@R`` @#@<@"   > #? /   /  &  @ 6 > #Ԓ? ?> + D`9 w `0 "`p$&`0`p`t$@&`p"@&`t&`t`l$`d@  &`hy`h@ɒ`h"@&`hvW ͐Y` D̐/ &!|?0 > ?#   5"`t  t 0#r? - 0 `x` 4` `xD` `X  > !D?k 2 $`t 20 "o&d= k&d2 > @> 8"` c8" c8` Z"`@ڞX T @" O@" K@" F#8 `" ?" ;@! &@! @! /@! @!  @!  @! @  @   @  @   @   @  @   @  H 0@#hcH@#hcH > Z@ZU#0㿘> #8 `> #̒@?   >  "#  >  "#  >  "#ȁ$4Xd"2 䨀2<䬀"䴀"<  2"d"d  "d䨀2  ""d"  ""䬀" 䰀 2"""> 䬀" 䴀2 ""3 2"d"d  "d䨀2  ""d"  ""䨀" 䰀 2""" "d"" ݘ  2ld䴀2 "dd䨀"d d d@2""" "dd䨀䴀 䬀n"k 䴀2d2" 䬀  䰀 "2"""" dd "d䬀2 d䨀"d d d@2"""m 䨀 "dd䬀"d d d@2""" "dd䨀䴀䬀"  䴔 A"䴀2d䬀2"   䰀 "䨀2"""" dd "d䨀2 d䬀"d d d@2""" "d "2d2"㿘d2d@d =䨀 "䬖$ 2䰀" "&$ 2#$#$䰀" d"d"d"d"d`"&d2"d"dd"$d 2"$  $ 2$`dd" "&$2#$#$` 㿘@   @F $$&d&d&d &d`6$$$$$@  㿘  @$ $$ 㿘 @ $$$" $$$$2$0 䨀 $"$䬀"$$" $$$$2$0 䬀 $"$䨀"$ `㿐> > Z#\!c8$ؔ  @r > > Z lcH#\ \  @r > > Z!,cX#\ `  @r > > Z"ؒ @ ch  @r#\>  X *X>  + (> ("Ȓ @  㿐|  @ܒ ; @r "6 $  0 , @Q 2%  H /` * ! @`" $H 0$`" > Z@{Ɛ#x&$ P> )#H> +'D'P''L x  ! @ ΰ @  "ɰ   ð  7 > #  @ L 't  r ,  0 s9 ,  @    @ @   /〦 2 Z  /   //〦   @i 2V @ @/& L'  q , ? Lr ,LL`,`, ,@ ,@   H /`4'* !'@ PH 0 P@^P 2"@+  @@P L@@ > )#H > Z@VF#X> )#H'P' x٠  @  2ٰ @8 "԰   ΰ ̰  >   @z @9- 6* ' q ,  0 rP , @ @2    Z *Z`,ޠ , b'/ p ,  0 r# , o @  h @   2 Z /     /〢 Z    *Z"L'  p , 25  qߔ ,  `, ,,`, P  H /` * ! @  PH 0P 2"    @> )#H > Z@US#@> )H> +'`D'X\'`'H''P'T''x  !d@   @9 "     4> #  @   @< '''@j H p , 0qP ,@ ְ /@3   Z 2  . Z  '& L' /!`@   /@ 2 @Ԓ @А /& L' / '"` oՔ ,  `q ,``, ,,@`,@ 6P`2@P"@r '.* "H* @)@  /o , 2X   LpƔ , LN  , `,@ǒ& H /`4'* !'@n@@  TH 0 T@;T "X X"@ 2"P`"@@   @@H@@  > )#H > Z@T#ȁ`> )#H ' _8 @ l 2h @  "c $ ] W / n , B0p0 ,@   ဢ``7 @ @Y " / Z   /〦  Z " nʔ ,   `o ,`  ,`,,@ ,2& cH > Z@S#؁㿈 @  7 @  "2 $ 2$, @&% @w7  ''$3>''$b@ b$@  `> Z$ &@wߐ# 㿀> + D~ @  Z @ C "U $ 2$O @ I&@v  ''$' 'H /` * ! $3>b@A b$@; `  @ @d ` H 0  `> [$ &@ww  X> )#H'L' x   @ A  @ א "  L{ 'M 3 m͔ ,  0 n , Y @h  R @ݔ     //』 m , 2;  nה , & L'L`, ,, ,   H /`4'* !' @˔  H 0 2& L@ߔ> )#H > [@RE H  ?0/ ! *? !%` `0J 8? `88 "J(J " ? # ?㿈&@@uΒ   '$  '>b@) > [@v X$  >b@ > [@vv &㿈@u $#>'b@ > [@v` $b@ > [@vW P> )#H'@u `  @ //'$2`!@ `/`/` ''''$`!`    ``0&`$ @^H /* ! @ H 0 #H  @ *  2  H X  Y`H0`H H > [@QQ!㿘 $> * `l*  @m! 2 $5 . [` > [@  & \@  @t3! `` . 0. 1& 42  . 0. 1& 8 & < & @ & D . X !. Y "  Z . Z㿘 @ L 㿘 P`> @n]" [> * `l*  @nT㿘@ #> [`L ` @ "&`T@uka0$&$㿘    ~   @ǒ &`T$  $$㿘@   @ L `$"@&$㿘@`@`L`㿘 $#> H /`* !  Z . Z P`@mb& PH 0& T L `> )#H ',cH) ks , /l ,/『 ki , cHl ,, ,`,ݠ ,cH > [@P7!h㿘@s `` ..  "@?* $& "& "@?* &  ..    ?   *``"`  *`*`  & p> )#H'@s 0`X  $"$H /` * ! `Y`X `   4 В `0@ d H 0` ?H > [@O!p> )`X cH'$"$H /` * ! `Y`X `   4 В X`0@ ~ H 0` > [@t !?H > [@Op!㿘@s3 ,`&`X. `Y. !`Z  . "  `4 &2 `[`8&`<& `@& `D& `[ `\` @: > )@ ` cH'># * € Z . Z Z 2 `& L`"``&``?`&``j. , "`  ,&``?`&`HH /`* ! P   xk?  P k: 0 x@r @r  /kH 0 T@ '`i x ` ``k x` xU&` Z 2R `??L&`&`J  X # ` X `>" X Y> "w  4> `b" 8"  <" @"b`" " "  $"$2# ` \ `" \ Y> "T  8> `b"( <", @"0 D"4b`"8 "< "@ "D H > [@Nj!؁㿐< @ K @! > D #'? '> [@$ @耢  $ ` $$$$'`0 ` H /` * ! @,  `H 0`2&@ 㺨> )#H> +'D'L|  '' 6 3 i $(   j<$(  C@O 8 > `'8# 2Gd  @^ 96  @ "P$ $d'O D@q$cܒ "9$dȀ  @ "0$d$   '8@'  N "d'$dȀ 2 " d @ "$ d 8 ? $d$d'$(x$(  H /`4' * !' @F@h LH 0 L@ L 2" @ > )#H > [@M=!㺰> )#H '|l 'H ', * * h6$( * * ic$(K  @v > א#ܢ  d   ?@ "$ d ?$d$d'  H /` * ! @ߐ  H 02& H > [@L"㿘?2F @N ? @v 8 @> &1 #? "`%@s   d(g$( 2 0d(hӔ$({ `> [& "@q 㿐> + D>2 @  @* x @&q  'H /` * ! > #?A@ 8 5H /` * !  dg@$  0dhl$ H 0, 2 H 0$$' @Q `H 0`> [& "@@pz 㺰> )#H> +'D lR ', + f$(   h$(9  @( > #ܒ "d'd(ڰ$( H /` * ! @  H 02& H > [@K"p㺰> )#H \'|m 2 2 2~ '@T ), * * ft$( * * g$(]  @  <> #ܢ & d `"@* $d  @, "$ $d'd  2` H /` 0  * ! @  H 0 2'`2'@ > )#H > [@J"㿐} ; ܎ > 4 #'? $ @  $ ?$$$$' 2$ @Đ` `< $`<&@ $`D2& 㺀> )#H \' m"Ѱ  @ C ǰ $ "° `D " `<@"$  )>  &$ '#I 20d 4    @  $d'N ! @n'$ؒ$@}Q (#ܒ " $dȐ@۔  "d'$dȀ 4    @ʔ  @ n ;' e? ,  0 fq ,O ې "H Q  2 2;   $ L'` ,ʲ`,dĀ "d @ d `@$d ?'d'd $d<@ @ ѐ2& 2'  @ @ H > [@I"㿐} 9 O "4  D "0  <@2, > #'? d @w  d ?&d&d'` 2d @$ D2& 㿘> + D | [   "V `D "R `<@> L #? ` d @3  &dd  E 2d $ H /`  * ! @ 2d  H 0ې$`D2&2& H> )#H$'d? $ 2b$ @n \$ H  "''''T # L * "$ T Z Z ` @"L' Z *Z$ L'$ L'2 L Ɣ , $ $d&$$d$d&$$d$d&$$d@ $ d `< C  @s  ?@&$#H > [@H"㿘N$ '> [a@{I " ?N$ 2?$@l` J ``$J @ 2 ?$ ? ?㿘N /2N#N   / `J@ /  $"d$"@z N# ?@lGd:  N `d*N  㿘`@>  hN  > Ȑ ? @#$㿘@@z@  㿘 @$ 㿘> ﴐ#> `h$Ȑ  "`h  "$$ @` 㿘 $@$Ԁ 㿐`"`"`<`> .#$Ȁ` d? "d$$  ߐ@ > `h?"`h`$    `2 &$ $Ā "&$ @} &$&$ 㿘  @$ 㿐    H /` * ! $(@kN 0$X@kK 0  >$>$H 0&$㿘> !! > !!"@c   cD$( $  &$`@ "`@$@ $@ @ 2&$@  㿘 $@ 2$㿐`  % !$ "$@  $ "$@  $Ā "$$̀`"> `@?"`@y$> !@dp㿘$d@z @y㿘> ǐ#܁㿘$  $Ȁ 2$ 4   `@>  X"  $> cc" $> #@  ` 2  ` `Z `?"$$`B >$`B >$ 㿘$ \  $Ȁ 2$ f   @>  X"  $> cbޔ > $#@C  2  "  Z ` `@`> [@k" /`*,`@ $( `B ;$X @B #:` $ @ P 2 P> "@b!$ P P /`@  `B : P  @B;h> )#H' 8@i$(@y$ ``h@y$, 2($> + D  `% @iܒ$ 2&$Ȑ   В  &$$  &$$  `H > [@E"㿘$`> [@jr"0 &$$  p> )_?#H ' >  \2$ > #$ 2$ $Ȁ 2$ `?2@ 6    @ >  @  $ `B >$>  `Y"a `8`4&> "> "' ! bݔ `Xה `X  `Y``Ȕ&@$`B >$ `[D #`\/> ->   $X$@2 Y&@$`B >$ [" \'@   ؔ> Ș  ɀ  o > )#H > [@E#  㿈@hӒ  '耦'"$ $>b@,㿈@h  ''H /`* ! ``&`X &`\ 2``>$b@ ````>$b@H 0H> ) D#H'2'  E 2#  2 *  2``   D2#\*   @ cH > [@D#0㾸> ) #H `'`2 ? @2    ?h?P?X ?`  7b  /jf 7f p'L@QRL@wT  `2` `* f@ ``(7b7fp/j@d`@w9  2 (쀠x7` t?#Dh ` /hX 2*@ Y*$ 4 ƀ`"``   `&  X/d/eX2*@ * 2`X/iX2*@ * &`X2*@ * `D @* @'D. . . D Xf 7fX2*@ * `?X   h> #`F> [cH@g  > [f#Pb2` X h@`#\j;`#h> [#> [##lf$2 > [("> [> [####pdf` #ta"> [> [##> [##xi#|@g > [@g#> #P@ (  cH > [@Ci#㿘` \ 6`> #` > [ @fcH> [#@f> [@f#8G`?6` # cc /> > [!> [ 2  #2 c #@2` 2  2H!x`ǒH@fv   , L#@f’ > [@f#  2 H!x` > [ @f_cH> \ @f> [@f# 㿐!> Р#> > \#`8#\ l  @^ > > \ #\`H   @] > "#㿘'>  )>  $"#> $c@`; 2@`4  @ p  ? x? z? |7 ~7 7 7 ///?> #`q> [cH@e > \  , L` P`2> \` > \`> [ #> [#  > [#2 #\ #` "> [> [##> [##d#h#l#p #t> [#> [##x$2 > [("> [> [####|` #a"> [> [##> [## ##@e> [@e#'> @"آ -%> @ !>   @2  @t 2 , ,@t 2  L L@t "D  2 > #@^V " /7 @^N " "  <`<`<@<` p> <` x#4` z "4` |4` ~4` ,` ,` $@@^1,` @_L @]” l, +, K, k@$$@ 㿘 "  `@2  ` @2  `@2  ` " @4   ` @ 2  (  ` @`" @g`*  2 (!$ ` @`"s @g`*  2m !   ` @`"a @g` 2[  \ ( ` "R `@g*   `@f*  2  F@g%*  2: %@fې*  2  21 03 ``)`(`@gi  `@fŐ  !@g[%ܑ*  2 ܒ%  `" @gN`*  2 0 `@  2P   "" `  2  ` 2  `2  `2   `  2   2""` "`"㿘  @sj > c`% @"` `4 |` 4 x` l4 ~` 4 z `, `$ \, 0 ``2@ p> # Y> "H%> [)> \'> [? ? ? ? 7   ^7^`(7耊 * 7c & ax &H@c  `,` `L#\L @d ,@d0  @cH> \L  @c,@c0  2 `"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @    㿘 @    "     2 0   " "  "     2 0   " "  `㿐!>  > Вc#\> > \`!h   d@XД >  @"b,  @+> "ad> \@ ! $ > \@`!㿀> )#H'@aq  @p%> P0 H В @]   @p > +`D& & Đ & Ȑ0H > \@=!0㿘`"  ` > \0` > \0   &   &   & @`i!@㿘 X`" 6``> \0.  ?> #`F> \a`@` > \!h & $ > ?&  ?> #`/> \a`@` > \!@`> \@`ΐ!0#& @`+!  >      > <"0@   2   " ``"  @" ``2@ 㿘H /` * ! > ` 0 "`' 2$ > \@_֐! $>Ҕ$& P @! $ > \!@_Ȓ@H 0㿘 P !H /` * ! >  $`"@! @^$ & P; H 0㿘H /` * ! > `" 2" > \@_~!& H 0㿘 H /` * ! >  `""&  H 0㿘H o *@ a > `" > \@_<!@H 0㿘" \$  X  2 H        2  H  8 (    p> )#H $ ' >  !h@X4!" " H /` * ! > \b0@n 2> \!&$`L`L "k`HS @  ` $`T` А $`TВ@n  %`> \b8@n  % > \bH@n{  % > \bX@ns  % > \b`@nk `T "> \@_@_ "@> \`T@`Oh> \9"p ""`HL  $`Hd  "d  %`L,`a,``$@$`"@`L" & @/`LH 0 `H  { "`Lɐ`L "!h !h@XH 0 cH > \@;F"x㿘 Ā "  @  ` `  `  2㿘  > \ L H #> > \@^"$`@  T@  a`$$А㿀`> '`""( @4#> ``#> ``  `@&@`2` #d#\#`ad"( 呚 > #`> \ @^&a`"(> \"$@^s> \@^p!㿘 o  `k@`"d` `  2^` "X` \ P \ "K`   `?? ">`  `26`   20`   "    `  ` @  4 2`"@`@ `@``2@㿘> '> ,b( < *!@ > #`> \a`@] "(> \"** "*  @  ,> #`h> \a`@]| "(> \#@]ʔ> \@]ǐ!0[!> * *"!d*U!d@ $!d$,`"( 4 "(> * @*`"@d*` %"(@]ʒ ,,` `,`! $` ?$ ?$` $` $`  @  ? @? ?@4` `! 2  @ :@* ,@ `! :` ,@  (,@㿘 $ B `>`L :`H 6H /` * !  `"  "` L"  ?`@" "` " `L4  " L `H > "`H @V!h& H 0 $ ` `L`\`X" 㿘H o *@ a > `"H 0㿘@le h!> )#H'@l; H /* ! > "0 2 `H 0mH  Us `В @\`'ؐ''''Ȁ``@\ے `a@@\ؒ ȀG ?`  P` @\˒ @``@\Ȓ @> + D3$``` `` a@*` * *` `*`* * **@  B8@ B  ;$*`ב*`2H 0H > \@8#P㿘 H /` > K H 0A * ! > "0? ,l@0 2 @ > + D$  `АS Ѐ ːL  H 0& 㿘  N @k  @\N @ ?А @kY "  ?А   㿘H /` * ! > "0D? ’  $  H 0 㿘H /` * ! > "0? 8  $ Ȑ H 0 㿘H /` * ! > "0? "2H 0    `` *`"`` *`   *@ XXX<XX<[[[]]X '"/@0@ " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "@` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"@`` @" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"```@" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"`@ @` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "` @`> )d'p'LH\''j'Pn 'X@Zo7Lb #`#\LP@ 2ٰ ` :,`2   ˰ <  # 2@ 2Ⱥt/X7/{Ԕ{А7耥 7  mL 2, .`47  ZL 2@42`   7 JL y2(..2 ,4 ?@$@* 2`@7 ֔   , 2 @3b  *`2  ?*` 47   ?, 2 @3G z?*`2  L bm `/>Ԑ!@*` €Lb #`#\LP@* 2   ^t @Yt@Tt@Ot@Jt > )#H > \@5#h> )`\-cH@''X`R'\ e N Lp /آ`z/>  bH`> B:`Ȓ#u''@`3  `  -` -`$  -`( -`, -@z˒` bH!x`?> \cx@X  9> \@X#, $ 1 (   " + e  X` e      \` e     ( 8'\ 'X  e  " e 'X'\ e `>Ԑ!T*` €\zs  e\X_  e L    D8 A  =  9 5 ! #\X \@X$D`?\@X$@`?\@X$<@?"\@$8\X8zm e89\X  (\XU e $   8#\\\XX  #\`H8\\XX  8\X  2R yԔ            yӒ e -@ "@{'@@#\ zۚ 2 > #` e  > \c@W}   > \@Wɐ# > )#H > \@4#X\> )", cH '07`D`E#d"h@#\"j#h`@#t#l#`#pB > #`'> \ @WAc"j> \"h@W#> \@W#F?`DyF6" ;"p`D #\#`   "",?  2 "`D""Ҁ """В" @` X@Zz""?c 8" 7ހ`27`Dy ހ 27@ H > ]@3 (㿘> ""t> b4 `<"@@6"@> @U 㿘`N "p @D  > ]E H&"` @X6 0> ` !>>>ؒ`lX㰘  @& l&!x&!p&!t. h&!. j@R&@Q D u@J @H /f * ' > tt`&"d"d"bh"t&"h> "4.`" H 0  㿘H /f * ' "`> "4*`" "d`""h"h"bh"h?"d"$"d$"hH 0 @SF@  㿘H /f * ' ! &!!` ` &!&!"`!?&!H 0 `@Ɛ 0ځ㿘@  @2   \"@2 \2 \ P\> )` d H' `` 2d;o?> "4*` `"h `D c@Vp @  =d8// / /''''d?''d' '8``(@e| d:   "$   ''ܐ#?''d d''/ 2 `` 4 `@*`4 ``B <```@ 8C <``D @@H  H > ]@2@ P㿘> @TH!X㿐`s >  "b$ @  "dg #|## 0##Ȭ# D#P "cP"cT`> ]``#\ (  @M &#|&#&#&#&#&#&# ( &#x.#8  5@Đ <� 6#,> ]h @V> `>ڔ>>#t`  %ܞ(&!t>&!x&!p. h. j& l&! `X&!@-x&>at@-s>b@-n@Q'@Pb> ]`x@[  @I > "!T 㿘@.t#@.r#> "`@?@I"@Q@ېH /` * ! #  "d#@ђ # 2#H 0@M#0@ 5@ > "!T ሀ    " ᐄ ᐁ㿘H /f  * ' `@H&! 2!H 0㿘   @  >  @M!&@   㿘@U !`  &  !> +&  &  & $` & ( & , & 0 & 4` *`2`2`. 8. 9`"*`2`2`. :. ;`$*`2`2`. <. =`& @ & D & H & L` & P & T & X & \` *`2`2`. `. a`"*`2`2`. b. c`$*`2`2`. e. d`ț222. . . . `̓3 3 . . 3 . . ` `'. ` `&. @c``l M$ ` D" 222. . . {. Ǜ2 2  `2  (+` * @  . . . .  D@. . .  .  D"@2 2 2 . . . . ` . `. `. `. `| ! .!L `2`2`2`. . . . `42 2 2 . q. r. s. p`82`2`2`. t. v. w. u`<222. y. x. z. {`@* 2 2 . }. |`B*`2`2`. ~. `D. `E. `0    . i. h`0 . j`0 2`2`2`. l. m. n. o. k`L2 2 2 . . . . `P2`2`2`. . . . `T222. . . . `X* 2 2 . . `Z*`2`2`. . `\. `]. `H    . . `H . `H 2`2`2`. . . . . `d 2 $    . . .  . 2 2 2 . . . . `h 2 $    . . .  . 2 2 2 . . . .     . . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `ґ* 2 2 . . `.!`.!㿘  * *  *` @    > #`> ]`@Rʐ  > ] * * *` @  @S > ]@S  v   2 > #` > ] @R`> ] @R> ]@R `^ \  * *`@ *   >   *  **` @  ?> ` > "|$ :> $|*@> #Xc؀` cЀ  ! !"> !@K\ w    @@V $ L@O  H@J  D@E  @@@ ( P@92 8 4 \@2 0 X@- , T@( ( P@# 8 `* 9* a@  @ : b* ;* c@  @  < d* =* e@  @wH  h0 hR`0  L`H  $ $ $ $$  ($ ,$ 0$ 4$ 8 9* @4  : ;* @4" < =* @4$ ,' %,& @$ D$ H$ L$  P$ T$ X$ \$ ` a* @4  b c* @4" d e* @4$ ,' ,&   *` *  * @ $` `l * +   *  $`J  > + ő*  Ɠ*`@`D* ǔ  `D"$`$`  ɕ* ʓ*`@ *  ː c * "@ # $` Ȑ ɓ*` ʕ*  ˗*`D @ @ $` ,`   ,` ,` 4`  * 4`!,`!JI,`  *` *  *  @$` p q*  r* s*`@  $`4 t u* v* w *`@  $`8 x y* z* { *`@  $`< | }*` 4`@ ~ *` 4`B ,`D ,`E k`2 `0`"  i 2``0 j*` l m* n*`@  o* `0 "  *  * *`@  $`L  * *  *`@  $`P  * *  *`@  $`T  *` 4`X  *` 4`Z ,`\ ,`] `> +`H` 2``H *`  * *   *`@`H "> + @ $`,`$`d$`h$`cР cԒ` &cЀ &c` 4`v  cА?7&cЀ `?# @`4`@e > lHo  "`> @Ob`?# @4`&   >  @Jt>  @Jn``H`"`0> @Jd `0`> @J^ > !@JZx> "x> ȖaTB "x`:"x`\ @b`> #` "```B <`B;` ` ; B;` "``B <` ,    : ` `B <` @( @K 2 ` `B x<`  x(`B l:(  * @ @6'x8`B ]:8x8`B Y:8 > 'c/@^   / D?> #bx @ ဢ*` > Ȧ * @ ` 0`B = 0J@Cܒ `+`ܖ  JŒ@㿘H /` * ! V J* *@ ` `*` `*  *N@  ` @ > !q[? 7 q 2 `w6 ° '>   >  nƒ? n{ 8  `2` 2`w  2  H 0 㿘H /` * ! 8 > > "Hbx%> ]` 8x` 8x` 8 x` 8 x`  " x   @N> ]@O1 > ]@O. `P`B <`P   Ѳ@H 0 㿈H o *@ a "  G`` *`` * ` * @ u!' "  `€  @ ɒ  @H 0 㿘 D  8Z    /`.`(` 4& /`G /`.`(`' 4  .`. (' 8.`. (' <(7 @(7 B/ D/ E2 \ 0" \0 0(. (( 0@&  \   ..`/` L@& $.G..`/`@' L  .`. (' P.`. (' T(7 X(7 Z/ \/ ] H0 H(. (( H@& 㿈H /` * ! @ `> > "xbl`h +>  '>  #>  F  *` *  * @ t' 4 € @   '`> #` > ] @M~`> ]@Mΐ!(> ]@Mː P`B H + H  *` *  *  @$ L  * *  *  @$ P  * *  *  @$ T  * @4 X  * @4 Z , \ , ] 2  H`"  2` H *`  * *   *`@ H " > + ɓ*` ʑ*   ˕* D@ @ $  , > + @`$ H`B @ b`@@vH 0 㿈H /` * ! @r `(> > "xbl` P  >  >  @ > #` > ] @K`> ]@LC!X> ]@L@  P`B D= P D H I*` J*  K* @ rW' 2 @+` @  '`2 D6 @ K   *` *  *  @$ 4  * *  *  @$ 8  * *  *  @$ <  * @4 @  * @4 B , D !, E 2 \ 0`" \ 2` 0 *`  * *   *`@ 0 " \ @@( 0J` 1*` 2*  3*  @$ L 4 5* 6* 7 *  @$ P 8 9* :* ; *  @$ T < =* @4 X > ?* @4 Z @, \ A, ] + ` H`` ) 2` H **` , -* .*   /*`@ H "`_> +s H 0 1*` 2*  3*  @$ L 4 5* 6* 7 *  @$ P 8 9* :* ; *  @$ T < =* @4 X > ?* @4 Z @, \ A, ] + 2 L H`" L ) 2` H **` , -* .*   /*`@ H " L> + M*` N*   O* D@ @ $  P, > + @`$  H`B = H@Ho  %`> @b`@@H 0 㿈 2> "xC `` *` *`@ ` *  '쀒@@ m @p 2` X`B < X 2 @  @Ր 㿈H /` * ! & > "x CI``*``* `* @ p' 2`X`B <`X `r2° @H 0 㿈H /` * ! & > "x C`` *`` * ` * @ p' 2`X`B <`X `ra2° @H 0 㿘> !T#`"` `  "`X >  !>  l,` (?@L!@L @#@"> #`B> ]`@IÐ > ](!> +`* `**`  @@ " #&#@#&#!> "  @ɣ? $"> c > ]`@I > ]!@I > ]@I 0> #` > ] @I`> ]@Iܐ!> ]@Iِ  㿘H /` * !  @*``@*` * @ H 0 㿐 *  **` @  >    > H /`4'* !'  * * *    ,@`   !* (+ ) * *+   $+` %@  "( &* + ',  #*@    02 2 02  02`2`2` `  `. $-`, . #. (. ). *. +. %. &. '+. . !. "ad     -* ` *  .*  *`@ `` 2 `(  H 0 )>  !*  "* #*`@  ad ( )*` ** $  %+` &+  +* '@  *   @8`H 0 0#` > ] @H`> ]@H!> ]@Hߐ > xX`B :X> "x 0@: 0 > "x 0@: 0?㿘@ h> )#H>' 0  !@ 8c$8!!@ , @i0!@N $HH /f4 \* ' \   @6 \@0 ?6 \@!c@@!c$c$cH 0 H /f4* ' (  ((& l@:@,& lH 0ٰ В @Hvb```0@W c4' c8 'c?'° @!V ?  H /f4* '  8 $c4䀢  H 0 ,c8$cOЀ $b`  ?*  2`4@!> $H 0| @I0 2  lH 0o `l@ b` g l@ g8$b`@$b`  ?*  2`4@!  $b``-8c4 )c ]@#Ґ"0㿘㿘000000.`.`.`.`.`.@.`.` 666.` .`.` .` 㿘222222.`.`.`.@.`.`.`.` 42 2 2 .`.`.`.` 82`2`2`.`.`.`.` <222.`.`.`.` @* 2 2 .`.` B*`2`2`.`.` D.`  E.`! 0    .` .` 0 .`  0 2`2`2`.` .` .`.`.`  L2 2 2 .`1.`2.`3.`0 P2`2`2`.`4.`6.`7.`5 T222.`9.`8.`:.`; X* 2 2 .`=.`< Z*`2`2`.`>.`? \.`@ ].`A H    .`).`( H .`* H 2`2`2`.`,.`-.`..`/.`+ 2`2`2`.`H.`I.`Jn9.`K2 2  `2  (+` * @  > +.`L.`M.`N.`OD@.`L.`M.`N .`OD"@2 2 2 .`L.`M.`N.`O Ő`R.`P@F 㿘000000.`.`.`.`.`.@.`.` 666.` .`.` .`  „6 㿘 *`#P  ` *   2* ƒP "#T"#P `*`#|"#?`"`&#"@"""d@@ #|2#`&#?##`$ "`$b`2`$&#&# (&#x㿘> !T<x (8\ @4D  ` , @   > G> `B <xp`B :p <x  @x `` <@> B<"x p`B ; p|0 < `< %`x%` >%`` (@.4 4 ` `@F ,`z> *`2`2`, , `#>z |`- `  ( ,d?` "`$ "$ $` @>_ @?s| @EΒ -2   2 ,,,, " `>C@$#?`c   `@@ $ 0 $ $" $$@E -2   2 ,,,, -#P3> `a-*`    `€@,   #P "#T"#P@Em > ȓ*`@ -,> Ȗ 22 2,,,Ǒ-D ` %`x %` %`@7D`?%`x%` %`` 2 ($x@U0"`B <` 8B <   $@Eۚ > x``B :`xx`B :x ($x㿘> !T> #Ȁ`> ]b@@ܐ  d$4`2  '`   6  \ @ €  #x (#@ @V . ǁ㿘> !T> #Ȁ`> ]bX@ c "C ` # 2> c bdc@9 bd@=F  0 `: .`: >6 # # c  $c#ca|# c"@$c> !p@> lHo  "`> b@ 0 㿘> !T> #Ȁ`> ]bh@Z @w ` "`$# ?"&& #?$# ?# @`2@  "d     @E "d@>㿘H o *@ a  H 0㿘> !T> #Ȁ`> ]bx@ #` > ]`"  @`2`> ]@Cl"㿘> !T> #Ȁ` > ]b@  b \ @^ € ˒  € " #x ƀ P@0L (2 Ɛ#@  ƀ  6  > ] > ]  '`` ǐ . #8 :   `@@G . @C"Ѐ` > > + @ "@ `> lHo  "`> @$b㿘"` 4 \ @0> +!> " @&#@- $"> #`( > > ] @C&`> ]@Cv#> ]@Cs >  l#> ` #`(, !@EL?ؒ@EI`@_  @ 㿘> !T @;bd , $ $ $ c| " cx`l ($ $c$ c"@$ccx$cx> lHo  "`> @b㿘> !T`2 > ]@B}#  ƀ ,@ܐ0(   > ]  ƀ  > ]@͐@ > lHo  "`> @|b0 @BM#H㿘> !T> #Ȁ`> ]c@Ӑ  : \ @6 €   € "#x ƀ (0 (2 Ɛ#@~  ƀ   4> ] > ]0   > ]  @v0 @s@8 0 @B#x> )H> !T'> #Ȁ` > ]c@  cH \ @ؐ@B   /ْ 7/@QӐ'@Œ cH > ]@А#㿘> ȓ.`!@ *`>  !T` > ]> ^> ^#`(@A(cx'.`> ^ H@A #P`"`l (cx cx $cx& #T & #T"$#T. Ɓ㿘 > Ȁ  !T> ]> ^> ^#`h@A}(> ȓ+ @ *` cx" #cx `+  "`+   "#T  ? "& &  . ƒ cP cx?#cx㿘> !T E 0 $#2!# " 4#x l (#x 4#x $#x&"#"&"#"$# $& $.! .! #8 > lHo  "`> @Qb` $  $*@& $> T"`$x"xbb "b?b""b"b`$*"`$x"x㿘 0@A !2`2`2`.@.`.``.`:-  $@!d222.`".`#.` .`! 2`2`2`2 2 2 .`(.`).`*.`$.`%.`&.`'.`+!.`,㿘> !T> +`@#$#>  L$##$#> c  > ] @@`> ^@AG > ]@AD @G #@< 㿘 H /` )##@. 0,* ! # 2  ŀ 8   #@8 `  `>  L$##p "&##Ā2 &#&#@  H 0㿈> !T@A > #Ē   //> +7'c`@/" '@. 㿘# `  &##@   z 0!> "&# &#@t? $"> c  > ] @@m`> ^@@ > ]@@ 㿘> !T#x l (#x{#x$#$#xu$#> T \@  > T2    Ā  㿘H /`* !F H 0㿘;㿘`    *   > "x @' 㿘> > "c@>!t㿘" @h  @ @C$"4" 5 @^ < 4"$"$"4"@7$"4"> ^В @AM 0> `>>#Ԓc>   $!x$!p, h$!, j4 \%$!t@($>c@ "@;Ő@; D @3 > # "#$"㿘H /f * ' @9@<> c" "cⴀ2ⴔ?""$""@Ⳓ 5@Ⱂ H 0 㿘H /f * ' ! &!!` ` &!&!"`!?&!H 0 `@ 0ځ㿘@ 㿈> 0  a@. a@" \a a@" \  !@" \a@P  0!@6 0 b  b w`@{  G(w (&H /f * '  l :@@aH 0W  @?lb'b 'b67 F D@!V 2?6 28H /f * ' @bH 0 $b 4b $b \ b  b `@6 \>   `B :㿘`.6 66`* +/`) ) ) ) 000(`(`(@(` ./ (00) #) "/ (00(` (`!6 6 6 /`.. ) )) ) 000(`(`(`(`5> +(00) !) ;> +(00(`"(`#) *) +(`((`)) () )(`*(`+) ) (` (` ) ) (`(`) -(`,) ,(`-`000(`(`(`(``000) ) ) ) `000(`(`(`(``6 ) 6 6 ) ) ) D`@` &.  ((000/ ..) ) ) ) 6 6 6 (`(`(`(``d `ń(`@&> X&/  ((7 7 7 `...` ) ) ) ) 000(`(`(`(`) %(`% ') &(`&`dJ) '(`'㿘 &` > # @"  㾨> )#H`\' @2 [ 2  ?  8 I ?E 6B ?? ? ??@ 0@= B?   ? ??@o @=g B?  ??@XH > ^@ ؁㿘 H /f4b* 'b  a  &bH 0. 7bd* @*`b`@0 0> bp@ bt@2bp`B :bpbd`bhB  >bp &bd@NH 08Ȣ@=! 0@= 0    F    >   @  㿘H o*@ g@  H 0㿘"@ΐ" ";  \ @4&"> > +`B :"f> +* 22** @> +*`" *  * 2 2 2 ****D222** * * `(2`2`2`** * *@ @ 㿘` @3  2 `>  7`B i: , b<$ b4 b* $ * b@@4 4 @% $  @4 , , 4 4 `$, 6`$ 3 *` 2`  2* 22  + 2`3 ?# 8#4 `D   `@*`4 `D@. ``B <``` 8B <`   bx@<  > # B: ``C <`㿘> ר> א"b @ѐ&@* 2`@, 2 @   *`2  ,`* 2`  , 2 @~  ?*`2  "㿘`    -   > # @   㿀> )#H0''@=0b$@ b#@40"@ :#H%0 "&@'0" @!0"(0""@0"!@  #H 2 @O &  @] @g #H > ^@ 㿘  @o  2"   " > `""`" " 㿘> !? "$ "@"" @  2㿘> ! "  @J.` 2 2  > "  2  㿘  㿘> "#(> @9X!!> > "!"㿘$x @  > ^p  @; 0"?>>>> !̘!a0T%Ԇ   !& l6 \. h. j&"&"&!x&!t&$&$ &!&! &!> Ր`  ` >.$( `.$) .$* .$,.$+.$-@$L@6U@5@Lx D 3@.M H /f * ' !> @~#(` dH d`2dH&$H#(#(`&$$"d$#(&$H 0 㿘H /f * ' $`"$$"d$?$"$$$$@e$LH 0@Lk@6ڐ$4 "$0@ $0 "$8@ $8 "$@@  $@ "@ @  >  ( " $$2 $$.2$$ $ 2$$ 㿐!> #( 1`/ 2C #( $H  $ $H 2$ 2$$> ^@:ؐ!  > ^ 0@:ϐ!8  $ > ^ 0@:Ɛ! 㿘> #Ȁ`> ^a@ #> Ƞ%> ȑH /f * ' !` !` $a""`?"H 0 `"!> @ 0ݑH /f * ' !` !` $""`?"H 0 `@ 0݁㿈 > ^`    @q   ` "@    '> ^@:R!0 @ 2 > ^@:F!  @@> ^"@:; 0 ` *   *`  @ /> ^"@:'"80#@ @ߐ `   @ c` @  @ *  *`   @ X  "3 `Y0TJ> ^20LDE0GF@M 2 > ^"9  ې 21`00.@5 2 > ^"! @ @" 2 > ^" ' @#> ^#(> ^#8 /> ^cH@8Z `$'> ^,2 @  * ?2 c  ?!> ^@@8#X*`2 ` @8`0ґ,2 @ ` P ǔe `0_r`0`2 d$> #(`> ^@9N#h0 > ^#@9G`00 d8 "@$  @m  $d80$d< "d@ "@  @Y  $d@0r$dD 4d(4d* $d$4d,@ $dh " dh`\ > ^#@9 `0dh> `*` 2ے @dL0^`\dL@ 4d.`\ > ^#@8`0 $d$@Sdld@0IH@ dL`\ > _ @8ݒ`0$d$>  ,d( ,d) ,d* ,d+ ,d, d8 ,d-@ڰ $d8d@ "d@ک $d@d$d<$dD4d.$dl@$dp0`0> _> ^"@8 > ^" @80> ^ > _ 8@8@㿘> #(`   > _> _> _ h`x@6" 0@ؐ㿘> #(`S    > _> _> _ h`x@6ה#@, `> _@8j 0=  @r  2 > _@8] 02  `> _@8U!0(  %  *  5   * `D@ @) @   & `B<`@F0@}x> )$  cH'2\@p@  A A"$$@h8 2  ??耢/" d" c$(2 $*2$,2 \ 2@CQ$(`$.> _$$!P#\@7 0`? @6`$ !(&`( `$ C > !p cH > _@F!㿘> 0!an @   a@a@0 !p@{1!o@Y@!V N "$4@7 " $$ h  "l$$  l l?@8$ l$$ $4  @x  $$4@6!  @׸  @E$$4$0 " @^  $$0@6!, @מ  f @Eɐ$$0$ ``0@E $4.$4` @E"$0. $0` @E"F . C $$ &$.&$d&$h&$l& $p5&$ -$$ ( '@O$L$$$$$d$$h>  ,$( ,$) ,$* ,$+ ,$, ,$-$   l?@ e @IP㿘 @  `   @u( `2 @   $  $ $ $ 㿘$$ ` > _@5I!$0  @6; $4 @63`@Ő` 2 g 7 ,  , , , ` `:*@*$@*@  , ,$0`  : ** $ * $0-, , $4  ,  ,  : ** $ * $4-Ĕ ,  , ,  ,$H ,$I, $J, $K2, 㿘 \ > _!@6N 0$$ L  "$d00!> `*` 0 H /f* ' $d  &$d \@  @H 00}*`" * <  $L$d \?`&$d> _!@6  0$L@ H 00aH /f * ' $h  0&$h>  .$( .$) .$* .$+ .$, &$$.$-&$h " $d \ > _!@5Ӓ 0$d> `*` / @ ِ$LH 00#@ " $h$h \?`&$h> ^#@5 0$h> `*` / @ $LH 00@5㿘$$ * H /f * '  &$$&$h  >  \ > _! 0@5|>  *$L@ @ H 0㿘H /f4$$* '$$    \ > _"@5U 0$ $(@$.&$$>  .$( .$) .$* .$+ .$, $8 .$-@# &$8$@ &$<@ &$@$&$D@6$.H 0㿘> _ 0@5""0 $&$$€>  .$( .$) .$* .$+ .$, &$$.$-㿘$$   $0  @4l $< "$D`@$D `@` 2k 7 ,  , , , 4`, ,  , ,$0`  4, , $0,, , $<  ,  ,$< 2 ,$? , $8,$<$< $D  ,  ,$D 2 ,$G , $@+$D$D  ,  , ,  ,$H ,$I, $J, $K[, 㿀> )#H'{  2`0 7 *  * 6`* * * *  ??"/ c2 /*****`? @3`!p  #H > _@"X㿘$$ 㿘$$  > `  $L 2@4s&$$@ 4㿘@E 2$$ )@E0* @  2  `B >  * *$. 2`*$/ * 4`* * D @% ʐ@E 2 㿘@45   `a"a " " " " (" ," 0\" 4`" 8    "  "  " " " " (" ," 0" 4" 8 㿘   = 2; H /f       * '   2 0`" ` && "` ?& `" @А  4`& & H 0 㿘  5H /f       * '   2 0`" ` && "` ?& `" @  ?& H 0 㿘> _"h@3+> _@1"㿘``< ( "?`  4;`  8+ @     d 4 2   (  @0   B<    4  2 <   @(<  < <   4 `,   8`0& `,€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (㿘!> ! 2 @@:! 2@> _@2"T     < 2& <K 1 @А 0@2 !     @/E <`   <  ?  ? @/3< ?<   @n< < $ ( < & <@U  1> !܀ 2 > Ƞ! `>`@ h @ j &!ܰ 㿘 H /f4> I* '> I 0  !Ā "  ! `!t " @-]  2!đH 0`> Ƞ! `>`@ , @ . 0> "!܁㿘 < > &`&@! 2`* @ *`@/&@ &` 㿘 ` ``  `  0 @0@Đ0@ !㿘@21  (   "$ !  H /f4!* '!  \!!H 0㿘N $ !> @D0"! 2  @/! 2 > _@0"Ѐ   0  0 @z0@0@ 㿘N $ " @20   0  0 @w0@0@ 㿘 `` `   @w@@ 㿘 `` `   @@@ 㿘     @@@ `! `29 `    * : "`  `02   ` @ `*  `(( `0 0 ``` Y `    * :  @"`" `@08 ` 0?` 8 (  ::8 2` *`` *  (( 2  *(000****㿈> !` > >  > А@1e"> b"b!`X-> @K@[  > > _! @!$@K@N " : 4`, @,`b2*@ *@ b 2`* @ *`B2*@*<  ;@ @ dd+ 3`@+` b 2**@ b * 2`*` B 2* *@/1%!> @1 $"㿐@: 0(@(b2*@ *@ b 2`* @ *`B*2*;@ C0((㿘 x @  $ 0 $ ("$ $ `2$ > " $ 2$ > "$ 2$ > "$ `$ # $$ 2 @0"@ 1!+ @4  $    <>    * $ > _"@/$     *  * *`" $ )c$ *  @?$ $$ 8@J;㿘@p 8@b   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿐 0 # (@J& 0 <"@<* "@ *`"  @*  " * @/ ?`$ `@Q 8)< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @Z "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@-? H`B > H P @ ; B > P 㿘(&@ $ @r@  , "P  * : D 00;9 `5? ` (` (  ::8 2 *!  *  (( 2`2  @ @2`2`2`**** 㿘@`  ` "&@"`` ?&`" 2 "00   "0@I< 㿘> "  2  *$ 2   @g b $ $$ ?$b@.t* $    ?': &  2`,$ `` 㿘 ? & > b2 "b@ 2@"@@ޒ  㿘`@ `1`  @,`': .@``, 㿘@$  @""@`$̀@"&$$Ȁ@"&$ȁ `  `(   (  ( 㿘    @ " @  $@$̀"&$$Ȁ"&$Ȥ`  㿘` @ 㿘`&`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@`& H`& L`& P@`& T`$& X@ & \@ ``\Ғ `㿐@- "&     H /f * '  >>>"`#\#`K H p@㿘@-f 2a    @A%%@,B & a$$$  㿘  2&  R$Ȁ`"$$̀`@ϒ  㿀 "  ܀ 7 ,`    a``,``2`a"{     `   @@@> _#( `> _#P@,[  < @"4`" L @"G 2E ̀ <?  <  2  >#h D#\ #`#d  @ >  #\ #p #` #d #h #l@Ւ2  ,` ""$  <  "$Ȱ 㿘  "#   "  @ $ @ * @ 2"@ $̀"$$$Ȁ"$$Ȱ 㾐6   U ܒ  !"! !& 㿘`   $> _`0@+#x@G) 7`4. 2 `$Ȁ 2& `@9 7`@ 2   `$  $ `C <`B> >  7㿘 $@  ` $ @& 㿘   `  $!t @ @&Ȑ㿘  , @  @ , $  2& 㿘 p    @˴ آ`@*   @ˬ \$@$`L 沒$`P$`$`"$`@@,a$`<@$`$` $`8$`"@d"` @"%6$`d & :  $`,$`,`%+2  $`($`(`(h$`$%!2  $`0$`0 '$`T    2l%@,*#而 @ @+y@`*"  d@+q*  = @$`\"` H /f * ' . ` @ $`H H H H 2 H& H"@$`H`P `@'`<$`D'`@@`  ``` "`@ @S"H 0㿘  H /f * ' 沒@+"& & 8& "`$2  & ,& ,$2  & ( & ( (& $$2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@$^ @*%@     $ @+g $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @K`H /f * ' @T`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ `9 @@˜ @˙ 㿀h@(! $4  l4  `&` &`&`&`&`&` &`#t@*#* #m&`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \> #``d#d#ht#\#l#p Κ &`> _@)R#0" 㿐`   @C`? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @/?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @ & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ 㿐@C       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l m  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2> _@&K# `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @)Ր & `&@͐& 㿐@BJ    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@P 2> _@%#` , @@?"@ H "@  ؑ* "  *`"  * " "   @)G & `&@?& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,    < <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$` 5<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@L`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4&   * ' *`%   @(  & &㿘 @ΐ ` @ * "㿘   `@@{  `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h> "  pВ@ "?@  @ ?/! l @ @& l& p $  ԑ* `@& 4& @  l   > `@_@a㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0㿘> `@# 㿘` 2 d ` \  `8 `"`&`"` & &  㿘`2`  "&"`  ?& "`@z@ 㿘` 2@} \2  ""@"` ?"`" 㿐@% "&     H /f * '  >>> #Ěb|#\#`͒ H p@㿘@$ 2a     @Ð!$@& a$! $   㿘  "  & @~ @ @! @[ ` `">   ` 2   @  ".  ܀`( @  2#  ܐ $#\#` ' ' ' ' ' ' ' ' '@o؀   㿘  "  @  ܀  @4   @  ܒ  !`@ I! !& 㿘 @ "  ` @    ` 㿘` @ 㿘  "   `@@ 2    2& 㿘\ ?[`  @!  @ @& `&! 2  "   "`  " k& ` ` 88 8   4" $l 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @     @# `*"  d@#*  b &   "` `!@  `  @e 0 @u&      @      @     @D 0 @T&  !(   @̚ "   " @* 0 @:&  !h   @ &&  $& & H /f * '  $? $*@  "   2 $?* 2" @2 H 0 !2$ 2  $`2`' ` 2`"`H 0 0- " @ "    `2   " @d  " @^  " @X   "@R @O  㿘 "z   t H /f * '   `" @ " @2`  " "` 2`  `  # ?* @ "@  !"!H 0@e! "    `2   `""` ` ""`  " @  " @ݒ  " @ג  @Ԓ @ђ   2    " 㿘`   $> ``0@!͐ 0`4@ "`   " `` 2$ $@w$ 7`@  !!`C <`B `@ H "`?$`К` C :`B<<А@Ж"0@B<0`  @   `@0@0@㿘  2  $   & @vG?  $  `"`&`"` & &  㿘 ` 2@o 2  ""@"` ?"`"  㿘  `4 `B >!`! ; @ B >!@u  ?" `?" `2`  """` ?""`2!ؐ  @+ @㿘 @ @n! &!㿘 @㿘[   @ 0 >   >  > >!  >!  >! >! >! @8 4 $ 8 4  >!>! 4 @ 0 0>`@ C > @  @ > 8@㿘 4 @ 0 0>`@ C > @  @ > 8@֐㿘 0@ >`C  @ > 8㿘      ` !```?&!`"{ X ! `"   p t@ H p@B* 2` 2 !!@2 > H H8 > H!( L@ > H!(  !(@B:2 > H:` : p  H > B   (@j!(2 !!,2 !!( @ b >!(> !    &!> xa&!a &!@> P !h   (@: (@T ,> X> ` X h@8  X2 h \ l@( h X P2  T"  @> P   b`㿘    `?  ( >` B > (!   ?`?&! " ,  H 8  H  L  H:@@j b !(@ (  x@ b @ B  > Hp H@8  t L@   Hp x@ b B> xp> H@ !!h ,@ ( `> Ȗ B"> X Xf8  X2 X \(  X X f `@ B B > `> X X h@8  X2 h \ l@( h X P2  T"  @ > P   2t (!  : h??PT  8P2Ḁ (PḀ2P: h㿘  @ѐ "" 㿘@| a  ""@ @ 2" DD8a "a "a  a  a   @  2! DD( !!""! "!Ā 2 @a`a a aĆ?a""a"aĔ`]@`@ @UD`DP  @ 8 a2 DD8a # Đ? "" "   ) `&  ?`@ 2a`DD(a "  ""a""a "aĀ`2`@    @ ` D `"`8 88 2!`< <(!! 㿘  @ "" 㿘@   "H H 2 LL8"!"!     H  2! LL( !!""! "! 2 Ha"`a a" a?a""a"a`]H`HX 2`LLP! H 8a2 LL8a?"a ""!"! + `(  ?`H 2a`LL(a"!   ""a""a "a`2`H!   P 8 !  T ! 2 P 㿘> ! 2`* @ *`@* 2`  㿘. 6` .`@b2`* @ *`B2*> a * @ڔ  㿘  (0 (2`*  >  2  @Ĕ >@2?? 3`+ @+` 2*@ * @ >`   @  @# , 4`@@4   >`@ ? c @} @ * 2` @ 2 E>`   + 3` +`* 2` 2    @s >`   ?? 3`+ @+` 2*@ * @^ >`(:: @: `: `: `: (` : 0`(: 8㿘 2 (q(  B : 2(@ 6@(,@@ @ YB c   ?,4 ??4 @4 @  @ * 2`  2 @ D@0B@c@b8   ?,4 ??4 @4   @і  @ʒ * 2`  2 @ D @ B @ F 㿘 2Z  @8T    B & @@ !@c, 4`@ 4   @ ? c @ @ * 2`@ 2  @ E @ &B @c@d, 4` 0@4 @r ? c @h @ * 2`@ 2 @  (E  @ B @F㿘@` @``$@p 2> @k> h> _@]` F  r  `@ G 8@2>@  @>> `> `B> (d4, @,`   @b     B 2 ,( , @ @b D,4@4  @ ? c @ * 2` @ 2 D> (>> > 㿘@&`& ` "& & `& ` & & & ` "& & `& ` & & & ` "& & `& $` & (& $& (`(> 0`0> 8`8> @`@> H`H> P`P> X`> `a& a& a& `> h`> p`X> x`h> `p> ``> `x_> > > & ` & ` & a> a> a> a> a& `` & `` ` ђ `  `?(    (   ?( 㿐@t "&     H /f * '  >>>!`p#\#`- H p@㿘@H 2!    @# T & !?" " "   㿘  "  & @^@  㿘  "!  8  ܀*   @2  @s 2   ܐ   @q 2 㿘  "  @] ܀  @㾸峒  @J ܒ   @!  & 㿘   , @ " @  ,  㿘` @ 㿘  4  , @"   `" @   ,    2& 㿘.`` # H /f * '   `@H 0  `.`  .` @L @  @G & .`` "@$`" 2  "` "  "`& & ` @4$` &W&   `4"` $l 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @q    @ `*"  d@*  Ő &   "` 㿘H /f * '   `" @   * "  @ *` * @"# ?# H 0    `  @C @@  㿘`  ` `$> ``0@L X@m& 7`4@ 2 `  2& @m 7`@U 2 0`   $` 8`C < B> 8> 0 7㿘` ` 7 @|3 / * "&  ` `@L `?$` ` 2   $  `B <   ( @ ; B < (ד* 㿘  2    t & @m"?    `"`&`"` & &  㿘 ` 2@J 2  ""@"` ?"`"  㿘  `$ `B > 0` 8 @ ; B > 8@lԐ  `2`  """` ?""`2 0㿘@&` & ` & `& ` > `(> `0> `8> (` & 0` ``ג 8`2  &  ( " ( 㿐` @C.`? ?*@   .   ` 2 㿐`   + >@(㿘> b ">  "bb> "> ` "b@ې  > "  㿘@8 > `@ʐ 0 > > `@ 0 b""" """"b㿘> Ȣ"@ @֒ "  2  $@ > `@ 0Ő㿘> " " @ "  2  2 㿘@㿘> b  > "  #$t@    F $   b`   $ 㿘> b  > " "$b @   H   $b 㿘P    & & & && & $t , 0> `@'  㿘    G㿘!> " > `> `@ 0!@ " > `!%>0#> `@C "> `> `! !( @  @b@a0  㿘@+6㿘" @!㿘  > ఀ@"  ఀ`   > ߁㿘@  @ @ "  JK2 ` 2"  `@2@㿘  !> `@!8@    2> )#H'@ ɦ  > "$'l'p'tv/x    @ #H> `X!@`t#> %> `!> `at  t EHC!``@  f`t `Ft@ @  > `'!p> ax@E x0@ t /x@p p> > "b"( > "( 'p@ e@Ґl t> `!@ @ b2#H@ O ?'lt `t@t "& pxlt a> "$`> " > "$>  "b(N@ 7#H> "(> "b$#H > `@U!㿘N>0 f`?@0ȁ㿘N>0 f`?@?ȁ㿘>0@ !ȁ㿘N>0 f`?@ȁ㿘N> H faa`?   #>0@a㿘N> H`f >0>Ґ!`?@(㿘N> G`f >0>ѐ!В`?@}l㿘N>0 f`?@?ȁ㿘N>0 f`?@?ȁ㿘N>0 f`?@ȁ㿘N>0 f`?@ȁ㿘N>0 f`?@ȁ㿘> B#(`> `> `@7!0@4!㿘@㿘>0@6ȁ㿘`> 0 >0@*ȁ㿘>0@]b!ȁ㿘>0@>!ȁ> Ɂ t㿘> q h㿈> b0> b('> > > "b$#" ",V#b0> b, )> `'> %> `#> !> @  "$ @#$ @@ bHX h> ",`> ""0㿘 > `@̐#@ !> "0 -(> )#H'@w > `)#@  *@k   > `@a  `@  ` @ @  > `!@#> a @@ &H` В,``` "@#\#`#d#hĀ   @  > `@d!H > a@ߐ (㿘@~L㿘@~H!㿘@~D!㿘@~@ 㿘@~< 㿘@~8 㿘> ="D' a@! 4   @ D`  @:`L "D@ D` @  @ ߐ 㿘>0@˜!ȁ㿘`> a H> a`x@       ` "`> at > ao `2 ` * @ *  `0@9@   2 `",`0 @ * @*`   @  > a @! 2  @ > a @  2`0  @@ `0̰ ( `> a`> a  @@`@*@@ \?&`> a @  > a > a!@{ 㿘   2 *  *   0@ )> a  2  * @*` ` @  2 0 `@ ( 㿘    @ o  *   9 "2  @ -"@ '  02  0  2  "  02   0"   * 2""㿘 r 2@&@&`&  㿘 [  1/ '> !(*  ``" *`  +*(` `  / *(*(*( &*(*((@  @ *}}x,~}}~}x~~~<@hL㿘J@ !> ɐ"p@^ x" "p@p> )#H'𴆿 cHL  `Ĥ@ H  >0 @ > a@"!8> "b `1>#\*` €      > a!@@  Д    @ $> a!P@|Δ  > a!X@o Д    @ > a!P@ҒZ  > a!`@ŒM  > a!h@@  > a!p@3   ^ > a@!x%> a@!   ^8> a> a@!x@! e  0   @@ "L@L`@66cH> "b$> a@!pN> )#H`'> *" "?* : `G*`> $ €>0@  <> a Ж   > a!@4 .> a Ж   @U> a@&! > a> a!> a!@ > a> a!@ > a  ^8> a> a@ !x> a@!> a@!#H > a@!ȁ㿘>0 @ _> a@!8@:    (+  2 2 " 2+J " ?㿈@ # @ !> > a=!> aa@! > a a@! > a  !@a > a @@` > a"@X > a"@Q ?'@  @F쀢  > a"(@@מ0@?'@㿘!>    ?> "" D 2$"$㿘@  > !@  < > a3"8 > " > "( >  "  > "$ > " $ @ @ @ > aR"P@k > a"PJ @^ 㿘@\   2> a6"P  $ 2> a'"P Ӕ $ @6㿐Ӑ / 0=  > a "P   > a"`  @&'@ '@?'@? π ̀ @ $@㿐 % @? !> a  "P  " @'? @Đ $@㿐Ґ , @?  #> a!> aĐ bP  "p * 2 @'? @ $㿘̐㿘>  `@R70@@ْ@#@#`㿘> aJ"`"> a" А  *`: ?Ѐ4 L@: @, L 2 ` * : ? 8*`N *`:  -@,ˠ L  > a@ "а a?N`_2 @,  z$?> a@ "؁`> )N#Hs'2 NЀ /> ɶ /> ɰ$  `V  ???'Ġ  #> ɔ$ , `2  "8 v* c$)>"'Ȓ!@ ߔȐ' e'Ȑ!@ Ҕ@̀ J@ :`$J@   ?  $J 2  `e> b4 "b4ВN@,6 ?`#J  L@   @ * :  "`J@ 2 @ +* Đ" 'Đ _* Ā z`'> !> %> aL@   + `  *`: ?+J 2 "8 $"84"8@  M`cH > a@蔐"d0`ddD`㿘 N@+Z  a "@$a> a a*`: @+7.@!`"@*@ې a !֒"@ !"$!㿘!> %>  !#> Ӑ"! aΐ"a$$!㿘`~>#!*` €1> > !!䀢@ ( @* !?&!1> > !a耢:ܰ @*J! &!> > !쀢 ͪ @* !a? &!ð > > !耢  !@*J@!!  &! > > !쀢  J   o a쀢@ J  0> > a쀢 \  > > a耢 0> !> a耢|" I y k 0u> !1> !` m J *!@*~*@*| !@*yJ!@*vJ^ > > "@@  "#> b $"> "'> ɐ@%> +> )> 1> b  ? $"$""J`b*"@b"?` @$"$"a$v%!"?` @$"`$"a"%!J`e `a*@`#aJ  S!> > ""@  J@ > "> b?  `  "#"" ""J "> > "?@  $" $"+> ")> a%> %!J`  a*@`#aJ  !$a!d"@ > a#^ 1> > !!耢@( U"@> ! ["  > > " +>  )> 4'> a!耣@  K`"KK@@2K> "> b@!   " `@" KK"KK@" K a!耣@ !`$"+@%!Y a!耢  #> "@> Ʉ" *  #"$"* $ !$"* 0%!> > ! @)= % ^ >    * 8 *!`$@)"%!!"@! ƒ"  㿘@> > > >   "!"a""@( @ !*!a"@P<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<\dl<<<<<<<<<<<<㿘!> "x x "x > > ""p" > x> >  p"!> >  > p@?J@`"> Ɂ > Ɂ 㿘> c "c@ 㿘> > "#"c㿘0? ?߀ ] ?Ѐ ` 0 > #  O o T  t X   x>  # > "" S$ /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ??Ѐ  ? ?  _> ae#x ?  ?  _ \C >  \ !S ?2,> aG#0,> "p %> a#> aB? ?  ?Ѐ  _ \ :2, \2 ,, ?2,!0, c@0,H `??*`>&!4 €> <   .4 0 . , * ( & $ "       <   >  > a@#X?㿘> >  c@ > #@@y @@$@'T @'M `@> $㿘> aJch ch#>  %> aL@'8 L @'% c"$c  q c  ?c ?$c $c  $c Lx  xL@' L m 㿘> #` > #  ??߀ ] !> @&> #> `"#@ c@& > c $# "c $cc'$# @&ې >  > ɐ > " ""c !> #> #c@W# $c > c "c@& > Ɂ㿘> #> "@ > a@ِ#㿘> #   > a#> a# > a #> a#> a#> a#Ѐ 6" @㿘!> !0  > a@#0> b$!0@ > b>0 ! @H"> b@ ($!0`> )cH>  > "Ȩ '@ :A> '> b@a̖ @   @p@̔@ @ Ā>  > b̀> b> b H@X Ȁ    z > b@K P> b@H X ` @ ǒ> bXG`cH > b@⺐ `㿘@;  " @ ? "  " &@8  >  `& & > &@#   &"$ > b? "b> #`> b@ p> b@ x    " ʔ  㿘> #     # ﷔ > c #c# ` L  $#L@>      Jp"  > > > > > > >  "# ,#c"" #"㿘N> p`? 3> 5> 7> 9> >  #&c ,&& '"㿘N p`?3>  ;> > 5> 7> 9> > &c  ,'b&& '"Jc>    > > > >   ,"#"c "㿘>  > c> b > b @f0`)> @> b>  t` t$@%#@    2> b%#@H ؁㿘> ɖ#$ @   ``+``2`` > b$+`` #`"`""@ !@?㿘> ɢ#$  , @ " @? 2  > b!(@0 > ɐ#$,  "  "  # " 㿐@7 > !8@* *`` :*  **`'􀢠!8㿘@ 2N    @`?㿘@ 'D @D  㿘N  %> ɪ#$L : , ` ,`@`"`@Ґ 2`` :`,> b!XL 〢 :@6 > ɐ#$,`@%>   @W `$`@  㿘@L`@ݐL  2L@ 2L` F> b> b!x@E0!@A㿐N  %> ɪ#$L@ :`,@  , @`" @e 2   : ,@> bK!XL@ 〢 :'', > ɤ#$$ @)> b'>+`" `@!8@3`? 㿐>  | `  @; > ɰ#$    @Ð  ` `  㿐> ?> ɦ #$ '"c   @@:` %#`` &㿐 !> &@#@ #&@&8>  > )cH ' 8ה->  @ ) @ &> b!ƀ   @   > bƀ!`cH@  > b!ƀcH @  { > bƀ!cH > b@ǐ!㿘> c@L㿘> c@U㿘> #   㿘> # €㿘> #   㿘> #  㿘> #` `@㿘> #   㿘> #㿐 ' >  '> "X A> #` > b@!>  > > b@! "> b> b@""X@" "X 1>  &"(>  ` > b>0"(0!Ȓ @9 > B#(` "> b> b@x"8> b@u"@> b@r"o"X 㿘 *> b> >  Р`  #> @a Р *> >  bȀ #> @a &   *> bk# 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ 㿐I > b)# > b"#; 3 > b#0- > b #@͒2  @ "@ 㿘> `܀ ">  "``> !X> b "`@#H > "  ܝ㿘 > > b@#`0, @˒ "   2  > b 2  > b@#0 @#p0 @$ $$ $ > $" ԁ㿘>   읒 "  8   @ $@0   2> b@\#㿘!>  > b> b@Q#0@N# > b#%> b#> c `  @;#  㿘q㿐  gbq㿘㿘> `Ԁ  >  > "  #>   8  `X @  2 $ԁ> ʁ ԝ㿘>  $ > "  "   @: 8 8    @* 2` > "  h> )N cH 'h"  l b> c  > c   ն?+> *)> ~>0 !> c     @!> c     @̐| 5 Ք 2&> c힐 (&%" %b$H > c@ @<㿐` ?`>/ P*` €> ɐ[# > ɐU#> ɐO#> ɐI#> 3"`> А #1> #'@ 2_ "\ 8X &#U > 3"` > А#@H1> #Đ'@ 2= ": (&#4 2 > ʐ @) > #Ā`> 3b> 0 `0 > " -a< ` l @ @ז  -  @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*@*`*`*`@ * @*@*`*`*`㿘Ĕ㿘  @* ` * `  `(`  @(`  `(`  @(`  @* ` * `  @* ` * `  `* @ * `  `* @ * `㿘 44444,44444444`?> )> c cH '@ ?> c ;> c  7> c 3> c  /> c $ 2 ( ` '> c ( 2 , d > c , > c 0 > c 8 > c @ > c D  > c H > c \ `> c@a &`4 &`8&`4&`0&`\ @#@ > c&`4@P H`h  @@  @6> c&`4@?!H h  ` h a> ᜔&`&`&` &`&`&a&a&a&a  &a&a&a.`.`@ @ @@@ؐ?&a'''&a,&a4.a8&a<&a0&ap&ax.a|&a&at'A ;ܰ' H€ 3> ʐa0a,@U> ʐata\@M> ʐaa@E> ʐ #\> c> c xa@a,@> ʐ! > c> c#\ aHap@ ' H€ H > c@!P``""! 㿘 &!@, d@* `H /l * - !? &!>  > c*`" `*!@ޒ  > c!h@w H 0@a @^ h>   @ 6 >  4>4b   4 `@ 0 2` @F   @A   @<   @6  `> )#H'' @ ^  ' 4 H€ 0 İ?cH > c@؍!㿘\@ ? @ : ~ ?  &@@ 6 ( @**@``$, @@  2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@  2(`@ * %`*`$ k``4*" &``  &`(`@ *@`2(㿘@ ,`@ @  2 @`@  2  @ ''@` 㿈  >4'''@~ > c@Y! 㿘` "> c  "> c > c"> c> c  !!@!> c@7! 㿘 0 4" T &@ L` @ &`   @K &` `   㿘 4 P  0` 0` @ 㿘> ʐa ?  2` aȑ* @ "0 ! " 4*  2!%  ` `$!`  ``2  @@{!? $!@S!㿘     0    0 @@~ 㿘> ʐ! ?   2`!ȑ* @ 2!(  "!#  ` `$!`  ``   !@ !? $!@!㿘> ʐ! ?   2`!ȑ* @ 2!(  "!#  ` `$!`  ``   !@Ĕ !? $!@!㿘> ʐ ?  2` ȑ* @ 2!*  "!%  ` `$!`  ``2  @]@۔!? $!@̓!㿘> ʐ! ?    2`!ȑ* @ "% ! "!  ` `$!`  ``@” !? $!@N!㿘> ʐ ?  2`  ȑ* @ "%?! "!? ` `$!` ?`` @ߔ ?!? $!@!㿘 `$ @Đ @  ? & & B&  . 9@& & & & (& ,& 0& 4㿘 4ڐ h  =   t x 0" Ɛ &  "  = "     0"  㿘   @v"*  :  "? &  &  x&  t"@&   `<  `4€`0 {&`X&``&`d&`.`.`&a&a$&a( `<  .`< `<  .`<2-a `4 h  `0``4  ha`0a > ᜔&a&a&a  &a&a&a&`&`&` &`&`&aa > c` p> c@!%   @a'a'a'a '`'`'p`'|`'t'x//.`.`&`l&`@  2`4  `4 @`0&a(.`<.`=㿘H /l4 4* - 4 4  !( " 0 =  0€ H 0㿘H /l * -   4&! `4 0€ H 0㿘L݀  4 y 2B0 @a$@"@ " @r @=0@2@@: H /l * - $$@H 0 70 H /l40* -0! > d+> c b*`" * > c  $d! @3ἰ`$d 0 > H 0㿘> ʰ !ȱ. @ 4H /l * - ` 耢 " !(  40,@". 0@ 0.  `&  逢 "`N ܀ 2 4H 2  4``" 4@ 0 4 ,@ 0. `@ 02 <`  < = `. <. = 2 <`2 &!( < = `. <. =&!(& XH 0 㿘> !Ȱ . @`hL9  a(  `= ` H /l * - `a "@ %> c?``> c  $`` ! @Ȃ a`$``  3`a "@ 怎H 0a@T`@ ےa@J@Ta @$a `  0H 0 #H 00H 00yH 0r #H 00jH /l * -  *!> c `耢  L` @J πԔ" ``> c  $`` ! @ a`$``   ۰ai` "& 4 4 & $ $ $H 0a`0a@@ϔ `  㿘H /l4 * - 耢   `  `@ݐ & ` 4 0@ 0.  逢  d  d@͐ & d 4 ,@ 0. H 0㿘 4`  ! h`` *`*` 2`@:`$`@X`  0 $ 㿘`2  ހ  > ʀ  !>  @#㿐 /// /    &@ & @ `>1"̓*` €   U * /  @  `.@ > )#Hp'!   `  cH @8 8@&@`   cH > c@"(㿘> !Ȱ . @`L9 Ȱ ` a  $aa(  `=` ``&`@ B >``2`a$ "`a$ a@: `@ B >`a@`"@&`a$"$a$``2` H 0 #H 00|H 00uH /l * - $@'> cؔ@`d> c  $`d ! @[ a`$`d  $@a`$ " 4  $ $$ `逢`$`L8  @@ H 0a@@ 2 ``0`  > !Ȱ . @!`4@ ,!@ "a!@ "[ `!@ 0c@" a_ @ "`8!"!@"a(T @C @L  b}@".!$@ "<!#@3 0: !@"!@ 000!@"b~@'% 0!@0"!@˰ 0 "$`X`X "$`X  `H /l * - Ɛ " `=H 00,`  ,` `逢   @Ɛ  `=   `耢 @H 00aa  `@ܓ*`&@ؓ*`&@&a` `Ԁ@Ɠ*`&@“*`&@&H /l * - a@`&```l@" &`$``|`ta@"&H 00H /l * - ```"@ ` : a@`&```@z" &`̐a@$`&H 00V@`S&;@\K' F `B@`0> 8 `<& €`03 \@`0  < `0€ #!$a(p  @< `=`'@;2 0 \@`0 &  @㿘` L @` ` d@ @ƣ&@@^ X @ܒ 㿘> ʰ !ȱ. @ H /l * - `A!( 2  = "  ! @`0 @` `!(  =`2`2 !$ 2        @ L`@ @H 0㿘> !Ȱ . @ 4\@ 0 "9?X "5? @  /?L 9 2$ 0 , 9    H /l4 * - 逢  N ܀ @4H 0 0X @㿐 4`d !#\`d>> 0! t x l `(>> 0 t@ l 2 .  㿐N ݀ 2  4  @6 4  ``  #\``>= 0!    `$>= 0 @ 2 .  㿘 <  4` @4`` $`` $``(L`9`$`(`` >=`$` 0@0`"$``` @$%L`8 "`0`4$`4$`0!$@&!$ 䀢 '   `` "    @ (/`"@ * &  2!`  Ԗ` & & !@`  Ė  0``  ` :` `$``$@ D$` 䀢 &  @ ` #@@  @  (/``@" * &  2!`  `` & & !@`  u  0```  i`` 2 =`$>= 0`ᴟ@ " =ސ = "!(L`8 2 !(` ` 4!( !(  `  㿘 < h T 4 @3    $  $  (L 9 `$ (`d >>> `( @ 005 L 8 ` $  4   @ @  $ 4 $&`d 0   @ @ $ 0 $  $  " $ `d  `(>>  0@ m ` 86 `81 `   "`2`#  "`` 2` "`` 2` "`` >1(` "`  㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 H> )#H'.`"  4' H€ 0 26 4  '' D€ 0  .#H > c@̬"HH> )#H'` 4' H€ 0 "cH6 4  '' D 0€ cH 4@ ' @€ 0 cH@ԐcH > c@q"Xx> )#H' &     꾒 &  :  @"굒 & : @2` `2'g B[ ,'`4 '`D`0€ R` H`$`4  @2  ?'ؒ ΀ 03 / `4 '`D`0€ (`  `$`4 "`? 'ؐ "` "` #H@4#H > c@ѐ"h㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && h> )@ #H''Ѐ'`z ''͖ؐؔr` /' 4 '`D 0€ b`  \'ܖ`$`4  @2` ?'ؒЀ HР A 4 '`D 0€ 5`  '܀@ ''" , `$  `4 'ؐvȀ `Ȗ  ''` , ` @ '@'Ѐ  &.*`&@*. @& @"@.H > c@ "xx> )#H'2@I F ` 'ؐ> 'ܰ  `$`0 2`@ 4'@ 0"` '܀`' `$ @@`'" 4 2 4  @€ 0 cH@cH > c@ʰ"x> )@ cH' ` 'ؒ  4' D؟€ 0 "` "  ```"@`#H` ``@`#H > c@m"@> ) 4 cH`8' հ     '  ' ' '!'!'!'! '!'!'!@'' 耢? ' `8?"` ' ` ?" 'Ī` ?"`'`?"'Ȫ`?"`'`?"'̪`?'`ې 2`Ӑ 2y   .  '' `  "  ''Ԣ``? 2``   . = . = =` !(  `. ="[`t\@ 0 2 =` ?''' '?'''' =  0@ 2` `''' ' ''''&!&!&! &!&!&!& & & & & &!`t   l$?"$$`$?2$`t&`$$? .  `$? .  `&`$? 2>  #耢  *`*` $@ ` `"&$`$? 2>  #耢 ̀ *`*` z`$@ ހ 2$l $?  . `$?  . `? 2`#`!p 4 ? 2Ւ!, % `?!p#`_ 2??"`3 !,J 2*`3 !p`39 2 3 "` !, 3$ 2`!p 2`p?"`!  4`s '''/@؟€ 0 2`?" =   = "m` @ 0 2̰ "K`xH /l * - { 1  l" = =   逢  N ܀  u  =    耢  N ?H 0 2`x?  8 (  f & `|   ?8 Y & `x?2 `|?" `0   Đ" 4& `0 ` "( 0. `0 2# 0 逢 2 0 = " 0H /l * -  H 0 " 0+ ` "' . 0 2"  耢 2  = " H /l * - H 0  cH > c@DŽ"x> )#H 4`8' 2  !,&@!&`8 &`!$ &`! $ &` !$ !p$&`!<`k$!&``H``3! 4  '''D؟€ 0 2&`p&`p&`p`^!@ &`!@  $  ̐" &`(  "@$(!&`,$, .`0 ,0 Ԁ@ .`1 @ ,1,2.`2 <2  .`6 < `,6 .`7 ,7!@ &` !@ h$ !@ l$$ @!  &`$ @ &`x @ &`|&`|&`x`$ &`t =&`#H > c@" 㿘2!!  h @믒&`  @뫒&@ `" &`@ $&` @ &`&`  㿘 \  \2  &@% 0 2㿘 \   @  2 㿘> !Ȱ . @֒ 㿘> !Ȱ . @0!@ + 4 ! !@ "}@  0:@"0!@ 02    @*  \" "$ \# `8&@`H`D€ 02`@ € 0  `` @ 0 > Ȑ * R`   > ʄ"`8P> ʄ"`8D"` ʐ > )H `' `"? at? 9 2'ap / `? / $ "`4 H€`0 2ap  " '  H > c@E"ȁ㿐 4. > c@A""  @* !> . $!X@*` @ !X!>  $"` > c@鲐"!X ""@ " #@ 0 %> '> c !X(@ Ԡ?`> "!> cc0#\\   @ \@ \@$> aX*> )H" * '$ > c$@'H$@鞒   > c@f#H ̒ * * @ $ '|  v   @$@"H$  v   @r   $`@  $`h @˚   2| (@*'|  @  B @ @  OȀ : @@ dx`  2$@($$ $`H̀ @ @Ԑ5 Ȁ` | &!: @&  &Ȁ`"̀ " @ @ P $%  ""̑*` * :$̦* @*` *$  2 % $ q$@1$Đ"%Ȁ` % @o @l > )@g @d  (%  @l@j%   $> )#H > c@֐#h㿘 ̒  ,@  Ȁ #&  ̢  @        @} <$ $ <   "@``@  ̨E @ h$        ̒ * @` $  ̑*`  *  @ " @:  *ؒ Ȗ: @俐<<  Т *`  *   @ " *` *  *  *   ,`: " ` Ж*`  * *$ ᴒ$@ Ȑ@̨E  㿘? 2  > !2 D *" > aX*  @  8    ` * p `@ ` "  @6 ,` ` " l" h l$ l$ h l h $ p@1 ԁ㿘?2  > !2 *) " > aX*  @_  " "  h  l l **@$ l **@$ h l  h @ @$ p㿘 L? 2`  2 > * X"@*` `2  D 8  D(& <& H& 80!  `@  D& HH /d * % @H 00H /d * % @gH 0㿐@`L *   @`` `x B ̢@ D *  @ `D 0`P-#\@,`8``x "`x@ Ā`<  8@   x`"x@<  @ <D% ժ@@ 㿈 Ȕ  'T  *?      > >J2`@8@ `,`* @ C @ C 4@ 2`@(`@ oe : @e? Ȑ@    >  >J"?4 ?2  8?     ` %@  =  B?@p * @ @愐:  誂@ B  @ -`8* @ `D2  : @  " ? ? @!?,`*  "' * &\!@ݯ?\#$`8 @$8$`4@ $4E #Ȁ`> ccp@N `8("`D`D&`H`D`H`8" @۔ @fb㿘 > #Ȁ` > ccx@N  8(""  * @ଓ*`  " `> c # 8($ 8 <`" > c$ <#> c <# @t   & ఒ    " ఀ "  #> ` D@0a\a\@- H("> c@Ő# $ H㿘?2  > ʖa2 > *X" * @` >I>ה!  @ 㿘?2  > ʖa2 > *X" * @` >I>ה!  @  x? 2  > ʨa5   > - "X* 0b- @ '`  eͰ  e`g@`f@  m@  "@  0"@ @   h@"e`e e@ "Z` r s@) 0@@  m@ 0 e g@  f@O "@ 00"@ ` } #@v  r`Ԑ@~  l ' `''  @*   @* * J$  @ " 9 ,    @ & +`@  ''' "  ,    @ޠ & > "@X* @@\ @ @ @̐0> - "@*` Д &``&$`@ܐ`@{ @ `Ԑ@    `p*@  `h " ``l "`@ϰ  @%> -     ``@` @ `̀@* ``  `.`@``@ `.`  2``@ `@ `,  ?@$``@  @@a @̞H/ /@I@Β H 0u `Ԑ@  n  @! @`͔!@] @%Z `Ԑ@e  S@ݖ @K ڴ!F &`*`` =&`Ԑ@I  7`$``@ʡ 2`@2`? 2  @?`5# @ `* * >I`@Ca` @$` "  0  ` $` ?$` 㿘?2  > !2 6?*> " aX*  ` > 0  / " ?? *` ࠀ?? @ B > 0  d ??  @'''''ܐ @ < D  @p``@j , ``H@   @Z``@T 0H @K &   @E``@?  㿘`@!`   6p&<`&( &, &0 Q&4&8 > c6Hc@   6> cc @ aW &&6r6J&X@`? 2`  ?6   .  6* `>Ia@B㿘> " 2 ! ? > > c@ઐ#b b  @y|4  * > `4*@ 㿐> "`!> " `@z$"  @|  6 @} 6  `*`>   4*  㿘> "` > " > * `4* `@  㿘> " ">  l" 2  3  `*`>   4*    㿘  b@1> "   @  2&" " ">  l" 2  0 `*`>   4*  @㿘> "` > > "`" "@㿘> " ">  l"   2 `> *` 4*  (@  ,  € 㿘> "` ``@㿘!> "   € "  €㿘> " !> "?$""  € " $"㿘> "    >> )ch 0` @|  $h  @%  > d` @$#S ?  '''''@p H`  @9 ; <`27 @D 0 `- D'D @  D    '?'''''''`  @& D&@&@| @y'@u  V4 V V V V V V V| W V< Yl Y8 YH Y YX Y Y Y Y@ Y Y Y Y Y Y Y YP Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y X _@ _@ _T _d _ _ _t _㿘  @  *@E b,? }  ` ? 2: 2  3  *   * `* > @ "0?,  R  @ 렄? `*   $  `@>  `*@&㿘  D ` b,? &  ` ? 29& 2  2  .   `* > @ "0?,    @ 렄? `*   $& `@> ʰ&㿘'>Q!D!$ $@ᠤ8 8 $,` `  "? `,` Ĕ  6 :&%&!*  *@ * *@  *@ `@㿘  *@٦!  * a*@ Đ"* @ٙ㿘!    `@@!  @Y ! @;㿘 `"!@!  &!% 2     ``*c% &%@3 `@㿘H /d4* %  > d@  h0  `4> d   @  `& !2  !$ * *`@" ! @H 0㿘  4!` `H /d * % `!  > d   @ƒ !  > d@2  !$    ``8`8, $$ `4`#   ?# #   #  $# # # !  $! 2$$! @ !  > d@!H 0㿘! 2!> d@!8 2 > d@!X  @ "!> d@א!p ,  $,, 23! `"  $` `> d   # !$,   > d@?!$,$ &!&! $ *`*  %"  $,> d   @)! $,! 2&!> d@ܕ! $ *`* @" @> $! &! @1V&!㿘  ` @! "!> d@s! "$> d@m"&$$ *" * !, !$$@ " ?- ,@ a$ 8`8!,  2@    `@0&!@s! -   z> d @ݹ"(!%` &!p&%, $"&!   &! `&!&%&%&%&%``0  > d"P@ݔ $, &%&!&!&%&%&%   $! &!<&% 9b !3&%@2 !> d"@k &!! "  "  !! @& € "   耢`" @   >  #@ݔ# @T @N! "B!㿐! " > d@۩" > "0 @`> d]  ̀ @2T   2 > d"     *@" > d# @ 00   *@"0)> +  "  `> d#8@  * *@  @ ",?    ` Ք? > d#`@Ȓ U! 2  > d #x * @ /> d# @ܱ >! *, $0> d!&! &! &!!&!@&%&%&%&% *   $*@   耢`" @  0*"Ȕ@{ 0##@t !   &!*@֣   j &%&%@ Ė *@ *  @*! ?&!㿘a  `*`*@`*H /f * ' ` *@` *` $`e `? @ @ ] ` @ 2 ` *@T ` ` "`*`*@H 0ӐT *`*@H 0` `* *`*@. ` * (` @'a? ` `@?  `*@ ` `@2``Đ *@` *` *@`*`` @*0` *a `` $*@ 㿘!  Ħ * % @ %̢:<$@! ?&!%&%̢  @> ` ",? ɐ  `  ?   2   2 ` "!% 2 !   ``*գ%! `&%&!! 2A `$ % 2 !   ``*Պ%! `&%*&!> ` `%*  &%%Ĕ (: ``27 ``%Đ ` .`$  %Ā %Ő @$ ` * > @ "0? L  @ Ơ? 2 *@g `` 9>O#*` €]%  %   ``*#% 5% "9!H ` `& B!% !=%  &! 8&!%ƀ   > d#@ʒ %> e @Ē % 2 %   ``*%  &%  `4( % ` &!   ``*% &% * > @ "0? Ő  @ ܠ? 2 *@ݤ㿘 Ē ! *   *%` %%@zH$@%% &%&%%%  *  &%&%` 2&%>P *` € 2!> e( P :     2  .%       .% > e @(  .% > e @   %K&% `@N> ",J  `  ? 2> 2   28 2 %% 2 % *@* %&% >   *@ *"0  ` ?  2 *@ `4 % o` *@`"㿐!  *` /  *`// ///    M @` $ ,!%`  &!   ``*% &% 㿘!` @`> e<  Đ*@4 y j !  `> ʒb* @ > e @g 0[2   @> e! !4` ` U  Ȓ  @2  ; > e!8@A $! "  ! &  @) `*!   ܐ!! !@ " $!$!% ` $!   ``*G%  $%㿐 Ĕ !*@   > e& @!X 㿘! 2!> e@c!p2> e@]! m  @ @> e@ސ! % ,X` @> ʀ` "('> e? ! C - d ` ? @2   >P ,  €-/+'/#> e"0@؝!%`  &!   ``*% &%> e!@؇ `&%`")    @ " ! &! @ ! `" %      ``*ҕ% &% ` > e @S"X%`2 %   ``*~% &%`^``!> e`&!"p@6 ```! `> e" @% &!!% (`4>  `b,@L  `@" ? > e"@   *  *@ Ā`* *  @*  &%&%&!&!&!&!&%&%㿘">Y>Y@l@  ! @ @9 !㿘#| 8  >] L&#|#P#@$6#X 4 6#X#@  6#X#X#H*` ;`#P* ; *@ 2` @ #|6#t&#T&#L6#p6#r +@`  0[ >Y>[!#c$!t$!x$>Y!$!?`"4 \! $! "@$!$> e@ׁ#@@B@ 㿘#` @㿘#x  ""`"`#€㿘H /f * ' @ @9H 0㿘#D" #c,@ # @ 2#?i # @`2#?#`@㿘> e  @ےb АB< Ё㿈> )#H 8"4Z#D'# 6#Z6#\6#^, #F`"#8#8,#( H, #( ,#,, #E#0 , #4, #@ "# #$,#  #s , # #s 8, ###u, #<", ##, #D# A, ,@  ,#r 6#v##w, #D# , #E\! #0,#4, #`"#D@#D#, \`@ {@ 4\#H > e@#㿘 \ $@ @cZcX@2! \$6 \W !€  !! 2!!    &!&!$ !?&! t  2 D> e@͐#x @ c\* @cH*` c @_@+ <@*c\c`* 4c\`*`cX2  4c\4c\cZ`*`2  4cZc^`8b @ScXc\ "cZ> ecX# c^@ԌcZ 2c^> e@Ԇ#X*  cD+ c`,c^2* cq c* @, c,c, cDc , c^`*`cX2  4c^4c^ g4Z㿀"#D# B- # #v | #D# -  #v#r#T" #* @#v #w"#w#s#u" "@ ? !  * + 2 > e@բ##r #v> e#\#t##d#`@Ք(#r@*> f#t@ *2@\> f  @<` B> 06#v#w#r # #u-#v@2#v~#D㿘#x 8  "#D# ,@ # @ 2# ,@ 4 `  #,@ #,@# @ g`#Z b# @  # @``" `B <# @B<ࠒ `\ B ;<4\4Z#Z*`2 <6#Z#^ 8" @?#X#\ "#Z> e#X# #^@x#Z 2#^> e@r#X#`* #D+ #`,#^2*#q #* @, #,#, #D# , #^`*`#X2  6#^6#^ 5 Z`Bw<0"#`B <#`@0Ր0#D# ,@ " ##4#8 @ @ #< @# @2[# 㿘@ H /f * '  ! "(`\! L0!5@0 !6<A@- @ 4`\ 4`\ ` )`@ 81 4@  2 `\$`\ @&4`\" 4  `@ `@  40` 4 9 4 @̔"@ 8 4 `\ @ " H 0㿘. 8@[2 2  `B >  D`B >  @ @ 㿘 \! "6 \ `.@@6.@01`*? 6*"h @    \"6 \ `.@@ 6.@0 @2 2 @  *@ .@  2  ߐ \ =6 \㿘8 @'R  L.2 &  &  E,2 !   @(7(`5( ,`   ??" $@ & ,`2 8& 㐀 @$*`2     @&   & đ,0@(ɐ 㿘#P"? #H+ ?`#P > f#H `P@\   &#H 㿘#x  #`"&#x@ > f @B   &#x 㿘#x  #`@&#x㿘 8#`""@"@9?@ѐ@ "  * *  (2*0#L@"#N (0?  ?+@``(0#T"*0  *2 @"` ` `  +@  @`2` 㿘p  @ D*@   $ ##  @## (Ⰰ@ D  *@(` @ `?   "(`  @ " ``@(*(㿘" *" ` ` @"`@ " " "  $ " $ # #""*@>Y>Y@l@z > ʢ"4 . @ @z   . @ > f @( *@` > f @( *@`@ * @> f? ( *` ( *@@ * @> f? ( *@ ( *`@ * @> f? ( *` ( *@@ * @> f? ( *`*` ( *@*`@ * @> f? ( *@ ( *`@ * @> f? ( *@*` ( *`*` `> f   *@` > f @ *@` > f @ *@` > f @( *@` > f @( *@`@ * @> f? ( *` ( *@@ * @> f? ( *@ ( *`@ * @> f? ( *` ( *@@ * @> f? ( *@ ( *` > g @ *@` > g @ *@`  > g   *@`  > g   *@`@ * @> f? ( *`*` ( *@*`@ * @> f? ( *@*` ( *`*`@ * @> f? ( *`*` ( *@*`@ * @> f? ( *@*` ( *`*` > f> f @(  *@` > g> f @(  *@`  > g   *@`  > g   *@`  > f   *@`  > f   *@`㿘 $ (D !> @t"@t~@t"`( #$l@I$ 1 ` "` $`, ? "$ $  L$l ?`$ L`> "@ț0`   #@tk> g! @ !> 0@t_ 㿘  (l @5  b~@b}@##kf@"'ej@"!$ !#m@" #g@!#n0#o@ " 80#i@   #h`"  !> @s"@s@t"䀤` @    #g@P cf@C #k@`ce@% 0ycj@rcl@"6Lq 0#i@ "E #o!#n@4!#m@> 0_@10#h@# 0W` @> "``J> g> g"Ȓb@ 0B@? <$L@68@3@o.@)@%@V D 2  " @g "H@gH&L& $D$L$H@M@sx㿘 (`A !> @sP"@sN@sj"`( @`@s`  -㿘 (!> @s7"@s5@sQ"`@O @n `2`(?%> ` "` $`, "@" "@W `(2` @` ``H "`L@g7`L @g1@s (@pK L& ( 㿐> > g"b#\(  @И > > g"$ c#\  @Ƙ > > g"@s:c    㿐#d@J   L@ng P> g@s"c&``&`&`(`(&`,&` ` &`$@| 2  &`8 ` &`<` @P&`@ @o L0 2` 2 > ʐ"D""`(&, ?",`0?"`0`, @`0㿘@㿘@v@2 㿘@uk  "    0@ 㿘%> @r\ ``@rU@rq?@@m@rh&  0@rd 0Ho * "`㿘!> !@R""@N!& 㿘 `!> @e""@b㿘#> @rb 2 @r1b0@r@r*b@`8@ 2 > g@# `" ` "``8@@r㿈> @q"` '   `a8 @ & @q= "  > g> g> g#0c@`@˞"@qʐ@q`8 "`0  !@` `<@  `@ `?2   `2` @ ` a8-` @*`  @@q  @o@za8$(xU @ @qu` 2 @qӰ @qk@qT P 2 LT R@0Ā  ?$ L '@D   $ U @y ` a8  L  @ X@$ \ L @  `@$ d L ?$ L@qL @q&` @q>0" L  @ X  2 L \@x L ?$ L L @ `  2 L d@ L ?$ L@`0!@"  L ``8 2 L@q 0O  ?$ L  @p@pa8"` `"@O$ @@pА` * @pɐ@p`   2 @@p`  @p@pΐ U #\@Ĕ0 @p0@p0@p㿘`  @z$`0" Ho !"`㿘`  @y$`0" Ho !"`㿘> "``> g> g@#p`@c` 3 ` T@. @* )`6 P`*` 6 R 6 R`   L & L` "` L & L`& X` " L L @& L` & ` L @& L㿘 l`@$ 㿘ܰ  |  `    2 @mS Lܢ`@ $܁㿘܀ & 7`@x 2`  L@k @` ܰ * @ *`$ܒh|$  &@"``"`@m! L㿘@ "$>   >  l>  "``> g> g`#@c`#8 @f 2  7&`"``> g> g`#`@c "u ` @   "k   2 "d `@ "^  "` `!8 2U ` `"&` @&` ` "`& $ ?"@$ $ $$  $"@& $   `5$ `!81$ "`` > g> g`#V`c@ʵV` ` 8#  " ` @      2  V`   ` *@   L2  "  H5` 㿘> "``> g> h`#@t` ">  0 ``  `2` & D & H & L` $ @b` $ @b p>> ʐ 0b`   > h> h@ ``(@<``   " ''  `` ` ?''ܒ'''''@化 `"@&`㿘> 0 @q  9 `0@"`82 # 8@b, 2* @"`$   `!@@wג `8 > 3" 3@㿘!> @n\" "@nv"`h㿘'> @nR``2`@nj0"dx@nH@nd 8 `  <@  @ @nR0 $@@  㿘 J`$ "`@ko L$`$` @:  a ?86   (+h'(% 8'  ` (  L@i$$`$$`$` ؒd 2 `$`$ d&`  @k. L$`$㿘$x@̳6`  :  6 2-6+ @,& `   @  @ ё,&ҡ-H (  ("@H (@(H"H㿘 $ " H@jǒ L& $ H   ( H?* & H"  H ?㿘!> @m_"  `@mZ@mv"8 ` 0!@2   < @2  @ ` ",`lL`l `l @ $ $`h,`l@mN㿘%>  $@m) %   @m @m< ( H@ ,`@֮ 2`    h @֠ l " @m! @m䀥  &  ?$㿘    2 x  㿘> "`` > h> h  8@C`Xd  0Ho * "`#   L  ?& L@ ? L " ` "` $ , ? "& & ` "`$  ?"&&  ?$  `@d㿘`? &` 4?& 4``"@`@i͒ L@``"`& $`?@"&@&`> "$@`8"""" "  "  " `0"`H "㿘`4 @> `8 > `   2 @> "$@K! > * "``> h> h h`@LJ.` L@g  & @&  * `@& `4 `0`$`4&  $`0& &`$& `$"@$`$㿘6 &dx  &d|d @"@ `?$@@J 㿘\dx&dx7  "  "d @"@ `?$@" @," 㿘`dx!8  .dx +` +` +` +` +` +` @+`㿘``  &dx` @&d|㿘 $l`!   T 6 T2 &$l" "? 2  L   & L&  , &  ,"$ , L & L@k> 0!> h @<  ?` "  L  㿘` &`> "@v!> "`` > h> h` `Д@ƴ $$l`$l"` $x`?` 2 "@$  , $  ,"@& , 㿘> !@L"> "``> h> h` @ƌ` $$l` 4$v$  , $  ,"& , 㿀> )#H'''  @Ū , !@i `!@j"!@jR"b`B ? @I" ޶#H > h@!㿐 /. " * @fq  > > h@7! 0"" l  %> '> h  lH@k!䠄?a> ""d> haP#\   @ @{ @$㿘? 2  4 ` `*`4 g@ *  @+  @ 2` > ʘ "d3  u + > `l" * !@j  ih`!8 " ` < ] ! Y`!$@ 0P!$ d  ?d$!$ @I ?  2   * ` !$2 2  ` `  0/!$ !$*@$!$ !$$  `+ @ `" "   $  $     $ @j4!㿘@Ķ!a,&(a0&,a4&0N &8@ga(&4> ha`@  6> hap@ a(   6p&<. !W &&6H6r6J&X@֐?  26 @  .  @*@ @ 3  `@ `?@  @ ` *6 >kbt@%㿘?  2`6  `* 6  g *`  .  2  > ʰbd6  . ( > `l"* !@j   `"      * *@$  * *@$  !  @ @i$ X L? 22   ` *` N@ *@ *  @ 2`  2 * > "@l*` > 0$`  8 (& <& 8H /d * % @EsH 00 ( x2   @@" D 8 (& <& 8H /d * % @ENH 00٨ & H 8 (& <& 8H /d * % @E0H 00$$@)  4 DH /d * % @EH 00& H$$ L? 2 (  L *(  @2 B  @C  P' D'''' x B* 2@* ?''8@y$ 8@'8<@{ & < % P D  x |8  P D  x |'8<@{ & <  P D  xn |8 @| <` 8(& 8& HH /d * % @DH 0 H /d * % l ,?$l$H 0m L8 <  " 8 (& <& 8H /d * % @DOH 00ژ +      `(@ 2 B  @ @ E X5` 8-  8@'  H-`  P >`8'`@xl>`@8  ̘@|8 @| ?" @;`&@ *H /d * % > #@ H 0# D# 8 @# <# @`<? ?` # L# L< # P < B; x 4>m## 4# #  #  #  #  # # '#  8# <(# 8 H%"@& HH /d * %  8@ `x "`x@C H 00# |# HH /d * %  @@`@$H 0@ <`EJ㿘!l 0 ,@&!l 8@ `x "`x@{㿘 ? L N *`   2  2 > * "@l*` > #Ȁ`> ha@+  < " H 8($ 8 8@ & 8@B$ < H>  D#"@ $ H@<a  D H`0 8" @ al 2 Ha?$a H @C 㿘? 2`  6  * 6  *`  +  2  > ʘbd3  > + l" * @a$ >k>ה"t  @g 㿘? 2`  6  * 6  *`  +  2  > ʘbd3  > + l" * @a$ >k>ה"t  @gw  㿐  @Ъ ` `h@    㾘? 5 2`  *  * @ @> )H5  ',2 @o  4> d6 > ," l `h* @ e e@ "a$  r s@h > )@y  m@İ > ) e g@  f@ "@ > )0"@0"@ > )a$` @a  a@fV  `Ȕ Z `@ > h@|   > h@E!@e  @$a, $a4$a0' ''''$a$*@ $a$ @t   a$ $a$ @s f`<  ? 2 (2<  @ya$@    @t@eH < 2  $a( `@@xW  @y&a$a,` @ $a( @y$a8 @+ 2a$ * H H&L a$@    @th@eg> )  @` H$a@cϒ@a,$aa,|a( >a$> ʒ`h`0$a$$`@i$`L@eFݰ a$ Na@e  Ӷ  `*@  `  ` @e) @a @`Ha@bR @g`0H/ /@e@!H 0 \?"&\d\@ `L*`"  l* a$`  @@wa8 > )`Ȑ@Μ ZTX&`y&d&dv&`a$$p  @`Z! `p!@b a a$$Z W $Q`[!O a$$H `&`*`` B&a$$<0a@d  7a$$a$`@? 2a$@2a$   ?  @*>k` @ bta$ ~@d{$a$> )2  a$" =$a$  > )#H > h@!p> 0 @m֐$!<  @_Ր"!('u!,8"!8   ?''''''`@t!<!8@w  !8 @x-@ab 㿘> "d> *`l" *  !$ d@d!* "@`l*` *!$㿘> 0 !$!8 ? &!$> h@!@  !<@r @mU!<&!(&!8&!<㿘? 2` 6  * 6  *`  .   2  > 6 `l. > ʐ"d*  $ 2,?? (2`   ӈ Ӝ Ӝ㿘?> > h`  `  6.@`"``*`ff(c3dϲg.`'a. `.(/`@`(0`!ʐ (> )#H' @d> "`M` @F!> @-" @F2`(%-"@%@-ΐ"@F@ /   ///  @ ///6/&@@ > @b``@ X@ > )#H > h@͐"㿐 >  p> (bԥ. . !@> l> ("Ԕ`:<> "p 2"l   > (> p`B :p""""@; :` ` * O` `" #@ `& & 4 4 :?  ; ?# :  :  : :2 > > lp" :  &  0 > x`B g:x$@$`$`2 2  \> @,Ð"> bl> ("Ԕ  <> bp   #bl2 "> p`B :p@,0;"> * @" "  ` `, B ; ` !bl`pB  ;@. !  8 @B 8B :  > "`  > " @ @,㿐> @ #> `h!> `B :h@,]"#> ()> ʐ' '@,S @@B <  & &   `    @& > )@Џ \@,2bp"l> (  "Ԓ@ <$bp$bp 2 &@,T㿘[> , @B :㾐> )#H'@:c > @+">   `!> ( ! $ #T@!!@ɐ#T(!@   C> ʔB"bt$8 #T@ 8(@, #H > h@E"> ) X㿘> )X >  p`2 > h@8"("X>  t@"X㿘> `p 3 !> > >s `L@"> >s  t@b> (  @ @" "$" #`> ""@+ Ð > ="D  a@  2` $`p㿐!> @+s"> ( @#T> > "t`B :#"t@+"h%> )H!> '@+X"> ( @{#T> > ʒ@"tB  :#"t@+"Ȕ @%@$@c@z @w!H > h@"H㿘ch!> Ē0@+"> (#T@B> > "t@B :#"t@+G"㿘   8  @ @? 0     㿘` l  @\ _8? 2  @`>>q!*` €7 > b  . #> ਄ X> '``C :X> h"`! @ ` 2`8> `B : `k` ` @z `  @ ` 2`@]f 㿘`A`? 2`   `A> "``A> )@Π`\0㿘V`? ? > ʐ"x> )``&`8> ʐ"> 'b&`8> "&` @*A"&`&@*v" 㿘!> @*5"> )``  "``2? "& @*\" <`" `@ 㿘!> @*"> 'b̀  "b2? "& @*<" 㿘?  2  D ` >  @[( ` '+`@8*`2  @zJ ?` , *  2`, , 2`ː ?` 2`? 2 ?  > )" X@\ 㿘 [@"@% "@ "J8""@9e @P`  "@ X b~@Tb}@ QR@!> @)"> ""@)&G@hu 2A #> @)ob> b`@ "`"`@)b1@h_ 2+ !> @)Z">  ""@hT 2  > "`?!>  #@)I"> )" X@hC !>   @)=">  @|"@)q" @ 㿘   `  "@ "   x@@B<   p@`"@ `@  ":@? "@ " h   @' ' '̐?'* '% '" `@qD   X $`"? ԰ Ԑ@A !`' 'N@ =`?'܀ ز`'Ѐ `0`4  `p@  2 `0`t( `0  <`8  '<`8`<   @ > )h8`B :8 '`p  @  "`8@6`8   @w r P   8`8  @ @ 8 C|<`8     !y7!` "@  ܓ2` ``?@[؀ N@ ."!l򀢠7 M! @M! `A`8@! `  @7 |-` @`<*'<'`8 @%|-` @  $`@@Y= `@@M@ j@Zܒ  `8  B<`8`88Z`8``<8T`8`2`8:  $`@`<P `8@:<  @  @5 @  P @+<`8䀢`   `0<`8 '䀢 "@5@@AЀ`` ?@Zt @$`@䀢  > )h0`B :0 Ѐ `8<`0"6`@@5o̒ @q@%`@@X@ @ H  ̐@m`` L*@H%`7 4̐@mO  "@P07*@'%`  @@57@Pr"X@ @ @5) `  ̒ @pʐ@%"@@@ 㿐  `@   `?@2 @4 '` P @ & '㿘> `4> ) 9 @w> )> )"`"Ё 㿘> 0 '> )%> )6` Ȑ ̑*  "  @2 2   @O 6` 0 2  㿘 > ) 2 > )̐ * " 2  @2 22"&& " D @Q    2   " "㿘 >  b`    D > h"h@R $ @p `@Qk 㿘 > b`    D > h"@RȐ@@d " @P$  @Y" :&  㿐  '  6`6``@     `. :   􀦠< P 26  @`!6` @2 ` @6`  2 ` 6`  2 ` 6`  2 ` 6`  @2 ` 6`  * @&`  * @&` `&`!m6`&` @3㿐'􀦠 `  `  *@ :   􀦠'`P ` 2! ``=@ ` @@` ```&`&``@` ```&`&`` `@ ``&`&`&`&` @3z㿘 'l '    &`&@H 8X. * "* "`  @* @, : & @ d@? * @,`,`* :`& *  @"?. * *"@ *`@*" 0*  ``d ,:`*`" *  * "&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `( d ` p  p p p  p p p p p p p ( p p p p p p p p p p p p p p p L | X ` h   (@2   *  ( @* ` *  ` `(@*   *@ 2`"`㿘> h@l"@2 㿘  `(@`$F`0`2 `,@6  /,` > h" ` ! >z"*` €  $ `$  `@> 3> 3" c  > h@("`, `,@@ݔ   `(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N > h"`  >z# *` €  > 3> 3" c   ?> h@"`, `(@2*``,2`@  ` `(&``$""@&`$2`$`$&`$ `  ?&`㿐`(> hb`,`$@" N !   !`al  #\ `( `@`$0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`  @   @` @  " "   -@ْ`.` 2  "@@3`  @v   @'` @  " "   @``@  " " ` ?&` 㿘@N     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X㿘``/  .`.> >` ` / ``..> >`  .  (.&`$㿘  2-    2% ` 2  > hc @} 2   2` > hc@p  > hc(@i  `" =&`㿐 `!`' `!al@`2`  *` * + `  X "h`!d   ` )&` `  "`L@L@2 L`L @2 €` # ` (`@`: `` >` 9``: `  0` + .``8 B<  2` ``@r   ` ?@-  P`` @ @/  2  €   2 ` '> ʐ''ܔLX6  !l x`!7'' '''ܐ !@J> ʴ#` Ĵ ?'Đ(`$  7> ʐ'6'''Ĕ' ` "#> h&ahc8@i     1&ahc8@`  2?"'> 'ܐ"? 㿘.     ?.>  "  ?* € . 㿐Leؒ ;) ;Y  А R, * @ ?Ѐ .`@*`@ ;$    ? +"@ )"@  ! . ; 0`;   ??? 㿐`\    =. `.X  ;` .F6 T D T T T T> 0 > ` > *@Hے`ఒ  > h> `,!> )@HӒ#h > h@#x07> h> h#c@GM| /#h'|@  | "@G2||@SS 0> H"| "ᨀ@  |#a |"@|a"`@ 0|@G @ʒ  ̔ t  `$`@| @  b @No @&(&&$&&,@@Ԑ d< "@I[ > `0@IݐQ @_ `@f `!@h[ @I0: @i`$@@2  @0  @I  `| Y| Z`@@$ a| Y| a@@$ at t@j 00@I㿀  ' $ ''    @M3 @K > )#h  `@e`  @O  @i> r耢   ?@g gl 0p ' 'c' ?@h 2'(: '  ;:  (?@+$ > h Pc @A  2  "` 4 :0 - ''&l 'X> hc@  " > hcȐ@  " > hc@   "   2  @- 'c  @-' ? * b> ?   9@P"!p@$!p$` P ` `+  P* `@ @ *@ $`a4 "  +  *   *` $aX ` `+  * `@ @ *@ $a\$al`$`@ $`?$`8`%8@,'"'   $ ' ' $' ($`$`$` l )  aX` *  : `?@*\ R P $adl l ?&l`8 "`8@,|'l  $@` $a` $a`a` #`!a4$ "  *  *` * $aX ` * `@ `* @*@ $al$a\`8 &`8`"@,E &"   `@,:`"@,5`@d8耢   ?@fn@gђ `@Q 9'"㿘@-($`L   ,: ($`D<`x$`88 @ $`H@@/ `> h`Pc @  X T c$ޑ, K? * b B> (@u  8@q  2 " 2 "  6&p(0<    B  6& .6&0  B  6&. !W @ &&6&&6r@&6 `8 $`8@+ 㿘6` @H6 b  `"@c   @eǔ?@G @P` 9`$*@$`$$b㿘"!4~!` `?@M -㿘"  &`&`   ;  0>`>`0@ >`>` >`( ` Z!` Z!taD t&`t  㿐 `` & ` &@F & F㿘 @ 㿈"? &. > ) ؒ @Dz  &" :@N2 > hؒ D @H< "`$$C$  @F ""2J'6@ @Fn F> h##@`!  @Fb F> i @ʒ0?,  ;    ?@(  @FN@*> i 8@0 P @ @@F= " @* > i  P@@  F$  @E$ 6@  Ґ!2`  `+"<>~#*` €> )  "`8> ) Ԕ" 8@D} > H`$ "`" 8@E@G$'p@tXh: @  l `@ "`@ &  2@ "`|"`㿘"@JQ`  `0`4&&         |   8 d p | | H*  2+ 2' ,2# 42 2  2 <$"  < >(      㿘 <  o  @J `   `$ `$ ` /$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t.  < 2*   @Lw$      $?'''''''''''@]耢 А$ < @N  $ D$ H` $ (`p< P <$ x  ' ,  6 @) 0' %`@ `  ` " 8 p@b    `;  ;  쀢 ( `B `E >@<  @K!  . D@ :`. a"   >  `@4Dp  ?t ?#`#\#d@&oa@Mz  ?@&V:`H'8 {`P@j`@  p@  t@`8 "`8@(g   2b   E  㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @j#0 2>#8 㿘"" N" =`?  " !! 2!@ ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#" 㿀#P`   @K' '쀢 ,a,`,b,a,`$c0 $cD  2 '* @J $cD$cH $c@  i`@! b`2 bL! 2 b#,b  L! 2` ,b`!`  l #\`? `Q,b``2c(c(b c(8ic( c,@8cc(  `  ,b̐ & ` @Kϒ  cH""@"@ "c8@&c8?  c@@K#㿐   `!` " h ?`?0(    @$ 5 ` P   ( @& H   > H`#> H@ (@M    > H c> H (@Y@& 0!@&~  #  @hؐ> H (@B0  " $  "" "㿘  @a @A 㿘  @a @A 㿘  ` @C D㿘  `  D@C`㿘` <? > i@  x p@21 | | t@2, |  p  t x@aך " | 8$ <($ 8H /d * % @)ÐH 00,?2 | P@1 D$ H |?2 H /d * % @)H 0  > ` $ L! 8*` € 㿘> i@͐  㿘 `@C D`>$(`!``     %` $` "`     ??1 J@` +???"&" @?(82`?" 2?2 ??"" @?` @((882`?" ?: P> )#H'@&ΐ(  $($`L<`x$`D$`88  @ $`H@@(͐ `P@  `P ?Ēc ? @ (**`+` @  3   20 3` ?@(#   <`x$`D$`88 @ʔ $`H@@( K `P@   >А  @ K @\  2 " 2 "  p(0<    B  6& .0  B  6&. !W  @&&66r&&@J6 `8 $`8@$H > i@& Ё㿐`&@`@ l  #? @'? < =*` >+` 8@ 9( : ?(+  ;*`@ @  4`,  +?   ,+`- 5`1?   # ,` .6 . 6`-` @ )?6 ?6 5  5     ܔB*2@ ' < @G D'`4 D@ `@?'@㿘 2 4 @   &@@ <@ @ 㿈@  4*'  @%찒  !@$t   @$L?@# ?*  *@2 @ 2@ @@#&@ 㿐!> Р#> )> i!a #\!  @_ > )> i a(#\ D  @U > )> i#\"`a0 0  @K   㿈`$ 2`$ $`$`$@d -A  ]` @X &(&&$&&,@6X N< "@?kE > `0& @?a;  @ `@[ !@]ސ @_0  @B ` Y Z`@@$ a Y a@@$ 0@?& ? (* 0*`2`    @   `  h'L'@B'̺    '@A9 > )#h@ w `@[%`  @E  @^ a ?@]? Z  @F5 h&b`> i` !8@ i@!` `HԒ!  P 2 ? ѓ*` ҕ* *  Ӑ @ @ ? @ *`* 2 2` ' p!  > i *Д @!Ұ  ? *` * *   @ @ ? @ *`* 2 2`  ?**`@ *  # ? ** 2` 2 $`,** *  @ @ @ *`+  3` 2`Ԑ  $`0@!w 'Ԁ> iO!Ȑ`P@]   d @dv`L@`$`HL 2`H@ "`,'В`В+     `?@԰ > i@A!r`HԒ! P !`8 @  '`<4`@`, $`<@!)Ȁ'> i"@  Q`H`<?#`8 @? @ *+`@ 2*  (@ 3`@ 3  0'РȐ`В* `:    `, ?@԰ > i@"(`HԒ!  P  ! > i@ݐ"@`H@ ٰ `'*" > i@А!@`H `@E ` @E `$*@&`$&bԀ "@ `@X ?@Z@\[ 㿘b6`  @=H 9`@X   ?@B ?@Z֐@\8 !`@ 0 &' @   > )!@Ɛ  'А * :    ?@ɚ > i@"(`@˒ @!  P  ? Օ* З* і ֙+ ( ҄ *  א *` x! > i@͐"`5` ? * *  + (  *   *` @c ? +  *+`(@ 20@ 3 2@  @`ؐ @BД   $@`@l  @3! `PE@0``P@@@'@f찒  @@D[ `@G0h$8$ $  $$4" @: > i x @< @@ ` ") "  ' > i > i > i<@7"          "`<4@9  > i@"> H`$ "`" 8@:@<,'%  &㿐 `` 2& &  2@8 "`    㿐`,?`-* `.*`@*`/   '?*  *2`  2  @A #? $ d `,`-*``.* `/* @ @**` @ 2 @ 2`@ `(`)*  * 2 @$ \`0`1*`2*  *`@`,`-*`3* `.  +`@ `/**  @ 2 @  2+`+   @  2   3 *@   :`*  ?@9 " `, " d@f d@CI 0Y`-*`.*`@ `/*   *`*  2   P2 d  @I d ' " d d@C% 5 01* @ *`2 @& $ ` 8 9*` :* *  ; @ @*` @* 2 @ 2` ? 0`1* @ *`2 @@ ޘ   # `( `)* `** `+ ( # ,x> )#Ha' ; [ ```@2L ,`/` > ib@ǔ  > i bА@  > i b@  , %`@a ?a *a*`@ * a  ? ** 2` 2 * @ H  > i@|# 㿘> 0 & P@{ L H@* `@     82@  @8D    & 2 8@  㿘> 0  ` @UX P@C 8 L H @*  2 > i@# & " " & @i 㿘  P@( 8 L H * @`2> i#@ `"  "` ?"&& @H 㿐> )#  @6 > i &@@#@ @? ,c -*  .(( /@ @ ? " @ #*`*0 (2`  0 2 *0  a  (( @* 㿘   ``<      @ $ %( (( )*  *+` &@* + '*  `< @=L㿘 `?@В d   @ɒ!`?㿘&` ? * c *2 g4 &@&@  *"@ *` &@ *"@ *`@ *` &@ *` *" *"@ *` &@ g*@ > ː"*`@ * * "@*`" @* &@  g@"@&@g@#@&@g@"@&@'Ѐ6!m* @*`" * @"*@  &@? * c 2`*  <@ *: x*`" @* "@&@x '' ' '`@  4"8$'$? 0 1* @ *`2 @$ $? %*` &* *  ' @ @ *` @* 2 2` ?  " ( )*  ***` +@  * *@ 2@ 2 @  "`"`L<  "` :U: < =*  >* 8+  9 :* ?*`@ ;* @  ??  c0( +`,` +?1?  (   # 5`- .6 . 6`@  -`)? ?6 5 6 5     < '! # P, \4<  L M*  N* H*` I@ O( J ** # K H,' T4`< a D E*  F* @*` A@ G( B **  C @@ I  ?  0(? #?  4`,  *,5?   ( @ / 7`,`.6@ @ 1?7  ?@6  6@5 @@ 8`@Ȓ@ :  4"D8"<"@"H #? '?"( < =*  >* 8 9+  : ?**` ;@ * @    4`,  +?   ,+`- 5`1?   # ,`.6 . 6`@ )? ?6 6 5 -`5     : P `< :X"    㿈     `' '?`@? < =*` >* 8+` 9@ :+  ?* ;*` @    0(  ,* +?1?  (   # 5`- .6@ . 6`@ @ -`)?6 ?@ 5 @6 5 @  @ @  4  0 @,  "(  B4 $@ 2'@$@ ''@Ӛ캒 @\' `@'`" 㿘> )> i@#p-  @Z!?  > i@#a@l a?# ?@ " `.@ .@ `a@U.@㿘> ) @+! ?@Wa@8㿘      & "& *& @[& ?㿘> )"`@!"" " " 㿘     & ( 2 , ; & $ $ @0 "  , `& (@ &  "    " & ,@=    & $@  `$? `%* c *2  `   & Z  #@   > i@#E @<  &    @&  $ $ & $ ; &  @ݚ  % `& (@ɐ & 4 `$  & @}" `$? `%* c 2  `* &` > i@# x& ( $ a@ & , &  , &   ?@$  ?& 㿘  " ,@&  ,  > )  "> )@=c > )"`@N`> )#H'D  ''̒` ' `'` '̔ `4  @;, 'Ĕ'''ܐ @SD'` " `@, "``0"`$`@+? < =*` 8* 9 >+  :* ?+`@ ;*` @  ?  1?*   # -` .6   . 6`)?@ 5 ̆  ?  5`@Ő?#y/> i `u  =`: `8 '// . //7'А   i   ? * *  *  @ @* @ *` 3`2`   /'//7'А// 1  $ %*` Ȑ &/  `? `+  `* ` *`@  * *@ 02@@ '   * ?  /7'В 0 7> jQ D*!  *`@|  D `#    :: (ߐ`@ D` "```("`$D ` @ )"@D"@> )H > j@u ( -㿐  x p@` | t@" p`: @@ p  p@˘ "2 | P@\ D??)< x t  x@Rך " | 8$ <($ 8H /d * % @ÐH 00,?2 | P@1 D$ H |?2`H /d * % @H 0  >  $ L ! 8*` € 㿘  ` @4, 㿘  `  @4"`㿘 `@4 㿘 > j` 8 8@ @5y > j@ P㿈  `  "@  "  `: @  @2쀢 "   @  <  2& h' '''`;?' )?' @ <+? =*` >* 8 9( : ?(* ;*`@   1?#' ' ' '?  '̓/`   .6-`   " . 6` 5   5 @  @ @P}ܰ  @ I찒  `   `J`. @1M"؀   `<> G   ? *` * *   @ @ ? @ *`* 2@ 8 `B :8   , "`0"`$?3# `/  `$  ? *` * *   @ @ @ *`* 3  2` $ %*`  &А#  `  9! > j@ X  "(   @ e` "`^2L A  ؀   "`<  > G0`B :0 Ԑ  @  ܐ "@P "@Ԑ  n  ؀    @ @ ` "``("`$㿘   @Pð 㿘  Ր " @@0&  @ "> )@9 > ) @ϒ$  㿈 '@?W  @! " @? Кc ѕ* ғ*`@ ӑ*   ? ** 2` 2  ؐ'@ ՗* ֕*! ? c * *`@ *   ? ** 2` 2  '@ * *  *  @ @ @*`+` 02` &@3 1@ 쀢 @&@@@8&@`?`*@  :`*   `?@? > j`: @` P '@  x@b㿘'D @!  'P'T`   `? `ї* `ԅ( `Փ*` `ҙ+  `ք  **  `Ӕ ` `? `* `( `*` `+  `  **  ` `  @c @ ? @ * *`+`( 20 22`  ? * @ *`2 @` @> j> j@      *` 2   H   > j!@ > j!@2@8d`d.D`@{! @ ؐ @ ? ( (@ +`   * *@ 2@ 2 @   ж5`2@80`d.lD`@G! @ ؐ @ ? ( (@ +`   * *@ 2@ 2 @   ж`@ .` * *.  (  - @ ?  @ ? @ *(+` 0, 033`T @ B 7"T?"D``8 P ^:> j!@ @> 0W> j > j!@5N  =* >*`@ ?*    ** 3 2   P 4:`P@:`d, `` '?`\#  #?'? 8 9*` :* *  ; @ @*` @* 2 @ 2` @`6 <  㿘'@ `  @  d  @!`? "mn`@퀌`  @ d  @!`?   8      > j!h,* @* "@*` * &. @h> j 0!hO!T@ؒ!@!@ .`'  @ d  @!`? "    @ d  @!`? mlۀ `6@  @ d  @~!`?  '̢@    @  @ $  .`.`@|..`@^.@u <.`@W <.`㿘` `- @?c *2 *"! "8! !0@ @ @@ @ `㿘`&a`&a ` &a` `@&a`&a$``2a` a`H  `@ g > j@@!@Hua``@*`@ ``>* "@` &`*`X" ` $ a$ a $ @,a $ $ $ ``@*`@ }``* "@` &`*`" ` $ a$ a $ @,a` $ $ $ ``@*`@ ^``>* "` &`*8"@ ` @ "`` a "`"`"`"` "`@ S㿘`&a`&a `c  2 * &a` `@&a`&a$``@*`@ '``>* "@` &`*`$" ` $ a$ a $ @,ua  $ $ $ ``@*`@ ``* "@` &`*`" ` $ a$ a $ @,Va`  $ $ $ a> "$`a  , $@```@ >@ِ``>*`" ``&`*8"   " " " " " " @ Ғ㿘`&a&a  &a @&a&a$``@*`@``>* "@` &`*`$"   $ a$ a $ @+a  $ $ $ a> "  a  , $@` ``@ >@z``>*`" ``&`*8"   " " " " " "  a *  , &a@ h> > ˔ " ?> )c$8"c$?  㿘@# 2!@ $!< @SF2  @2  2   " ,    㿘'T?\ > &"   *   " $" 9> &   @&> b   +@ #@#@@2   '@`'@  `'@"  `8  @ F"@  @ @* @ >* "@  & *`X " $ $ `$ @+$ @$ $ @"A @* @ >* "@  & *`$ " $$ $ `$ @*$ @$ $  @* @t >* "@  & *`X " $ $ `$ @*Ő$ @$ $ "    8  T @* @F >* "  & *8"@ @ &"`"`"` "`@"`"`T"x  #\#``#d#h#l @F 2`  > )'T#H D ''L'P''t'p''@!Ґp'\'X Q  < A `L@I|! 7\ X $`1 `!@I] 2!  4 2  Ȁ "  ,  @2'\Ԑ\ 2䀦 > \" t@  `8 `` "  `` @@. @'T,@L T"!D"@  p> ,"  t 8 @ @  $` 'l  " @ @ @ 'l$ 2$  "3> ̐ $   c@aۖ   @6j 2   $ $@#dl#`#\l@ 2$$l#`#d#\l@ژ  $` l @6`i` 2@6`l@ @>   *"@T@T,@ "L"aD>  C\'d 8'` 40 XXT 'X'h   "@'h#\LhdҚ`  d@ h   @ L"@P"$# hd 'h  @D  @H%\ h@2 hT@)f"> )H > j@l9!x`  ` 3   '7/n 23 ?* 2  8, a`H " ,`@ # > j@!В ,  @0ӐaF `?&a&a , @ '#> H `` # @4`(a &  倥` ,`2,",ޠ  2 > ˀ`Ѐπ`@> ː#&a4 . 4`?'> j @    > ː#`@ ``2`2,. 4, e ?'耢`Y'> *` € 2   ' "@'?'a`#\֚䀤`'䀊  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a  , a ?&a a?2 &a@a> a $@ @*@&a&a&a@`&a$  @/ސ " *" ," @"" &a8&aD @1@CDa@~`"> H (@b@1p @` Pa@aD`'E a8=  @1V > H (@A@o`01@ & '  '' > "  ''   ''''   ''''a<'''˔ @@1# > H (@   㿘,,   @/[aΖ 9 ,* - 2&  d! @   @/= a   `@2 ` @` `0 * `@0͒ @0ʒ  > )#H'>' @ H`' @ H> j  ??????    '  4 /77''/777///''''777 @M 4 H * 4B D @. >?'@㦖 mH ""` "" #`# "# @MV* RH* `4 B > j@""@ɘ@ :H@D > j@"0@& )> j "  @ ""X@  @M  @D  H > j@i"  x  #` "  #d#h#p#t#l#x #xx#xx#x>  #|p B; `"@d"`h"`l"` p"`t"`x"`|"`` ##x> )#H |'`N'8@ h (  h?,'0!'!'!'! ' 8' L' 8!<'' ` "' 8' !''  '' ' '@'̒  h '@'D'H> j@ޔ@ 2r!8`` 8*  E'8 $=p?  x'P?X'p'`'d't'T'h'lP@{ 2S 2!8M  '@  * 'D'H @@L. 2>@> j @L#  23*` D@L 2'8 `'8   ?@'H@ '<> j@@{< 28 @8 8 &cH > j@hj"> )#H 8'> j> j @@@U      @ݔ$@``\H@k 21 P '''@0 2# &  ?`!@@T 2! '''@ @& cH > j@h "㿘 @K  @Kw  @Kp 㿐`? 4`a'a( ) ` %> jbА@  2C `  8  @ L  2` , @ J@ 2`*@@ *L %    9> HJ@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` `'` `@A`!@CZ @D  ",`a( "> j@f"ؒ@ta0 a(  &a(2` > Ґ#`""`(2 , ?",`0?"`0`, "`@^b`0` "` ?"a(  &a(@+  ? @+@%   ? @+% @ $ ?@+ڔ $a( > j`0@  ː $@ @$    > j@#a0 0 @$$&` @[ 2$`a(   &a(``@?  (@>a(&a,a &a( "a" a" . " 4a(   &a( ?&a(a0@  ```@> ` (4@ `  @- ?  @- ?@/㿘  > j@#@ , > j> j> j#`cp@y `, " &  ?@+A* , " ŕ*  @ @, ?& 㿘  :    " @#   `  & @,Ȓ ? && 㿘` @ "  +> j` ` 2 @>c  $ € ```"``㿈`> , "$`@ 2' ` 2#  "`  @3  2` A#@` $ #`` #\#d@`  @㿀`2> " ` * &`#\ ``  $@ * #`#d ?@? 2(  #`#\ @`#d`  ` #h`@>#l 2` 2` `  @  8  $ @% @ 㿈`> b `A`#*&```  $ * #``#\#d ?@z?  㿘<>&a&a >  b$4 * &a ``@*```>* "` &`*8"@ a@ a a" " "`a"`"`"` "`"```*``` * "` &`*"@ a @ "`a a" "`"`"`"` "` `>!> * 0!" $`@`Ķ@g@~> k> jc@ @@rv@ĩ@@ܓ@@0r@@q@G@k> *"ᴖᴒ " "`$```$``""` "$`"> 2!̀`!$`!̐`"` %!$` > *c8$a<> 2Ě  $`<`<"`@"$`@ > 3@ #c8@" "# > *"c@ $`D"c@$`H> )cl"cl# " `0Ho  "`> ˒c  ,`5$a8> k,a&a'  >aА`|@`O>a@`J`> )#( " `3> *@7@"``5> `/> )"`;> = +> H@1> *@?2 > )#$`(@Am@ ( > *` $`cP"-> +и#? :`:@`>  <P  @@< @4$!> "    :+    P < @  $>   a@`>  ` $`$$`  $aD@0I @;5@Y'>@: 0@b@@߫@r@@@@@@Ԁ    $ @  2 @I'H /f* '@) @H 0` > )#H  @ "@  @dD#d>c#\#`   @ > k@ @a$ > Р%> k !$@Xǖ !$` > А"@Hʒ > k @g > k @g @>  ( "> k > k@ > H!$ "$> H  €` "`> k@ ` "`@ o`` @@ܒ D`"` ` " @ b`D> +  "` > +` ,%,#0",�!`#  ` 0" "`@ $`$```2` @>s> k"4 @Д ">> k@g!> k"` @Ĕ ">> k@[! > k"D0 @ ">> k@O!8> k"(H @ ">t> k@C!P> k P` @ > k@7!p@=q @v<@ @@> +"cT> А"@H > *"@Z@> kတВ @X > kP> k! @ '''''@D  `> k> k@!0@!0@ SX> *a'̀ -> %> ̦ش7> )  #> k !b@W֖ !` ̐ > $"@ '#`#\#dԖ ?@? " $> k@ϐ"(<"`<Q> k -/ @ `  s/ِڦ  * "$@'А}Ò'@ $@'В }?''АВ} ̠?} ?} Ȕ'''@ > k"P@  2 -> k@"h> k@t"㿘>`0@)`㿘>`0@`㿘@P@4ڒ L@  '''''ܐ@9 =@? <    `@:u - > *#`1> *#耢 "@> *@YI#c쀢 "# ` @:\&#$c@ @$c찒 2    $c@@:H 8> *c> )#H '2    `$ @7 "` #?:!'~4 @6 @7@ 7`ؐ@' ب" '" 'Вb@ ?@h 7ДĒb?' '?/a ?>  >  $@" 7``` @v 7`0 `,@=  7 ' 0  '!< ` "? l?'  !W #\#`/#d#h#l  ( @9š  @70` " cH > k@a["㿘@ڒa . c   6  `  # (.` 6 `.` @.`6 㿘> *c  c>> k#D@  㽨> )#H>'`0`7> #> *!> *5> k3> 1> k/> -> )> *O+> k   :@ @ d(  24 , (0 # $c$#@E( `";%#`< 9 `X  b :@ @ d(   c, 8  $#$c@" 4# (@Ub#耢`"c`< 2`X  @8?$#%#@K  @8?$c㿘>#> *c 0 `!> *#耢  `"# @8ܔ?$#$c㿘> `̐ @v > + "`> k@"> >  "b<@X""8> *#`> *>   ""@T> (> +"`8"(㿘@?В 㿘@?ʒ 㿘> 0`-0"@)> * @  >   >  $@[D 2  @[  >   >  $@[3 > * @[ђ > *#`2`L@c`L? $`L@`A@!`l> + H>  `$> @> +` "@" "@> 5$`> 5 "@ "$ > 50 > +0!> + #> +"1> +0> 5 ( B : ( (`B<8((#((< (2(` (`B#8( Дb?" ?/!" `#  ,@ "?/!@" ,`$ , $`D ,& @@\ > +@`㿐@ " А"@? &- (c (c& > , "@*`" * * > $?@   %@`4 }> $?@   #㿘  &- (c`(c& > . "@*`" * * > $?@ڐ   %@)4 }> $@ǐ   #㿘 0 4 0Ho  "`> +`4  !"`4> *#`H /m * . > + 8> *c> > "8@h"b +`4? "`4> *c  H /m * .  > > "b8@1" 0>    b8`D  `$`D$`@> *@c> *@c @  0 "`@ @4`@? X$`@ L!&`B < ``B 8<```B 3<`" `@ 0 !H@`@? 9$`@ > #@ "`( 蒂`B < `(`B <`("`0`H" `0 `B < ` B<` `B <`08 $`@ p> +`<  $ p>`0`  "`@`㿀> `$> >  > *(> *'#''''@Iǘ H > +  "" H 㿐@`*`" *  * & &㿐ݐ*`" *  * & &㿐@*`" *  * & &㿐@$*`" *  * & &㿐@(> *c0c0" &`" `& А"@@& &H > +,,"" H  < h  l   㿐!> Р#> +> k! c#\ `  @x > +> k#\ Lc!,  @x > +"!Ё:  * *"*   6 *  ? * "? @*`2,  㿐@ 2`0'  $`0(@&l @Y `0`,?`$`0@T]`0 @ސ@&tސ@@&j㿐`@     ` A ` =>  < @6 2`0&1  $`0(@&"@  `0`,?`$`0@T`0 @@&'Ő"> k@#H@@&x@ @  a 2`0  $`0`` > *` €   `` } ` (z`0>  < s(@%Ȫ@ܰ   @C`0`,?`$`0@S`0@%ѐĐ 2 `0ܐ@\ `,?`$`0@S`0@%0M @ A&`  @ 9*@ @ ?5*@`* :` ?* :  ` *&`!  34`` ̒@`4` `'ؐ"~؟ 2`0` `@'`"}ذ  "~` ?4`'` ؟`0T` 2``( <& `wذ &T` 2```("<  `"@  @"D   &`@(" 2!<˰  &``  `v` PT`  ``(v  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "9   `0 `0` H@Ho  "`` 5@Ho  "` @9  @9 @V@P  ??7 @8 @ C7T` = `(`v  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @8 @ 2 `0`vS  `0`,?`$`0@RP`0㿘` #@  `0`,?`&`0@R?`0F . `"" `0 $`0"    ?*` `&` `0`,?`&`0@R#`0`> +   +@@"   2   3 * +@@"  4$ ` ' 0@ Y@ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @> k@}# & 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @> k@}}# 2 0$  0@@ @㿘 @   (@#}@#0 (`@ 2 0!  $ 0 ` 0 ,?`$ 0@QW 0  @, 2'`uC p㿘@ 2`0-  $`0T` "`(  -`  "& `@3`@7n@7: `0 -`0`,?`$`0@Q`0㿘 />   <`@8@ @&: <`   <`  "@,  ?2 ?2,  `2``  ?, ?2,   , ?w8??O `-    : "@,  ?2 ?2,   , ?w}8?-  .`@@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘  1 2* -` ' @* u-` "@@} u@}%@ `@ '` :`: ` :`: @7 ,` '@,` ' @ >  > . u`@|ג$ >  ?. uS@|ʒ$@ :  :  $ $@m '@j '$$$$$㿐   2u> +> `<0  @;`&  *@?2   2*`  * *#   ` * *" @> k@{# > k & > k@{#X< "> +!@t!  # , @`" > +@ #@" "@ # aДaЀ #a" "a#   `* "@#   @#  "&@& 0 # 0 㿘> + L@t!     @.$` $` @(> kc`@!ِ`(> # `D` ``?4`&4`$$@$`$`$`$`$`0$` $` &0& 㿘 > + @tz Lt D  " @ " @  `6 & D &&   `c*`@,`4`@: `c,` * @4`,` '@Ɣ ,` & &`:  :   '  &  &  @, & ,  '@ & & ,`t2t. < < , t' , t#  0?  @ "  R 2  `@ ?& 0& 4& <& 8  @#`"  `  Ӓ "`  `@ 㿘 &?* `F4&``" `0 "`0$ @9 &   @ ' :  :  $ @ '@ ' " @ "4@4 "<@В < "> +@ʒ > + L@t㿀 2 ,t   ? & ` > k@z=#h 0` & ,!> k  0#@L  0` ``` ` @ `V ` (   7?? 7 @4 @`"   0 ,?`& 0@N% 0-  € `"  "` ?"&& @)  `> k 0 "> +> k 0@y#a> +"a̒@t<! 㿀`@e  2V` B ? -`0 &`0`(  ?7 ? 7`?А*@6`    7 27 ` 6`      0@4`0`,?`&`0@M`0? 0 "` 㿘> 0 0a   7`" `@    7 2S  " y #@2r .`"@ >` +`* ` #    +  "  @ ?2   3`* `+@"  @4O& N . .`" >` (*`"@   * +@   "  @ ?2   0* +@@"  @4&  >&  *@ ?2   2*`  +@*"   +@ * "  > k@x# 2 R&  㿘  `` `+` $`㿘 @`(@`@@  ``@ @ 㿐!> Р#> +> k!Ԛc    @p#\> +> k#\"c @  @p 㿘`4 €`4R` (> τ"`8 "`" 4(  ` 2``?"`" 4 `("   㿘@!{  >-  0    "  `  0!  @'Ȓ "    & 4 6 ?Ȓ*  0 & & 6 !& $! (4  ` 2``?"`"㿀< ,@@    &    (  `  6 & (# 2  ,   ? .@  $ '77'''@    &  @ 㿐 `&  (  & (@Ӑ   0@y#' 0@{#* "@*`@*`'L@PW <㿐> > TcX4%  0"T@y#' 0@{f#* "@*`@*`'. ` 6   @X >@P*`|@P,& < 㿘 <@Q;@ > cT?"cT @ "  㿐  + 2` 2 > ϒb"> +!@p!""" (& 0 && 0", ?",`0?"`0`,  @Kd`0 㿈`@ r T` "`00l $`0`  o=  2Z`0&`` D`( ' ' * `o(* D $   o4 @B ` 14 $ ` o `  ``?&` &` *` `* " @ &` &`   &``` @&`0`,?`$`0@J`0㿘V`    `  ` 8 > ϐ#\*` 2  "1`8@@ 20  $0 `$ @`0:*`4@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `<* @ "` 2 2V`T @2`   X 23`> +"@o  2$  $ 4 $ 80,?`$0@Jd0`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@$ $@  .$ ,` $ 0`$ $Ho o 8   €   (  $ (@H 0` " ` 8@@7 "` ( 2`Ho o (  $ (H 0`  ( Ho o (  ?$ (@͐H 0q@ ('X U A#@w'` ' ?h` @Mm ; T!@ >  *@ *`" *" * ? ' '?` ?/a  '8''' 3`   -@@"" ''Вb@ ??T!@ >  *@ *`" *" * ̐H/` /``!`6`  #> k $`!@GH 0 ? # " '`'`"@$`` @ ` "` $` ? "$  $ H 0@0 (` $ (`?n$`  2  8` € 2   ( ?$ (`[$`& & & &  $&   ( ?$ (`$`H 0 8@ @uHo o " $  ($ ?$ ($ `?$`` $ `"@$`H 0,, l Ho o  `2q@`"` $`?"''H 0` ,lq*X%"@   㿘 ( H/` /`A   @   $ H 0㿘 (@t p   :&`>`8&`H 㿘`  0' ( 4*@ @-> + @ 4`0 "`0 8@ 4@na$`2  0& 4 8 #?!  <*@ @3> + @  8@@n=b$`2  8 * <> +!@n-& ( 㿘   ?& @Gߐ   ?& @ 0 @ 㿘  8` € "   (  & (@  2 8㿘 @@ @S@ 2 8㿘 .`4@㿘 8@ `8 2   @  @5 `8$`< `82  %`<`0  ! (!  @, `0`4l*`0$* @@t*``4 "$`0@ $`0$`4 `4* @@&&@& (㿘 8` 482  <* @@"@5> +5> +2?"& ( " 8@> 8`  4`0 "`0 4@md㿘 H/` / (` > k> k> k#cЖ@rݔ#&  & "" ( & (`"H 0  㿘 H/` / (` > k> k> l#cЖ@r# ` "` " ? "& &  ( ?& ("H 0     (  " (2   2 (x`(D% (% $@Đ  &a<    `@+ma 2 4X $  "a` 3"`` @@+G 2 4a `I2 ` @+ 2w 4 @,#\#`` ` #d`#h#l@' 2T>  ` ㄐ"   '&` > ː#  @€ a4 <`"  2a( a(  =c ` 2@ >a$@8 a @@  a   $   z` @@' > H 4@l? (0 4> H@l: (@ x!0 @0'L@  Ho  "`0@r> H @j (@$ie찒  0 'l'''h@''h''l''@'!> )#$ ?@K #$h'''''' '''Ȕ> ː#' '' Ӭ0> b@K 2> l@qh 8  #5> H  J@,`J@   @,@ ?  @ ?ؐ ?'``z  2` h谒  ?` ?%@'i5  `䀢 2`` ?hӖ谒  ?"O 0M``?%@'i  ?䀢 #> cx  ? (cx* " h ` *   " А ? ' 'А@e>> $ $ * 2@ $$ * 2@ $$ * 2@ $$$Ȁ 2> l@p P_ 6''>`$"  %=ch  @*v @8' 'i͒?,Vc 4V@ ʐ @ >$Ho  "`0 Ho  ?"`@DoL @`2` ` 2`Ho  "`Ho * "`,@ Ho  "`   $@֒ @`"( $  @"$  @"q' 'R ( `  "' 2C``  є܀ G܀> l@o h@ѕ@؀ 5 @(n؀ " `H "`H 2 > 2` #`""`(, ?",`0?"`0`, "`@C`0``$Ho  >"`  " `"0@ 'H /i * * @I $$$$ଖ  *@" "  @ "`"`H 0> b@@i( @$n ~ ," € 2 (L@@ 0(@+p @ ?8`" `L䀢@؟€ؐ `,7 ,7 D€  @`$8 @Ho * "`0@ !@S؀  ?'`@i(耢 "@  @# @i(> b@[@ ?Ho * "`O> H (@h0J2@ (@z=`@hϐ(耢 "@ڒ @hƐ( @#> b@@ʒ ? @Ӓ Ho * "`(@h 㿈`` ''fI  2U !4,  * * @  @'&@'f2  -eۖ쀢 6  @ ?' 'f  ? &`f   e쀢  ?  'e   㿀`8'> `4`@ ,"  @u^@u&`@%>  ` 0c`@ * '#`#\#d @ "`4`@@u 0(f`  * @@  @&!@@u`@   *  $a`@ #`!@#\#d@z 2`@ @u 㿘@*`@  㿘 8 'H6`> l `@mx  `"  "` "` ? "& &  0 > 2`> 2#T@f  0&!XHo  "` 0  0Ho  ?"`@AZ L?&! @F&! @F  @F  0@2!<@ !< `@2"!<` "&`` `|2``x  @) @` ` " &`@&m ` "&`@X&`&`!<@2  `& @Ғ  0@  . 5 <`" @ @"`@ @? <"@& @& < ` "`   "& & > 2ЖЀ & А "` "&  X`'> )@@D`H!`P@D`0(`0Ho  7"`@)  2`P 0@2 6!T  He{!X!X`@E  !X@`H`& t  0@ L`0@ D@^`X @@@$!8 L`"> @> b `@"`> l@lg 㿘#> @c|>  & < # <"`@"& @@c|@@q㿘'> @ΐ|> # 2 <%> lc| @>h c c <`" @ @"`@ @? <"$ <$ @@|@V 0@ h, 5 , `  ,@(z L@@6 L0@0Ɲ㿐@ 2`!<` &@`?" X    8 0 @" ` 8  !< @ 2} P`  , "u P L 52L 5 , 2l PL 5   8&``  !T'c 2r` ` !Xcڔ H 2h@gc (` %` 0``Ho  "` 8&``  !T*  'c<7   0Ho  "` 8&`` ?#'c   P 2s 0 2` 2 &> lȐ! @=M "[ X 㿘`\ "" l@l `0Ho  7"`&`\@`,`@'@?T0 l $`l@ 8 & l6aT aX@ H@(L > )D@2P ",P"TT TT?P""P"T`X"P`XP T"`X`X"T"L㿘> 2!X@e\#T! @g *@ `"  "`  ? "@& &  P`" T T"`T T P"@& P& T  ?@! " @$ `? $"` `  > l> l> l В`@j"J@`  ` "  @O@ > 1@e"> 1 @e #> 2!@e> c?"c㿘 0(@& @ǐ㿈  $>Đ#`at#\#d  @U 㿈#`#\#d    @H 㿈@` `@ "  $  `@   `@2@` 2@2@#`#\#d   @ 㿘> 1#@c ""  " &   &  "@"  " `" & x\'􀎨'i ["> c  >  8`   2>   > > ϐ"D@B5c > l@j!(G #$c @   :` p  >  t `?@c #> ` @ݖ   > 2?@ߐc $c @c! , 5$ ,$ 0 \@j !!c ,>aА |@B[> a@BV 0 " 0~ 0!  0Ho  "` 0' 0 Ho  "`> 1 @bА"  "`  b   `"  ` "! $!@A  $ )$ +$   `" @  "`"  ` "!< ` 0 Ho  "`'Ho  "`@$ LHo  "`$ X @"  l$  $ @ l$ l@!{!8@!j$ (!8 H€6 `$!D> Ś #\#\@| > b @A| > b8@Av $> +c\c\ "c\   @(" > +\ "   @" \ "   @ "> +\  "    @" 0(  *@ ` ' 0@9> +'#X'> +3> 2#> 2;> 2 X D!'7T "#X@k %@#X T#X$ 8aà $ a̐ "` &a$  8aȐ aĕ* @ $ <@  <"`@a 8aĒ @ *`"  8 * $ @ X $ P X P"`T& X$ T D $ D D D"`H& D$ H 0( 8$ \ L L  $!!"!'"@ 8!"! 8"`)H /m * .   ؐ  4!V, 5@$ @H 0 @ t * 8 K> b ` "`` "`䀢 "d` "`d`2"@耢 0  3> l a0@9Ö  0` 쀢  ` 0(@$) ``  8"`"@㿘@א 2 @ 2 > 2!Ѐ" 8"  < @2 28 㿀#d> *'T'X#\!К#` "Ж a 0Ho ""`!' @iKT& 㿘  > 0 `8> l!8@ha'>`0` ޓ. 㿘> +#|` 0 @   2"> l@gK!h""> ϒc`""`㿘> > +  "c| cc@ $c$ @ @  c c㿘  ` @ & @j㿘 (@gՐ @Q6 `8a'&  `R h> )#H'` !8 <`"  ` 8 ,@ @& Ҕ  @ 6 $ $   *& `2'!8 <`" 'ȳ,^Ӕ @g'Ȓ'@@ (  *@& #H > l@C!X#> ) cH@'&   ''Ȓ7''@ *@& cH > l@C!h#> ) cH@'&  c@gl'Ȓ'@ΐ *@& cH > l@C^!h#> ) cH@'&  A@gJ'Ȓ'@ *@& cH > l@C<!h> )#H'`PH  & > b   8 Ȓ  @ `'@'`''Ȑ@w '"@&`&' > 0 `"@D 8 @4^ א`@ `  *@& H > l@Bݐ!#> ) cH@'&  .`>`'8'<'@'DH^ 8 ''Ȓ@! *@& cH > l@B!Ё`#> ) cH@'&   ''Ȓ''@ *@& cH > l@B!؁P` ` @  *&   % @ @'''''ܐ!@ٔ 2~  @<` ` @ *@& m `> 2!̀`X`2`@ &`$ ` ``2`B2` =  !@f  "5  `/` @k@2`D``@1 `  @O@"  ` @2 *@& 㿘@ ) 2``@&`@\ 2``   &`?* &`&` ` @` b!8 㿘 Ƙ X`  P " Lh 2@D   (Ȑ  '?''''''̀` '`$`( ''''`@ `@  > l@  a@d> 2!̀  2 & =   2 @z ` 2 2  2 2 `&`0   㿘@d  p?& && & &    2 㿘> 0  @  p > l@d"8@` > l@c"8> l > l"`@c * & & @ > l@cސ"O > l#> l # % @  3  `&    @5 &    & 0  &  @> l > l@c"  ? & & * && 0 @ à > l@c"  & 0  @    3  `&    @5Q &   &   `&    @57 &  *@& z &&  "m > l@c1"  > l # @c% ?&  `* &?& 0   > l ?& 0@c #X  F@7%0B > l@b#@5   1  -@   &   @4 @    耤   &&  & 0@bŒ` @@      *@&@6ː㿘   > l @d,#0@ > m > l @d!#> m @d 0@d (  > m @d 8 B B B B B> #> > "#> L L > #"#㿘?2   0$# > c  # #> m`##`&#!`P@4; 2 # `#  $#㿘  @ H>  bL?& D & `& `$ ` @``$`  & $L & & "@" `&& `""`㿘`"  "`> ""P ?"&& @p > ""T 2> Lp> )cH!> "L  '`   $@ &( `"LТ  Y & "L/  ,@q 2  $@2 H &H > m@> X㿘> c - > "T` `D?"T`,]`"T""T0" "T> c4@x< "T" 0"T"$c" $c> c @x- "T" $c㿘?2   > c   !> "T  #  #P"T## @5x&# 㿐> 3"`'0# @e  0# @] c @1>  #@> #@ J'c@X D'0# @"0# @ 7'10 #@#@2- > ""T`$ #@  "`T1> $ &#" @w T0 c""@ & `"T"4#"< @w T"`8"`0 & T0 #@"`8"`4"`0& > ϐ "c1> #? 8   > "T`` " (`ؐ XΒ@ 'T``    &#T "#? 8   > "T`8`4" (`0 X@ 'T`8`4   &#T8 "8> "T g#   2 7> > "T @  "@ @a" Ts T  "(   ' &#<TbT0T84@  <, [ T> m"D<@ahT` "`F&#81>  >&"T`(   6  > o"c "T0"1>  (&"T`(   !'"T> $&,` &,@& & @b{ "T &`, &`,`&`,W '㿘@ 㿘@p# 㿘> "L "  , ,`@o 2  "  2 , 㿘 ,`: B`@ "` 9 a7> ̐ L >ϒ`T     `a7  2`a8.` .` > ̐ L, `Xє `X͔  $` ` > ̓.`@ L*`@`X 㿘 ,` 4`2   @ @ 㿘 ,` `z "`   "8`  ` `>  0  > !<>ϒ`p  !< `@  2``0@ .`h 9>  0@ 6b .`$> !<, `X_ `5 `>    >  4>ϒ`p   4 `@ 0 2``@ .`5 >  @ .`- >  4, `X+ 0` 0X&$` ` ` .` .`"> * a< `X 0 > * `4 `X  0㿘 ,`D N`L "` E `> #  > ː#  `   `@ ` @ 2`#@ .`' > #@ .` > ː# , `Wǔ `WÔ ̇$` ` > ˓.`@# *`@`W y㿘,` >̐!ؓ*` €  ߒ    x> , .`@`> n@^8!`> " *"@ @ > > 0"L@6Rb > n!x@_ > n@^!   *@8@ %@ :``* *@8`-`"@> 0*`"X@H /f4'* ''``@?> Ϧ#cij.`/`  4`  @/Ӗ ``@񀎠` *@  $`  2s> b * @b `@, >  .@>@ .@ > c@sؒ > ,> n@]!БH 0  > ,& ;  + @ B <3@ > b  * @  '0`'$`&0  B > " X<"'7o$@  b" *"2 ""`" $'' $ *`2` > ϐ#ē:` > n> n"> n#`#d"hb8:bX@^Ҙk> ,> n!   C'?> #`  `` "!> ̐ &`` #@/ `  @ 2`` &`@Q `  @ސ` > n> n> n#`"b8bX#\ @^$?" 6 7o""*"> ,  7o" 2#\ *> ,> " &`&: > ,* R@@> n@\ː"> n@\Đ"H 0 + 0 `*B? <$`@``B ``<$@@ $`$`H 0 耢  @l 㿘> , .`> ,  @> 0"H > > ϐ#ē.` > n"@\zb `& > ,`: * R+ > 0" * X  *@ H /fb * 'b  > n!   ( 8 " :``(  * 8*T@> n!*`  b > ϐ#ē.` > n"@\4* )b `> @r֕+ `( "$4`4@  6 @05 ?B$< H 00r7o"@ `> n'> n 2`#0@]@[H`    7o""@`@ *"@6 `  4` * @ "3   $  3 2   $( > n@[ɐ#` (@8  02    ,@(  0`B < 0 "B<  $ 6@/Ȑ?`$$ " & $ H 0> 㴀> ""> c> > (8"c> &c88*"㴁㿈%> > " !> `0#V'> bX#\  @pƐ> "c> ," #> 0"H*` @rD > 0'> ,bX" $`(  *@  @]:  ,cV * @*`@] " $? 6$`` ``` `"3 ``  -0]`"L  ->  )> +#" @[  '> n  @$,@@\@[ߐ  @`#* #   * 8 " :``*  * 8*"@ > 0*`"X@T 8''  8 b > ,*   @#:V> b J > Ъ"@  I> ϲ#Ġ . @  @[    H > n> Ϩc$b   %> n. nb $ @\2b  @[j @`b @*?  > Д _ J@ "*@  @bb @"> ( `*   * 8@"@8*  ( 8`( 㿈> o> o> o(8> n> n> n> o> o> oc#\#`#d#Ȕ `> ,> Ϥ#Ġ`  ,``> o H   : # `; c#\ ;`  #`#d`ߠ 㿘`@5` @h 㿘> 0  @% @X 㿘`@ @㿘`@  @ 2 " 㿘 `  > o0 > 0   > o @Y  2>> o @Y  0   > o @Y!@Y!8" "㿈`* >`0#> o, `x` T֐ ?-@@ `@6  @+ƒ`"@,ma`?@+ ` @, `  #@2@  ` 2 @-Q 㿘 ` ? ?n  @-;㿘 2>> o @Y!X 0  @ > o @Y!p㿘?> o > o @X!㿘 > o @X!㿘> 0 `? @H /d * % `8 # !> o`8@&`8 !@* `8``8 &`8H 0&`L&`<&`4&` `@@-` `"`'@ &`8`*2 @ : >`x@&`P`(&`D&`D`D> o@X!> o@X!  `P@lg `8&`<(&`80-@ŀH /d * % `8"  !> o"@*M `8b `8 &`8H 0@ `P@lF`8("`D`< " `D`H@@> o@X="$`> o@X8"0 @"  $`$@`;`` B# ?` '`@ ` }``@&p@H /d * % `8?# @&`8@00 `8 @`8*@&`8@,H 0㿘H /d4 * % > G!@Q$!H p@!Pc!" 㿘> #Ȁ`> obP@c  @ 8 @"> G> o@W"`!@R  D@4" D㿐> 2"!> 2"a!>  8 %> 2 > 2 ): @?  8$Ā`#> 3`:`> 1 )x@3  8`$``:`> 2 ) @(> 1`"#|` !> > o@W"#> 2> o#\!b!`  @Oy > 1> o#\#b   @Oo > 2> o#\#Tb H  @Oe > 2> o"b#\ P  @O[ > 2> o!Ԛb#\   @OQ > 2> o @bؒ 0   @OG#\> 1> o#\"b   @O= 㿘> 2!> 1#| @ *`   2  ) ޔ     2   )0 "` "@" $"` 㿘͐ @ " > o@V" "   88 L 2 8 > 2Ȓ> 2 @ć( "   8  < 2 8 > 1x> 3 @( "     2  㿘 "!<> o@V#!<  @ > o@V#0]  8> o@V#` > 2!@P> 2 @@P % &&&& !<  Oʐ  0Ho  ?"`>&  0  " &> o@Vh#!< $ @ "@&&> 1x> 3 @* `&" x @* @"@&& > 2 @@P> 2!@P2 > 2 @@P> 2!@P@d !<@`  D`" H H"`H H? D"& D& H!<` 2&!<@' &!<  & D  D"`H $ & H 㿘 D`" H H"`H H? D"& D& H!<` 2&!<@ &!< 㿘  `"`x""`x`"  "` ?"@&&  @? "@> 2 @P6 @> 2!@P2㿘 L!<@` ` 2 X` &`? &`@% X !<@" P` 2 P 5?  ` "`? "`@  P 2!<㿘  L 5 2 D  @ @  D 0 2L 5㿈 5  *`> p:@W(   8*`:`> o#  8> p 0> p!'`8ƀ !$> p!%!ƀN!&> p !0ƀ !D> p $ƀ!P t@WȒ d t@Xb d l> p p ƀp > p !#\   ؟ƀ ܁㿐N   n.> pJ!Ѐ` !N@" L@`L@ 2`L@m> 2> p@V!> p@V"> p@V"(> p@V~"X0n!wa0/"0,> p> p> p> p> p"b@Vf" > p> p> p> p> p> p> p#\"ؒc# @VTc(> p> p> p> p> p#0bPX@VG#h`>%> p 0)> pN5 KL> p #x  *@V38L@ n"> p w a"D8"(x4#$'@V-# ? 8x `<N5 "#\#\#\'#` @V0 ' > p8#@Ux2N5> 2!Ц 2N5` 8"`L`8"  `L8"!< "㿘@` 8@"!<c 2!<  !<`   !< `&㿘@` 8@"!<G " !<!<`    !< `   8& ` "``"  @" 0 "" `  "``"  @"㿘 @`  R` &R @:`   K.  2& 㿘'> 2 @M@%> 2 @MԠ!< 8 @   @N@@N   8 8 &㿘``@L > 2!@Lؒ   8 "8  2a<1 !<`  2+ `0@"a<$ a< ``2`8`8@ " ` !<    @M㿘  @ `  `` KY ` KQ ` KJ  "㿘@` `  @ @  "z  u @ @   @ @~ 2a @ @   @ @h 2K     @S 4 @    $  `@@] $"  0 2$  0Ho !"` 㿘  @ `  `` J ` J ` J  "㿘@` `  @ @  "d  _ @ @   @ @ǒ 2K @ @   @ @ 25     @ 2$ @$" 2$  0Ho !"` 㿈 ` @'쀦' @2'   2 '? ?'?'e㿈 ` @'쀦'@2'   2 '? ?'?'㿘  @`  @ "@  @" @ @  @ "- @ @  @" $  z  v$ $ @$ 0" Ho !"` 㿘  @`"$  @  @ @Β @$ 0" Ho !"` 㿘  @`  @ "4  @" @ @  @ "! @ @ $ $ @$ 0" Ho !"` 㿘  @`"$  @  @ @] @$ 0" Ho !"` 㿘 `@= 2$@  @[@$@``H,  2@ 02 Ho !"` R` `(@ :    *    ` V2V @ 㿘> 2!@I" "㿘@? "@> 2@J"㿘  I, P &㿘ؠI P &㿘`  &`!<` ` HF@㿘   !<  @Gޒ` ?"  02  &  㿘@  )  "`O "'`K    2 2  @&`> 2!̀  )`  @2 N!&&  2  ) )?&  㿘@    "`T "-`P   C`@F= ` !< 3`  /``@0 D `$` > 2  @&`> 2!̀ `  @`2  `@`  2 `` 㿘  @  `` @( 4 &?Na&6 .a&  .a&H /m * . @.XH 0 㿈`G  @@㿘`(  .`  `  2` @  2  ` @(  c " z  ``  `@x "` ?$  ``> ` `` >  "  "(>  <>  8 :`? 8 >2  (>@8  ` @`>`2)@@` " @82 ` (`>" "  >" "  > "$8     $@ @sߘ  <@<`㿘@ * ` `Fo  㿘H o4+@n   ؑH 0 @D@B 2 > *%%&&&&#4`>  , @,`b2*@ *@ b 2`* @ *`B2*@ 8*@N Д @N@&Д @@N6`.  .`@c3`+ +` b 2**@C3`+ +`&  @N Д @N@%А @N@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@Nf Д @N`@&А @Nc@&㿘@ `   M `  H`E H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐#> b !> 3> А##\> p c   @EQ  $b @F F  $ $ 㿘`? "`> 3@G 㿘  d " T" X` >#$ Hƒ$!X@㿘1> >> q"#Жu`X ""> q@M   &"㿘> 0  H /m * . > 3 @̒ ,50$ࠓHo  "`@+> 3 @ϒH 0> 0 )> 3> q> q> q `(H@L  `H@ +> > q> q> q `(X@L d 1> 0H /m * .  @*,5H 0aX?<`"@@"`@@<"@"@"<+ aX2<d cȀ > q`x@  @VEaT `` Ho  $`@ DaT D @M0㿐> @n"@' "@ 'Вb@ ??  А & ̀ & ?/a  & & !X & <!X <"`@$!X!X& @H /m4 H* . H * 5DS > q@L 㿘!$2 > cȀ > q`@  L "L&,  X& X"@"X T*@"T > 3@ː > 3 @ ܁㿘!$2 > cȀ > q`@u  ` L?# L`,  "`,   " X  ?"&&   T`!T *@* #!T!T > 3 @ 㿘> @> cȀ > q`@@    H 3 > q> q> q `(@K!!T  >!TF?*  T0@ 0  H 2 H o@G@ H /mސ* .0. 5㿐#> 3> 3@ϒ`@  ?@z@O `   \&@ @p 㿐 0   0P> 3 > 3`C : > 3@` @< > 3 > 0  \` > 3 `B +:@9 @*@j@@$  > 3`B :> 3`B :㿐#> 3`@ "@Ґ !TE?*  T # 02 @* 6 2 0@ ݒ "   ː> 3`& B :2   2  㿘> 3` @   > a$ 84E"> b8 > 3 @ > "8E L> b0E P`2 @`  `$`8> E<&㿘> 0 H /m * . !% ,!$, 5$  0Ho  "`8 `@ @("`@H 0㿘> "@> 3` `*  ""@` `0*  *@H "@` `0*` @(H/@("@ @` `0( * @㿘> @b@"㿘 >   #> 3`D, ?,  @ 䐂,`:  ,   > @  " c䄀+ 8  > @  " c䄀+ 8  > @  (" c䄀+ 8 H> Ж@" > D" D> D`` $ " """@#"@H H T X  P 6 "`@"@  X `88 2 82 `8@@ $ `82"`@@"`@"@"`8(@ `@2 T @  T" THH> Ж@ @> D  D@ 2@@?"@"H H T" T X @" X    2?""@`8(`@@""H > D"  22 㿘 2 X "  82 @ 2 8 㿘 ( I   > && & b@!@,0 㿘@")  $ "   > q0& $0 & $ $` !> q  @M  $` ̒ 0 $@HV 㿘>  @$p  @!! & $㿘 $  뭒 0& $@  $ 2  & $@L0& $@!                       7 52 0!<<  / 0(>P*     0        㿐> 3>!ؒb8@ A > Вc> 3> q#\!a!D  @? 㿘> 3 @@ؐ! (@s!D $!@ ("`( (@ @㿘 (!@`@& (㿘 (a@? "a@> 3& (@Aѐ!㿈@   (` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a  $ a `  @$ 2  0 " 0  $  0@"   $   2   $  `* $ ?. 2`  ? "@    ((H(`"  ("?`M"  0H" 0H" 0 8 H "H@("@8  "8 "@  "   "   "!8> D2 <  "< > ЄH(` 2!!H "`"! ! #!!   ! #!!   #! H> ЖH  *``*!"!`` *`㿘! + (> Ц"H!! @ * , &! *`! &!Ho * $`*$@! `2!   0$a($a$$a $aHo * "``P "$`P " H   "` "` ? "`("?"H  ! "㿘 (?!!`$!$!@ 3> q&!!(a @t  㿈 (! 2`!( $!(``"@! '!$'!( =' *@ $ =r   !(  ! ?$!#@  ! $!$! $!$$!( 㿈 (! 2`!( $!(``! =G *@ $ =6   !(  ! ?$!#@  ! $!$! $!$$!( 㿘 ``  / @  2`$  2` `@J  `    @㿘   %> 2!̀M"8 $02 `@ 280 " !< 2 )  !"8 $D02D  ` 5? @ڒD28  㿘 K*혐  D  @    "  "   2 D@ D 䀦0 Z     "  "   @㿘  K @ 㿘   ! 0 "  D2 D@` D 󀦠 0  (* G! "D$a8!2@$a8  @` t.`x@'t@! < "<!8't` @!`@! &!a@`! * &! > А"H`"$@!&! $@$a8$a0$a4$a,@  㿘@ 㿘 > q@C!( 0@$ * !֒@ > А"H.` 0  !! !    N!&  .!&  !< ` !  Ho * "`!   Ho * "` 0 Ho * "` Ho "`N 5 H /m4N 5* .N 5 >   " 00> 0 h  Ho *"`0o f2e!$`h Ho *"`6!T@- 0U 0hR` I* 0 Ho  "`  Ho *"`"&!$ x & &. 5  Ho *"`0 x `@+0   "b!$ 2 2.!$@!aH 0`@ L㿘 0!2  !! 0*@ * =A ? * H * %!! 0("! 0 ((2; ( 4!TH /m * . @ "  0H 0 0("!!T "!? !*@ 2!Ho * "` (.  > ВbH @ < E 8`> q!@@Cv!* 0(2!!< `2{! 4!TH /m * . @+ "g!H 0_!2]! 2Y! 0(2U!> q@C=!`P!Ho  "`㿘  0. 5Ho * "` 0Ho  &`> 3! ``@ > +@``@㿘> 2!̀ !#8 0 0Ho  "` L`0   @k L  2 0> 0  (> q@A=!p? * Ho *"`. a,@@  a0a4a8 @`  x't@ta a&  @O0K> q> q@@!xH/` /a  ?a$a`@ $a@  * $ > А"H`"$@$$@H 0  < "<a,@2't$a8$a,$a0$a4't8 ` t㿘 0Ho  "`!V> А 6!VH.`` (@ "a, "`  㾠> )#H$> q' 0@  > 0! > "`" "` > q!> `  ( @*   @  x D sH> q "@B' !g `  % # !% ''''@' ɐLH@ 4`< 0  , 6) $ @2$ @  ?8@ VD4V!`9Hc0D@ td8?''' 0€ @& @" "H > q@Ԑ!@> )#H`!'`@' $ @O' (> ', '0'' *' *' +@@ +@ @'쀢 2@Ԗ 2  #`#l#\#d#h @ #H > q@!㿀   #`#d#l#\#h  @̖ `!'> q"> q" #\#`#d 8> q!@@ @B >  㿘   N㿘@@ &&  & ` >#Г*` €& & > 0 2 " 4a" "a 4  ` 2``?"`"@*@   "  @ 㿘  > q@?"  `> 0  `> q@>"(V R> 0` `?&?&8  "'@ "@  2@@66ڔ "@0# 2@@8U @&@`@"$`$@@"B &>` 2㿐` 2`> q@>"8``4@> q@>"P  2` &`&@  "  /6   0*  `?$ $```B >`&`㿘 > q@>`"p , *, ,     @?*``@ &&㿘    2&  `&  && " $  &" $ & $㿘 2 @``"`& `?@"&@&` 㿘`  % @  2 0 ?` "`&  "$ $ @ `W  2㿘  ߘ  2&  & > В"`" && "" "㿘> ""@  @ ` @@@2@`2> q@="@ "` @""@?&&   㿘H/` / > А"  €  2 0> ""    € 2 H 0 ɤ    < ` | ̘ x 4 h ΀ p  ( < P L ͼ d x p p $ ό Ϩ L h | А Ф и 4 \  @ 4 L p Ҍ  X t Μ ̴ < Ӑ Ӵ  ΀ < t p Ԙ μ ˴ ˬ ˴ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˬ ˴ ˬ ˬ ˬ ˬ ˴ ˬ ˬ ˬ ˬ ˴ ˬ ˴ ˬ ˬ ˬ ˴ ˬ ˬ ˬ ˬ ˬ ˴ ˴ ˴ ˴ ˴ ˴ ˬ ˴ ˬ ˬ ˴ ˬ ˴   D \ x ֤ ָ L ` ׀ D ` l x ؄ ذ 0 8  @ ` x p , P 쐝X`   'Đ+ `  @*4Ȱ xȒ?` #>"P*` €>` #` >!>] >">  >  > ",>/ pQ -` 4  H` "%`#> Аc  => b ` ``H3 " (`⏐c-  @P3  "ℐc0"`#\``ğ``` "> А@P,> l#  ` `4= x> )\#H '`?`;>#*` €r ?`Hl>"x*` €> > Đ-> > @9G> H">  8>  <> +g!> Dd#> Ha"_> CY#!> 3"'@첒  " 쀢6 $"@6$"`8  $" H> 3#@! ݲ`۰> 3""> 3!@! ̲`ʰ> 4" !> 4 '@ݘ$ ̰> *0 @@ @  @H@> E"Жa˖ Ɩ    > ѐD#> Ґ= > Ґ6#\> "!!&VK3 NK > А"{ v q l > ="D a@'  ]> ="D a@"  5  #\ߑ!> + @;e >  0$  @# $  > G `> +\ @ ۰ @wjҰ>  L> #d> #@ð @9 !> #x'@䲒 䀢``   #@4H$#x @ > ڐ_! > ڐX!$> ڐQ!(> АJ#Ȑ @a%r @di @ b @JY @ lP> @P @ .@CH @(x9> Ґ!@8/ @ &!> "ܐ@%"ܲ "ܰH U $"܀ > "5  @;~ d@ > "> G"b -H > q@"؁㿐 \`?ְ ?`> *` €> > > #c> #^Y> > "b(P* >  > " " F* > " A @ > #o> ql @  > =!P> Й*` + # @+ u> =!P @ >h> 4 `c -@ ^@V3> 3b Q -1> А @h# 2G# d d&## &&# b@#7 > 4 0 -> 3"> 4 > 3#> 4 !@%> > b(" ( >  >  " (  @ -㿐'@6 @   ' 㿘  @     `&@0  0 㿘'P` @     `&@P0s 㿘 @ *  \ -㿘  @     `&@0B  03 㿐''` @     `&@0 㿐@#\㿐 #\@㿘\@8 `  @@  `,  `% ` "&@@   ?*?@/ې@@*&@/Ґ  /Ô/㿘@8   @     &@/㿘  @ ` `&@/ /㿘` @   ` &@/r8  @ @> +!̰ ` *` *  @&@`!> +:&@!В/T  !2&&@.  '   `_0s `榒    @ ??????? /) ` ע ߰ `&&@ 0\ @F!`?&!| >V`& `, & V` & ` & `& `  > ` & (`& ,`  > 0` > 8`(  > @`0X&  " `8  `@@2 `8> H`@> P`H> X`P> ``P > h  & &  &  ?`> *` €`2`(  > p <& x & | @&   >  X  >  X` `@F ` `@~ p` :> > 8*  & > & ]& `(R&!R&! >! R&!  `&!$`H " `D ,`0A `0= >!(`>&!0`8&!4`<&!D`(1&!H`D >!(`>&!0`,&!4`0&!8`4&!<`8&!@`<&!D`,&!H` &!L`$&!P`(&!T`  >!X`( <  >!` @ &!h`( &!l &!p`( 4&!t`a'`8&!x`!@ &!``@E&!J&!㿐'L'P `  `L` P@  ! ! !  ם 4 `p > 2k 2i > +!Ѐ`e`  `#\    -̔ 2@%@`2` E@> 2!̀>0"2L5  `$82  `#\  ?~- 2%  `#\  ?e-| 2 %  `#\  ?L-c 2%  `#\  ?3-J 2% 6)- @`"`, 2 `#\  -$ 2% &2_0!̀0"2L5  `$  @2z  `#\  ?њ, 2 %  `#\  ?,ϔ 2%  `#\  ?, 2% 6)- @`"`, 2 `#\ y, 2% &2u0 ֒   L P, * "@㿐   @  ` `2    2    "    `2  `&   6     "Xܔ > 2!n' j;> - €!`8a< @2]`0a< ` "U` 8`0 "O`a< ` "I` l` @2@`` `28` `0"22`E $@J+!` 6!`+ܔ" 0$;d @ĒX"X+ɒ %?@``2N`5  > 2!А '$@'@  x@'@  㿘&@!<` `  P&` `&` &`  &` &` &` &` ,NN 5  5 8  $&a&a&a&a$a8@4#!&bHa8!8&a &a &a &a$,/  &bH L "&bL 8&bL!< &bP!< 6bT 0 ?` `?`l&bX`x " #&b\`|&b`&bX`  @ &bx!< `2 &bx `bd> q" @C< `.bk`6bp&bl6bt6brb|@C2 .b!8 @C-b.b      P>b  &bx''ؒ @B{"Xؔ ܖ8` `  8`   @ 8`( `  8`0 $ 8`8 (  8`@!<`   8`H!X 8`X , `d 0` `h 8 `l!<` `x `  ` ` ` `  ` ` ` ` b0 ` b4 `''+~`ؔ  `` b80`!<`0` l ` ` ` p ` t ` 8` 8a 8a   8a a! a ! a$! a(! a, 5(a0 !&(a3!T0a4!V0a6!8'@B['ؔ ܒ!'@BUa8!< a` @BM`!<`  ``  ``!< `2I 5``  ``I 5 4 5 (0  $ "!D a $` a $` a $` a!D  8` 5(a0 ` a ` !$(a1 !%(a2 `aP''@B   x 8aX   " 5 P8b@ 5? k? f  8a  a a 88a : 8a   :`8a   :`8a   :`8a  $ :`8a  ( :`8a  , :`8a  0 :`8a  4 :`8a  8 :`8b  < :`8b  @ :`8b  D :`8b HP?@'TL @ '?/!@ '' b b$??8bH L "!< 8 `p!< ` " 0 8 `t 0 ?!< ` `?`l ``x ?  `|`| 8`P `| ` 5 ` $`8 a'  a a a aX`'T `(     -] 2 5   &߰ ? ڰ 0b@Ѱ @ΰ $  >  %  ڔ 'T=?  ?'ܺ ?''''ؐ@E      ,``*` '`y&@:w  /> (  w ?T''''''''ؐ@Eq c "V  '  ?T' 'ܠ" '''''ؐ@ET F L  @`@@L 2`@ +( ,@@&'',(  ` &'`@   '(t @[Zʒ 㿘> д#Ғ  > =aD u > =!H `+>  -> `@14@`c Ӥ  "> =Ӟ > =!P * * "  * %%c% ڔ H*%c`< > q" c$`> q" @1Ôc`@0@` @?@{`$& `( X> `0> `8> (`@> 0`H> 8`P& @`T& D`X& H`\& L``& P`d@& T@`cc*?3&aD 0> =!H`,'> Ф  `@?`@C`$& `(X> `0> `8> (`@> 0`H> 8`P& @`T& D`X& H`\& L``& P`d@b& T@`ݐ 㿘`"     >  @Q >  d $ D X  <*ݐ& @@ &   &    '@> `d`d &@ &`  &` &` &`  &` &` &`&`>  P P`&@`&``&`` &`&`  @= 6  > D- > D",,  , @*``$@ , *  $@@/ߒ #,   , "@*`` (W  , "*  @/Ȓ $@@: "&' d  "㿘 @ 㿘```U ` L  Ў T $  @>   <'  T$ P/ T   0  r @ $ $  $  $  $   @$  $  $  $$  ($ $ 0< ( 8$ 0 <$ 4 @$ 8 D$ < 0 㿐 `< > #4`> / # 4+ '> ˑ*c  * `@`"      0`< `' `&`< 㿘` >??  0 ??2    (> 4   ?㿈>  `> B#(`Ho o> "H 0 H 0  @V@֐@ @@ِ@1 2 2㿈@8@@``H /m4&`* .&`@w @X@@`@-&`H 0  2㿘> 0` > q@-"L 5 " > q@-# @ @`@  є  & & & H /m4&* .&$ ,!$$ x$ $>`> 4 $ ""㿘> 0   `  , 5@`"@> #Ȁ`> qc(@ߐ @ L 52L 5@L 5 > q@->#8 !%*`HH 0  0Ho  ?"`  @ @`@ j 㿘`>`0`@ |㿘> 0 0d"0Ho  ;"` #  @| 㿘> 0 a`3&  0Ho  "`!`  0(!@ c  &  x  @i , 5&  x & & 㿘> 0 `$   !`  0(!@ 3  &    (? *@  ? 㿘H /m4 x* . x  N 5 @ ] 0@ 0Ho $"`H 0`x@8` > 4 ` `?@""@"`"`x㿘H /m * . > > 4 c @ @@`= +> q 5 *`cP@,:` x2(`$ x $` $ ?"$$ L 5 2 ( @  , 5$ ഐ$ > > ""4"b `2 5H 0㿘?㿘@ ΰ 㿈# @-'` '> q#h@-TX > 3"`> +  `` > +0   > + D @> q#@-8" 0 *c0c0? #c0  ?/a  #c0 H 0@F԰ 㿘`" `` 0 0B Z  & Б*`" *  * & 㿐@ܔ `#X 㿐ڼ `#D  2 @ 2 T  㿐@  2 >  '@,"'``#& p@#  Z#@,'а'@ɐ "`M  ~  y> > q"ђ! ?"  #" ` /"@'ܐ" '沒b ?"@'"'沒b ?耢 6`''`"Ɣ  2㿐@   @F@"   ``>  ," 㿀 2E@ "  <` "  3@ "&`H /i * * > 5> 5" "`$H 0 *"@ *`@ *`'~'䀢  ` > `,"`," 㿐` >  > 5 :`@( 0?`"L  2,@ '٭ 2#@"6  H /i * * >   :`@(R> 5:0H 0 㿐@ H /i * * > 5 $H 0 ``k 2n@!  gc*" * "@*`@ *` @` #`> Ѐ@# # > # @4> @>  (*@ *` (@-n @+%`& H /i * * > 5 $> 5" $"` H 0 ` !В"@@+`'"@@-B'`!   㿀@ T H /i4@* *@ 0   ' ' ''쀢,䀢 " ''" '"@ 'Вb@ ' ' * ''''H 0`!8 x@ 8 ` !#  2}`` @?  o k@Ȑ 2f @Ð "@_  . @耢 쀢 "m@xؔ?ܐ '耣 '?/a  ?& & & /& @H /i * * @ * """"@`2@ @U @  @N H 0 㿈    ?/& =& ?/b@!b?     & @&  @& &  @ @    "" '耢`'@???$  0@ @ }x8   沄  }x@8  Є?`  2  " > $&"    > $&"  6  "@ @" "    "  "  " " "  `" Є@@" "  㿈  "@' "'Вb@ ?@@`       && 㿈Ȑ"@' "'Вb@ ?耦2   耢   &&  &@ @  @ @4&@ > =8 8  > 58  " " " 㿘  > q@'_#؀`!> > q#@'X@א#$> + ( @  ?&  & "@" ? " "@&& & > =`8`&& `""`@#$㿘>  @ :`: @%  > $@(`@ : D 4`c 㿘>  @ :`: @% > $ *"@ *`@ `@(ϓ*`@ : D 4`c 㿘>  @ :`: @%w `   (0 (@c3`+ +` b *2*@C3`+  >  $ @( @ : D 4`cE 㿘>   :` @%;>`  `c- 㿘>`0( (@b2`*  *`@>  $C3`+ ;@$+`  㿘>  $@(;㿘>  $*"@ *`@ *`@(,㿘!> @͐#$   ? " "@&&   ?&  #$ @& 㿘!> @#$> +(`#( `> 5 8*` @@ > =8" "  "@ " # ( 2F8:  ' @@  8" "  "@ " # (:` .8:` ' @@  8" "  "@ " # (:` 82`*  @@  8" "  "@ " # 88 @ @#$㿘> Ь@E#$> =88@ > 5 8+> +)@'@8 ?" "@##  `("@ a !:` `  !42`:` "#* `( `" # :  !42: "#* # `("@ !:` `  !42`:` "#*  " `("@ !:` `  !42`:` "#* "  $ ` # @ @$88@8@$㿐$> 5 8&%> + !В ! `2'> r ' > r(<`"    @&:2 㿘> + ( > r@&| 8> r@&y H> =̐ 8> 5 8Ȑ #`㿘> 0 > "4> => "0 @ |`> >  "曖 > ="`X㿘> #0> c4!> П€#8>   1#82 @> = @b:`㿘!> #0 > =o @> c4#0€ > > А "c<$#0"8㿐> #0`Z -   0R5> 8' I 7> =/!> B@> c4c0€&&8!> В#< 5#< 5> =X  #<> > "ܒ / &X 7> =  7> =5> =X`> A"&X#< !> #8`> c04>  #82 @@:`0@㿐!> => r`x#\    \@F  \@5 > А#P@ > В#\"#\"`> #0ג 㿘> @#P> Р#@> > r "4 " > r@$  `@$ 㿘 $ ϔ   & & & @&  > & !(& 0 㿘@y   ?`&!> r       `@ R 㿘.`> = `@ \   @ @  㿘&@&`&` &` > а#@ @?&` `"& @rx 㿘@0  %> #> r'> r  &   4  ` "  @%#@Q 㿘@ #> r     & &     `   ? &  7 @, 㿘 %> = ``€` @\͐ 2@ 㿈֒ L> 0'> r` >@!`"`ؐ> 0@!`2``Ho  "```2@> 0@a `  2`  2`` `  ``2@@#@v@㿘> r!@# 7 7 7 8D 7 7 7 7؝㿘!> #> a> ` @$ƒ > ="a @6#> =  "`< "#`L` H"`LH"`L > >  ""4㿘> > *"c*> *# > 2> r> r> r! a0P@" !̀ X 5 ?` $   $ > #d t 2 `@$ tH /m * . d t  p p* *  @$* @$ t l$ pА@$($ l@ !$`1L 5  !%2`2@" ,!$m !%B,!$0,!$H 0  2 5@O> =a! 㿘> " l> #Ȁ`,> raX@Đ , @& l &  & h@$ "& l ? & & l@K㿘> 0 H /m * . !% ,!$, 5 `@ @4"`@H 0㿘> 0  > r@!!hH /m * . !% ,!$, 5֎$ վ `D @ "`DH 0㿐> @ 0 L`5` > > r> r> r! a0@!!gcȀ  > ra@= @@"" '"@ 'Вb@ ?`̔? $``@ $`?/a $`$`` `: @ (2   8#    Œ   @8    @`B <Ho  ?"`Ջ@  >   "q>  ,`5> "b4Ȁ > ra@ `> 0@ > r> r> r! a0@! !`4 㿘> #Ȁ`> ra@ N 5`*`> # €> r@!! 0(!T  ?*!Ho  "` . 5ՠ& А  & !$  H> 0 H@ > > "b"4㿘> #Ȁ`> ra@R N!& *  l @ 8    .!%  H> 0 H  > > "b"4㿘H /m * .  l $ @8& l!$ 1!%.!$H 0> =8 8 > =0 0 > =!(> Іh"`"!(  㿘   @> ct  `> r@!!V` `> r> r@!ܐ"V`@!א"2  @ 2 `> r@ >"  t > r`"P@!   " &   "& Ö & &  Î 㿀''''耦` `  ` @ > =!(' ,'"$  * 2  (*`: * @*``  2  V  2V   2> #t`耢`> r   > r@!V"p@!R"㿘` `  ` @ > =!(4*`$ %` * 2  ( `*`: * @*``  2  @ T ` 2T` 2㿀> R`P'' ''''`P>  V* @*`@ ?* 2    @/ 2V * 㿘: @'"  !> Р#xƀ * @  㿘  > r@ "  @ 㿘  `  ` ` @g `* "@V   V `  6 6 > =a0&```&``""`@`> r> r"@ }` > =#`@ w` > =!("&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@|@{㿘@ /`> r@# e  2`> r@#( V` && ('& V`  V`> r@ $& `  @ @*`    @ & ` @ *`@ 2  V` & > r `c` @ &  (& $> r@d#h` #  , @$*`*`$`    "> r> r##> r@H#@, @ $@ @* ` > r#@4 & ,㿘  ?* 2   > r@%#`  @ ` € - `> ss  @  ` `> s`$2`@@`2`$>   `"!  2 $T  T  @"4 T 2  $ T  @ 4  $  怢 `"  "`> ="!4 ? "& & @l `* "@> s p@E @` 6@ 2    *`"   $$4  㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(㿘 $ 2> => s@_ !8 > s2@T`2     2"> s@G " "!8 " "@(" 㿘> =!8 !8?  $@` $`$ "$ $ @  @ `2 > =$ $㿘> =a$ a$> s@ !a$?"a$a$` 㿘> =!0``"  `$2 `  "  @ 2`$ 㿘 @  > s   @^!8 €㿘` M  $2F ``` 0   2͒ *> s!P @.``> s@(!`!  @ 3> s $2   @a   @  2 $0  2 $㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,? & ,Ò  ,"`,U" ,`HH-,"K"`,,H H , H >2, x`x48,2, |`|81,,,2,+"`,,2,$"`,," "`, ,H H  2, x`x4,2, |`|8,,,2,,"`,", (   @*`2  ("# ( p < @B 2 8?3 p# < 8 1 "3   0 0    @B 2 3  p <@ B  3 # 3 # 3 L# P p < @ B  3 N# T @# # 3 r ( !W'H??耢@  "  (8  " (      ?# ?* *2 @ @'2 @ !W ? @ @*`* @ 2 2`   * 2` *   @`@ @+` ?8#(<, D@ @?B@ H+ J*0*4 X''''( @ ',/` '0*@ '4+  '8/` '<*D (@ + '/`X. /`@ ص.@б6 'ԃ(`/ .@62`̹7 '67`6''' @7 '@.``'ܘȉ1 @@  2`',(2`'ĉ7`06 7`'4,2`'87`'<2`/`''D X2`7` @ĸ  @   ` -7  ,6`6-`6- 2 @@@%0%4%D5H%X%55%(%,%8%<5@5B5Jt\?   ?# @?*` @* 2 @ 2` #  p?r#  @ `*2*`2  @5p5r??   @*` @* 2 @ 2` #  ?c @ (-`?  @  , +,-   @ 44`2  `4(0+`2`5`5 @ %55%%!?   * * + +` @ 0 0 @22 @ ##r 2  @*` @* 2 @ 2` %   @ `* 2*`2 @ 33   * 2` 355 b H p <@ B ~!Hr )H  6r 6p    p?, l -` H5`5` ` H7 p' <7 ' 7 ' 7 L' P*3   @B @   2쀣@ HH 3N#T3]HH6  8`N '? `T `8  @ ?B 'H'P??'D'T' '  '  `(     ''2`((`(  `(4  @H@D;`x`(4   @}D *` 8 DDH@@D P̐?"DP @,`D Pa *  _Pb?# ?? *  *@ 2 @ 2 @"   "'  " ??* ? @ * *`? @ ?3`?  @* ?(3  2` 2  FB?P`?`0 2`,  '`0`, 2`8  ?'`,`8 `0`,'`8` 9?.` !@ #`p+`(*  1 -?`< 0  @ 0 B)?2 8 1  @ @+` (0 @ 3`  @  B8z @ trH C    ;P 5P2   - ) )P  #P    ?@* (`?@ ?2`@  2   ` '  +' P`&`-` # ?* * 2` 2 ?F 5`%` + +` 03   %@5`   `I.``P 0P `+7`)PD`P @  " `  ` ` * :  >*`2`n!P``  B 7a'a7a'a /a P  7`L'`P`p `< @ B @   2   7`N'`TT`3 `(4 B @@ޖD:x`(4   @D # 8*` # DDH@ @8D  DDP <㿘`8 "g `( !2a @X !W@2Y ` 2U  EN ? `* @ ,.* @     B @ B 22  2/      @B @ B 8  2 (    + +  36`ɐ6`! 㿘 L  D*  a@ c: `8`O: x KI  @  x`(@C@ 4  B   @' 8,`2  ,`2  @ 4  B @ @b D?$% H( % D `(   @ 4  @B  x @ D`8 @% H 8 (% 8% <?㿐 L? @2  `@ `4` a> s@a>/"`>0" 8,  :`> s!> s!> s!Ā Db  x> s!Ā`   ? F> s!Ā D?,! x:` :`@C> s " Ā`@ , D`(@9  @ `8B F   @& > s#\Ā"`8 @V `,  @ `,   @H > s"(Ā> =H H > => = D"!P㿘> s +b@ @&   $  㿘 ! ! X  & > s@"H P&> =H& "@"> => =P> =!@` "P "D 㿘> =!@€?  `"  "`> ="!L ?"&& > => =P ?"D "P> s@S"㿘 @ΐ $  & $` X@㿈@  $??& $> s @"N X"@' \"'Вb@ ?? ` d & ` & d?/a  & `& d`& X& \ >` @ (@ CB> @> ( H 0@ CB> H> 0 8`B > 8@  X@ 㿘 h 㿘 > )#> `,#H '@%] `,!? @4  `@?`#6  @ `* * @T >> s`,"@ 0  T@v? X> s`,"@Te  `e?@֚ T> s`,#@  @j? > s`,#@@@T,   @ B > s@#h ">~  " > 2 >  # !# > s@#>a؟H > sT#㿘@%  > s@א#> =a0 > s5> s3> s  @ɒ  2 c@’   2> s@#㿘`J H&@  *`: > =!0 9?# "  @$ 2L 2@ 6 > t@ `*  *` @*@ & 2  @# 2 L ?  2> )#H> `( ?''h ? > ) c@ "c@c@  (> t@O  "> t> t @H `2> t> t 0@@`a> t@= 8> t@: @Ho o 4 p@"/ 3 H 0> tp @#J`H +> t@     @#x@| ?L *2  ,!l ll > t ->  f3> /?> t@ P> t` `> t p> t x@ܐ @ڐ`@Ho o 3  @!ϐ3 H 0p@" H  @  (?&'hl? 2`   n * * 'h h > t@ h?'hhl@> tl> "`,h`4%0? " f&`4 'h-> 3> >K" @ `?> "`,> > "` "0S)> >  ,?%`,@ ?*   *` @ @+  *> @ " ,'h'hh> > "`4*"0`,2 @ >  ,p? @2  ` `4 @> t`a @[@ ll > t @         @V > t@ǒ`  > t>K" > ' (i"b>  ,> t' ( `@ _> )&`4)#> t`a@ > `4 ?`4-> >  ,? 2` 22    2`  2 "`4 ?2 ?0@`4%0`4?2 @q `4? 2`   > t 2@a0?"> s2 @] 0? 2`   > t!2@a> s@#> )#H > t!㿀> )#H' @!  ?*#H&O   @?А (*@`J@ 2 @>   @ "?  @! ,`  `?#H > t!> "   2`@@2  㿘> #"#"`> => t!Xa( @ 㿘!> # # $##  > > & > & & >$#& & > c` & `""``"`` >  `?`""`"`㿘 "i   `" a  ^ ?> # > =!X@2   !X@2 "3 -6$ -0. Ho oH 0   X   2 ؄ 㿘> c > "( "c (` > t@2`@!0`@(( & ( "`"(& 㿐#> c$ !> => taX#\!x   @Ș !x@   $c$㿘> #(  #>0@a  㿘@ \> t@!h > t!@$> t@!`+ > t@!  `> t @" @B& ( 0& $`&    " " ' `" & `    2& - & && & &  &  & `a  & @ 2 " 2  "   " " &  "@㿘 2 > t@("H " ?`"`"@""@$  `"  "` ? "& &   r 㿘     @ <"' '   ' "  & ='   . `2@&  @ "" & `""`?"""@ƒ @0 ' '  '" &' 㿘 > t@"h > t"@ > t@": > t"@> t@# 2 > t@}#@@ * (> t @#> t#Ȓ@> t@i#@: 2  > u@ ([   P  L> u @ >   &  !`1 " <%@@ @2$ ٲ`@`"  "` ?"## @3  :  @#@ @& #     㿘\ `> u@ hd 2 > u@ @ *  @ > u  @o > u!@j> u@ܐ!@&@ > u!h@\> u@ΐ!`> u@ɐ! @: > u!@J> u@"8@ &@> u@>"` ?           > u"@&> u@"    *    "  P? I  4 2`"? @ $ @  @@    @   8 ?[ Z#@u" r:   "@  C  ? ? 53`" @ $ @  @@      ? ! ," )      &  !> u`і "3&@@  #ڒd "㿘 > u@ ǐ#  @  @> u#@@B> u@ #x:  @> u#@@4> u@ # 2  @t 2 m N @ > F@2  2 `""`?"""@ >` 2!@  2@  ,@   $` $` "  $@" "$`   @  @> u#Ȓ@є> u@ C#"  "`@I  " ?& P 㿘  "/.` 2 !> u`&`"   & ` !  ` 2  쀎` `"  "` ?"& &   .`> =!x@9 `  & 㿘 `-> =` `  &` &@ " &  &`> =!x@:  &` &@ " &  &`     & 0!x@!㿘>0@b㿘 2> v@  > v > v  0 @`X   !> v  @  2 㿘`/`a> = "D        @ @ a&&   J `  @   > => ="b@"8> =D@a``(`` "`"`&`"``` ` "`"`> =<   < > => = < H 㿘> ="D H/` /  @#%> ='> v HH 0D #`$H! "  H 002 @『H 0> =bH ?"bH  `$  @&`$ ``     " 8㿘 H/` /`A> ="D`` > =@ ~bLH 0 R > =D> І> ="P"8" =P  P` 2``?"`"H  <`` " ``@ 㿘> ="<`> =@ ;"L!> ="H "H "H > =mbD"H ?$"H }@"0 ~@w@> 0@@= v@( 08H> =D   H`6$"> =D @"> =H HH H> =bH"` "`  "`> =X" `"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@ " `$ $ `,  ?   ,  `   2 $ &`&`&` &``6# # #@   "" `$ $ `,    ?  ,     2 $  " `$ $ `,    ?  ,     2 $  "     2 0   " "  "     2 0   " "  `㿘` 2 H 2 H> v@<!  @@:> v@5!@&  H @" & H@`"``"``?@"&@&` l  t" `$ &@" & &`@C l 2 <> B"h@h < `& <@& 㿐\ 2B > " @ 9"  @*@@ @ # |@ d4 *@ > =*`"T*@ > @*` T@   . `$ >.>.!b>.>.!a|$$ > Р#  2 > " $     $ ?$ " ` ( @@  @ (& > v!`@& & & > =d ?`& 8& d& P& <& 0& 4& l& h& $& (& X& H& L& & & & & "d`& T> v@r!& & &   & : @ > " @  & l & &  & t@ w&@ r& , $$@ В  & @> v> v> v `@4!q@ $& x?& p & |& & & & & & @w& > B"h $`> > v 0a#\  % @ > ##`&  "` ""& 㿘@w& p㿘 L`" > v@!  `  "  > v> v> v `@ڔ! "  > v> v> v ` @ϔ!`"  "`> "# ? "& & 㿘 l "> B @"h@㿘` > #Ȁ`> vb@@qI @w5@.@wi 2 $ a" > v@"P  @w@ @wO  $@   $ 㿐'`L`P@> v`d@z"p2` `" ";`h` 2`ޕ` -> v`b@ (` 2G `H" `d> v@"> v@W"В@t    @w`2`h`  $``$`h`d [ `L@` `$``"`L@vސ@v`L 2`H> v`d@" 2 `d> v#@ > v@ "7"@"  > v`d#H $@ ` "`$  ? "@& & `H`L?`$`H$`L 2 ` 2?> v@#$`` "` "$$ ` $`" $``$    ` $ `@"> v`d@#`"  "` ?"$$ ` $`" $``$ @`H`0@@d㿘  €@v@ @vM  & h`2 p> v@# > #Ȁ` > v@pc L 2  l d> w@ > v@q#  X  @ !@ ''~ t  `$( `,> v> v> v `@E   > v> v> v `@9 7> w d@B (b&@ &``"``" "&` "  H L  & H& L&  h  ?& h `  & 60B `2% @  8  &  Ô 0`""`?"""  " " &  "@א0?@`""`?"""  " " &  "& 㿐@uR @@@M.@I @*  4 `& & 4` @֔   ` @ِ 4 8@ `& 8@uX 㿘 ( ,  & " &  &&& &$ X & &, l 2 | t` |  x  & @ & |& |`$@&( @ H ??& H7"?> v> v> w@ "&`ఖP@J#j `&` "& &@ $??@ "&  <   & <& 㿐   &  H 0@ @P ]  ` @S  "  " 㿘` & 0 @@m @@ @& 4& 4@t H 0@@t㿘`  @@pQ @@l @& 8& 8㿘 L@  & & & P& `&   @@R3 @@N @& 8& 8" " " 㿐'@tA %> v'> v)> wr  < 4@ " Hఖ @$ @ 0" @tY`  ?%> B` "` "$ $@ $ l 2h 2 㿘@#㿘 '> w $@   7"#> w`@  2 2 $㿘@ :  p" `@*  ` d> w $  ( ,ƀ l X> wƀ! 0> w 4! 8ƀ < @> w H!H Lƀ P > w !ƀ  > w ! ƀ (  > wƀ!   > wƀ!   > wƀ"  2 $> wƀ"(0> wƀ"@`> )#HN' a* > w@^"PcH*  $> w> w> w!> w#> w%> w'> wІ؞"b> w> w> w> w> w> w#\#`#d;h;p"pb⨘"@8b > > w> w> w> w#b @-(> #cH=  a2 > wd#8X@ " 8 > w> wP@T X@N > wd#`@ ?, > wch , $@ ?@, > w @#p @?@,  , @?@, @, @֐?@,  , @ː?@,  @, @?@, > w@#x <@?@, @, @?@, @, 4@?@, > w@# @?@, > wc , @ d@a \= cH > w#㿐 X $ @" l `> w#@y> w`d#$0 3 7"'> w)> w`"#\@`#\ d$#`@V# X $ @ `@K#\$> x`d X@A 0  դ 㿘`    ` " ` `   㿘 "   ( $2  (  2  $`2(㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' > # T  ' H 0          0 0@ d   & d㿘6` " X@q X @qQ㿘 X`€㿘6` @3㿘@^㿘6` H /f * '  X> c @Ò H p@㿘H /f * '  X> c@8H 0㿘> `>  X6` @ 㿘>  X`@ Ǡ 0 0 Ǵ 0 0 0 0 0 0 Ǽ 0 0 h p p p p p p p p p 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ɼ 0 0 0 0 0 ʴ 0 0 0 0 0 0 0 0 0 0 0 Ĕ 0 0 0 Ȥ 0 0 Ȭ 0 h ( 0 T 0 ʸ 0 0 , 0 ȝ㿘> x @ 㿘> x`@O 㿘#> Bc(H'H 'L'P'T'X ! !!> #0"@#0$c(> x@t @> x@n!> c @@lE㿘> x!@\> cȀ    > x !(> x!(@㿘'L'P'T'XH/` /@   @LH 0> ="<`L  @z ,x> )#H'  <@J > x H@;O؀`  >L @;  L   > @2 cH > xa!P㿘'H'L'P'T'XH/ /   @9HH 0> ="<`H  @) ۰ 㿘> B#(`> ""`  `> " ````@;X  ` `> b""b`    > ="@` . :  `> "` ` `> #̟@`2㿘>'H'L'P'T'X 0 `0  a<  `   @H 0"  !< `" @"@!< 㿘  @? "@> 2 @㿘'L'P'T'X$       @6    @L4㿘'L'P'T'X  @sL㿘>  'H`'L'P'T'X    @`H㿘!> 'H'L'P'T'X@n#   @OH> B#(`@o#㿘!> @nِ#  @9 > B#(`@o#㿐?'P'T'X`'' (@P`*㿐?`'' (@ `*@> )#H '''`'' `: `   2.` K> ) . M`%`2* 2 ''? M`Z.>."<*` €   ? 2  "2   @  ? ?  ?L@  > xX > x` g O2> xh [O `L `   2.` > ) L.IL 2L QL@   $? @   :  < ,`   2.` > )!L@.L@: `   2.` ` L@.`L@`  @`*  L@  "`L@ ` 7 >`  + 2).` l> )* ڔ% `"1 0M-  ? (' '$ " +M`*  ?&?MЀ   , * ?РMЀ &?  , * ?РMЀ ' @M l2  " ?/     ? 2  "   @?* : ?:  ` -  ?> :  @ ?"" ?2    ? 2  "2   @  ? ? d  ?> xap '  Y x ?`> x!  @  "''@I'    ? 2  "2   @  ? ? & > x!> x!p ' ?  2  "2   @  ? ?   2  `' ?ǀ`"R逢 ".  5,A> x 4, 40 - 806 03- @ `0- @  8' 8'0-,4   4 - !'@ '$ '` /' @ & +` ` 2`  '# ? `  2.` ֐ . A ?< `   +` .3,/ + 0`   2.` > )  . ` 2.`  `.`2!# ? 0`  2.` t . 0ߔ ?"@ ? 0`  2.` U . 0 ?'M `  2.` 6 ?.??' "@ ? `   2.`  .  ? `2&> )#H > xפ!ȁ㿘` @@`% 2 x  H /m * . `"` " @"`xG"H 0 㿘   @ %&@   @  * 2`     0   $ $ Ho  "`>  "b㿐 0 +) ` @ #&@   @ה * 2`@   ` >   7;  x ؘ ج ؼ ؘ ؼ D   $ 4 T d t @  D  0 @㿘>  + > > .((S7> ܲ"P4P&ܲ.`(@2> "c ԅ.`( #ذ $> #؄!#؁㿘!> #  > #䀢 2 #> x"> x"$##,`:` `q$#`Q > > > Ѐ@"> B`( "㿘#> B> x (cX@'cX1> #> c !> B#@cXicX@cX#@&#> >  > B ( > "#"㿘` > #Ѐ " > x4 > x  > x> x#0> x}"0z#㿘. > . @> *` @ > xj#V `*`>4#x €> xV ]"0 > xY#0> xU# 0> xQ#(㿘> Д. cԱ>   !> #؀*> x#8=0*#ر:  )> `А4$#Ԑ& ?> ƒ`ԕ* `* @> ƀ`\ @ > x#X#ؒ& *`@ > x> x#h> x#x0]#Ա: $. > x#0T@> *` @> x#> x#V? > x#V?"T #> xcVo | V?T   4> x> xՐ#h> xА#> b* R  > "|  '> xVؕ*  *V? > x#㿘N -    N 02% N x  X2   `     ɠ  ]  *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +> J@    `,`cܑ:  4- *> : b|,`: @k2 `@Ȑ "`* cܓ:`@ - : ? &@?㿐%> C )> x'> xڐ#G@֐ (@ԐLJ@ "` "` "`J@   > y &@    ג㿘> #Ԁ 4> С. Y< %> y#> yP`(, :``y`Y`n`N, :  y Y cĐ. > `*  `   %>   "`$`" `$@ *R@? @ `R@?,   > yQ 00  R@? > "| T* \ y@T?`> y @Ro  , @ %   > x #>> y Hː0T#؀ > y X0K>  В 4D> x. < %> y#> y`(, :``y`Y`n`N, :  y Y' c#!> ƒ&  Г*`> y@ xؠ & *` > Ɛ&?`\* @> yʐ {>%Đ#㿘> #Ԁ - . > * ` R` "   "  > y4 > y 2` 2` > x > x#. ":  0> y 3> y!> #؀ > > y 0- В 4'> x& > Ɛ \*` > yx #> ƒ&  Ԓ*`  4 > yj  > y"  d> y^ 0[#㿘> #Ԁ * . > * ` R` "   "  > y " > y2` 2` 6 > x2#. :  (> y0+!> #؀ > > y!"0- В 4'> x& > Ɛ \*` > y #> ƒ&  Ԓ*`  $ > y  > y" . e;Z> y!0#㿘> y!0#> cJ@ j c,@@@M)> y`  %> yِ``` c, @ ?* : `2?*`>4# €> yÐ!h08> y!04> y!00> y!0,> y"0(> y"80$> y"`0 > y"0> y"0> y"0> y#0> y# 0 > y#h0> y#0> y# (c,J@c㿘> Р "#%> #> Ƒ, : % `А ?v ?$㿘> Р "# #> А"|,   > yV#c܀?\ > ?$㿘> #> Ц   Q"c> > "`* V @ > . ":` ,T/ `2@1!@@$ ). :``e `s`d > y# > y# F < :   T?ˢ` #Ԧ$?'c㿐L@?  -> L@    2`L@,L@` "`` "`` "`ܑ:  4-`*> : b|,: @*2 @ "* ܓ:`@ -`: ?2L@> z 0    > yM s0 㿘/ ?  c > "#>   `Y%> Ƒ.:   @`2L $ @D 2D $.:    T `` 25 $T 21 $T  2+ $a *?  d e c > y# f> y# $ $x  $,`:  $/?  $ `Т @6A? .> !> з: `\#ؑ,`@ -`+Б?  d"# e c #> z f"> zT#8 А* : А ? `Т@ˑ,`?  c> А?"c㿐NN    2 NN "  "  " N > z 80   > y.`.: :l0 㿐.`?'> C> >` ' )> z X@ (LL "  "  " L :ے 2"L> #􀢀 > x#-`* * @@F  `a> zm `` ' ? q  ј f ` Q> yV ` `h@ $> #> cԨ   > z> x0;.:  > > z5 02  `  @`2 $@ " $ 2 > z> z 0  aà?$* *`> z` !' '`'` '`'`'`'`''77ڒ i=̀? a.: ,: 6#Ԁ !̑+` * > ` $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?> #(Ԓ@И*`# ؔ@ "܀"" """"" >   R   2 >  X`> ̖ P  R  @  2 #Ԕ %#Ԁ` ? @`2$@1 2 $V  2$V4$ 2@   ? @`2$@  2 $V  2$V4$ 2 !@`2$@ 2$V  2$V 66 $ 2R`㿐N  /> N "  " N - N    2  J@ ? @E2  @ "  J`NN "  "  "  M@ T > z!@O *` ?* : `2A*`>5 X €N > z!`7  > y> -"#N > z!x%  > yW-W N ’ > y ` `> z> "#> z_! N i   > yWm c@ 0N % X dӰ  lʰ Ö > yWG dN > z!  0 e Z   > yW eN > z! < W } d> yW fJWu  0qN U> yP 0j q&?0eN ^ 0^Ԑ[ N  9> yN#> -%> z$`,  *`:   2 NN "  " N   `,"  t`,Ġ`, `,`,} y  > #t `?"#t> z"> z" > zh! > zc"( 㿘!#> z> zZ"@> Bc0VbX@T ( O > zI"`    N - 2  *  > (!<2  * > ( 4> 2`6?> 6?> *? @ `2 ?@ (@* ?> 02` > !? @ `2 ?@  (@* @ 6?> *"? *?㿈@ nܒ "   `` ?0`"0#\ #`@#  㿐@ n "   0 "0`#\`#`@  8/ `   $  Ô  l   `  ''''''` '` `G `  @`2   \   ?  # & P8 >B`C >8`>P   _   `" 0,?`&0¨0㿈@ n "   `` ?0`"0#\ #`@#  㿐@ m "   0 "0`#\`#`@  8/ `   $    t  @ h   ''''''` '` `N `  @`2   ŐK \  ?  #   L & X@ >B`C >@`>X    < `"5 0,?`&0ِ0> ) #H@'m@    2`Hb b> ` @ ?* ` @  * " ,2` ð  0 $ 0   > p `傔 2 0 @*   `$@ b|"5@"{"WT i b}b~2b @ 'l    ?4    b~Ul@ 'l  @  ?4    b}Cl'lT   ( "<  `"@  @4"D   'l' 2!<(  'l   `vl 2  ( `<$@ `w@  $@  2  0` 0 ,?`$ 0 0`: H > zɻ"pH @ 4 ,`,`,  i ,`,   ''''''@Z ''?'ȴ'` 䕔 0` 䌔 0` 䃔 0` "y  00  k? '  '?/a  '''' /> C0㬓Ho  @"`А@ i e` ,kU@@V"" ''Вb@ ??T!@ >  *@ *`" *" * iH/` /0`@㬀 H 0Ho  ?"`> C> z#!H 0 Ho  ?"`?"  #" ``" ` 2``㷔 2` `㮔 2Ѐ 㿘'D  'T  <T> z" -4* %@,k  2 02  $ 0 ` D  4`*  `-  & 0 ,?`$ 0v 0A " ?@&Ց- Α4T@'@  `E㿘@ 8 "&@N " &@ x> C#@2&@` 6`㿘 "wp  D  > Cc  "c> C6 .#( 3&H /m * . x> C#@2 0J5 ސ 0 0 @0Ho  ?"`H 0㿘  @* @` 6`j\ 2 0 6` $ 0 ` V`6` 0 ,?`$ 0ѐ 0V` "` ڲ`&㿘 @ ` ⴔ  ``   `>  `<` `  ,  9 @⅒ ހ@ 0`2`@  ?,#@:* "**% *"@ *`@ *`?!Ѐ  iȔ?̐ 'Ѐ  '?/a  ''''Ԧ 5> CHo  @"`M d?,iKЀ@Ԁ@VȐ"" ''Вb@ ??T!@ >  *@ *`" *" * gH/` /0`@ H 0Ho  ?"`> C> z#!H 0 Ho  ?"` #"@@?  @0@ "  @@@ 㿈 #> C( Ɛc@{ Z c⾒ @s Om I 2 > 2` |" ("`&mt 202 2` " ("`&$ <$`<, ?",`0?"`0`, c`0, ?",`0?"`0`, T`0p kYnݒ @ @_(㿘> `@ " @x> a0& && & & "a0 㿘 & @ʒ & @& <& D 2g 0 0 4c& 8& (& ,& & $ 㿘 @!1> z"$ @!"Ζ " @ !" @ !$ @㿘 @ ~b& @ |& @㿘 @ @ ?& @  @ " @u   @   8# 㿘(  {`D 4$`D`  $`$`@" $@$`$`% ;  ?$`@3  #`@> z $`@!b 2)`D 2#`D@"`@` `" 8 8 ` I "` 2`Dg=` `D?  $`D`@  ?$`@_` @!T@8 ` `@  ?$`@P` @" !d㿘 ( <   @ " D  $ D@ #> Cc        @ c $c( " D? $ D @  ?$ @ 0 " @ $ `R 2r D "@@(c @@ "@ @4   @    " > z粐"$    $ $@"$ > z瞐"  $> z畐" 2) D $ @   # @> z $ @!f 2 D @ 2   " D @   D?  $ D @  ?$ @|   @  ?$ @o    " 2f1 ( u }@  ( ~@ @ 0@ @ 0@ @    88 "㿘 (`A <   2  @   @ 2 `" `@ `   ` @" !8 `A  @ @$ @```@ @$`@㿘`(@瑒 p&`  &`H   @  C B?@>`8>`@ &`  $&`$ (&`( ,&`, 0&`0 4&`4` &`` &`㿘 (& @& ( 㿘 ` > Cc?"c> a0> ߔ" "a0ఒ @9 & 㿘 + @ D `& @!> z @` & @ #^  D` <   @`$ @$ <> C#དྷ`4(R` < > ц"`8"` " >  "`8 "`"  4(R <"  " ` 2`?  ` 2``?"`" 4(<" @2  `" `@  2     4(<`" `@" @  2 "    ` "   㿐> Вc> C> z#\#c  H  Ә  )$ )H ) )4 )\ ' ( ( /4 ( ( /4 *X + + * ( ,| ,L , /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 /4 -d , . - / 'p '0 '0 '( '0 '0 '( '0 '0 &p '0 '0 '0 '0 '0 '( '( '( '( '( '( '( '( '( '( '( '( '( '( '( '( '( '0 '0 '0 '0 '0P@  ` 2`0G `0 ? #@`$5>I!h*` €`88@+b/ h, ` `!@ƒ `8 > 3"4 @ "& h2`L  L`5 @2&0&@`$ >I ԓ*` €`0Ho ("``La 8$`\  * $aa@归 Ͱ `  '` :Є@   ''??''''؀   @ْ &`   Ę :̖ '''?'''쀠'>I ( €  '=ؐ ' 8ؐ ' 3'a8 ` * : @ '䀢  h  :  @  b 4耣@  '''Ԕ@ J@n̰" `'} 0;` 8 ``".a@u /'a` ) `L 8`\  `0e 2> )#Dy!`0$`\Ho * "`a@ L`5 2` `4aTH /m * . H 0 ` p  &` `0Ho ("``L 8$`\xӐa    * $a &` `  @䦒 ``'`  `   $``  a `0" > z> z> z#(c8X㫔!@   r P`۾ P @t 0x0" > z> z> z#(c8X㇔!@m h  N P@t `ۛ P 0U0" > z> z> z#(c8Xd!@J E  +!`w! @tǒϒ 010" > z> z> z#(c8X@!@& !  !@tl `T! 0@t'` G> z,#x㿘`  ``0!@ `8 2`0> 3" `0@ # 㿘  Ӓ `0@ `$`` `&``?@@ `=  ?c'?'''''''`$@~ 1`+ * @ @ : C >? 2  =#@@ B 4    =# =#" & 㿐#\ (   @EB 㿘 (   @C] 㿘c  (L "7cG2K  "~ ""}2?  ##28  ! >3 G    |" ` | = 3 3 3 |3  P # <` `# @` @$# D <  "  2  " i r   @     `    @ 㿘 ( H /` * ! `A L `@:   2  T 2 2  8 ` `  "@  " 4    2  `" 2 8 ``  H 2   @  `| p | 4 |`t   4 H 0㿘 (@d p0&`  a$ L a$&`  2 ` &` &` Ȕ&` `    㿘 (  @A$ (㿘2` ` `@@@ 0 `` @  ``@@   㿐> D@ @ (( > "`"`"` #\"`"`> D> z c   8 > D x" x"`> D> D> D > D"`t"X#!`"\㿘`>'@>'` (@`@8  @@ې 2`h  7&`h p`h_ l`h 2e`h`l`"`p`p"`p> D" |`p?`l"&`l&`p`d`h &`d` &`h> z`h Ė @ݐL _ 2;`h ` 24`h`,@> D  > D( !HĀ@8'Ā > +&`&` ` a > &`D&`H&`,.! 2 `h@ ` `h? &`h`d `hN 㿘 `  @@`b@X  f&!  a " `0`b> D > D> DaXD  @ a ـ` `&㿘  `@ `> zG#@@ t  ,p> D!@ k!@Ĕ d h ,  $"@ @ $ h> D!` )` (,#> Da@a` @> D "a\ d> z $ d! 24 h d 2/ Y , $" *` a` @6` @( 2` Y #@ 2 h@L d  ?$ d d " h Y h? $ h d  h 㿐 @`` `@@' N J! " h0F: Z)> z $ h`( d`$ d!# 2) h d 2$ Y@ @v 2 h@@ d  ?$ d> Da\ @r"a\& h? $ h d  h6 㿘  ) |@C (> +D> D> DH> D xt```? *@& & & & #t t6 & ,& H& x&& & t& l& p > DX l # "X  > Dx"`2ld  > D x"2ld 㿘> D x  d " l ?$ d l 2 d㿘 h $ t> z##> D? `"`& x "@"" @7  t2 L aX?$aX㿘!> D !`d > Da` "a`$ ߐ  t ` @`6 4 㿘@5 > D > Da`?"a``> + $ ( " $" ( D8" 8" 0"`  x` "` x " x > + $ ( # $# (`D8# @# 4  # x? "" "㿘 2> zd#q   @  4 00`$`` @3:   @4W(( 쀢8$ ` $`&` `   =   @ 㿘 @(> {  8'  "&  `  2  @ 㿘 E `B > D!@ *` *  &6   ,   * @*``>   > D x  ` ` l ``ː#  J J J J J J J J J Kx K LH Lx L M Mp M N$ N| X Yt Y Z( Z Z Z Z [㿐!> Р#> D> {#\"0`  D  Ջ > D> {#\`(!l   dՁ !>  d  5*  d> D"b,* . > D> D"ah"d㿘> > ب `l ( ׽l ؐ?"% ؐ!> D"ؐ!l֒  #> D ֊!lad    2  & 6 ad&$ad㿘@  > D!d   2&@ 2 S  "i   2&@b S   @K 1> і 2@`R2<` 222R 2F  *`:   3 > Dad "ad> D > D 2?"#al>  ؐ?& ؀@ *  "  "@  *`:   * `3  32"  㿘> D!d J '> T   @(  *`" S  *`: @ 4 *  "  ?"  *`: `@ݘ *` 2d$d@$@> D!lҒ ؐ?$ 2T 㿈`?`  >Q!4*` €` f  >'`>' (@#\#`@@P ? c@ \`>  d 6 > D",,   >`  @2  >Q!X. € > `$ Ԓ  `" $ ~# > Di"0,"@ ’@ D > +$ $   aD > $ ,$ u!  Di! &  6 . * @`'@T! &  6 . * @`y'@?! r&p  6l . * e'@+! ^  ` @W.` @   ` 0L! F&D  6@ . * @` 8'@ 1&/  6+ .  * 2   ` @ .`  @@  ` ?,]0 㿘   @` @` >  d $ >  Ԓ"@ > D  Y"0,@*` |є $` 3> `d . -> D > D",@ `! `d l ` e &``T,`~Z > D"0EK,d ؔ "X >  d > D",`" d   , @`2 d2$`2 `> D$@` $``, $``?h$` $` > + * 2 > DD ",, 4`$`,4` $`$" > `Ԩ "`,?c *  &   ` `} > D"0X ?@` @'L '> `d`d> D",- 'W@ @   `2 L "@  ` ' ,`  {* Ȩ',``*G 2 9> D 7  @ @ߑ*` * U` `` # * `2  2 `2    2   2 `@2   Ϛ`F @:``* @*` @  " 2 `(2 #U` 2  4  4",> {0!$ ",'@ W@?c "U`y Y 2 ?4 ?4  k `I Z> ++`"= V` 8 @h 0Ā ?+` * !> {`"V`  @Q "ـ 8 @4`* @*` @  " 2 &  ` > +@ *@ *  8$ `> + D$$> Db,h L" | 㿘> D!d!d I+> D 2 BT  6)> Ѣ @63%> D,`  ,(V `V > { X` &`> { x + @ *  @@ 2 @ *` 2 ,(@T `@԰ al$T ؐ?% ؁㿐` ` 4 `6 ?`>Q!*` €3> `d'9 `d@?#@ *` z} #> D`db,*  zq* !> D`d!h*b,| !h| $b,$!h&`dp >  d ' d @`H?#@Z $ W >  d ' K  G/ C$ >  d 'Ә 7 @3?#@- $ * >  d '  @`4$   >   x>  |>  >  ” - a a ` ` ` h hp h i i> X 6?> D("2 (?? > X@ > D*``:` "`   㿘#> b  8`  @, > D#@`> D> D4 ""@?"#"㿘`?#@ >  X@ 6( '> D,` >  "$  @@.* ?&` (> + D*`$ 0  4 ( "  > D"""@ 㿘 $ `! @`?" `  ?"@@2 "  $  㿀  $ `@!>  P  *  y&   $@ `?$ @  $" K@ 2`i @!!ג ^ @` ?     ?2 I > "   ` .  ``"  @?@2. '@'8@-@, #`#\#d $@ @ > +$@ $  8(D`$ 4($,&@@㿘`>'@>'` (@`@X  @ː P 8N >V#4. €S! 2A@ < : 8C 21 < 2*> +& &   aD > & 4& ' 2 & V ("` & ?#@> D> D"b* " 㿘> Dc. @ "``"` @(`  && ? #*`@'  㿘>   P``  P+> D b >  "  %> D  , 4  (@ @?%b#> D$ `fc > D `c?cy  #b4 " %bf$> D" P  @ > D <+> D7> +c` `@ ,``2`P @ c> {   ` #" > Dc*  <+> D7> +?#" <+> D7> +c,`"@ @]$ < ,`$$  ?b?$ $ $   * 3 4 $ ` @ $  *`@  8 D$ $$ 8$ 44 ($ $ 0$ ,'@㿘`@ a$@ x@ `"  2 #㿘 `2@'&` ,   w4&` κ@ `> D?#c? * @"@( 2(@ 㿘  @  ?t`@  x & 㿐> Вc#\> D> { ` ##>  @1 `P   v*  > D"c* vޔ > D"b> " }`P> D> D> D$`P"b""㿐` `4 `6 ?`>V#H*` €!> ] P  > b ` P P`* : 4# x >  P 'A l @h`f $ c >  P`', W`@SN?#@M *` vp !> D`#*#x $#  v`* !> D`"*"x  $"&`>  P '  @` $ >  P '    6$   - z< zL z z$ zD zL z4 x y y y y y y y y y y y y y y y y y y y y y y y y y y y x y x 0 T x 㿘H /e * & `p &`l &`p`@ &`t`p =&`pH 0 㿘> b""b@ j  & x | ` 6 @? "@> 2 |] @& p& | 㿘`l *`$@`(" `H /e4* &@ @ cH 0a > D#`DB:#` &`D> D#`$B:#Ȓ`&`$> D#?`B :#7` @ . 22U @   `x` @2(`p" `!@$F ! "!@$>!  ( 퀌@`@"`p@ !`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@`p &`p ` ! @`*@&`@ @ ``( "`@ `&``5 2  ` 2 `@p @ ʒ   2 `x  `@Y @ `x  `p( 2 " `p2 `n> *`4 * `&`p@ € 0{"e`pw  2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@$a`@ @`p2/  +`V``@` `"`p@$I`@ (` `p@ ` @ ``"6`@"Ð`6``p>*@&`p 2B  >d< b`@ @$  ?"`p@ @$?  > {   @@ @$?   ` @@"`p 2  d" @ n`p 2` d` `xՔ @2v`p@ r`p``( # V``H 6d`p @w_`p@( [`p`@"| S  @ @ uK`p   2`ހd  6`@#’`(@  `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@ C 2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@f㿘` 2 > D# `d``B ;#ؔ &`d`H@! ۰? <  9 `5 `ܔ   "$ H /e * & > {`H@"j!> Dcذ&`d > B;cؘ&`dH 0`܀6`?  2?  ` > D# `d``B ;#ؔ  &`d @!`H " 6` 6`܀ ` 2 ` ?  4? 1@`@.@?`>Z"l*` €  ' ! ^ ( ) \? @> Dcؐ \`dB:cؘ &`d@!]`H =`@ > DV`܀ "2?> D# `d``B ;#ؔ &`d@!@`H  > {  `?`V`>Z"P*` €4 6`` " 6`  6`ܰ?0 `@#`}@? ] r@<#> =``^@F!> \`{@Y`z+@@+#> =``@%`e@ `u@#> = ` @ B` @`@<h  g@ #> = 3 `@/`@ -#> =!> р Ő   a!!@ v !<|  0`"hx ` ! 2h! "h@ "!?`n@ `@c `@G` @`^@`a@ڐx @ " h8  w`o@"@ug@ "!< s@M][@W b@"# "}@ <8   @ ] r@Z?@ "t"~@?5@/ `Z@ e@Ԑv@ `g@ϐ  `@`@ 0H /e4* &  p p ?$pH 0 H /e * & @*&H 0 H /e * & p$$pH 0Ӱ ` ` @{˰ 5> ʠ"  " > { p ( (> { > {!В @ '''''@`5 @` `!@@& @i= $"> b""b @ " 0 , &666w6H /e * & &&H 0a |  0 2 x~% R x " ʐ#H /e * &  $H 03 H /e * & p ;$pH 0 HH /e4* &#@  @b   H 00 @2@  I $ ( 6 БH 0 € " pH 00p2   2 $ ߐ"$p@$$$($(` |   ` @   @"<  ! @4`$@֐-@ ( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $ H 0Q > " lI  hE H /e * & h> Ѡ!@*`  €. €  h*` €H 00,hH 0 H /e * & pa   * ~$$p@TH 0   ` ` > !<| ܰ  0 > h!@*`  €ΰ H /e4p* &p n> *`4 * `$p@€ H 0 !< @  |`"!<@  `" !<@? "@> 2|@ @!< 0`  "!<` $|!<$x!< "` H  "r u!<| i  0 e2 a  ^ [$x@ՐX @!  Q 4 44x4E H /e * & t@** *@ *$t @@@$t t $t @t $t t $tH 0  @N  㿘2  *>  `4*`@ € H /e * & `A@ 4   @` p ``T  H $  `ڒ `Ւ H 0㿘6  `*`>   4 * @V`? ?2  > ѐ! `&`8> ѐ!0`&`8&`> * `4* `@€ <H /e4* &   "2? "& H 0 㿘 `>> * `4* `@€`<H /e * & @u$` H 0  2 `  p 2` `  4`   㿘 >> * `4* `@€ <H /e4* &   "2? "& H 0 㿘 >> * `4* `@€ <H /e * & HL" & HR䀢@  H 0  㿘> #Ȁ`> {a@5  @" @ !  (    " 㿘 H /e * & ## @ H 2 p p + p`2  # ̀ `& p> і H!@3  H  p` `2   ̀`H 0㿘 @ 㿘H /e`* &`  (`" @ ( `" p@  p>*@& p6 @6 @j`>  n p* ~ 4& p*  H` H@B H 0㿘> ѐ  â 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @ H 2  p`@@3& p @@ Ԁ €   p @& p㿘 > {!H /e * &  p @ & pH 0㿘 ̀`@ 㿘`F 08 㿘 p ` @` & pސ3 20  n> *`4 * `& p@€ !  p ` & p  @2  | "   "    `@& p 㿘`" p p & p ` & p  @2  | "   " ߒ   x> #Ȁ`> {a@4    p*@  &  & p   ' ' '''''& & & `@  p *@& p㿘f 㿘> 0 'L   ऑH /e4* &@ H 0<| +0'x#   `  `  > => ђa!@a `ऑH /e * & a;>  G @ʸ  &1p0z  )s`   j >ebZ Y ]` `W` "p0Q( N(p  @  L  H 0  H 0 #> !> і!!@ H 0`" ` 2 #   # p  #m`% H 0%> =5> E 2  d$2 x 5 `:!@ 2 2 ' !       d  @ 6 H /e4* &  @H 0`k` 㿘> #Ȁ` > {a@2u  p @% $" "  @ H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` > 0 a  HȀ@$@"> 0'> {` !@"  pH 0 > `  & p  Hm H@H 0 㽐> )#H`'V     H /e4 p* & p*   @%  H 0  > ёH 0 # !@ H 0H 0> 0 < | 2/`0 "+` x& @" 2!` 2` 2`  x   > => ђa!@b i `a  @2e&` Hj``b8"Ӕ 瀤@4`B) '> D/> { @  ?@6 p 6A H = H9`0  H@6 ޠ$ؖ ܚ@  d< C 6 ܒ@<& d $@  H`4 ``2 `4 `&`@LF H?H /e4 H* & H  H 00 " pH 0`&`@ `  #> ѐ & p H!@ H 02`0cH > {5"㿐` h  *@`z&`V`ހ &`ސ> > {   `?e>Z"* €@| v`` @"r`ސ@s m`ޑ*`:  @{0eH /e * & `p` @ V`ܐ``&`&`p6`@ @@ ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ j? `> {" C`ހ` `p 2 &`p \S@b``@]`ސ?6`ށ㿘`? < 9 `㿐 @?* H /e * &  (@@   @'@  @0 @@  p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^˒  @ ?Ò㿘  p   x * @2``@2@?㿘 @ϒ 2`@: !4! & 6 6  (  h* h 4(  4@` 3* @*`@*`6 p > "Ԓ d* ,  , $4 @Ɯ d@~> {bH& | 2 x> { bX`2`> {bx  > {br6 ި@o 2 D t* @*`"@*`@*`dL54  5  $`8 v* cД b?  '?/!`''  '?/!`''L5 ' " > {`2 > {""> {#! @!##\#`@##d d@#h#l> {8bš6 ށ "c  5 2 `5  `5(  "H 4 `ll+8 1`8  ?@ ") $ `"`8` 0`0 2`8 `88  㿘H /e4`p* &`p    ` @ H 0?2 ROH 0 㿘  "V , : @ ?> D > D Н㿘 > e:! $@  ($@  H$@ܔ &> D# & "@" > D>d "Вc 㿘> DcА? "c> {R#`"  "`> D"# ?"&& @ː @ɐ (@ǐ Hf >㿘> D#Д *`  d* &> Dc l""("H" 222p"|"x ""  " h*$(㿐`H ?`<>Z#*` €> DccԔ5> Dcؐcܒ˔,> DcȐc̒”#> Dcc> D#В* Z+ f7 0@t 㿘   t t @ @ t t @!?㿀> { #0!> )#0 / / / / / / / / / /#H/'@ >@ŗ >`.`-$.`"> {> {#@cX @  p ///.`7 t6`"6`$6`&6`(6`*.`-.`..`/.`0.`1.`2.`3.`4.`5.`6.`,/#H > {C#㿘.  d 㿘!> hY"> "  > b1  ⌥,$,⌀ 4 ސ!> ∢"*"e $"$%> . @    c̐ 8$n"h?" h;"> {# 㿘 $ > "b> ""@P 㿘? @2  `@ Z> ",   2X$ p  $qL  0B"$ ph # a %$ $ $ $ $ $  ̀ " p p $ p p`2 hb`$ p7> ѐ !  p `"$ p h> ђa@* @€@ 㿘?2  > b. > a@ h`* @€[@ 㿘?2  > Ѱb. > 0@  ` "h a< | @ 7`0 3 x"0 (%)> ='> a2c a2_  ` W  } !! Ka< |   `0  x2a ( 2 (6 #> і (!s "`0* $ (` "  (@ (^  (  2 (@ ( ( 0  > ha@* `@@[ 㿘?2  > Ѱb.  ̀   h> ђa@* ` @  㿘 l? 2`> ѐ  *  pa `  * "@$ 㿘 l? > ѓ2`  * `   ?" .`* ` ``@ 㿘 l? 2` > ѐ * `S  P`L  㿘?2  ' "> $".  @ $@ ̀   h>n> ѐ a@$ ̒`*@    w$ ,`!$`,` 㿘?2  > b. > a@ h`* @  € p$ ̒ $ p(?> )2 H > Ѱb'.  @  )v> є P! gH p `  ` `T VH ` @" ,` ``,8 , ה,` G `"  H `! "  H: <H,`! ŀĀ`  +`  `d8 d @ H@4 `T  H   p  ?$ p H~ @aH > {# #(> )cH? 2  > Ѱb'.      `p   "=``( y``",`(  `d8 d#" 84J x `p ] @`(`` `(#ٔ`(@ (Z] Y 2 d8 d4 H `p "C  > Ѧ!T``( # ``!2 `h,``p `h* ?  `` ǒ `p  ``&` #> є`!Җ "i`p`&` @H > {ΐ#㿘?2  > Ѱb. p  h  [``A)H /e4H* &H  p!"  `` 2  ` ! 2 H 0 `  "( `( #``!`` `` 2  ` !    `# `  ѐℑ* R`   > ф"`8 > ф"`8"` ѐℑ* @㿘?2  > ђ@*`   `@$` "`  " ` `@,  `((" `   `@,  ` 7$` 6  * > `4*@ >n"@2 `h i@"W @"_`H w@"$!8x `h _@W f@"8o `h ` @ ` @E p@"!b `h `@\`@*Z `h7`H>  D@ `x 2 ˰  &   &       ?     ?$    ?$ M  `H@ b`H `h?  ` ; `x x  `@ `h> ђa@* `@@ U 6`  !@  `J, !" X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@,  `"  2  "  `@    $ , Ւ 0  `@ ߐ $ , ʒ 㿘`"3   & -0, !> > "! bS"3> bb  b4&b> " &b "bZ"0 > "> *   " ̀ 㿘!> b "b&"㿘!> b" 1> !> "@א "`b!41? # @*  ` . 0 ,@M 0 `< ) k\ @t @S: '''@tkH `H  $`H@U㿘>    > >  4>m`D   4  0 22 4> {#ȁ    㾐   @''(a?x a0?o =A0_? 2`  > ",   `"' ''''f  5 0 2`> 2 #`"` "(@uX`-h''l''h@LL' x X`$   >  @Rb!' 'j'x@sj "x@Uxu @u'x`D  `@( @tD x@U2  ''h''l' Y 2``2 " x "(@tx&&`"6`$6 `&6 `(6`*6`,.`-.`..`/.`0.`1.`2.`3.`4.`5. `6.!`7.", ?",`0?"`0`, `0, ?",`0?"`0`, !`00 <@(<@"`㿘+ ڼ ڰ 㿘> 0 `h G  i A  [!> Dc> { "c `> D  "` $``Xp$`a⠐  <`$`> | `$`@ `p`&`> !@ $a€ ]y  &`p}>wcaT㿘 . h!Tp ]d > Dc& ؐ? "c> D"#> !D€㿐  $  28&&L>`5-: 4,-@ c,@3`+ b2`* +``*`0(b2*(@C*@3`+ B2`* +`@ d*`4`, `0(,`@ b(@b2*2`* *@*`@C0( P+ =3`( D+` @ > B &L pe􀥀&P@> t<> &D>p&H t "2> !@   @   " $&D !&!*`" *  * &H& 2> . @  & 2 > `P4> ѐ`. &> !T€!x @ "  $ N `* `, * : . C, # `,. @!  "N x> |@Ȧ` , % LЖ  `2*` *А *ɑ: @ L  @@㿈  @  $@耢 覂 B!x4 !D2 !|8!D !D>!x< 0( (@b2`* @ *`b2*@ *@B2`* @ *`b2*@ *@ b 2`*  *`@C!H+ 3` +` :  @ `  >!p> & |@?#耦 & > |"`0N!J & * : `.!>t"T*` €> | `> | `(> |`8> |`H> |`` \@1 > |`p \@* JAV`0 & &  & ܀` &  2!!Ty"X!  & 㿐N  `J@  / 9$2U?J@ "N O?/N?N * ?В@  +  +`  Г*`** gЗ:* /7///#: 2`* @ *` b2**@ c3`+ +` B2**@ c3`+ +` b 2**@ C3`+  +` >@ 㿘N#    2 1/.2-`*: ?В "@@@k>t", €N 1 3 9 5 9 ` N  /$ّ*`2e?N .&  N"?/94N- ,* *`?Г:`*   N   / 9- N :?=`3`+  +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b 2`* *` B 2* @沣* @" ; @= @ D>@ 㿘   & !T]"X0&    㿘> 0 `h H  fk B  X!X> E`> | "` > E  "  $X $\mt$da⠐  <$> | `$@Ʋlmeh&`> !@$H€ Z#  &`m'>{`>㿘 . hS!m Z > E`& ؐ? "`> E" > !D€㿐 ؀ H 5a&H&L>`5-: 4,-@ c,@3`+ b2`* +``*`0(b2*(@C*@3`+ B2`* +`@ d*`4`, `0(,`@ b(@b2*2`* *@*`@C0( + =3`( D+` @ > B & 8e􀥀&>> <:> & >8&t "0> @   @   " $&  &P*`" *  * &&P 2> L. @  &H2 > L`4> ѐ`. &L> !T€㿈!L @ "  N  ;  !L .  * . !L `"N @㿈 @ @耢  J  B  S3ؐ< D S2!@'9s D!@4 ! 2 !D8!  ! >!@< 0( (@b2`* @ *`b2*@ *@B2`* @ *`b2*@ *@ b 2`*  *`@C!+ 3` +` :  @ `  #>!8> P@& D \` & H d  ?> |& \& d` $@!  N   N   & & \&  & \ \ 2!P!p"X!P  & \㿐N D2?N  :2?N  .2?N  .2|?  * :  .  ..  .  . . . /9    `J@  / 9$  2U?J@ "N O?/N?N * ?В@  +  +`  Г*`** gЗ:* /7/// X: 2`* @ *` b2**@ c3`+ +` B2**@ c3`+ +` b 2**@ C3`+  +` >@ 㿘N# `U   2N  :2?N  .2|?N  .2x?  *:  . . .   .  . . 1. /.2-N?В "@@@">w#, €, :  1 3 9 5 9  N  /ڒ24?N 0?=`+ 3` +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b * 2`*` B 2*  * >@ ?㿘 \   & \!E"X0& \㿘> 0 `h H  cX B  U!X> E` > | "`  > E  "  $X $\ja$da⠐  <$> | `$@ßljRh&`> !@$H€ W  &`j>~a`+㿘 . h@!j~ V > E`& ؐ? "`> E" > !D€㿐H 2R &L&H.>`5-: 4,-@ c,@3`+ b2`* +``*`0(b2*(@C*@3`+ B2`* +`@ d*`4`, `0(,`@ b(@b2*2`* *@*`@C0( + =3`( D+` @ > B & 8e􀥀&>> <:> & >8&t "0> @   @   " $&  &P*`" *  * &&P 2 LL 2 .@ &H`4> ѐ`. &L> !T€㿀!L @ "  N    !L .  * . !L `"N @㿀  @>?@?  ?JL@?~ং@ B !@D 4 ! 2 !D8!  ! >!@< 0( (@b2`* @ *`b2*@ *@B2`* @ *`b2*@ *@ b 2`*  *`@C!+ 3` +` :  @ `  #>!8> P@& D \` & H d  ?> |& \& d` $@ J 6 8 9  &  & & \  &  & \ \ 2!P!Z"X!P  & \ J   J/9$ 2?J?J  (*`8(J АX   '''''''''''''’ ? !m 7@l d  @f! !n ' ? D?   +`` +`@& 4////'/: 2`* @ *` b2**@ c3`+ +` B2**@ c3`+ +` b 2**@ C3`+  +` > 㿐N  :2`?N  :2\?. . L 4Q?/ B ;4G?/ 8 <;? ("** "@ * *` 8+ 3` +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b * 2`*` B 2*  * >@/ 㿘N + -2A?  *`8?" *  * : 3`+  +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b 2`* *` B * 2@* >@N + ` >@㿘 \   & \!"X0& \㿘 >RN  & ,`:   >RC & &  & & && & 㿘  " @5  S >  " &  ,:`@'` SҒ >& & ?H4(*( 8 82!   8 (** """"" H  㿘H /e. * &'   "  " 4 K @’    @" & " @@ &@&  &  4 & & H 0$@㿘 H4(3 2     `* ' !  @ >@8 `0   `HH(@"&"`  #  4   ""@ ""`4"" H 㿘H /e * & @`@ `H 0<?2` ` 2 &`> | $ `&`&` ` *`` `"@! :` `  * @+ ` * *+ @`  ``@ &@&` `&` H 0  :` @ `**6+@` `8@ + "@ 8  ""  ( @ ( (+@   @ (   +@ +@  &+@ (  @ (+@ 㿘`R H /e * & @;`2` 2,&> |! А$ "& " " 4͔  "  @@ &&@& & `@& H 0  >  88` 8  `@"  @" "   "@88" >  8  "@" "88"@?H4@(@!` `2`"` @` "@` ` 8 82@"`"` H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00K7?㿘0  < ` `@d?@f;@g 0 㿘``0  a< ` `@c?@fm@g 0 㿘``0  a< ` `@cՐ?@f_@gq 0 㿘`0 a< ` `$  a@ q @ a< ` `0Ho  ?"` @f4?㿘0 " < ` "@f50㿘!> E > ѐ#> ؒbX" > "`$"@S$  > גaȢ "`$ `%> G'> )> ` "```:` "`` 4* ``2`< > E $<> E  << " > E"b> E">a9!T>4`t<6 !T3 > E"  22 㿘 2    :  V`@ 4*V 㿘   2     : V @V2  4V 2  4`2 4 " 4 *V 㿘`(?   9  " @ۚ.  p$ `8     @   R` 2`4`0`4@ *R` *㿘> E ```:`    ` 4* ``2`㿘> E `> ``:` ( "`` 4* (``2`>  2`@ Y:`㿘> E `> ``:` $ "`` 4* $``2`> ` @u 6㿐!> E> |"4a0#\!   >  D w"4> Ѫ"3> 1> |/> E->   ,ap@2  !84#\  s HY @ > G> Db8 @ 㿘> E" %> '> @k <  `> E@R"4㿘H /f4> E* '> E ` ``:` , "`` 4* ,``2`> E  `" H 0㿘H /f * ' @?> E"4B ` > E  .` `2 H 0  6 & && 6 㿘H /f * ' @?> E"4 ` > E  .` `2 H 0   < & 6 6 &&  @ (㿘 < & 6 &&  @t (㿘   @0 0 > ђܐ * @  * ?     "2  "2  ( 2  㿘ِ?*  2@ 2㿘> + (> G> G"`\ D > G@(> +(> G\"  !@#`@;!> I 0>  l *`   0*2  `@`@ *`> +>  (al 4#`@`@ \@"8 2  *`  2   <  (2"`2㿘O? > |!@  U H /f * '      H 0: > E, @?*" ` & <, `@H 0 H 0  <` @& 6 * $& T& H& P& @& D& \& X㿘T > E`*`@ ?2@  " @  "@> E"4̒㿘H o*@ gؠ H p@㿘 X@"  \"`\ \ X"`X =  T> E*` *  <   @> | < H D -!h ?# @6 & H㿘 H o *@ g  H 0㿘 "^   2V > |! 2 P?   `2 B?  @Y  $ $   &H /f * ' {H 0    < <  $& \& X  < 6 & &    ?& & ,&  c 4 B 㿘`> |!@$& V   "@& =&  2 j; ('  ` 3   @3  #  ?#  #  #  $# $ (# ( ,# , 0# 0 4# 4 8# 8  6  ` <# #   " ?@& &    & 㿘@  㿘@ 㿐` `> |!ؒ2   2 `&@` 2 > |!!@:沤" ~' $@"  @͒ }2$   "8$   P 5 $  <$ < @$ @ D$ D H$ H L$ L P$ P T$ T X$ X \$ \H /f * '    @4  X$ \$ X& X X" \H 0    (ؐ$ @e$ $  " 8 $   @   @ 2&  @ @> |"8  2V > |"k 㿘`> |"P6> |> |"h~&@ ` 2 v"@ :#> | 2 kb" & 㿘 n @`@ &@T`6  W@    O `A @$ $@@` @4@= ` " &@Ɛ@8`  $` ` "` \@@  T`      `2$   $ $@@4@   && 㿘 2`!   "& X2&@r` ( &  ``  @ Y& 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘  ` ! `` ` `  5&@V :  {$`   ('` ` 4`  @4` $` ?$` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 8$`8  6 ```<$```  ?$@H /f * ' )> E)` * 8 `` $ A ` &@@$`  " &  & d`ڀ ` H 0$@ RH 0 㿘`_v  h ( h` h d`  8&@[V   U  (``2$` 50J  "'c ` 4` $` ?$` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 8$`8  6  ` 8``   ` &@@$`  " &  & `〦 `$@- `&  (""@`2 "` 㿘@ `= "@ "]  @8 "V   "@ @"  " $ `""`8    2 " `* ϐ&   "  $  `" &   @@ 2@"@ @ @@ 2@"@& 㿘$@   @8 ~ `+"Tː  @k " j "& $  % `& ͔ V&)$  Ā2T Js ܐ  " ?@&   "4  <& < @& @ D& D H& H L& L P& P T& T X& X \& \H /f * '    @6  X& \& X$ X X" \H 0  &  & $ &$㿐'􀦠 M  2$ P   0K$ `G      @a   (( `2(  > G <@ @ $@  $  $@$  8 $  $ 2$&@`㿘 '!> |   ` X`ΐ"`` < @S H < @L   @F  2 㿘`> |" > |> |"(&@ ` 2 #@ :$ #> | 2 c " @ ߴ&  `  `X "`0`<` `" "   X "0  <H " "㿘` 2  > |> |> |#8cHh'%G' ` 6 ` @6 `& `& `& ` & `$& $`(& (`,& ,`0& 0`4& 4`8& @& 8 "  2  <&  㿘 > |#`  &@`  (   "     "  X` `   "@ "@@  r @@ 2@& "@& &    @@ T``D `      & Y`"!T  2T`  `""`` "`    "& 5TV     r( `  2$ 1     "&     $  $&2&㿘4`T   ? (ߒ      쀦   ( `   u&  㿘` `C o " 2 2   "@"  `2 㿘  @ & 2?"&@ oE> `"6 `@`6 㿘 &  E* o 2 6   2   2  㿘      ݒ 0 㿘ΐ``   Ð 2 "@& "@$    6 @` "  @㿐> G> | `c#\ Ԕ  _ 㿘> 0 ǒ "j +  2Vd +_ )H /` * ! > G `l!$  $ $  $ $4P 2` 4 ` `$ `   @ $ ` $ `$ `8$ $     `@y4 H 00a8>  D@  4 H 0&@ 㿘H o *@ a   `  H p@㿘H /` * ! ` >`0  `   " ` H 00 `` 4`> c@> c>  @&4`4H 0 㿘> #Ȁ`> |c@        @ p  @ = @h> G `㿘H /` * !     @ O @Z  2 @ E @P   7  " 2 @ې 2   "   !!" %> |!>     ~V  6!r "   > `0  `   `"  " > |#6 xH 0㿘> #Ȁ`> |c@ y  >`0  `   㿘H /`4 * !   > |Ɛ# ?(6   ` 2  5 >`0  `  H 0㿘  / -H /`4 * !      `2 8@: "  8 >`0 `   H 0㿘H /` * !  >`0  `  H p@㿘H /`4 * !    9 "   %>`0  `   H 0㿐`   'H`'P   P`:   U@ ``` '` `  `'􀦠    `4 "`42 ` +`, #@ C`( H 0x`5`8H 0n`H 0f`H 0^` 5` eP` 5`H /` * ! ` Ƙ`8 ˀ 2``  `$2`2 92` 9H 0)`H  '`` "@``" 4  ``$     @  (   (H 0`@ <D=  ,@ * !`!! #` ? 5` ?5`re`@``?# @5`H 0 PD`H 0P% P p sqP   5  $$  쀤 4'(a%'"  (`(P > E"$ @4  $h4( %4 %P 2 6  " ?@$^$ %P `  W"` `` `P` 2``` 5`H /` * !   2``8` `?c 5`` `   > 0 PHH 0` ` ?5` 'P  P E`?Ȓ* 5`` ? 5` ?5`q|`P  5 0㿈 ''H'X''` &@ 2'X   ? !2``.   >`0  ``   @  ^ ` 22& $" |  > 0  `    | `  #@C L 6 | 2ŰH /`4 d* ! d `2p L@ :k `@ `@"e T8a 2]` 2X2  8 L " 8> }  2I`zx6 8  2=p | "7 d "1 d2V  2   `"X 9  RP #`N | ? 6 | ?6 |p |@ LH 0 "w |G " d `8 "`8 d > }> }> } ` @A" `` V > }E X'H    H"@w L " & LV  " X P " & P X?& X HH"@& XH "& d&U dP& d    '@ L " & LV  " X P " & P X?& X  H"@& X` " ' `2'\€'& d& d`   `€b& d '쀦 V  !`2V& d" & l> }> }> } ` h"V '`!2a"2b   d  > }> }> } ` hy"& d& h& l  * 2  ( > }z ?6  H "8 "8`2!`2H 0\KH /``* !` $"& "@G` 2``U  L" & LV  " X P " & P X?& X `H"@& X%@& d%@& d d > }> }> } ` h#8!&& l& d& h& l@`  %@ "@&&  L P""@& L& P H 2 "  & H  @Q6 O`K`@# 0  ,@ L " d | ? 6 | ?6 |nؐ |H 0 2     `" 8  V `    `  ```2'@* L`2" & d& h& l "& l` "   > 0  `  쀢@````  ` | ? 6 | ?6 |n` |H 0J |`2X X"@ | ? 6 | ?6 |nE |H 0㿘` `` 2 @`>  >`0`     ` L 0  @ 4 0@K0 4 0H /f * ' @ 0 ? 4 0 ?4 0m 0 ' ' ' ' ' ' ' ' $' (' ,' 0''@ 4  4 0$ (H 0   `@@{㿘?#@'P  " * `  @P * ! >`0`H 퀤`"Q`4""L`@"G`B`Ǥ *>`ä *":` 5` *` * ",``"'`"` *` * *`4 *g`" ` 2 ``b#@4 6 `" ` ( `` {6 *x6 `" ` ( ` $ `" T`` 0a !0[ @ 2f 7  @ 2^ 7 L@ GU 7  8 =&  T 8 6& `"E ` 8`? '> $@ > ? c"@@. !  $@,  2 ``06 6 ~`  ` ` @P `#㿘?#  " * `@ ^  S&` 4" "OV "JV "EV 0eA"@V 0`3 @"8V 0X4"3V 0S`"8 4` ")V `"$V 0D)`"' T0=``" ``"V0-&`  ` "@V `)" V ` $"@` 8"@6 8 `"2 ~ >   &` `@ؐ$@> $]`$  *& 㿘 <  @S{ DÐ p`4R`(2(  > > ф"`8 L> ф"`8 H&4((("` (000H 4(H4t(t  "t` 2``?"`"t|2|H `4( L"`   "  8` 2` 8 "`"`,  " ``0  4(H4(  "` 2``?"`"2H 4(`` ``"4" `   2`8"`82,`   , 0  `&  4(R`2" R`2@  2 㿘   ;  6 @ @Ҕ @_ L    6j 0j 6@O L   @E 㿘  6 `8j6 @9 @6 L   㿘  6 h0j6 @# @  L   㿘@ > #Ȁ`> }`@' !> E" P d* * @ "  L@l T`4T`2*T`0 @ @c+> G``! J!> @6` ?6 `6 ` 6 ` & `66 6`<& <`& `& `& `& `& `@& @`D& D` @! 2 `T'> @ 2@Ԑ@* >`0  `    @9`` `@`L`` j>`6 6 㿘` > } &` 0  6 0 2  6 2&``&`(`(&`,"`"``  2!  0 2 0 " 2 2 2(", ,, ,?(""(","" 㿘 `6 @B 㿘  6 @9 L   㿘 0!  @6 0 > } 2g㿘 0  0#> }  @4 0! `g " 0    0  4 0㿘d`$`0 ? 6`0 ?6`0i "  D <Q  @㿘 @# 2 7@ L  ` 2  & ` 2 (&   8&  @* 7`> @0  (*`"   " "    > EPL0@ 7 㿘@& & 㿘` "&  "@!0 @z㿘  @"  > }> }> } `Ж"#@g & 㿘`1  &R  "    &  !&  " H@&  "& " &  "`?# @2`2@0 㿘`D   @ R  2 @ 2R@ &R  "    &  !&  "H@& "`"& # "`?# @2`2@ 㿘 @ > }n!       ` # 4 4W @  ;  2@L $` ` "$$@  &T   "    &  !&   " H@&  2  &T   "    &  !&   "  H@&  "& " & &  㿘> }!      ` `# # 4 $#?   &R  "    &  !&  "H@&    &R  "    &  !&  " H@&  "& " & &  㿘 `r `` ` " @ 2R R V`@  1@.& / +( ` "VV`@ ` `   & ` @&V`   `  & ߐ"& && `  &V`  "  `  &  !& ` `H@& ?# @6& > }6!0㿘 0 "  > }> }> } `ЖH#+@? 2 "  > }> }> } `Жh#0 "  > }> }> } `Жxڔ#1 "  > }> }> } `Жϔ#2 "  > }> }> } `ЖĔ#3  > }> }> } `Ж#4㿘 = ;2  > }!1@("@"" "@&R ? > ":& " &R  &@ "   " &  ?&  H"@& " `ƀ0" &R  "   " &  ?&  H"@&   `""& & " 2& &  "& 㿘 "" &  " &R  "   " &  ?&  H"@& ː 2  & & 㿘` ? (> }!%        ( `2 蟐   I` ? & `$ $$ 㿈`8 ( - 2` 2 > ѐ "``@` 0"`(, ?",`0?"`0`, "eސ`0&7 (㿐 @n@ ``@7  2 `( 0" 0`, e`0㿐 @J@ `(`0?"`0`, e`0㿈`  `   @&@ H /` * !  ( `2   2! `2% 8  # 5` 8   6!c) 2} T 2   8    > } 54 8 8 i4 8  ) 2> }"   `76 (%찒    6dϒ L & t"R  2` 2> ѐ "` "(  `` 8'  `    0, ?",`0?"`0`, d`0睐 6 (H 00,?`$0d͐0㿐 @@a' q`(  !!2``0?"`0`, c %d`0_ %`@  2B  2<   !! 0" 0`, d`0P $0>H /` * ! #> }    8   6!b bF "   84 8H 0  ?4 `0?"`0`, d\`0 ??" x @`` @`` | (6<+ఒ j '2  2` > Ѣ ""(ఒ 2M2 2` " "`('谒 5` 2 ` w찒 +`   $, ?",`0?"`0`, c`0, ?",`0?"`0`, cߐ`05 h'ݐa'耢 O5쀢 Gp`` ``'` @'''''И''@6؁8`   (䀢$% ( *  15 䀢*z  `@'@ '2˒ h'@ ԰     '  '? '''' `  ' `@  | "&'  @"m @  f @2̒ d ' ?  "`"@"`  @`2ܒ ,  0ؔ7Ԛ`( ̰ 耢 ?  #    K7  `Ԙ$ '`@`B ;`@`X @ ; B ;`X`   (t 2   0" 0`, b`0Ѐ zp`   "`0'`` `'` '`@''''Ԙ'@B؁8`   4䀢$1 ( *  0& ` *@ '*g @'@  `'Z 1 ` ''@԰     ? ?''''   ` '԰ `@     @`2ܒ ,  /ƐؔL耢  Ѐ #\#\`( ̰  耢 ?  #   $  ' 1D  $'`".̀2' '' @" `2@` jȀ&   @[԰  F Ѐ @?#@2G& " A&?" ` "`Ѐ 2!  :  & `` ?$ @` 2 &@& `8`B ;`8`P @ ; B ;`P 0" 0`, aY`0̀ "Ѐ  㿐 @@ `(`0?"`0`, a4`0㿐 @@Ƞ >`(* `   ``    ( ` 7 2`  7 `  `$ `( `A` 㷐 0" 0`, ``0㿈 @@'찒 B` " '`̔  '`(`,` 2` `쀢 " 8'  `  0" 0`, ``0쀢 㿈谒 ''@   2 ( 2 (㿐@@ :`d  %  (ᡐ  `   ` 8'``M `F  0" 0`, ``B`0`㿐@@Т H`(  $ 2``0?"`0`, : 9`!`06 9  $ L  `   ` 8'`` `  0" 0`, _`0⪐㿐@@ J `(;  @ 0" 0`, : -_ΐ`06 -   2 ! 7`   ` 2 - ` ` `   0" 0`, _`0W㿘 0 # W  t( `2  7 $ e 0$@ * 㿘 ֐ 2R`    &&`0  "`0㿘 @    : ``&  @* 2   "   "$d|8L LT㿘 `  h -`   ` `R -```2L `F.`># €`A 8@L=@x: @3` 0 . @'@j"@ `    2  > & ` ѐ@ V  2> }> }"(`   X`, `"  &` X$`, L`(`#  &` L$`(性 x"0 @1 ܀ V : s> }` o 8@ i ` /`  > Ғ `LԖ `     7D @ @   "` 9  4 9 `L( 2 ` `L` `,`X " "@& ` `X",` `(`L " "@& ` `L"(y`   "8 _^ @ՐZ @ 5U  &HV  ?` "?`L@&H?&``2`0> Ga$$` "a$`0 &0`4& &$&4&(&,`:&` "+&  & ``$ ` "&   "&  & `   `   & `   & > }"@ oj㿘 "V T  V "> Ҁ ">  > }>  >  $ k"P   8+#  " 7& "@M`0 㿘  " " @# &  "  @ @X 6  2 "  > G!(` ;, @{, > )#H ' ` @ V `@?,  'x'T'P't'|@DP 2E` d@Ctd@#R0@#@#M2 0@ ې '$8 a'd`@At ` $ &  & `  &  @ & @C& $ H > }e"`P` D`  a '''''K?  (0W* @ܐ R < L &` @A{ B `"> =U@V@@9 )`  `1`  2`) =` `沔 $ $ `$  @  $ $ $   $ $`$$$@@"r㿘V@V@  )`" V  > }"B"  =" ; 1"p㿘 '& R`` 2  $   2 > }"2$ & ` ?2`TQ$ 㿘R`   ,㿘4 8   g$  +S 㿐> 0  `4 6`8, )  ` `@6R`   '`( <` `2` @>~ 2` - ( S'$@Ѡ 2H, Ӕ .`     .` <.`  (  - (`@*`" > G'  (" "(.%& - (* 㿐 ` ``?#@2 @   ?@t 4 ,`? ?$Đ`   a  '( `W 7 @ `@$@ ` & ?@-1> GC ?"' #@ "   , ``  "` @!( "`&!(  `!> G` ` `?"` !(?"$!(㿘> Ga  > +!Ъ> G  %  "a,?#  4  2 > Ѩ#aЀ 4?#%> G# , 4  $, `2 @" T `4  (" `2 ` >d`t@Y  2 , a> +a̔  &(* aЦ  ` @2   2  $@` 0 $ 0 `$  2 @R` 2 ?`( "?4?` @ ֒ ?`) &% 㿘 >`@ 㿘 1 *?#R 2! (` 2` 2@?2  `$@  2R   ` R`  > G,  ,2`2`㿘 > G 0 & 0 (& ?"( g 㿘> #Ȁ` > }b@>  > G @ > > G!8  > G   !H  !H  2 !H> }" 8   H;@  : ( b ; (H;@  : b;  ` $"`$$  $? "& & $HB?:㿘> #Ȁ`> }b@  `   @  > }> }> }"bЖ9  8 " > }B#!P#!@" > }8#( !P#!@" > }-#H " > }&#p`"  "` ? "& & > GH> G!ȐB? :H>  @"(:@ " `#!#!@  > G!b㿐%> > G!> >  #> G'> G ""4$"$S$b@Ē d$"$b@ $@ !> G d$! d$!!4 2> &f!%!4> " bؒ4!4@.%!4!4? @!> G%!4> }c#\!В   | !} > G!8  ""   *"@r!4b؀   :`*` 3  > G:"a0> G" @o b> G$" @h$> G> G"""b㿘H /d * % > ""ؒ )> G :`6 *` : > G"b%!0@B > G$"a@; $> G> G"b""#> G1> G  l@U@&a@ ؘ!H : @ !0  !0!H :  > G $> G┘!H (: @  > G , > GXA"> G!H1> G#> } cV ؖ:   "  "H 0㿘> > G"aĀ ?1> G!" "  !> G" j$!! $!ȁ㿘   @ `8" `8 > G&`8!H 8 HB`B ; H; 8@>d>`0` , "," <@M < 2 X    2  x`B > x`B > 㿘   @'@㿘\ d   @$  @ 2 `.`@   `@ @㿘 T` " @@ɒ& D` % ` 8("`8"`8@  &Ē  8 @ؐ0 8 *@& 8Wc㿈O '> "$ * ƚ`E    @=s쀢  '? @@4*  $ϔ  ,1@ 2 ~i@ < E `C   @,  $@  6, $%`8"`8@s? &S 0s?Հ @, $@> 0'> G H  8  H`B B9 89 H`8#`88 B; x" @" D;"`P``#```h@ B ; hڄ``pE > }`t  > }> }> }"bЖ"%` > }> }> }"bЖz"&`8 D>8`xb `8 `T `H 8 HB`B ; H; 8@= >`0` , ",@w㿘 ` `< 2`X`  8  `$ @@SO  `"p`B :`B :p> G!H 0 @B`B ; @; 0 8? 8a `$ 8H /d`* %` @$K  > 0 ` 0 "0 `x "`xH 0 8@ $ 8@<` @@㿘 8 $> + 8> + & 8@`#& (H /d * % @$H 0> 0 ` 0 "0 @ (@ >  0 N *> "@ !<*`  @0  8 & 8 8b& 8@F㿘 8`& 8@ #Ȁ`> }c@9  8 > }# 8   8> + & 8@`#@#& (㿘> #Ȁ`> ~`@  8 > ~  8  8 & 8@#㿘H /d4 P* % P    @  > }> }> }"bЖL" 8"@ 8 & 8 8@i > G!`@ 8 "  8 ?& 8  l@9@" P &  ` >  8 @"  8*@& 8UA  l@H 00> (> G @H:  :(> Gb B8((;   > G,> GH ,#b> G!@!@`& @ "`$ # "@@O& $ 8  > (> G @H:  :(> Gb B8((;   > G,> GH ,#b> G!@(> G @H:  :` > G B;` !8 8 "&  &  "`$ # #& $> +`@    & $ "# > +`@!,& (H`B : 8>ߐ# & 8@:> Gb b?"bT  8 @ 8*@& 8TH 0?Ȑ l@X "  8@2 X?Ȑ`l@ڒ EH /d * %  8  8  & 8> ~H R)H p@ ٰ 0( 8@> GHP`B :P 8 & 8p@H 00H 0@ "?ȁ㿘   @ " 㿐> G` !Ȓ `'> "> Gb#> `, 2 ?!> G![`,! $`,H /d * %  > G> G!0 aH` : > G`$@> G> G"aH (:`   > G , > GSА"> G!aH (:`   7> %%>  , " 7> !> G%> > G!@  l@@!T2"aH (: @   , > G  > G  ,@ 4@ H<`?)> G!@      l@l@!)@ ??"ؖ: `@ B 4"؀@ "> } %"" Q0 H 0| ؖ: `<`@ B 4> G2> G@ > G> GaȀ 2> G#> G!xbaа  > +H 0W  @!Pc!,?& (& L& & & D@"`"  ayaH 08 > x@ > p`l@K > > ~ P~ 8 & & 8& > (( & ( "`"(& > GH`B  :H> "$ @z*@ @H 0㿀> 0 > G"ȃH /d * % > G!H1> G'> G-> G!0: ` > G `$> G> ~"p P Ő8 !0> G> !Hb :  !0$!0ʐ@mH 0 8@H /dn * %g  8 2 > ~~[ x < 8@7> G!    * 8 $ 8H /d * %  @  ;  ; B< $ 8 $ $""`B <@̐$8fK"@'"'Вb@ ?H /d4* %耢 V 8 pQ!0㿘 8  > }> }> ~"bЖ}ڔ$H /d * %  8"  1> ~ O–  8b H 0 8$ 8  ;$ 80  8(  < " 㿘> #Ȁ`> ~`@C  8"> ~}  8 "& 8`> G!`@ 8! > G 8@*  & 8@> G!H!H  8@ 8@ 8280B?:0B?:8 8 @  8  & 8€4 8 0 8 *@& 8Qz㿐> ~ > GHHL> ~    $> ~#\ !    > ~ 0!H 4 8 <㿈> G""""`!> G> `>  0  $"#\#`#d"ؔ ?@ ? "> ~}!p> G"@> G> G""" " "  " 㿘 8  > ~> ~> ~!a| PH /d * %  8`& 8@"H 0H( 8" 8H 㿘> #Ȁ`> ~a@]  P 2X X> G> Gb @@")> /> G> G")> /> G!> G#> G%> ~""b`$"$b N Ѐ "@"  @ : :6& P -> '> ~)> ~+> ~ h, @ B  ` @Ɣ 2ᘒ!b|o  ,`8@l  @: *& P`" \ \"`\> G"" \? X/> G"& X& \HX`B :X 8*& 8㿘 8 2  P> ~> ~> ~!a|9  8@ > ~> ~> ~!a(|* H /d4 P* % P  > GHXB?:X& X> Gb` X& \`""`> Gb b?"b Oג  8/c & 8H 0㿘H /d * %  P & P 8 > GHXB?:X @@ `  @<  H 06  8 & P X`> G \"`\> G \"   \? X"& X& \ 8> G ?& 8 8 & 8Ѐ & XА X"`\ X"`"А& \H 0 㿘 @@  P@Q"@& @㿘 8 "  P> ~> ~> ~!a{{  > ~> ~> ~!a`{q H /d * %  X`" \ \"`\> G"" \? X"& X& \ P @& P@ 8@> G!uH 0㿐> "  @ * @ "  `> ~> ~> ~!ax{0! "  P> ~> ~> ~!a{%!  > ~> ~> ~!a{!H /d * % > GD: > ~  > ~> ~> ~!az!b ` 6@  -> GK܀`(I& @b  ,@ Dܒ @1  )> G> ~"z @;#b   ,@ Dܒ  #\ @D > ~ ("0Ho  ?"`b  !H6@ `B ` D  :@b & @& `> hH 0㿘 P   `> ~> ~> ~!az!8 > ~> ~> ~!a z!9H /d * %  h  > h& `  +%>   ,@ @ E  @ 2 `0> ~> ~> ~!az[!C   > ~> ~> ~!a0zP!D@"`0> GHB?`:D    @: : іΐ H 0㿘N 8N`8  9" @`9`"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@      &`&`&` &``6$ $ $@  㿘      㿘 ޒ    "     2 0   " "  "     2 0   " "  `㿘 0  `"  "`> H"  ?"&& > H?" `"  "` > H"  ? "& & > G?" (  ֐  (` "  0 . 4T@*> G (&> G< 2"> GN 8`4 ``N : .2  `> GN 9 .> G ` $"`$" $? "& & $> G"q @8> )cH> 0'  &@>  0`*@&  > G(?`B :(*&*:p/А 2 > G ?`B : @(> G 0`2* 4  @> G`B : `? "`   "@$ $ > H`` $ `""` `B :`T> G`B :@@; @$ @1@& @, +   &  @-N "@ԐfcH*@& @       @0ٔ@&  `T)  > G@> G`B :`B :@     +?@-   %cH*@&> G`B :`? "` "@$ $> H$ "@"&@ ?cH > ~SC#H㿘>  0`"C&@ 9> G(  " , T@"8 2()? K 2> ~v"#X ?"@> ~v#@`B :@J8& 9&@ "n&&@  H`B :H&@?㿘>  0` > H>  `4 > H  > H  > ~$#> Guܐ##> Gbo!`$ 0`T$ 4$ ( T 9$ ,, 8*o:  @T b bp0I`.> H$$ "@" $@/> G`< ,L 8`4$ ``L : .2 $ `L 9 .4$ ` $ $`"@&`> G> H$ `` $ `""`> G  "4@> H  㿐> H " "`> H " "`> Д> G> ~#\"c X  m_ 㿘  !> H     $ & T $ & T㿘> H `!> H`( " @ X@k ` 2`( ``( " ` X`W   2`(㿈 p   >`>`>`&` ` `"X``B 2X 2X D;  `;  xB 2X | "`X@@wc8` ? Q' D: `` %@@spD,`@2* D``B 2$ D 2! D@ؐ` *`` @/? ` 9 * + D#\#```@e  D  ( +Q>` DD: @s"@"  x@.Ú   x? |? &`  x>`>`,>`  &` D>` >`>`[>` ;`@ `#\@#`D>`&` A>` x>`㿘 X 8\ `> ~#t.D  @``2`````0+*  `8  0M 0  `8 ` D Ȑ D 7㿘``  +$,  `  & @&  .` D#?`D `@&  .`" `& 㿘> 0 ` > ~s#  < 2 @ " @   @ ݒ 2 @@`  @(0! > "& @ E~ 0(!(& @ @  " @`  < <@2  " @  @(2  @ >& @@  "    `"  :@  2" 㿘 㿘  $> Hm (     P > ҄ 8    `@" "  2  㿘 2  > H`$  ӑ* "@  > Қ#|> > !> @   "  t@r P * #  2㿘> |*` > H> r p`$     `$|* " `$ 㿘> Ң!` > H"@ 2> Ӑ!8` "$ @`"@ "$a@    a@     㿐> Вc#\> H>  ($  `j @ > > !xa|"!x "a|  @?`$Dd8(l $h㿐> Вc> H> #\ ` @  j\ 㿘 `` > a* 4  > !쀢 $  > H`" kt " 4㿘 4 > H" l㿘>W` 0 \`l``"@f @ B&_ `` @2`?? DE?4P 28K  2    7`A     @ ` 2< 2 M< $ $ `$ 4 $ $ $$ (`@4> 0 `8$ 8?$ 8    0@@,@x0 㿐V  $   (_  @q  #"#>  @    @2`xa `xa`@ > ! @   @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("@$ (aCL   ,` 0"`0"( 0? ,"& ,& 0& @) 2'  @6  `*`>"4 €`" "& V   R` @3  2 V R 2ېw  @  @ " `B  & :@ʒ@ ^ V   R 2$@ !`$?,`"0"`00"`(0,"@"0" ", (,"0 ("& ( $2,`  " ` '&  "@x  & "   B?:@'g`" "&  `B :@ 㿐  2'0H: ;@?`>>"L*` € "@F02     @ @> ""  "@.   B?: ' `B  : @D  㿘@!   6`6` >@ 2   ?2    @ b `B >` 8&`6` 㿐'  V   `  @ 2T 㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4>  @ @ 4   8 2> ?>   > o0 4 㿘 `@2   ` @2 ``B > 2&` `@2 4 `@2  4` B?> !&`  : :  :  :  :  (: ( 0: 0 8: 8`B: " ," $ $" (`B> &` & 㿘 $?,`0"`0& (0,"@"0","  B  $2,p,$ ``$0` `"> ``2$> n Ѐ?"`> n 耊 $> n!`> H (g $` $`f$`fT  "  > H`h ($`  @`2`` ` 0@ "`f`@"$ `@ *`L /"?` ""$, $  $ > H $ `J`/2 @ `> Hh ( > H`h (0@  )> HN   (gq ``$'`   ?'''''''@(а   V%> H (hsR`2  # ?( `gJ`h^ ($`*@@$`J`/@A @ X `$`@.$ @`@ @@d`h6 ( $` 2  @(  `$  >%> H`h(@@$㿐$` $ ``  `"` `@$` b*$``$@$+`'J@ /2$`'J /"`""@$$`< x J 2` 2$m $`  ($`'$` ! `  /`* @ `  /*`2#@`$`"`$`D ?$" $J`/2``'J` /" "$$` $`*@$` J`2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@`@# > H 2@$$@` "$`!"X$$`*@$`@%d "!`  ?> lƐ!8` ` X $` $@y  `*@$`` ""@$` "@$$` J`2 `  $`@Ē 2< @&  @͐ 2f`@͐$< ` <  @  @@"$$` \$``? ` @2 @$`@`@? `2`X $`2 `"  X`$"`  `@ @$2`@u`   @&T    `  @@&F @]@X$@ $㿘@*   "&`@"J@ 2> k!P@"> k!h@$q "@@ ?> kӐ!8QO  X $`J@I @E  < @"> k!? &  X $`! " X $`" @ @e 2@  @%ɒ     @@% @Ր@&@`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @t &  㿘 @b   "  20   " " "     2 0   " "  ``p p4?2  p`t t( p?`p4  2  t`t  㿐>  4> Вc> H"#\> H> !a   ` > H!"!"`> H"x""x"`> H"@ " 㿘  > aA `" `" @  ;`  㿘  @ 㿘> !|``@xX 2` `&   X" ̒ $ $ @ $ $$ $ `> `$` $*  $ $` @x  /, ! Y`v &  > H@" ` 2 @` 2@ @ 2` 㿐 >  > 0  a * & `& `4aa?# @ `> H * @ ''a `'4a & J   *`J8*  ???: P" " `": " D" H" @" <" 8" 4" 0" ," L" (" " " " " 㿘> 0> > H > Ha ℔"*`  #a ᬑH /d * %   > H"x`"x> H!`!ᬀ "H 0> H!a !$ l$ $  $ ‒`b$ @ A 2 \ 2 DH 0> g!&X  "  \> !@f> g!Ѐ` `"``$ `? \"$ \$ ` L ?$ LH 0 < @4 > !@A> gy!H /d4 x* % x  > gh"H 0$ @$ $ <$ $ 8@ & $ D$$  X`d"hh hh?d""d"h` "X`"d`d h`"`"h㿘@  㿘@ 㿐?> H&@"   &@$ <@  '@&&@ 㿘>< 0` [ @ @>` ?> H* b @    ` @ < <@2 D  @; 耦      < "   ($@"`"` ` "@"`"`@g~  $@@$@ @h@& @ @ @ 8& 8& P$<㿘 @!`"Z & @> 0 8x Q  L D`3  "1 DH /d4 P* % P    \`2  ` `> H "! \`" ` `"``> H""| `? \"& \& ` L ?& LH 0  D` & D@ߐ " D? & D "@ 㿘 D`2 <> f1"8 2`> f+"X& D㿘H /d4 D* % D  > f"p L "  P> "@Ӓ> f " `& L> H!> H"x < 2& \ & \ \"`` \""& ` \& `"@"H 0 㿘> 0  > eڐ" D 2 ?> "@> eϐ" & D @  0 H > #@> e#@ʐ D` L 㿘> 0  > e#0 D 2 ?> #@@c> e#X & D&  H " > #h@S> e# @ > @G# @ D`2   L 2 M L!PD2P\"`` `> H |`?\ "`"\> H\"` P"P㿘 P`2 L> eA#  & P` D  \`" ` `"``> H"! `? \"@& `& \> Hbx` \& ``""`㿘 `` `X `d@ 㿘> 0 @"2 `  @ 2* "  D H "#  < 2  D @ "` <?  @ > H"& 8    &`㿈>ɐc'''쀠 `  㿘 D  & D @!"!> d#& @ @ڔ@ڐ` ? @!  ` ?@n@ @̔@  > d# D?  & D P > d| T"> H" & 8 @ @& ~b& @ |& @8㿘 D  @  㿘> 0 @㿘 @! "> & @ 60 0  X   <? 8Z D U@  "  `2 "`2 @> d  @(4  @   @ < <@2` `  @ < <@2`" > c 02 @@ 7 @ @ 7& @ Q &  D `>& < L :H /d4 P* % P  > cĐ @> H"x@"x \` `"``" `? \"& \& `xx & \x \"`` \"`"xx& `H 0 ;` ?> H⠅(    @<@2 " 㿐@ ?* c`@ * @ؔ @Β `@`㿘 @(2 " D  @@ ` ` `< <@2  D  2 P> )#H' "`<>  d`<> Ґ"h*` `D> `H`Pd `@`/> `А@r @`@ > `ؐ@rܔ @`@ > `@rԔ @`@!> `@r̔ @`@"> `@rĔ @`L > a@r @`L > a@r @`L > a @r @`@(> a0@r @O > !@d`` > > dY!P#HdU!X@$#H > ?!`㿐`<!> !|`d `  ` ` `[ ` 2` `T @\#\`,J  "`   -0?4 -0<> !x*5> 1 !|`,  `' `2` `   * $[ $ $$*$ ̒ 0 > GH* ` -㿐 > H" ` *` * " * L&@$&@F > H@!!@ ; c  .@` ''+> `X > "`cah`dZ$  Z Q0'@J@ʐ$&@   .  @* %  < <2  `  < <2`"  㿘\`  $"} $`0`4Z P $`4 $ "o$ $`l d h`f d @ 1T `XY\ U `\@$d_,`d" \`Y B d@$ g, #6 *`  > E  `"@ 2`` "``$€@ 2  7 @ @"  $`0`4Z P $`4  1㿘 `    1㿘 %>͢ #    & 㿘@" $ <& $! F " $!& $ 㿘 $! `* @` `€  2  $"2㿘`   @ `I/ -   ! @! 2 @` @  @2 !2 2   @2 !2  2 @  㿘 '> H  > 0)>    2`@A  b! ᨀ2  > a!> a!֬ 㿘ܱH o@> a!> Bc( > *  @x!@   > > aҐ"0aϐ"㿘> 0  > *!В @]  ' @c /> Ҩ ( 3   8  "  8 "% H /d * % `H 0S  > a"     > "(a}[``㿘`  2 -> 3"` > Ґ'="d㿐  -\#\ِ 㿘> #Ȁ` > b0@G  x   x L`& L`1 " x㿘> #Ȁ`> b@@.   x??& x> _"H L`  & L3 x㿘`IH /d * % >  ` t`.H 0@є  H /d4x* %x  t > _I"pH 0@0H 0H /d * % `p   p  p`&   t  0   p`&  7%> p &*8 8  &8` 0 "pH 00*8ې8 `8 &8iр p  t > ^ː"H 0 㿘H /d4 t* % t & >  8   8 ^ᖐH 0 `0+0Ҡ`` > H 00 Ė  t` H 0> "70H 0㿘> #Ȁ`> b@ ` > ^Z"&` <? ?  &`L&`L p &` p`"` p& p&`㿘> #Ȁ`> c@ː  2 > ^1#!P#!@  ` "` ? "& & L`"& t 2& "L|`""`?|""|"& Ð 㿘> #Ȁ` > c@ȑ   8"@`x`L&`x `"  "` ? "@& !P#!& 㿘> #Ȁ` > c0@d  !P#!@  ` "` ? "& &  8 2 L L`4 p t 21@ $ L |`"  "` ? |"$ |!$  t <   > "> "2`@ :`  `> b@_e > "@@ & @ "`$@& 㿘  > _#@> !| !| @m$      >  x@4"x& " (`" @ 㿘> !|!|  @l  2 2     $@|     4 2 > "!x  <  㿀 >  4 <>  8#p L#`#\#d#h#l pƀ x T>   P#\ #` @#d D H (ƀ P>     ƀ `@>㿐 `> Ґ"*` > ! <` > Ґ"*` > ! >  !`#\  <ƀ X>  ! D H Pƀ x`&> ƀ! p > #> ƀa  > ƀ! t  #> ƀa  㿈 >  $>  0 ""ƀ >    " ƀ+>  P>  L";` H#\ 4 8 @ƀ D l>  h#(#\ X \ `ƀ d >  #P ƀ  p>  t# ƀ  >  x# |ƀ >   !ƀ#> ƀ#  !)> '> %> @ؐ " d d  @_e  `ƀ dƀ d ƀaP`$> ƀ   %> 3> 1>  d @_@  ``0ƀ d 8ƀ d 2 dƀaP㿘`  `@l/ `0``& `d & dl Z& l`0&@> @P> PH> HX> XhU9& ha U5 Zat!DU1 l㿘#> !> b  w!!> `"$b> @> > ἒ @H4L(L|" ?|""|"L"L> *`"||  "H 㿘> 0 > H/> Ҭ"b+> +9> 7> )> 5> =3> `DH /d * % !*   %% I Д  :H 0   @ŐrH /d4* %  t >  < >  @ X`"> >  P\`> [/ `> "W 2H 0@5 " ?%"`D (`, 0㿘H /m4> H* .> H"  x> =!@9 H 0> b> ҕ2 " :   > "`#""" 㿐> H" Ֆ 0$  "`H> >  a "`<"> " > ᰓ3 2   : :`#a  "> "2 :`#a"  $ 㿘  X> "Đ ˒  `$ ?`$`$ @    `$ @$`$ΐ 㿘 D 2X  @ 0%" H /d * % |`""`?|""|"L ?"LH 0  n"H 㿘> [Ԑ  p> #\> )cH '   qH` ZQ hHВ D ''''Y' [H`@@9@ 2X4M @ $  @    U |  `a4` &``&`#  @@` $ @$ $`@Ж 0 @$  P # J "` &`X`$ &``  , "<ɐH ۰ @  QY !> !|@`` 2` ``ð @i !|``@i6 2` `2 -    +"  @>$ $ `  $* @ $ $`@i $  @$ ` " $ $ `@$ $ $>ߐ# $ $`  ^ @  $ $` `@ 2 $> + D$  $@@"&$I $@ $ $ $@*@ $ $$ $ $     7 "$ $ XCH㰐 25 ` $`> Ha$$ a  #!"!" @3 @% $`1   0 ` H% H"`< H > 5 㿐 D <  '> 2 %> H > X `" ` 2  l$  2 2 `_$ 2``2` L$ P@ D'''''騐 .  X@` @   "`$~0`$@ @ r n  `@㿘 $ ?& $  " $ݢ &  $ 2  ` @ " @     @> H $ `,U*> H!@ "` @""@?&&  ` @"`  "  > W /P  㿘> H! @(  "`$` 2` ?$`$ @@9 `` @ "``$ @$`$`@ܐ P@ @'''''א   X `` `@`㿐    ?O ` ``O   `h h!!OP@ @'''''蝐  X  0`   $>*@$ 0`㿐@ @ 0`( X 2 `0?"`0`, # +T`0  0 `0?"`0`,  +@`0  > $*@$ 0`㿘``@Y!> H!!@3 ?#7  `$` 0 ` " $8 $ @$@R a(ᨀԐ` (&&0& 㿐@@ P I (`0?"`0`, "*͐`0`@ > <` ` @@ ! `ǒ  ` €Ԑ    @`Ͱ $`P@ D '''''@2 ` &`P ْ 2@ D'''''@  "  $  $ 㿘j   <   `` @@ >0@U Ȣ` 1(, (  @``$ @*@ ?'X'0$`` 'T'4$'\ 00  ;0@ U   ?``(`  ?,ی(&?"b a(@ $``, 2`,> 2 ,#`", 0("`(  ?7 ?x 77   0 @, @#x 5(`@ 7, 2., `2`X  $` `<  @  l,  ?@   @(ל, 0 @(&,, ?",,`0?"`0,`, )x`0((> )#H'͒ *H@ D'''''w HА@U  X ' ' X$J H`M: H > 2 ؁> )#H' @'D H``  @`b (Ű LH 'L@L  Lu 2  FD` ذ 2'DD`< ` -  !@  LdD`<  {  @  uL@ D pLdP옐  ?pD@  `LD@ e XL`D`H "`HL `2`L 2 L> Ґ#`"`L`0D)"(  ?7΀` ? 77̀`  0D@ DL @ D$'D`@ L 2D @H&L, ?",L`0?"`0L`, (l`0 L  HmLD ZuH > 1, > )#H' )H@L.  !H릐 2  F\` ذ H`\@ $\ H`L pH > 0 h> )#H'k 2/@K  2'k 2   F` ̟؀ 2 X  0    $>*@$ 0`KҔ!H > 0!, S` `N @ 'l 'H'p'L'tАH AX " v`< $`8 ` o ' '     2 '' ' \Xl@ @ hl\ | @  'H'l'p'L't䁐H 2(X \@ ClX@폐 XW X툰 0  '$`8 / @'\X@ ֔lP@ @'''''J - <   ` ''''ܐ8'  @ @G  @ 0@ x԰9> H L (@$J 24(`  'H'l'p'L'tH '(X \@ ’lX@ X֐ X (ꕐ $X8 '\l@ s(MP@  '''''ɐ  @ @ Ā֐0읐 @Ĕ@ (  @ @ 2T W 2T (`<  M ``?  `   @  <  @ B@ 8 "/@ D   6!< % `h@w 2<   (  @  B @P 8<   @8< 0>H `B "d`? @@   3"?0`'`'' @ @'H'l'p'L't)H BX`@X`$ 6 `?`??[ 2> "d`? @@  3"?0祐`'`'' @ϐ(@8@ P (`@3X`$ 6 `?`? 2> "d`? @@s  3"?0?Y`'`'' @j@  `0?"`0`, #u`0ؐ6`   '''GP  ?耢??'?2@?'@ @'`'8'\'<'d_8 (H`@`X`$  + *" " * *   * *''''`@ߠ`   '''F  J耢??'?2@?'@|@g  8| (`@b`X  $  + *" " * *   * *''''`@@ |`0?"`0|`, "`0@ @'p'H'l'L'tǐH )X`@`<`2 ` @` @ Y`? @m膐(`@@ 3 ``  (`@`<` @b (? @>@p  0" 0`, "I`0㿐@@  , (`@@  `X "  $@@@; `0?"`0`, "`0@!  ''''' 2v<  ,` '''h''l h  @ђ !> HNx |<  < ` `  <  " "?`| "@ܐĔ|@;x@ 篐 "窐@אp!> HGߐ ( G֐ ( @ `'l'p'H'L'tޘH *X \@[l\秐0p碐 0` '$`8 ! @'\X@l VXP@  '''''` %`<   " `@    Ĕ@@Ā\0%#`` N `@@ G` 2`(6  < 2 ` `''''''''`@m̒ ?   '@̰:` @  ` DՔ `"@& 0" 0`,  ͐`0 $ "`2$@ @'p'H'l'L'tАH %  X@   @  `D `@(@ؒ ǐ㿘  R   ( <` 0 "0& 㿀@  "$   2S   (`< 2` ``''? 0 # 0#\ #` ]  㿈@ ˻ "  2R  (`< 20  "0```#\?#`\ 㿀@ ˔ "#   2S   (`< 2` `? 0 # 0`?#\ #` ] 㿈@ i "  2R  (`< 20  "0```#\?#`]n  $0<HT440`,` @d$b ;  $`(i$`$ L$`(ܻ ` 2`a'h' '``@`$ {#`@i`$``@崐 `| `h$`m }$`$a  D$`(܃ b`<  Y -bU >d` !@ I`d< B @D = @ 6d<   ?@ "@˖ @$ ;&@$`  &@1`e ` H &H 㿘 X $`" @ <` >!*` €   @ " @     @" @㿘` H?$ H`@O@Ґp`d hl`@9'\ '''?'쀦 '' '@@$  "  @ 㿘(`@@ > < *  @t@$@ @ C >@@ 㿘 ( `<   2   2  2  `X  $ ` `@Ȑ@>@O @$B>@@W 㿘 (@0 @@ "K&@&` <?`>!@*` €  ( 0&  *2 @ 2 >`@&`&` &`&`&`>`8&` &`$&`(&`,&`0&`4&`H&`L&`P0`( <?` >!\*` €"@`@ +`$ " &&!@ !   @T`@  a@< ` "<< @"`㿘 (@㿘@"`@#> ! @! "@  @  & @ a@  @2 @㿀   (   ??77 @  V p㿘 (@㿐#\  "@ݚ `?'D  `h@ "  -D"&@ ("'D'@'H> @!  'L'T'X'P'\'`@@ D"d&@@;D \"" Ꙕ Юج<    ?''''''''`  '<@    ! #$ ` ( "  &@ @ "A&   < "  D "㿘> 0 8  ?.┐%)&@@ T@'͔ 2&@ 2 &@T 2&@x&@ &?⟐%㿐\ @``'D'' `> H DD`Ɣ D'DDi' /e*c nD_'D< `  ``@ Q!@D`@ D!@F `X'DD > D  D`@ 뀢@D`? D D > GӐ!(> Gː!P' /*?'D' D& "DD 㿈`4  " "  X #\,4  ';  B   $@&?@ 㿐> # 8#''*` €㿈> # 8#''''*` €㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀>   8 '''''* @x>   8 '''''''* @؁㿈>   8 ''''*` €㿈>  $ 8 $'''*` €㿈>  0 8 0'''*` €㿀>  < 8 <'''''* @㿈>  H 8 H''''*` €㿈>  T 8 T''''*` €x>  ` 8 `'''''''* @؁㿀>  l 8 l'''''* @㿈>  x 8 x''''*` €㿀>   8 ''''''* @x>   8 '''''''* @؁㿈>   8 ''''*` €㿈>   8 '''*` €㿈>   8 '''*` €㿈>   8 '''*` €㿈>   8 ''''*` €㿈>   8 ''''*` €x>   8 ''?'''+ @ @؁㿐>   8 ''*` €㿈>   8 ''''*` €㿀> ! 8!''''''* @㿈> ! 8!'''*` €㿐 > Ӑ '' 8*` €㿐 > Ӑ,'',8*` € 㿘@  " > ED#`@   㿘@w  > E5#ȁ 㿘@m   >   8*` €  㿘  " @T  `8("`8H /d * % L H 0  㿘   @, >     8*` €㿘@  "        㿘> FX#  㿘> DŐ#㿘 @! !>  "& @    @!"㿘> H"*` €㿐` 8`  Y $  =  $ $ /  $ . " $  z$$ ""` 2`      $    2  $`s ` "`  $ ``"   2 I  2 `  2  $`U ` = "` 2` b> !   ` 2``     H> !(  ` 2` ``` 㿐      @> C 0  2 ) " `!4`      #\ `` ` #` >4`  ` " 㿘  `` > C @ "  !4   ޔ     s `+ `  >4 8  "~@"#       '`  "  "  ` ' `  8     A`` ?2`  @' aA   @2    `'  a.@㿘   k 㿘  `  /     ? $ K   "   ? $ I   2  q $` "㿘 `    \ $`㿘> Dn P@ >  Dh `㿘 >   hD_ " "  "    "     -㿘> B R  2 > Ԅ " 8L> Ԅ0" 8 <`(" "`(`02`0 <t  "t` 2``?"`"t|2| <L"    2    ?(2 `  <਀  "` 2``?"`"਀ఄ2ఁ<`` ``"4" ` 2  ?(2`  X  -> b  b  ה `5?  `0b > a'CÐ    8  $@ @`$`  Y  &`=  Ƞ '?Ю  '''''''@V i  ?''''''''@Vk U   K, H '    " ?'''''''@VE /  "?`@ 2M "@        # c"    @@ @lbҒ 㿘-`8 8@2`0հ (Ұ ^% ̔`0Ho ("``L6aT 8&`\  N`5  `L`0(0>6aT> 0|}6> 0w`0(`0Ho  7"``L`\ 8  `0 ϐ&`\Ho * "`0H^ -`0(0 N`5  `L 5> !  N`5  `0( `L :N`5 26 `L22 `0(., N`5 (5> !   N`5 0@# H /m4N`5* .N`5  qH 0 x> )#H' H - 'ܐ@pܰ ?H> ܒ@  -`0> ܒ@! ")HN`5 2!``L2``0("``6aTH /m * . #H 0  H > !#0X> "  > ) h l(   +*H" +@ ( , + + +@ #t* > '#h#l#p#x;@#\#`#d#|##A"?!;    2 8 `2   #@   Δ#H > ΐ @㽈> )#H"''@/쀢        b("  "  @ ' `' cH >  X"@ @> )#H'   @'@  -#H > v px> ) L  8cH '28!<       8@O)> @O$$ 0` @@!'8 /`@@A> #\@!`ߐ@@2 0 3>  `/?`l 2  `n > @!)`@N* @N6!<@NݔCL@NؔL @NӔU@NΔe x!?@?`ِ@? > ` > !@> `̠`@?ߐ!< `2L> !@> ``@?̐L , > @!`2@? >  ܔ ؒ!@y`@?` > #\@d!`@? x >  > @N] @NX$V @NSG` > @?!`@?v >  @ !@/ `ߐ@?fV  > '> ,   @!`@N"V @?NV  , > @!`@?>`@?8 H > 2!㿘 * -    >   2  8   &@4z |ŘŘŬx@\$$ǔǰ>   㿘> 0 > Ԩ @ %> Ā> H 2 X2  / Q&@2> H" ո D @ r $ "" ""* "">#ؓ. €!m"  $ <$ @!$" $ <!m" $ <! !$" $ <> =!(" " ""  @Д 㯐 @㿘 `""`> "!?""" ϒ &  㿘   `m  28O  2 `> 3"`$`` 2`A  &>  ?` 8> *` € - &  Z     5 -㿘  @"!   (ߔ "  > .@@=ې J?` 2&?.@& 㿘 @LL   2 㿈 $@@< - 4ǔ  1 " $+ ' $ & $ @ a D&" 4V Y Z`@=W" !@=S Z> !`5Ԕ !t5Д  $`㿘@  > "\`   פ 2"ޒ @&" 㿘 }  >0@   h@k+> >  8%> cԞ$ ؑ; &` <       0&`>`>`>` >`(@>`0 ``5x  `5t Z!`5p Z!taD5l  ``@LD  |||||X||||||||| 44HH(H4T`Ф DP\\\\\\\00000  جج8h㿘     2 "  2   (2    X "   ($  ` >(`"`  㿘  `  @!4 㿘 `>(`  ` "`  `    㿘 > `"` ` `<`㿘  U q 㿘  K g  㿀> )#H '       J   !>  < $@ $``<$`$`H"  $`(<`P<` `@`<$`0$`,$`4$`8 `!> *` €0! ` >$` $``$`  @$` $`$`$`  `N*`># € "> 0 > `88<  : :   <` $`$` $`/<`P $` "`$`  @<` $`<`P -$"  ` *     P !  <`P<` > :"@#H > "P 0  ~    `<  ٰ㿘 > 0   `%@`@* ? $` ` 2 M .2%@*     `*  0@ `   > `"`@IÔ `?`   `> "h@I `?`  XH Ԁ`Ғ _`@$`> !  > Ԧ  `!  @Ix  !  X€ !  !  X ` (`@$``@#"@ X  ~`|  `@t$`@  `@$`XV c`aH  [`*@W$`  M>  > ԰  F`H ` @I   " X€   ,@ 2 H``  `@$`%@ X ` `@$`@   !@ 㿘b `    㾈> )  cH '   ɰ @9  7 B 2 < >  H- @> `耥  "  X€ " `` *  '  2D/ /     耥& }> 2!̀  t q=  K> \-  €  > !'/2 ,@J/  '/> "`    '/> "h 1 4/X"`  . '/>  !X"` - '/> !1ޔ  /#`@8> *  #'8!8:< // j   `  = =H > \"p㿀> )#H '   > 0 `8>  8: 2 > b`@H2 ` * cH > *" # Є #* ((Ї8 #2    Eܤ$$$㿘> H"*` €㿐`X``  `$  <`>#Г*` €>    ` ?1> ` ,> 3b   > ,  4@*` $ q  > H?   `D մ Z@Z U > , `4*  $@  (@ $@ (` @?``` 0.>  0 * > 3"`` ?`  > , !<"@*`   i , "> a<* @`` h   > 7=" 2 > 0  "> 70" 2<Ű  >  \> `4* * `@  `0 6 (` ' `>  0 >> *a<" * ` @`3  `h@  +  ? *@ `  ? *`2 @8* ` 2 ܀ `"2)'ܑ:` :` U R* 2` @ ܚ`: >  @5,  & 8 @B܀@@D ??#\#`#d ?ښ: H"@8 Pe쀦 "06j" 㿘    㿈   > 6T" 2 `<> 0  "`<> 6G"Ѐ  >  x`> `4* * ` @  `쿔0 2 6` > (0 = > *a<" * ` @`3  `h@  +=   ? *@ `  ? *`2 @7Ñ* ` 2 = `"= 1B=  =쀢 ? <* 2` @ `:  @4D  %@ 8  ? `H%8 `P@ 쀦 "05"! 㿘   < ` ` > *>  `4* `*> " a<* ` @    @ 5p"㿘 `< 2 ` > * `4* `@    E㿘 >  `4 `(*`  *  ``,   € 㿘 < IH /d4t* %t  >  8   8 5j H 0]0۠` >  J t` H 0> #(ѽ0H 0 㿘    N> G!`"> @> , !<"@ *` € 㿘   <= m> g 4   !< `  4 a< "4 `> *`  4* (`@6M@  ` @!1 `* 4@*` 7 @!2  `       @!`  ` 4 @!4 > * <"@*` 4`#@  㿘  @ "  `   ? 㿘`  @   `` ` ` `9``k 0 㿘  @ "  `    㿘 ?   > 2 #X5 `>(`  ` "`  `    㿐      #\  㿘> 3ސ#p㿐   2`  `* ``? <`  `: 2`+@ * `@2 H ? `#* @ ` * ̊ :  > `4+  * @` `* 2  @ @ "@ I   "" "  @$ d $ @<`` @ ` * **@ 㿘 >  `4 `* * @     ?   @ 2 `@ 2` `+ * ͢*  㿘>  ,> H*`" * "㠢 @K%> H"㠒 @6Y4` <@5@6S <* .@5@6L * > H2#Ta@5> H㨔 ,'"㨘  !n!m:"`> #> # @  *@" `@:* !'48D* @4> H#6&% * ,  , @4b.6@㿘 6` &k& g2`**`" " `* * .`@ * @ d@5D> H@@'> H=)> ?" 2` 2   ! "!n!m  `> #> #6  ?> #4%  ? : ?*@  ?, @*`" *" * b $ ,㰓*"@ *`@  &@5 d* "*"@ *`@*`@*`&  > >  `>   (   > >   ` `+``   " "*@ .*@ ``  > >   ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?> # .@ `2 @ .@   $ &   ?? "? ."?   > # .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @4~  0?,@3ڒ   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?[? ?+` (@"@ `P@@ ` K>   * @   7` 3 >    @   #`  >      ?@   `  ?<璂 @a ?a @ ((` *`` 2??P`@?((@  +` `/"<+? `4< `  +` `/$0 ` '*`8+? < `  +` `/" +? `  *`+??<   ( @0`㿘`? " .`` ?` "`."` ` @1 㿘> `4> H2   ;: c > H"c 㿘> 0 @6@)> H'> H#㸐 * @ "  @2 $2 @2 0    # > H> H$ c0(   2$ $2  2 0"   2 @ 2" """@   2   " "㿈> 0 `xc 2``"`@`  &> I @9   & = >     <"` $ $ $ $ 8`$ $ $@$ `嬔 "$ 40 "`0` $ ` $ 0`x#@&`@@## @ "@, h`xc 2$ t`@$ t`D*J`$ x !4 r4 j, i4 l4 nS4 p@ 찒 o \(  c, h , i  * @4 j  * @4 l  * @4 n  * @4 p  * @4 r  * @$ t  *`  * * $ x 4`x    *` * $ t h  " < t?c @>  > `X*  $ x"/0 "`< 2 &㿈  X`$2 L  $  &  r p  h . h 4 `   n     l j i  ?&    ? h`&  0 z @ 耢 2t \'h   h * *  i*`  k* j2 *` m* l2 *` o* n2 *` q* p2 *` s* r2 *` w* t2 *` h  {*` h  x2  *` h耊   y*` h耊   x*` 4x#耢@  u* 4x#耢@  t`* 0I㿈` @ `h``4  x#@> `$` /&#  ` @ `x@` d X@ 2@  @@ "  d0w`t?''$`t d@  X@M2@  \@7? ` X?"@  H*        X `6@" *@    ` d 0C@|``P d@."@6$`x` $$``  ` ͢  􀢿 @?  X2@$`$`쀢`  x2@ ??@Ð㿘 `@   4 x#@" h5  h " x/ @ 8 d> ,#X X@@2@ 2 "  T    @    x    & x $& ^ 㿘 h T㿘 > b`    D > #xk@L "&   =$  㿘>  b`   ``D > #K \   0 `X $`   ?Ș  , \   椔 \`㿘 l@.ߐ p' 8"@8 '*  <@@ &2&  l@/b'㿀> I` `4 "`'?2`t `t 3' `h + X`x.@ ߰  ` D"2@&  ` @" .@   >2& ɰ  X`x.@ d"@ 8 ' 2&   d''@&@'> I` "`> H#ĕ* `" :g x x2? '5 @.P i쀢 L?   ఒ b耣@  k 4 x#@ P  *`  * *  ' P ` * ' x/2 x 2 ' x ' x2 ?8'  ' x2@ ??!   X `"  H?*   >& $`|$`0& "$`?$`  |    "(  " " |?  :" 㿐 | )  42$ *@    ?] & |  P W* T2 * T* T* @   @"(   6#  8  `D v ' P`D$`P @b   & 8 @R0㿐 T 2* $ T  * *@# @   @" T$ T& 㿈 2 >  #  >  ,   `P`%א@,` ? `谒 `0)`x#@  P  *  *` *   P ` * /2 23 3 8 & b?`x#"' R#&K耎 P  * /  < / 3`P* 7 `P*`P '* < P@  @ *   *` * +@ 3`P33 * `P * `P *  &`h'耢  U㿈`@ P?  E0%@,5 N?  谒 #v` x?#1 a4\蒎` P   *` < o (` `P3쀠*  P@ *``8'5`0``P*`P*) < P@@  @ *   *` * +@ 3 P33@*` P@ *` P@ *` '@ 􀦠2m  $ h 㿘6` *@` P?*2`# `"  "    * @" ?# 8㿘   2`* `(  "  T & T `?   2'`2'@ 㿐`   q@D : @qbm$  P`9 @+ɒ @$ 4` ,  `  * ?@, #8 ?t: P` " @ 4` @!4` ,  `  * ?@, #\8 ?O(` "     X㿈'?#@* ՘耢`?  x谒 "0{ T6`  $ T* ` * *#  x?#@")o" R@ #@,J x` `P   *` 2  <@ P2 *@  P@ /*` P  ** @  P !*  P@  @ (  *`+@ @ P+ @  * @P6` @*` P@ *` x@ 6@ ?8@ `( P@(l 耢` 㿈P  2  '?," P 2 *P _$T"@*@*l 쀢 2x " ? 찒 "x08#@  P@ @  *  *` *   P ` * o 23  2PT4 $T*  * *# P( 㿐t  4 h > ( 8 > I `" t ?> H#"#c Ę  `0G 0 2' '?$ ~&@& t 2  $t G     ?$X$T' h  ```X"@`H( ` ' `dL +`` `X . `d=`X``  p@$"  x S ??< x x?2  P |?2 P> & h P@'B D$ H& w?`'`2vt 8 > )' cH'  ''?'' * '  ''''$`4" `h 2 $ # @ > ) > )@ "J@ .2  2 J` .2#  '̒ "`   ` " `' '`  '``2 @2 @Ȁ  @ " ."'Į d'И?`Ȕ*ܰ ȀQ P ``2?'@``':E K`@ &  ` +͒#'?' @`?  @5   ? '%`(`]]%`,Ȩ  ܒ`'6  P> )`' "* @'``2( @"#`0  3 .> )%`,%`((` $ x@$?@`3  %`,  * #`x @ @  * @*``@@ @" ̀ "`'# `x#@``"`@`7` @1#; ϒ > )`t ̀  "İ > )Ā `"@ @$`4 0 @-#2  ݔ > )`t̀ Mİ > )Ā` "(u$̒ p @5 Ð@$̐*İ  ` W> )*@Q$ ? @;` `?> )*@+$`t ̀#"@İ > )&#H!> )  @  n@$ "@) > )#H >  㿀`(`x `4?`d"`X 2@'  ߘ   x ?N 0`X`x*@ &`x`(`X2 谒 쀢 `(`\ `?2谒 \`( `\`P @   h , , i, k, j2 ,  m, l2 ,  o, n2 ,  q, p2 ,  s, r2 ,  w, t2 ,  h` {,  h 2 x2 ,  h  y,  h  x, 4 xc  u, 4 xc  t, `, ={ `,? 2&`,`(`\@"䰒 M`(&`(`X2@  !谒 A?`谒 6`(`\P &`(? ͨ 䰒 "  h t'`x#@`@"'쀢  #˖㿈 4  Ҙ  ?`??X耢 .P"%> #> `" 2耢`@2e `@2_  P * a] 0Z  㿐`h ' 1' h "m `ttf e`44@"`x> " Z #@>`@R9h P` `  > `@2 " `@  `#`x*`  ` `*` * tԀ , `@'`'  h ՘?``t`X?" `H(  ``d    2> #Ӑ  a 㿘` d X  `2 "@ D* ` \*  X `6"  @ ` H" +      ?o   &  \ P  '㿘 $ 4 㿈`0(?4 &`0  *`?  `\ "*{谒 3` 2/ `\* ) `X?4   ?`谒 K0`\P  `"Ġ (" <  㿈 4 ``  F D  W `7 5?ܚ袒 ( P P@   @0  `ː  㿈 4   22 ?耢 ʰ 0#P@ @   @  "` `  ` @ * @ ѐ    x " |  `$@@"Mxb  ` @  .  `$@2 -  'x`$@!f `r `!ٺ   0  *@&x x| @&(&&$&&,  < "  > `0  "`$`$ !!`& n 0g ڼ`$@@2 @]   "b0K& && @&"& `x#@2&@gt @40&t`   &Xt`p Yp Z`@@ $ xa Ypp a$ @ @ati |㿐  '  > )#h  `֚`  z  2 `$   ?د Ԑ'  ?8   ; 8!# 8 P$@   * 4` * *` 4` 2,`  *` 4`   *` 4`"  * @$`8  * @4`(  * @4`* $`4,`$ *2  @*2 2   *`   * * $`,  *`   * * $`0 * @$`,$`0` 2-``" 29 `8 25   * @`2. #  $`x$`$`  *`   * * $`8  *`  $`` $`2  `a@2 `0`" `8 ؐ `4$`0`,$`,`8`$`8$`<`xc  " !+  #  $* * `q$`@`<@$`H & %* `4h$`| `c` `<*`a2`  $`H$`@$`D`0 `H@!p"`8 `x*` $`t$`L$`P/  ?#  $`x$`$``x/2@`*` $`l`@!N`t/``P ?> ! N$`P`l, 2  ?$`p$``$`\$`d? *@ $`Xt O9'`| : `4 2$*   ? 2` >  PaX@.  2$`|> a`!@.  2$`|%> !h@-  2 $`|#h@-  $`|8 "8'`P 4   ?@  ,  <!  $`" $`$` 2 `$ ` $`` ` $` $`h` &b&`  &` ("  "  "`Ĕ`  ?^ ` ` " < ;&b 㿘6` > #b ` " Ԕ `  ?ɐ b <_ ;`$*@$`$$b㿐"   `&@㿘" d &`d 0&`L  >`T@  >`T >`  >`0>`( ` Z!` Z!taD | ``@-є  㿘 < ! ` <2`  t ` @  `` @ 2&`@ א 㿈"'''' h  > 6> q!paPR耦` ` Ж 2' ד 㿐"`` 2& `&  2@  "`$"`㿘"B`  `0`4&& qrrqqrqr > )#H '  t`2 ( x@e $2`>  !@˒ X 2U`  ! /'' X't  'l 4''pp $  'pҔ閖 Ȑ / `p Δ 釖 p ̔p ?'pT 2@> H (T "@> H  (cH > !؁㿘 > H (   㿐 `D /` *t  $  &  r p.  h . h 4 `   n     l j i  ?&  㿘 !m` h` 4! `   2@ 22   <   j 㿐`  4  $  $  r pږ h , h 4 `   n ˖    l jÖ i  ?$  $` h`  t2'$` x#@   @ x 2$`  `2   @ X ` H" +   @  $2@ @ nB $` h !m!$` 4  $` h @$`  !2 @` $``2`  $` $` 4 ` `4$` 4 $`L$`  x <`  r p 4 `   n ǖ`, l`< j i $`H`4`8$`<$`@$`,$`0$`H h 2$`D@$`H$`D 4`d$`( 4 x\* <`P<$@ 㿘` *  ?2  ?2  ?2  (?2  L?2  P?2  T?  D? ? ?"`<  2  ?2 $ $?"  , $ 틖 t ,?2`4 4?"4 `4 @ "`4ʴ "`4 ` ]  V`4 `2  4 ,? ,`n 翖  4? 4`r`p緖 `h` ` ,`h$` ?" H`4 @ "  ,   `h  ,`h` $` H?`4 @ " He  H@@ `h ߐ ,`h` $`_ p  `   4 6 h < 0    x 4 X2  8X @ ?\d "@ 8  x " *  @찒 p ?GX``B & @z ?B2(X2$X x @h X2`@ (``@["  #\?#d#` dd`@H"  d?= dH"@8 rP耦 "n  `X $@   % p   ' < ' 4  > 0 耊 "  x =x ! p  j @ B d " x `2  x`@) Q  x 2  (  칐 @':` x '  B  2,`d@ ()`d:``d@ E@`XB B?@?4"@  j  耧` '耊`䀧`   ހ``X?2 ? ? 'Ԑ@``% @z`\   @ 2]`d@E @y@g @q@_4`d2 x@ 8 `d x 4>`d`d@9 Ԛ 'D@Px"Hp@|t@p`X``@@" x ژ ??:x`x?2`\`|?2`\ `"e 0d?S |`\ `d @"@  x <  B 4  ' x  @u4 @uPÐԀ c `d    ` '  ``X@Ѭ ب  9܀@ 6 ` 耋 Ԗ?  @ b %= x?ۘ @2   Ԁ`    E㿘   `?   `?㿘   < ` W  i  f㿘  -@ \ P> )>#H0' '''X"` $ $2`X> " X  #X̰ ̀ [#̀ LJ> )   `΀ ے h`"   J`.   `  @ @Ȕ  $ '̴   ` ` (' /З/Ȓ  `tt2  $`" "̒ΐ 2`@2> "  2̴   !h ^  B`  h 怦~   ۀ  ? $ > M"H` рFȀ 2 > 8"p`j  `(' > !"pr` SP h\АZ V $,$(  F `0`$0$`( ``X 3  ꤘ  `Z V `\ @$$` B`At 2``> "?`X?" `H(  ``dİ 4$ȕ4 `P+ + `x#@t`@" 2+ ;+ :`x#@ 4 24 2+ 5+ + + 4İȔл Ґ ?$> )#H > e"> )#H '  t 4(x@   ?T툚 2`@   X'p2'p $  'pҔ Ȑ / `p Δ ݖ p ̔Ֆp ?'pT ```X " `H(  `d` P@`d P> Ԑ#XL @W P+ T2 + + ̑2 + + ʑ2 + + + Α2 + + ґ2 + + Б2 + `x@ t`@" 2+ ;+ :+ 0̖2 + 1+ .ʑ2 + /+ -+ 2Α2 + 3+ 8ґ2 + 9+ 6Б2 + 7`x@  T+ T+ t+ 4 t+ 5B /T$2> "Ȓ "T /'''t 'lPx T@> H ( P   "@Ĕ > HԐ ( H > d"㿘    y' = " B` @ BN  c  璒   TR㿘  -, H `'D> ) ?#H '` '  `h?`4? ' @ђ!` `  D %` " 'г2`  .`D"@"`2 '`t `x#@2a`@]Ȓ @  @'UȀ@ Q`\7DX3Dȡ4:  A' /> -> `xc 2'`@'  /   /@$!  /@$!  ? 7`@  Ո 2D D " &`   $`x`: ' `X@dȚ $`\`d `"@ 8 `x" Ѡ 8 !ظ Ę?`ظ  H"  P  r 2 ?'Ā` Ē `@'Ĵ?'Ĵ?}?  #`x*`   *` *  0  - +`@  *`  * * 2 ܀``@`X```H" * ̒   @  P$ : :@ @uB  '/ߐĐ @` n/*?  ? '7`@   OԀ2&D"ԩ? ?  &`ް Ԧ `P D \ *` D `"@""@` %`=``x d @  b DD`8   "@ "> )#H > c# 㿘  ` J <㿘  `  <@`㿘 `, <㿘   ` 4 "@  2  2"`X @U"     㿘  `<? `> # x p@2$ x | t@2 x`4 ` X p@/"  x ʘ ??< x x?2&`  |?2 x P@ D$ H x?2`  |?2` H /d * % +H 00 >  ` $ La  8*` € 㿘 > `#( t P $ ?  2` C "> > ##> ;#p <> 6# 㿐 `  x #\   8 x``4>D( `  " ` $`    `    㿘!#8#ТcC @@ ,ӣ(' @ + 3`3  @@ @ 1 㿘` "$. `". `` ".e `".` ".\ `i`" .U  .    .   h C g6 $@$ ` $   h$( `2$ . 7$ &  % @       =  "@$ $  !o  2"` o h" `"`"` 㿘 8  . 8 @3   " > #   > `@#2"  2&   "@& > I (㿘?2  @  >   X `"X""H 㿘? 2 @jH /f4 * '   @@H 0 㿘?2  @F  2`  @ H /f * '  X   $ X $ 2:$ $> + (6$ $4$ $ "   2:$   >  $> +`(? > ! # ? #@GH 00W     )$     2 :  %$  $  $ $ $ H 0  H /f  @H 0 @H 0 * '  $ $ @$ H 0㿘ِ D   H` L PA T% \& \㾈> )?cH2   '@`2`= `\ 2`7 2 2 ` ,7 )`l (a(gX  ("(@` /H /` * ! ap H 0H > O# "" 4" " " 4" " " 0㿘? 2 @# `; I  C|@@j@; "v@ "5-"h+fq@- (t@%s@ "$"kbo@ bn@"@ w "p@"k "m@0"{@ "k@"*`Qs@"`H!bv@X  bh@ΐbi@"`w j@"`f@"`l q@6 f "@~x@"5 `<t@"(`@U |@"0 `=O "n@ ">  "o w@";`LA @"`0<  ~@ "( "y@ " "r@ "&8"u"p@"$ @" "}@ ""z@ 0}@"  "w@ "V"g@ "N "m  v@" @>  0"f@"*` "l@ 00"{@l 0H /f * ' ` ``@H 0&& 2ǰ >     8$` &$`  @H /f * ' H 00 " H /f4 `8* ' `8   ` @P  ,`8H 00{` u@t "q  n&` j@ e "b  @ 0]@Y  >  $@ M$`  I G$`  ` @&&` @>  $:&&`46&4,`:616/&@ +$`@),`;'&@ #,`<!& ,`= ?$` $` $`D$`L ` $`P  @ $`T& ($`H &㿘" ( ,` 2 @@ 2S H /f* ' & ,& (H 00b5,`  `? '@ !H /f* ' & ,& (ĐH 0{  w  㿘> I $     0@ 2 `"`  @( 2 `",    @ !H /f4 * ' @  pH 0 㿘 0 㿘`A?5 2  @@ - H /f4* '  : "   ?  $ > + ("$"B\H 0㿘?2  @Q@V`?>   &`8&`<`H /f * ' X "X&`"H 0  㿘 <? @2  `@$@H /f4 `* ' `   # `2? "& @M H 0㿘 <? @ `2 @@`& `: " `&    㿘   #>( 0 = $ 0   (@  @a < 2  2 0㿘#> 2  Ր` @㿘`+  ` @` !#>" 0 = & 0   (@K @c`x < "` 6` 2 0㿀''7' @6㿀H '''H7' @6h` Ȑ0&` `  `!`&Ԓ`777&` &` ''7'` ``  `?&`6`&` 㿐    @ 4   $  `2  4 8& 4& & & & & f  @(a$$@""  2" :`& N $> + `(     & & & & $& 7& 㿘    &     & & &   M  7㿘 X? "& X  " (>   " 8  " (2  ( " ,,  , & @㿘  j  2> I>    $ "@" $""" "&""㿘> I $ < $>!`-> )>  /%@ @ 6  4 > !` 4`@ `0@ 2` `%> I(  2 l`h   `(В  2 & D㿐`-    -0%1>  'ҩ 2􀢠>  4 & 1>  'Җ " 4&   > I("  h2l2h 㿘   t ”   > I& h(( & l( l"`p"(& p㿘 l`" p p"`p p? l"& l& pU 㿘 > I  `$  "&@ 2`"`@@  ,`  ڔ  "`&@㿘 ` ,> I $`    2 2  H /f * ' ƐDH 0 L`t4<|D0PlHd$8t| pp@@ " 9"@ @: `  " * ( (/  "-    " "  * ( (  * ( (   * ( (  " "@ @: `  " *  "  "  *  H  )?? `">$!ē*` €   A2  t`   J2    Z2 ` Q "  :H  @ 2ܰ  =@ @ + *  *`   @ 2°  m@ @ *`   2 `  "  : z x@   2 `  "  :  `a, @ ], [ Y  * T@ * O@ * J"@ * E"@-  () '  *# !  2   "  (  *    2  "  * #  0  +3  #     @ ̰     + 3 ߠ ݘ 2 *`*'>%(@"> l   0s"h`  0kj > XW_ @"P`"K E 0NB0 0I">pP8 0A5> 2.+ 2  0  0$@  0  0       **` `?`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @ &  㿘 @q   "  20   " " "     2 0   " "  `㿐> I>  `  @#\  $ !> !>0ݯb@!́㿘>    > Ր "`ܬ '> /> ը 3> -5> E> > `ܦ  /> ը 3> !5> E*`?# > ܐ "ܘ  #`0@*` ܐ  6 X耢 @&7& ܐ $@ ** @6* " * t `   % * b 耢`    $& & @ `H*`" ! 2!>  &!!&! &!`&!&!&!@@ 㿘!̀  0@? 0@b i@`( ``,`   ((,( , 0 X>  i+` h2 , , , 4 #$&!>/"$$ $,  *@ 㿘 X> `*  H o *@ g  @ &!̑H 0㿘H /f4> I* '> I 0  @  H 0㿘H /f * ' !Т@ > E   ,`" @*`$@   2 ,H 0㿘@?> I 0` 0& 0 "` ""00& 㿘@( h   > I 0  h 2  2  > I& `0` & `""` & &  "$ Xw㿘>  ܀`  > I 0" 0"`> I 8" 8"` & &   2  & $> m P" "  &  & (> a P" "    & ,> U P" "㿘> #Ȁ`> `p@mې !`8 ! * ` \$ ` "!t `"  "`> "  ? "& &  ` ?& `!t@0  & `& > Ւ`` & `""`> lHo  "`> @m/b㿘H /f * ' >  쀢? `"`$` "@"" ` ?"`t@ 쀢2 H 0㿘H /f   \@  X* '  \>5 {>5>5>5< ` ,6 \&!t&!x&!|&!Ĥ  h 2 H@@ H " T@x4 T  h @w! "!а!! N!@@@ @{Ð> גb\@> [b@> ax@ `"  "`> I" 4 ? "& &  ` "  `"  "`> "  ? "& &   2'> > ["?@  `2 X 0` 4"`4$ 4 0"@$ 4$ 0 X*  "  $  ?@ $   ڐ @ϐ `2@ X* "`  X* ` D?"`  X * "t $ (q  ,n > E  ! 0"  * @`" €  2 0@  X> `* "H 0㿘@  ` "&@$`` "&`` &`X"` &` 2㿐@S  @   €  @u @ 㿘@7 0 @c 2`)  2 \$ - "`H /f * ' @H 0`@`@ `@㿘$  L  А 8 ;$ 8L 4`4 > Հ 0> L  ? >  ؀ &`@) 2 @; 2 `& L !   /А  *`: %@ @,` * , ?Г:`$ L  `2&@> ؒ؀"  " > I, ,@"`` `?@""@"`> I ," ,㿀> I`,> )#H  '`&#     4 >  ?`  @y   @Ô  " H > ݜ 㿘    V   & >.a&> ` @c d$ 㿘  & 㿘@ՠ> I 0`"1 a(2)`` "%`   2   @ `\ "   "   " @ϒ    2``2a( 㿘@> I 0`"' a(2``\ "`` "`   2   `"   @    2``2a( 㿘  @h   >   > I>  . @ >  =@> I 0 8!(20  `", @ 2#```` @@ @   @`* `" `@` "```2@  2!(㿘@> I 0 ( 2 "  @   22( 㿘 `" H ` "D `2; "  " `\ " @ . `"&  @ 2  0"  ``   @   @`  @  2㿘 ,`@ ( `$`     $ `@` ?@ &`@"` &`@  >/"Ȁp> )cH'H /f4> I* '> I 0  %  \ " @" \!x ?`4 \7!x  2 \H 0H > ܐ 㿘> #Ȁ`> `@ii  \ ؒ @6 \  " !Rϐ   2! " !!!   T`" T` &!&!"`!?&!`" TU ! " H@8 H @P@4@Ɛ㿘> #Ȁ`> `@i!  \ ؒ`@6 \ T " H@ H @0@ ` @q@S㿘@@ (^ 㿘U=  & && 㿘H /f4> I* '> I 0  T Z   Z*` 4 Z!`" @  2T ZH 0>  Ɛ㿘> I 0 "  0@ ֒ 2   0 > )#H0'@ $@ @!@;  az@>ay@ ;00 !@ $!0!x@0,@0(` \#H !z@&R?NJ@F@aBB >#H@m9  2 !F@_\K a@p!a2@a1@Qa@1a@` a@$` aI@=a@"%l` a@a@a@m` a@~`  !@ "ؐ!'a@ "!F0a@&a@"Oa@"6 !Ja@">pW` aH@ aG@a5@K` a~@".lE` a@"J(a@"7 na@" l5` a@"b/` 0 !@a0 !6@0!K@"x` l&j&h! e 2#H\  H /f * ' H 0 "\\ 2\H /f * ' @H 0\?bR! x 4\\: 26#H "`` 2`H /f * ' @uѐH 0`" 2\ `$`H /f * ' @oH 0` *` :` @ $`\ #H$p #Hxll@@\В #HxW, @@ 2* @ #H @l 2\,  @@ @  @\ | @ wp @  ٖll #Hp –l 2_\@l@PX4lV&x 2t#H 8o J,nH&j f#H`8a (@2@Ր@p@b@u &> ["? `  0` 4"`4& 4 0"@$ 4$ 0@$  ?@$  2@"  @?>  @@"@ $( #Hx@ې@ #Hx@) #H0 #HX> `*  " `"߰  2۰  " hհ    `ɰ   ` 2 `  ``@  \ H /f * ' \А ?4\7! x!\!4\7xH 0 "e\ "    2 @ɵ  2T\  p -! "$ ! "8!! "` 0a"a"a "a!` a a" a% ` 2`  .a#` ` 0a a "  \aa2\6\  #H@` #H\ H /f * ' @mH 0#H > w ȁp> )#H@'! > I 0 0    !  `  2 &@\ > I 0>`;` 0!      7   H ` $=  2 6`  @ 2  ̀  В 0R  `@Œ  "@"&@H >  Ё㿘!` ` &!&!"`!?&!`P !  㿘 ,   @   & & & (& > I`8` $& $& (""` 㿘N@ " @J?`/$  @J?`94 M `  @@ M "D ``2@  K   7  C  > I 8 @ / 2 $ 2  2  ݒ ڒ   $ $@$$ $ "@$ $` `$` "&  㿘   @ 2  2 P ` "`&  ? "$ $  "2"`""`"` ?"""  `? "` $`" ( ("`(> I" <?`(`$""`(" $j g  㿀> )  cH'``")   & ``2     ` `@ @ @۔  ``  H > հ ؁㿀> )#H> I`8' @] 2 $ 2 0    "*   &  2 !     @F  `0@o     H > d 㿘> I 8 @ 2 $   $` 㿘> I 8 @ 2 $ 2   @`(  "`$ ! `!x!@`2` 㿘 ``!> 0&  #`!@ ` @T "`@  `@ `"`@}  @`> )#H> I`8''> Ԁ  > a@ 2 $     #>  a 2  @  //@ #>  < "a@ 2 < @ #H#>  < "a@ 2 <#H > Ԙ! p> )#H'`" @ \`2 @ 2  & @a 6 \? & @ \ > 6 \   \ !xa7а#H > e! 㿘\`      -0  -0    @"`` `"" "`"``"` "`` " `?`""`"`㿘``&``@y 㿘> I H @$ $ ($ 5> $ 7Բ   2 `Ԑ$ )0` 2`&`xؐ@ (> '': Ԡ    2  2   `> I> I$`> I @㿘 a2  a1 a "  a2 -$  ("l R\ @ @@ 㿀(@ܢa( @  (@Ԡ`0> a(!0 `h  d 2 `\" \ `k ( \a( "  \ 2  \@$aO T A A`\ A A> 2":4  `(@W  8?$84 "4h " 04  @0 @=a($h 24 A "`> + D@ : A @   => D!x% 2> >!x@9 " `!(`\((`;  (沔 M ($7@´ !˰ "7     7`0G  /`@# M   ?    "` " `H h 2`H@nk`H +   S  `H @  2 2  Sz   c 7`H S @m [H /f4a* 'a   aa aa@&$L  7a 2" $aa$a $a "`a $a" `H 00!@ <B @<` @ B = b``B <`ĐH 00K㿘J !( &(` N=  h`@  h "` \`@ 2h>   ` @"`  2` `  @C  > Ր @;  !"6 `B <  `B >   B<   B> > "l` `"l 7ȒHo  "`  ,` 2`!@2  H@# V H "`?# @ 6@nV C 2  Г,`  !2`@2  T АBK.< 0. " h  ` `@mJ ! h  #  @m. ? @6  #JĐ0   \!"`@  H /f * '   54`@"F \4!hh' 0"݀@@l}"d@z c@v HlHo  "`> @^b> [" \ lHo  "`> @]b> "\ ~@‰0@Ho  "`> @]b> m!x # c K  } "4` c@> > !!lHo  "`> @]bC  94`6 @ 1  ` -*@"@( "L & && J  2@2`2`2`2`2` 2 ` 92 J$0J!0!  @  `J&   0 &  2" & &  & H 0> > Ֆ :  0 *@ `  *@`*@`> *!㿘   ."`."a."b> !> `?."c`#!@7:`."e."d㿘"` >8ݐ>8!  !̒ %. i. j&!p. h& l&! a!̐"`  i` &"h D  㿘"h?`""`"@"" # 7"h2 >  @  (@2 (@2      > >  2 ` @2`(@* @ 2(@*   㿘ǐ?㿘א?㿘  "    H /"  D /랔 ; 2  > Ր!디 > 0!  ^.@.`.`  .` .` #.`  3 2.`  2.`  2 .`> Ր!(q >  !0.`.@ .` .` .` .``  㿈H o *@ g     H 00c 耊 2 bhH 0V  @_  2  @X  2      & H 08  7   H 0* 7    & & bh & bh "`&bhbh& bl`&bl@  bp &bpH 0 4㿈H o *@ g    " bhH 00K @  2  @  2  2  H 01 ?  & H 0%  `"  "` ? "& &  7bl&bl@  bp?&bpH 0 4PPhP(L(<0Xxxdd | | | 0 0 0"$"$"\"\"|#D#D#D#D#d#d#d#d#d#Dkkkllll(l4l@lLlXmmmmnn$n noLoXodopo|oooooopp pp$㿈 \  `"  @ C o> &"`> cx Ҕ 0  Ț`C B> GZ> 0!(&`("` `  / I/  //`I ` ` : J 2 > c  0  ȖB`B > U>  "" 0  "  >  cȐ  0 y     W@ "s"40`W"v" !`!"O""@"B"" #@ "0"4"# !@%> "@"+"" "0  &"`!  @4  >  `   8 0 В`B c> А" @0v t@0p n@ 0j h> "d@0b 2 \> lHo  "`> @Yb> ["&" F> "@l0@ 2w \> l@Ho  "`> @Yb> !x^&"" 2  >  `H  M   5@"4!h>  А"݀@ >  В`B 0> @FI0slHo  "`> @Yb> [#"l@Ho  "`> @Ypb> !x>  `    0  \ `" H /f * ' `` @&&`` $`H 0 > `Ȑ [ 0` 2 m ` 2" $@`$` $`H 0 㿐`(@L !(@  `(@E 0> !( pH /f * ' n  \`&"@@ EH 0: 22`@6 \H 0> "0@H /f * '  2G"`   `  *  ( :""h 2"h EiH 0  1 "l@6"  2"` >  a8* @ " "`  *` 2""`" 2) E  2" \ > a0  0 `B > H 0 7 ` --   -- " "0"(  "  ! !"" W 2 2` D `B > H 0 /`  Ee  2` \ > a0 I 0 `B > H 0h 725 `!  @ !`D&!"0 70/&` 2" $$ $$ !! !!@&&`D  7! 2" &!!&! &! " \! &!" \ `B > H 0$2"!t@" B> H 0 㿘#> bp 2 bp!> >Wa"t "tՒ bp> " &" >@ $bp 2` > զ!H. h&!p&"&$&$&!&"l6"6"&"&"&"&"&" #p",``` >VaĔ@8@ @ @S@8㿘> "p "" "p" 2"""@p #p> ِ"t#p" Ԑ ϐ#܀ "# # "# #耢 "#} #쀢 w 㿘!  !!  "x"`"`"x!` ` &!&!"`!?&!`C !@S@QH4"`("`  "x!`?H 㿘H /f  "x K!€ F* ' "x    &"x&"|$ "?&" 0@ ̐ 2"`" '"`    &"`&"d$ "h?&"h !Ā Ɛ!! 2!!    &!&!$ !?&!H 0㿘H /f  "x!& €!!* ' "x`" ""`" "`` !Ā 2ߒ ! 2!!H 0 㿘H / * '  2@ 1@@ @#x @"  \r  !@m 9@e@"M`c 0:@W~@"R lY S \ @`? \@  `? @  ?Ȑ*6 \32" "  > "4@ ` \" @`(6 \> "0@0"  \ ?6 \`#@(& lH 0  "`@T@H 0㿀` \  `> aX 0Ȑ 0Z ``> #\` a#``#d` #h@ 0`@E 7 ?> ! 00:6"`"@&"" >  a뙔 0 \ 6"k@"x" 0M6"&" \@  6"좐 > b 0{ 0  @)􀢠@ 㿀 \ jM @2  Q   $ $ $ `52 *<"*c# # 3 W`3 3 ?2 #\ > #` b#d   0; ""@ "p!`&"pA&!  $ "| 2" &"x"&"| &" \$ !t@   "  B> 㿐 \" `   /  "@2  8  ?ʒ  j, 2  @' ' ' "  2 `  2 **   2.@.``6``ؔ,@2 @y@``> #\b@ ǔ 0`"> `@> "h""@"p!`&!AD&"p  `B  > ' "| 2" &"x"&"| &" \$ !t@   "  B> 㿈`\` k>  bp`0ꀐ 0c  b*`@ @ #\>  b#` h`0`*`2`@Z> 걐"h@4 ?` ">> *` €`4  (>  "ꕒ`0"`b* @   4   ? *  `>=#*` €      @w0c(b"   @k 8 6@c >  b `0| ( bȔ `    >  "3`0`b*@`>=#ē*` € `c(b" @. 0 @% F 8c(b" @ >  b 體`04 ( b   >  "`0|` ` 2   $  b*@`d >=#*` €cbГ([" R @ؔ  8 b*@`G >=#*` €@Ĕ >  c  T`0   ? 00(b"@@  ,@瀤 b* `>=#d*` €@  4@  4 @ ,@ 8€0`   > c@ `0`> !H @b     H+  2 `" *`@ `` `*`@m > #`  `0 + -, 2 `#\`> ##` > #dchɚ`"   `* `2 I`* `>=#D*` €@ 00 !@x00 !q b* `  y> #`0u``4 r> B# * * *` c  2`>  ay`0> "4@0X,c, c2 , c, >  蹒`0+  3 O 0@0 !@& c@23`` 1>  (`0蛔0+>  `蕒`0 * * *`  c 26b0>   x `~`0b&b  ``B >`㿘`\ b *` @`0>  `   b* @  "c0@d 0 b"@ @]  8@㿘`\ b *` @l`0>  `ߐ  b* ` >> ,*` €@6 0@1  0@0 @) 0@$  ,@㿘`\ b *` @3`0>  `禐  b* @` >> L*` €@   0c * b"@@  8@0@ 㿘`\ b *` @`0>  `ؔo  b* @` A>> t*` €@Ɣ   4@ 00@ 0+@  bc* "b &b  1  ,@0 c* b"@b  &b   @ 㿘 bЕ+  c"@ $ +  , "c.@b㿘`\ H o *@ g bb `0*`@  *`@ >  `  *`@ ?  $@  *  "  0;: @= * 4@8 % 4@4 ! 4 * `#>> *` €b &b   0@  8@0 8@H 0㿘`\ b * @" @`0@>  a悐  b*  "@>> . € *` * "֐@0  * @*`@c ?>   l  "#"#"#"#"#"#"""""#"#"#㿐 \"` H /` * !  . k炐H 00D l &#&#&#6"&#e&#  \&"'&" > a   0 \" @`6 \ ""> b!0"!>  " &"`€" !> > R!H " " !> " @ 6 \€" ג㿘 \"` H /` * !  . k!H 00*> " ߒ \ @ > aP ” 0昐 "> a 帔 0" b  @" \ &"]6 \㿘#䀢 #  ?&#"> &"" 㿘> " 㿘> " {㿘 \   | > a p 0p !> %> `  c?" @@} @媐 @ "   0A >  ` C0  ` ;0 4 `"- `儐!) `0 `*@ *`2`"#@2 # ` > p! `#؀ 2 " > e! `  &"> \" ` `@ `% @> I"-0`!3 ۔  > > <!H> b   0` 9> " @@ @$! @ "3 `  "L ` `S 2~ ` ` `*  `*` * ` #  t> "@ p `> "H"# 6"8 222,`,`,`W,`  `  `  ` M> ܐ"XJ `> ֐"h,`,`,`9,` `*  :&#> Ȑ"x6 ` ` `* * #إ2 @" #@0#@-> "䰒#ؑ2 ,`#,`0"#@2 ` ` " > 䜐" ,` `B `@ `% @ ` a%"#  &"䀤> |"-0`!3  > o"ؙ-0`!3  > `"&"6".0`!3  & `?㿘 \ > b  0B`> " #> ` @> "@@@1a@ ""  " ##`2!`#&# ?&# ?&#  #怊  > ## ? &#>  #8@`&Ų@ > !H㿘 \ > cP 㝔 0l`%> ` lj`"@@@ߐ@ "L`  -O`2M`# HG` 2E&``*`* `@*`@ #@ 8@ `> 㶐#h(!,&#*&#> 㭐"x&`$` 2"&```,  > #x㜒"?("@(8(#&#  &#"> > ㌐#8> "4@`&@`> ~!H㿘 \@   > ? \ > b  0> բ!H , @ `"  @  , #  " "  &"@;> բ!H , @ `"  @  , " > բ!H , @ `"  @  , > դ!H  #"  ,  `2  @  ,`$"""€" @㿘 &"@  )> #!H,@ ` 2 ` @@@,㿘 &"@А$`@㿘&"@Đ$ `@㿀> )#H# ' #  ',&# / , # 2 2 2 , , , #, #  ,   , # 2 , # ,  #  #,  *0 2`"#@   , *2 ,  0, b#2    ,  "+  &"."0`!3  cH > Ȑ#> #H   *`  ``* 㿘"   > "4@"""#"#""㿘> "dВ㿘> "d㿘> "d&㿘> "dV㿘> "d㿐 \   3   > c ᳔ 0`6 !> ` ˒ ?" @@ @! @  `  > ߐ! `> ِ" `ځ `@ `$Ϣ@`> Ɛ"-` ``!3  > Ẑ!H# #' @  > c U 0^  [`7> " @@ @ᖐ @ 2> ` ` `*` `* @* `@ @ #  " #@T> v##' &#"&# > h# @>> `#,`,`2 ,`,` ` `@ `$@ ` ``# ` 2 2  2 ------ > - `> &"ؙ-` ``!3  >  (. ``!3  ߒ `?㿘 \ > `8 ઔ 0`#> `  "@@ @a@ 2`# ?&#`&@ > ې!H㿘 \ > `P | 0@`%> ` @>`"@@ @ྐ@ *`' 2%&```* `*`# `*  &#@ }>  h#  `>  x#&# &#`&Ų@`> !H㿐@ # `  ` #' ` #'@ 㿐#&# \ ? `&#&#@    > ` 0 0  ## `&#&# 2## &## &#㿘# "#@ '# &#x> )#H# ' # #'ܒܔ @|  / *ܚ *ܘ *ܑ2 **"  &"."ɐ`! #H > V """#"#ȁ""㿘> "㿘> "p> )#H#Ȗ  \ ' &#Ȑ@  2#䀢 2#耢 2#쀢 2 #Ȁ > ` 0k  cH> #Ē`&#&#Đ"cH >  㿘> "Ӓ㿘> "<`> )#H\ '    $ > a +0  C ` @ +> > ?" @@  @aa @   `    > M!  `> G!0 ` ` `$@ ` 2ǐ > 0".   `W3  ƚ> !!H @X > a8 ”0| ` y ;> " @@ @a @ 2[ `  `??Рס  @Д`?   Ԁ  <؀ ܀`?< 7Ѐ`8 @ONР@ % > !X˒- `'`  ,`,`,`,`,`,`,` ,` @ _ " `@O)Р@ > !Xަ `N ` `$@ `  ` .@  > ވ!h.  `W3   `@ ΐ@N> !xq.   `W3 9 `?> )#H > !㿘 \ > a  0$`` ! #>   "@@ W@9a@ 2`#Đ ?&#`&@` 2 > $!Hp> )#H \' > a  0Y`'> ` XV`"@@ @@ B` ? 2=&  ??ؖ<‐7Р`֗ #Ā` &#@N_> !#Ȁ @Œ@촔   `"> ͐!@u@t`> !#Ȑ &#`&@`> ݵ!H#H >  "#"#㿘# J&#p#> )#Ę cH 'Д @ɖ  / , ؒ1  "  &"."ʐ`W cH > ΐ" > ) \#H '``4 ` > b0 0  H`@4@ ê`   0]  0z $@@ 0 0 @Ő"#> `b` 0 0 @"#`> `bԐ ,@ ߓ2`> "@ ’> "h@f` @f!@j##@f@f@fD#ܒ @Z/#ܒ ` #d> #\#h#`#4#l @@<H > bА ܕ 0`$ > > "*``@ 2`> ڐ!HH /f * ' "0#ؐ ?b# &"# #  H 0 HH 0 @אH> b 0T ` > ܢ"*``@ Y2`> ܚ!HH> c 0@ H $@@ 0 0 @"#> `c `* `*``@ 2`> s"hH`"̀  > cP 0 H@ܼ#耤 > #@9 >  0c ,2`@ > M#@ܥ#* #@ 2`> D!H "@r"Ġ@0@Đ"#``> #\ 0cݐ ,@2`> ("@˒> ""h i> c 0 Ę bH@e` @e@f##@e# @e@e@@ڔ  !> `> #4`(#\ @? #4 ,"Ā   `> > #4`8#\ @, "Ā &H!> #4 #4 (@HH@"`@> ``H#\ 0m `*``@_2`> ۶"hH >    ""ā""㿘#0"#@#  !> #4 8@#&" 㿘bĀ > #4 㿘 \ H o *@ g   "@ 0> "` "? &""Ā !> #4 ,@p 0"Ā   #&"!> #4 8@^ H 0㿘 \ ##怊  &" !!,#X`"  0>  >  >  Β`#怊 > >  0!H /f * ' #" ` &#H 0 0 H 0 " @㿘 \ > a( ڔ 0#X#> ?&#b4€x# " #ܒ`/."@)&""̒ #d#> #\#h#`#4#l  @㿀 \`  "> a8 0] 0``4@    0׀ 0` ?@ `$@ 0 0 @ #> `ah`, *``@2`> u"h0!a@"@0@ #``> #\ 0a ,`2`@> Z!Ȑ@> T"ha a4/#@(   #@!  /`> `( !> #\#`"#d  @"" ,"    /`> `8 > #\#`"#d  @g" !> "% " (@0w#p > aؐ ٯ 0 N@`" > > ",``@2`> !HH /f * ' "0#ؐ ?`# &"#  #  H 0 0 a 0k  N@`> ٶ",``@n2`> ٯ!H0> a 0V 0> `b` 0 L *``@>2`> ٕ"h """"㿘#0 #@2 ## > #&"ܐ" #0 #@> #(@#o#p㿘b > "| 㿘 \ H o *@ g   "@ 0> "ܒb@ "ܐ? &"" !> " ,@O 0 " > "F H 0㿘 \ > bh ͔ 0> #(@㿘 \#  &"> "> b غ 0H /f * ' #" ` &#H 0 0 H 0 @㿘 \ > b ؏ 0#@#p#> ?&#b4€p"#`."@(&"/@%##ܠ"˔ # > #\;`#h#l#p"/#t  @㿀`\  'X'T-&  |'`b  `2` `  **  2  ,, T  X "@@:-2` '`'` `4  @  >  b@#\ `0`,`@2`> ^"hbb@bpa`&a.&bp` `B >`.0'`b| 2" &bxb&b| &b`\$`at@` `b` B>`㿘.f  & && 㿈H /f * ' V> "p a> " "`"Y" \ @T``" N`2 """ 4"D4" ("s"x" 2"> b 0א `@4" $ `")"@%"  4""  "` $"" "" 0"# ' $",#`!  P" 2"H 0> "t_         2    "   `"   22"`2"@p> )#H \   '     ` 2 `  > <' ' ' '@'`'`'` @T'܀`2'䀦'` &#$@$`$`$` @A  $  > b 0ɐ H > q"x> )##H'#'ܒ c     -  ` 2 `  "  ' ' ' @'# 2'# #$`@ H $) H > %#p> )#H'@ Т@ߒ      F ` 2 ` ? ? 2  4"       6  0         `  H > #p> ) #H ' ` 2`"`? ? 2`@'`'` '` '`'`'`' $z #H > v#0x> )#H' H ؒ `T/߀  ۀ 88 ې @ /`/Κ cH > C#H㿐`Q  ` "@",  @A @  R "@ L  v$ $$h #@ߒ #@ܒ #@ْ `'$ +0-"vɔ "@##ؐ@Ò"@4 `4 `  >`0`s 2`` @ޔ!`" xU  xQ  㿐`  ""   "@"  @  0"@ ~   vu$ `$ 0m"vi "@##`̮" x  [  0#@ #@w K * 24@` "`w ` "w @8 #@5 04`,@a   v#@R` "$`w̒ $`  ,@J   v @;` "$`w $`w  㿘 &"@> բ!H , @ `"  @  , > դ!H  # ,  `"  @  ,`\㿘 ` (>> ؓ*` €1> '#`1> $#p1> !#1> #1> #1> #1> #1> #1> #1>  #1>   1> > "ՙ "㿘. 06 `# b#4`"1>  `   ` 1> ( & (1> # 81>   @` 1> 1>  1>  1>  H1>   P  X1> > "S "㿘 ?`>>!*` €1>  `1>  h1>  x1>  1>  1>   1>   1> > "  ( " 㿘 "1>   1>  1> 1> 1>       > "0  "0㿘  1> 1> 1>     > "@  "@ %>>$* >  >  > !> !> !> ! >  !0>  !@> !P> !`> !h >>L* > !p>  !x>  !> !> !> !h㿘. 06 `!"1>  `#  !*1>  b# * 1> "`1> "1>  #01>  #p> "P2} "P㿘> !V .`  !> !M *`  㿘?.`#`@#> !>  ^ 4a `/!Ȑ*  @㿐 6 6 !> #\> 6 И `"`8 "`㿘 \  "k 0> aҵ "    k . kH /` * ! H 0㿘!> Ր!\@ M!\㿘"` s  > 3  `0 ?>^>]a D  $`l4`\$ax$ap,`h,`j$@,`ia $a>]c` $at!> IO$!!b 0`͛`D Z  㿘> I! " .ul  㿘` > " D  \  ] &`41 @" (4Ű ° 3 A `B < `  ; @ !B < !Ā "K!t>]#@2E )  2 7`"H /f4!* '!   !! !!@&&`(m  7! 2" $!!$! $! "!t! $!!t@H 00d  >   0> ["  > !x " (<N /H /f * '  @`(&"H 02 7&` 2" "" " > * lHo  "`> @;Nb B< `  ; B< H 0 㿘> "lH /f  !h "!€ * ' !Ā !! 2!!    &!&!$ !?&!H 0 f @* ``>  "8> ["  >  @4 ax K'0JH /f * '  @ `'"H 00/$  2" "" " * Ho  $`> @:b `B >    @ ; B > H 00i` "`\ 2@  1@ @"  \ @" A2 \>^(""  /  /" l "  " " " "" " 㿘  q  2"`> -"`"` "`"@ "`"& 㿘 `` ``㿘@ 2 & > 8 ѓ"``@ 2&  Ė @~ 2& > "㿘 2 `/-0!50 !6""` a `@^ ` @2&2&N &&@ F&C& 6> ` `&`&`&`&`€  ` $.  qV   *$@*`$ǜ 2 r &` 㿘 8 @  > <  2 b  2㿘 ?2 @2 $ & "@"" r 逦> Մx  @2` @  㿘> I"!> ( ȁ㿘#ap p֔  2 H >  $"`ǐ 0?>d>a`!!(  2 $ l4 \, h$!x$!p$!$"p$! $!Eʀa\ > H /f * ' > I!h!$l"l$#!H 0 㿘"| ( H /f* 'h  l " l ? "$ $ H 0 ѐr  㿘" 2" #  $"  $(" ""` < 2 ""`>  # \  4 \"H < $"<`$"@~D$"㿘>`0`} \`h > IV ! Q!h`H"| 2H  "G 7&`&"|` :> xH /e * & `p$ &`pH 0 H /e4`L* &`L"Q &"`` @ &"#x 0&"&"H 0 2"| 㿘W ؀`'. hH /e * & $b|& $bb$b $b$b $b HobObH 0X@ ?` "㿈> `0O#8$`а /`B <`@m`(!(@" b|`(@m  0> !(#P7b|`2`p$ 2 2 `\` @2`\$w A@ ` $k 4H /e4b* &b$ b| H@ LEa`@ @ " '`" 'Вb@ ? bb|`@Z$bH /f4a* 'a aa aa@&&`$  7a 2" $aa$a $a a $a H 0``B <`H /e4* &!`K@b|`H $b@  H 0 X> )#H ج ' H   ̟@ H 4ꀤH L H" "QHH /f4d* 'd     $d$h% l?$l "`B <. ሟ€  ᤀ 2ሀ    $$% ᐐ?$ᐑH 0 !\` HȬ  @  %\@  ⴐ@|   @*%\   / ſ p `K; H G ఐ B<>  @@6@ @ @```@@ $@ "ఖ < B<ఀ@   @ ` ݐ  "0`B <" 2  ג " ϐ ࠖB<`B B<<H > #㿘b !  $b  "(b`  `H`<b@$b$ $ $ $ " $b 㿀> D#> )`ؒ`HB  ;#' 6?2 "`p 2 !(` @2!(" &$" $`(  \B '< 2!$"" > +"D @6$""D @"  $"D$"" H> +D$"   ܀ """ 2"" 2а "" 2ʰ "$"  ?$"""" `!\` ĭ " @ @*  p 2 \ O*@ \3@ "@|і" 0@ p2 `'" p@|" $  \4 \4 !\`' "  `* H /f * ' a\  IH 0$L  B!`< IːH /f * ' > ["  @ `&   ȖB`C < !<   ";0$`  2" "`"` "`> lHo  "`> @4bH 0"""@`*@$"$"" $" `B < "`< $"$"$"H > #㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / \ )6 \ `"# /  /@ 0`&`$ `$ `$ b$ b$ b$ b$ b$ b$ $b$ (b$ ,H 0@@@@@@@@@@|㿘> I"!> )!㿘# kؔ  2 J >  $"xɐ 0> `?>h>h>o  %ܚ  $ l4 \, h, j$!x$!p$!t$"$!$"$"$! $!@{# : H /f * ' > I`$##"c$#"H 0  㿘" % H /f * ' #`"##"c#?#"$#$#H 0 Ԑm  㿘> I!  ""# 2"a " 2# %& $$"4"" $"|@>$"" k4  $#4@yF#$#$#" "? 6"> + D$"$#$"$# 㿘> #Ȁ`> c@3 t \&" ?6 \&"""" &"&"""?&"""  """ &"&"""?&"""  """ &"&"""А?&"Ѐ" " "Ȑ &""䀢2" &"@#(&# &#lm &#(&#$#0 "#4le �&#,#4 l] p> )#H Q'@$ S@ "b8  Z N@"@3?H@ "4b| V@,?H J@{?H `G@ `F@R@RY@?H  M@`K0 L@&?Hb&bx&&x H @H /`4b|* !b| @ @@H /f4b|* 'b|<?c $b|H 0~ wے yH> $@(p4bo l&w˒ iHc4 e H /` * ! c4@x&H 0N w IH 8D$bw AH 8  ' 5Hр  >  `  2|  = H /`4c* !c  c @$c €  $cb|@@> #h`0 7H /f4b|* 'b|* $b|H 0HH /`4c* !c  c @$c€  $cb|@@> #-`0 7H /f4b|* 'b|* $b|H 0H b|@@|> А Ғ`0   ! 0 L@c&v Hc@ H /` * !  *`" @b@H 0b H /` * ! > +`Dc"&c " &H 0G "*    hܐ( j 2Hܐ   jz &    G@c,c$H /f * ' ""H 0 jW   H > Ր (㿘H /f * '  2@ 1@1@") @"!n @" \h 0!z@ "P!{@"[ @V  @S ?Q6 \  `  `I$ l"F / B@ /@K 8"&"&`"&`"&` "&`#&`#4 - &`#4` &`#4`&` #4`&`$#4`&`(#4`&`,#4` &`0#4`$&`4@  8# "## `€# #`4€,H 0㿘b "  2\ @>   2@e`((@" ``(@e0> ( 8Ǯ`?Ȗ*@6`> `  c` !6` ,  Ǎ0ΰ /ɰ 23 R  2` 7< * * ** ``2b|>  @`>  f0@א 2!c` *@c(  i 2c0 c0 ] "`> + D$c`*c  H /`* ! b`"&`Z$b`@ ab @& &` `f"0 7&` 2" "" "$ aa aa@&&`H  7a 2" $aa$a $a "ba $a "bH 0`c`B $c<`@చ`C = B< #Ȁ`> `@/ "䀣 m"   *`@ `! #"[ ZP $ @ # ! " @ `"0 7 2" &"" "% !  !! !!@&#    7! 2" &!!&! &! `"! &!`" #`B > &#  $ 2 &"㿘H /f * ' "|*@&"|> lHo  "`> @.bH 0㿐"Ȁ    $"$"& "А?$"Ѐ  !Ā !! 2!!    $!$!& !?$! 2 " !€   $"  ` `, @! `  -01 !"|,0#4( `  0  ` 02 @tJ  p " ,` / -,@,`,`,`@Ք 0 !3  "0"|# +"|@' '   "| #  l  `#@`"| Ð  ` "| 2"| 2"| 0 !" "|   & & "|  2 ` @,`,`   & & 㿘> #Ȁ`> `@.> H /`4> I* !> I! S #"|2G"! "Ȁ "?"H /f * ' "|$"|H 0 "@&"H /f * ' "` ` $"$""`"?$"H 0 `" #@7" # 2"|H 0㿐` 8`@`` ` `` ƞ ` `( @  @"|@>   ī0 @?`>d#*` €"| H /f * ' "|?c &"|H 0 0"| ` @ ` 2(##~@#  @  "x rH /f * ' "| &"|H 0 0[Y@ @# #\`$ ""x KH /f * ' "|@ 0*@&"|H 0 02"|`/2##)@&# @ 0 @#(@ H /f * ' "|* &"|H 0 㿘# "## @&## # @&#㿘H /f* ' ` 6`&`" 2" &""&" &"> lHo  "`> @,QbH 0㿀""| &"@ ' ` 0  > ! Ó@` ` `,` `  @?А*6`H /f * ' "|(&"|H 0 D#B8"|  <# `, 2"| Ų` ` `,:@@> !8 0FH /f * ' "| (&"| @&"|H 0 "| "|@ #`0€  2"|J "| `  h-#4  @r H /f * ' "| 7&"|H 0 -/"| O#4 K` #\` @s쨒   "|@@;> !X]  4$ $    (H֐` :` 0` ?`$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4`8$ 8` 6`  !,@,`,`,``O !  $ ` `"@ &` &`` 8$  `9  ` @ $ $"! "| #4 ̐` #\` p@r쀢 6  !"|@@> !Q 00,`8&``  Ԓ     *&` &`&`!( &`(` *#( = "#0 3 "`> + D&# `*# ” !*  \ # "`W0t`` ?&`&`&` > lHo  "`> @*b> ["" H /f * '   @&&`  $ H 0 "|@@> !Ē 0 Ȓ`B >  $0   2" $ $  $ H 0   `C <B> > "@0  "`B &"> > )#Hh ' * | >    2  @*   @ *  ** ޔ ">  >*> *S!cH > !Ё㿘"@㿘> 0  o0 `H /e4`h* &`h  `؀ " H 0B `8 2 "H 05 `">r@>rc"`#8 6#l@7&#`?>q>r>o И#L&#D&"&"&"&"&#X@s&#\ \ @6 \` :`> x&` H 0 㿘H /e * &   ؀  . h& "@ אH 0 㿘H /e4#\* &#\  &#\#` ""|&#`"|$"`"| ;&"|H 0㿘 ؀  z H /e ;"H 0k H 0c* &#     @  > ёH 0D # !# " h " "H 0+ " pJ ("` ` $"$"$`"?$"H 0 ` x "^x> ) p ؀#H'2  h  @2 h` [ "Y U l` @`K (3H#H`.@   d `$ $ 1 $@$ `#  J(ؐ`@ 8   $ ` ֢/`h ܐ`"ܖ ` #` pܰ#H > !㿘 ؖ "p? P@\  `U@.`X@V  W@ "  T@J  O@CmU IF$#8#8C& mI =:$#X#X7& m= 1H /e * & #8 #@#D*  $#D$#@$# ֖0*  @2 (2 `* 2 㿈> )#Hb 'H!c\ ڐ " H  ?b ~`&b H?# 6cp  `Tc8 2 *`  .c8    2 *`  +@"  uHb$@&b%@+`&H /e * & H } ƒ ;   +H 0b  &b``? "~% m cpc88 ; *  .   }//ÐH 0ހH 0ր/cp8 ;  ; *  .  },@` ,@,@` ~,@`H /e* & H  XH    ?0 * H 0 $b &b " % "&c\cp *6cp% &c\H /e * & @8  b|$b` b|$&b|H 0cH > E!㿘H /e * & "   ( H 0㿘 ̀` ؟@!  H c` p    @ "Y 㿘"H o *@ f "| {&"|̒ H 0㿘H /e * & "#``  (    H$@"<`  2  ߒ  2&H 0㿘`؀`0b@,> D@b쒂`B :  $bb|@@> ~"`"( `2` "``p > `n*`4 * `&`p@€ 0  `p`̐ >`&`p@0H /e * &  b|b|@ $b|> ֑> * c0@  * b|b| $b|H 0b|@@ ~2b|clc 4cl@?b|0   3<cn @/ H /e * & b| 0@ $b|@@> cn"`0`b`B $b<`0*@$b|H 00z 4)cd u@> "(`0H /e * & `bb|B` $b|<`$bH 00P` ?  "` c`cd@ 2@$cdcd! " cdc`$c`"b|i b|H /e * & b|* $b|H 00@  cX*@H /e * & b| @2 *@ } @$b|H 00$b| H 0cl @ c` 2c`yc` 2 c`b|@@> "@&` c``  `<``<&`$cd`<c4cn $chb|`@@> "X *$ch *cl`$ch4cl`  &` cl 2cl  @b|@y> "`0sb|cl 2cl "clch*cl cd`$ch4cl  " cl  2b|@@U> chJ"*`0Lb|b*2 `  4clb|@@?> "cd 4$` @ 2@@ 2 @b|@@(> "]`0#b|$cd` &` `< ``<&`$ch` > ֐ &` ch0*@cn`*2 $ch* 2@ )4cn@%H /e * & `b`b|B  <`$b$b|H 0b|@@ 㿘`#r#*@ &## `  >  0"#@#r&#> )#Hh '"> 造  >/hi> ֑2cP @ + @  +  +   * >+ +Ȑ#H > 0#HHHHXhxٰ 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@{  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@P`&`㿘6 & 0㿘`$J  2F   2B  6  2=  `!>u#$*` €#  #)  "] " Ϥ ,  *@ P ZR   `*  ZF  & L[  & L&& . & . 㿘 L "[ [ߒ 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . U 㿐#\#` 㿐\ #\#`㿈`'H`, ` '` ` 'T' H"T4'T  Ғ H`"$` `T@    (``@  o$`   @,` , , ,` 2 , ` , `` 5` & '}'쀦 {'@? `* @,P@  * @`@  `  :$ , P@ @ @ N`, `耤 !'7 ,   `$ $`  T $@ T"@ $`    j(` ڹ/ `@ * ?@ '-` .` X@*`@ `T22#2`T25 %`%`& 4@2 ,耤 `!'7 ,   `$ $`   $@ T" $`    (` ڹ/ 耦`$@%`$`  %` `%`$Ԑ .!& *耤  !'7 ,   `$ $`  Œ $@ T"@ $`    ۖ(`h ڹ/  )耤 %' * 2 ,   `$ $`   $@ T"@ $`    (`:` ``$@$$`  * ?@ `@ `  -` ``@  `<%`@T`%`<H@  IH"`4`8` %`8 %`4`H `D `%`H%`D㿘`   +     4   `& 46 `  ?V`S`  Xc   *@*P  * @       :" * P @:   #` @ *?*`. *  T@"2 T03 #  L& + ,  2  @2 , @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . x  'L&`"'  '  '` ?`"f ` `$@ *     > #J 4    'A  `=   ('` '@ `!'@ '`,@- - ? '򀢠`' ?* @''􀢀 2@ *@'a'@`0@`2`    G> B#H ''@ @@!@  -> #h> #ϰ @ 'ܢ'L,`   @@' ڐ > # @< % "  ג  c $ $"  ( W' `,` V*``P *`,`*܀ !- "HC,` ,@* P/ @-    :" * P@* X *` `T23 #2`T3 2"L$ *@(2  "', @`2 `  % " $  @ $$H$ " H > #H `@@$HD <$@L$D$<"㿘 U 㿘W 㿐`2:   24   20    2+   ' 2` ! d UԔ  >z>z"c& 8& <#\&  ?   @ &  H@ 0Wl  㿘@i Wc 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @)& 㿘 @"&㿘 c -    &@ư4   ,&@$ `     (=` `6   $ ` $   -@ -`-`-`@`: -@ `-``$`($`$А"@$`($`$  @  $@$`  "$`   5`` 2`(" `($` $`" `( #  $ 6 $ ' $    M( $`$$`( А"@$`($`$@  > `0 >  @  "``(   `($$ 6@ 2`P @ " @`P`T`$`P$`T@ "`X &@`X`\@ $`X$`\`H`L@ $`L$`H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@M &`㿘`25   2/   2+   ` 2&   " 2``  d Th  >z>z"c& 8& <& $ @  &  H@Z 0V  㿘@ U 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @&㿐&` ` `" ` ``$@ * ``*    " >   H & E    (%` %@4 `6`` %` $ `-- - & & @`    & $& (`  :   2 (`"  (`& ` & ` @`@  ( && (   -  $ ( & $& ($  Ò $ <  ߖ( k& $& (@~    >  0  x>  @?  "  ( $$  H L P T@ & T& H& L& P& r 㿘` # * <:8 &` ?& & ?& &  & ` & ` @$ "@  >  0  >  @ 0`2` X \ H L@ & L& X& \& H334L55L556x69;H;=>@,CDEE@RSTThTUVDWXY8Yp㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@k$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  > < 2 >  А@/& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @@K  2` ( " (" 㿘  `8  ``  & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` >  Ȱ?$`` 8>   *& ( |*`?:  *` * @ `@; $ q&   "  ` "   |2   q`& `2u  `" `>  ԰?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ ;0@ 0 @֖ `  D <*  2? D <@t*`C` ` |&  `2   2  & ?c  ) ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @@@& @@`@$`$@㿘 $ D*` <*  & 42? D <@*`>  |`*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!"@ `0`d`p`a`8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0 h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@̒"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \`" @ l? p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @  d=& T )` ` ) 0 d  @ " d T  0   d" @Ɩ  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @O & ` T  0   d" @ d& T  `?x>  > > "   ؞   +  # a(+@ ?` > !L* > "   >  * $@ +   ㈡**@ ?  *"; > !L> " *>  + "?,@  ` ?㈡(!*@?  $`2? 62> "  ,   2 7耤 !> " ,  3  7ꀤ!!> " ,  3! 7怤!> > " ,  3! 7> "@=!> #  4`@V 4@  `㿘> #`Fbbbb b& > > > & $8"L )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@ @ & @ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ Ґ$@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(> "  *v $  * `"?  *` @$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)""> " *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@Ζ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> "d⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &bd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Xz+w+"" `  2`2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> > b@Ȑb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  -2@ " >  & a @ *  2 `> > `>`# !# @*)` # >`#! @* @ 2  | '"2# d>  TaL" *)  @@`?`" "2@ 64  bb  `?㿘☺@ > > @ ب@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> ⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> "@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@> L+> "@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @W $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  ># *@  "` ?㿘ǒ 㿘 "? ? `>}"ē*` € ܔ  & &  @   `" &  "> b` 2    > "" &  " "   & &  @ ` &  "> b   * @  $> b $ `@B`      @``  " "~  @Ҕ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   "> b &  "" " ? ?`2   " ?"㿘` ?@㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "`G $$ "@?㿘 8 " <&? 8  `$*`(  2  ( @ @L @I (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ p 0 4@` $ "? ,"` J>}"*` €  *``` 4  `&  `/`2  `4 $@&إ4@b@耢 & & $& @&``$  &`&@& 4? && &  &4> &#(&`4& $& @&``$  &`&@& 4?  *```?c82   > &#@&`& $& @&``$  &`&@& 4Ҕ? ` &&  q ` & $& @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & $& @&``$  &`&@& 4u 8 " %@%&     &  *`` `?, `& 4   ! > &#`&`& $& @&``$  &`&@& 41?@ ( ` `(  & & $& @&``$  &`&@& 4? & &4&   2  @>   `Ϫ  *```  *@ *`"  & 2  4    > ט `* *`"  &  &   @ ?2 & $ `(*`$  && $& @&``$  &`&@& 4 &&  4   ! @  > " @, `y  *`@ ,   *`    $@ * "  & R4    @ `]  *`@ + 4$@  4 @ ! @$@ 4   > &#&`& $& @&``$  &`&@& 4E?  ( ? + "@ &  4   ! @    @ג  4 #\&  `   !`''#`@ؠ ?2 & $ `$*`( && $& @&``$  &`&@& 4@䠒 2 @@& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@ @  @f @c 0 4@` $ "? ,"  `I& `&& 4@ 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘@ (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <J`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?" 8'H\'L'P'T'X''''''''''''''''*`  " H X "9"     , `" @*   ,``"@8 " *,  @   /`,` @?#  '' "@`  ,  *`#`" H`@ *  '?'p ͮ / '"¸  .aH . @``'+@`  "? " `@*8 `+@`('''  p@s`?X " 'Xp"" //'*` $4@, ""4H+ @'  / /L    `/'LT" * @ `P/P" * '4@)  ?, * ""  ) @)@4 @2@)@? @  %*.? @ F 8/ ` `2?㿐#\#`    ??> ! & @Ғ> a&?㿐`\> > #\㤘 #`!q ??> !/$ -@@> b$ %?,`> > #\!#` R ??> ! $ 2 @@> b$ ?@@0 > >  (#t"> ଢ   ")> %> +> '>  -> "`" U`>>#c̰x?h'pH "? 6"  *```"a a *``a"a4  *``a" $#\> > ! !㤘 #`ۚ`  "? 6" $#\> >  #`! Ś % `?$`%&@` && 㿘  ? *`$`( ? 㿘 (    * * " " "㿘 0 4 @` $ " ,"` >}#*` €)` '& $& @&``$@&@&`& 4   @e  0 4@ ` $ "@ ,": $   $ $ $ @ > `  *`@ > b+`@   * @  @$@ 4  $ $  @ $  $ $_   $> $"(&`& $& @&``$  &`&@& 4? @ > `Y  *`@ > "+`      $ $@ $ $ $4  @ > `H  *`@ > b+`@   * @  @$@  4 $  $ A$ @ $ :$ > $"H&`& $& @&``$  &`&@& 4H? @ > `  *`@ > "+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 (@ "@""& $  ( ,   ( ? $ $2D  ,  0 ( @ ""22 & 4@ʐ 0 4 "@ , ,"  0 ( @ ""2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& <Y ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& </@&` & 0㿘04@$  "$" ##@""""4 , > . .`(  ( ( @`x@> (" `!d7`(`!   7 (   (> @H@" `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 㿘?c6  @`f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@#@#񀦠,`㿘> I"! >  㿘@ 㿘"Ȓ 8=  2 p $4>  $,0h>  >#>>cL#a$x$p$t$ $$ $>>ܖ    8 Ē  7  %44\,h,j$lɐD  a?(` 4Đ4\|$$Aa$pH /f * ' > I  `$"b$" H 0  㿘@H/` /#W"|#U"H 0H o&4"*@g"`""b"?""$"$"H 0"Ā(9?  > I "  ⴀ22ⴐ 㿘"Đh @2 d "        7`    @   `> ה     . L  ǐ` L@  `H /f * ' "Đ@@6"đH 08’ 㿀> )#H'DŒ 2D?2  @r 2"Ġ> > ؒ } *] 2"#  ;4""Ā   4"đH /f * '  \`@@44 \rH 0 cH > q"㿘? 2 & 2"F ?"~ @6"đH /f   \!  0$* '  \ @6 \! 2!!` ` &!&!"`!?&!`떐 !H 0"Ā$"x&"  0`\?bĄA`2`\n2bĘ1" `\"`\bĄ2b`\" b" `\"`\b2b`\" b" "b 2b232b 2 b2b"`\bĄ2b`\"b"2b 2 b2b"b2b2 㿘 H /f * '  a2a1 Aa3a  _"ĐaOa%V"0!5L a"J"0 !6"@ C"G"ĀhG `B@b0>90;#ҒҀ@(6# l4 "1 /"Ā( 2 4"! 0   / \2  h" (   H 0㿘 \ A AbĐ ` hfi @b ؔ  2Y 7`"H /f4 D* ' D   !  `!! !!@&&`/  7! 2" $!!$! $! ! $!H 0  `C >B< < @  H 0 `B < 㿘"Ā`@?# @6"g2"Ā  "  "N""x㿘?2  5  H /f * '  `]@"[ \@"M l "@ w@""0 b}@ib~@"\0 ! @"" `v@  [@" 00a @a!@""0#ҒҀ@( # lH 0  + h \# @  3 \ ; x& h6 \6 |~&    \# 3 \?  @ l3 \H 0k  """Đ!]3"? " """Đ R3"?# @M3"`Ē  !€  !Ā !! 2!! "8& 5&#" ` #"  @)#"'&"Ā( "`H 0" ( H 0 "`i 0 H 0  H 0 㿘? 2 =   bĐ ` ? @# @4bđH /f bđH 00H 00* ' bĐ  "a!> !"c bĐ  aĀ *aa 2!aa    $a$a$ a?$a % bĀ!`@H 0A #a€ ` `@4b> !c}  "bđH 0 @8` Rm  `  "  G ``B <`㿐? 2   9 ` Ā(l@   @ % ( W  2` 7! Ē  C( ` (Đ  7翰 78 Ħ(+'  &$  8 $  R$ `    " 7`!     ( `Ϣ( ` ג   "`B <" "`D "đH /f * ' D H 0Ā(+> lHo  "`H /f * '  H 0 `B }<`"` ?" `?"`("(0 > ["  > !x V /0[H /f * '   @&  $ H 0`B <6  9 75 7"  `$"`  $ $  > * lHo  "`> @[b`B <  @ ;`B א &`8|> א &`8&` #Ȁ`> b@ "Ā(!! `$` ][! ! "!!€!`"Ā(  D "   `B > 㿘"Ā  (   k . kZ 㿘  &`&` k   \ ` &`㿘> I"!> !@㿘#b 0^  f @7 $"2 \  d $"l$"t>bĐ"|g$"b$ 0b D#> I#"?Ӄ$"x >  ,> `>>>b"%ܘ њ $ l$!x$!p$!t, h, j$!$! $!  H /f * ' aa`$"`"`"bd$"d$aH 0  㿘@Ԑ@ ` "@G" "?`""`"@"" 1 2H /f * ' "``""d"d"bd"d?"`"$"`$"dH 0 "@ 1W 㿘` @4`` " H>`@``"``?@"&@&``@ O @ w14 p> )@ cH'H /f * ' H@! = !@"`\ aS@ aP@ a@@GaE@Q  aZ@aY5@=@>  !G@%<@_  A@>?@  B@$ 耦 0S@$P@ !M@ "M>8 AU@ԐT@ >ʒ`0@ "l!N@u ǀ F@"%t 0 aO@ 0!C@aD@  0!>@  !B0!X@"yP @  `0`<  " `H 2 "  2 2~  `h 7 `\ ,В @`\' `4`\7ax eM  ` @Ґ`\ 4`\7ax 9 M 5  H $ 2C  $ .     `h 8   3 $ $ $  $ $  $ $`H $" $ $ `0`<      0@  2 @`0`< X " `H  2 "   $ 2  $  .!  Đ!$ $ $  $ $  $ b $ "  $ $ >`0`;ƒ " ?  0@I  2`"  "` "@$$ /  2     " `H2  "  2 "  &   `Y.$ `| @|.% .& &( .0 .1 &, &4 >8 &@ >H &P &T `"   &   "   & ꀢ "   @&   J   F& `0`;E E "9 `H25  ? 2 ? #@2% `  @  $  @,   " @ $   $ @ B>`0`;  @ >`0`: K " `H 2 !"@  ݀ ڰ `0`:ڒ Ԑ@ "ϰ&>`0`:̒ Ɛ@$l >`0`: 2 N>  @ #@4 $t |d dא| & "`\@`\  @ `0`:  " `H K2~  "z  2 "s  ? 8m ! ` `f @ e e! Z@ [ U>`0`:T T "H `H B   2 5 @ i1@l- 2 6  X6 Z2 .^2`.\2 . l.j6 T.0>8&$J6 @>(&0 &4>`0`:    @GH 0H > gl#㿘 H☀ ? 2`"  "` "@$$  @ޔ @ -Ò & H 2 㿘 H"`9`22@` 1@ - ` ` `  ` ` ` •`@w  @ 0`2`㿘   ` @``"``@``  X  +  - * "W*  @ѐ``0@̔ ` $ ` Y,$` ":``@L,% ,& $( ,0 ,1 $, $40`X`?&`@ `@L X` W0- b* " *  @j` `0@e` a$ ` X Y,$`~@ ` X?&`@ `@ X` W8ݒ0,Ò - * "* &` > )#H'`  ` İ `H 2 b`` 2@`2`  ` `   ` `2  I- "* "* @˒ n` m`0 @``0@  / / / / / / / / / / / / / //  "`$ƒ`$@ n V- ` n?&`   ` I- "* "* @ n` m=`0 @``0@  / / / / / / / / / / / / / //  "`${`$@ n  - ` n?&`   - "* "* &` H > ej#(㿘 \`@ `@"@6 \"t`a"|㿘 \ @ b"| @ \ 6 \㿘 H2` $   ڒ  2` 7`H /f4\* '\ @ D " {^  `B > `  8B > @B   \  @ԗ H 0 `$ `$@ ϐH 0  @=☀a``\ @W@   •`"N2a` # "Fa 2 aa@&a$a /   q   沔 i  2 ކ`B < @@ 2@"@    ` @`$ @ 2`]H 0  @ʔ`\ @ @ H 0  @H 0 2㿘> I! )H /f * ' !` ` $!$!"`!?$!H 0 `""`@0݀ 㿈 \ @ `B> `  ; "B>  2  "`  •``  q    2 ?#@     "  @|  "`  •`` #   @2`0`"&  \ z @   `  ` ^k" @ d ` ` ` ^\ @ S @ K @ u` # 2 2\ `B > H /f * ' @H 00Q @"  2     •`  @ "00 @a )` `$ "l @0H /f * ' @ QH 0㿘 H   `2?> #8# @6 H\ @p  2 eD  yQ @9  # > c@V  2   @  "E    •`< |  4   . ~ H /f * ' @& $ ܀H 00 2" && &H 0> lHo  "`> @b h    h`2  &  a(& ( `D x   6  T  `B :   •` n  `h 2eb`@  "    T C@Ք ?b` ` @  @m k  D  x}   `B ; B>   @; B> &  !(& ( h o  6  g b``@i     T  @  "ۻR  2  0  "G  ~ H /f * ' @&& ۘH 0) ێ%  2" && &H 0> lHo  "`> @b 㿘> #Ȁ` > cP@ "`X`X "  •`"2`\ # "z`\ @"va  aa@a-$a@U 2b@ Y@` /      沔   2  `B 8> @@ 2@"@    ` @`$   @) " a$ "`l  @Z@$2q㿘  h> ["`` 2`0`#沐 ۄ  2& `B > a( &(6`D v  ``B >`㿘" @沐 [  8`    1 |ݔ (`\ @" a  aa@a &a *   `B > @2D㿘@." (bpbl@}  %  w |  , $ , , .b $b" "b@$ bp`]$bp  @  " / 2 '  "/ D  bpbl@<  $Δ  6 |S , $ , ,  $$  "!' 2˸bpbl@  $   |5 , $ , ,  $" '$ bp $bp 㿘@* " "  @0    4    `' `ṕ* `+ ( `* @ `"x 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘"p"l@/@D"p"l@( "" ?  "$ "@"""p&"p %˒ "p"l@ 2 ݤ㿘H o*@ a@  H 0㿘 *`")`?  2 `? * * "*  $ """"p&"p %} 2 cґ*`"t`[W"|㿘 H(` @x 0 *`"`> +@ @ @*  c*`㿘 *`"`?`2 2 $ """"p&"p %  耦`cݑ*` 㿘* " "  ? @  2` "` "$$ "p?&"p$   㿘 *`"#`?2" " $ """"p&"p $ǒ 2cؑ*`h> )`#H  `?'   "-Ȣ2"` ''0zw  ؐ 0zr  zn  /` ( @y1/鰒 -``?&``( ( ڪ`Ц-`* &`H > ]#h㿐` $C ` 2?  h":  h 5@/!"݀@+%8, ` '  O?c*   #2  2 (   5(!"݀   㿘& (  ` @%  2  ` @  2 2  @  "   2   ;? 㿘  "<  `"(  y `( y ` `!, N`.`, M`.4 4    , $ " &   , $ "&  㿘 "    & & T #  2      & & A #   2  H> )#H\'``נ ``) .#Hd`" V `` ?ΐ  l @ƒ  d//ђ  p` 2 3d+' l0,d`" 1 ` `?ΐ   l @  d//ђ  Kؐ 2 3d ld =  d 4'Đ ϔH /` * ! @ Р Z $ V  R  ̀@2? > +DD:< '   Ȗ B 8 ̀@ # ܐ ' $ " ǐȒX @  Ȗ B Ȁ 8 ̀@ # Ԑ@' $$" ȒW p  dH 0g H 0_ d#\ @  S`` d > Icd  > Icd։ dd9  π`, > #`'`@$d! ` > + D D!:`  d!   #\;`d@  d@޾ ' #H > [ݐ#x㿀 'T h.!"݀@*e83   -   :?c* "2 T #2T 2T( T T `T h!"݀@T T` T`  %   'T> [b`   "` T2` 2`> [b`X "`X < > [b` "`    'T> [b`  "` T@䰒* `7 > [b` "` @T T$  \ 2"@ "  "׀  \@T #\#d#`  TҖ }TT`z `  ׮ u'TT` kT`7 T@`I7 T` ' ט (  'T>  `B X:T @ `> `B : "BT"0`B::` \@ ( #\#d#` . T%  T # ` T   'T  vT    'T  v TT  { 㿀   !@$ha$ `l H /f * ' @H 00#e   ؖ?c* " # (| ֏ ֊  ג  j @  `l #\#`#d@0Z`l@U EM `<&  q   vY  g  2) 7vM H /f * ' @*  H 0 H 0Ӽ2` > [b`D "`Dӫ㿀`h  6``B >`` @ ; B >` "*a$ 2& !  a77&7     3 7 < ?#ߒ @6a  aa aa@&&X  7a 2" &aa&a &a "  a &a"  `B <  `C @ <`B < < `@ B >```B >`x 㿐沔   `0cd @`\ W  $ $   ,@"@&& 4` @|"@4`< "@& & *  @$@ee4 4  , 4 @c4 uN uI uE    Q  u9  G   u/   һ0ҸhۄD4H|4444`0(> I 㿘 `\ @(`&`@ 2`@ V0 l@`  `䀢  2 `.@.`@V`.@ `@` ?&`p`27ر*2*@`2*22 //////``2 '7* 2`* @`2`* 2`2 //////``(7`*7`.7`,77@ߐ``/׀`//֐@0Ё㿐``v`\ @r K  m $ $$a̔  ` @tn > #ti  4  / B//?*'  /'/`tS H /f * ' ` .`a  aa aa@&$Ɛ  7a 2" $aa$a $a `a $a ``@ < CB<`<`w{H 0㿘` ` (` 4`` ` , ` **` ` -  5`   @,`4, @ -` @ `,@ @  @ 8@` `(``/``*``+ 3`` @ , 4  +`4`, ,  `,`  8```(`.`( ```(0` ` `!(0`"`"`#(0`&`$`%(0`$``(0` 0``(`(``  8 (`/ 866666 `(`)(`+(`,(`-(`.  (`*   0 0 (`/㿘`H /f * '   \ @!  !!@}    x B` .....!> ㈐ +` +` +` +` +` +` 3@ 3` 3`  ".> . 4$` &3` ` r &`.& 5$` '3` ` r '`y#$`$` ` .`!  `!! !!@&$`v  7! 2" $!!$! $! `! $!   @ >`CB< < v+H 0 ` ``  `뀠2 @`h2  `怠2 `†" 0 `  `䀠"  "  ` ` 0 `" 0 㿐 X'P`VP` RP `M  $Pl"@ PҼ  A'P rd  B9P B5P 1P* @+P  /`@ `0` P@̐`0.`@#   P @PP@3PP Ϸ h `  `p  /ϒ@>0` %8  \ & &  &q@+p `p` &8  < ' &  'qxՔ@ 㿘 @-* 㿘`倢  @?`w> *` €. m.`.`+ " *. 2* .`*  .`)  .``뀢 @  ".`>`>`>`>` 6` "6`"$6`$& (!6`&@ .`@8+ " *. 2* .`*  .`)  .`@p -  .`.`, " .``ꀢ  .`.`.`*  .`)  .`@S㿘`/     `0! `0`@  @6  ` ` @  `$`$@" 0@& $ 㿘`` 倢  ` @ p ` 2   倢 2   @   @8> 2@ `87 @82?2`` 8+?` *& ( "?`   ` 8?2`` 8 ?` @  ?  㿘 "  @\` "  `  o /@  x  > 0 6 ` (> 8> H & P Z> @ \6 b ^6 d 36 f 倢 2, ? ? ? ?   @(' 2 0{؀ 2آ> 0> 8> @> H !6 ` "6 b $6 d &6 f 2  ^ 0<  8$   < 4 4  `4 ( b4 * d4 , ^ 倢 4 .  #@+ 2<@r 7@m  4 `", ` @ $`$@""0 @U & P 2  А@K @ِ@ @@ @<  2 0㿘 m   `" . m ` 2@ `䀢 "@ . m@@;㿘`䀢`,> *` € m "``뀢 " `` " ``뀢 " ``  .`&`.`` " ``뀢 2`@Ȑ.``퀢   `  `  .`.`.``• "  m` 2 m@ m "``뀢 " `` "``뀢 " ``  .`&`.`.`` " ``뀢 2`@.``• ""``8 @ "``X 2`` 2``•   @y `@t `• 2`` 2.```` 2`` 2.``• " ``쀢 2`` "``  `퀢 " `` "`@p`` .`.``• ?` @2`` 2``  `&`.``0#`*@N`• 0`8 " ```쀢 2``` "%``` "`` `퀢 2``쀢  `  `  @ `.`2`@ `퀢 "`` "`` "``` 2`` "`` 2``• @ے ``8` ?`&``.`,@ ` 㿘 ?`l> *` € ?  @0  @*  @$  瀢 "   2 @  @@ 0< ? 7 耢 3@ 0/   ?@ 瀢 @   ? (   • 2 @  ?   •  @ג 㿘 .  .   ".   "   쀢 2 . , m   &  .  >  > >   (>  *6  ,6 " .6 $6 &   2(  (2(  ((2(* m㿘 •` .     8 . ,@ 0@ 8  & 㿘 䀢J "  `  "  *.  " .. @ 8.  X*`*`@2` ,@ 8 . . . @/. . , m 䀢`> ԓ*` € @Ԑ `@֐ 8 . .  .  @̐ `.  .@ @. Ӑ㿘` `" V0 @ P. @ P .  ?& 㿘`? `@. > *` €@ h .  @ 1. . . ,. @-? `& A  @ . .  . * .   . @x . @ . @h h . . 㿘 h      h .a*`@N2`   & `d h`b@ *`@C2`㿘  "!   H &*@ *`@42`0@1    "`" `?㿘   % `x 8 `x2 7`|#8`x 7 @t)#  @t$*@ 8    ?#@8 㿘> #Ȁ` > c@   2  ,2   2.  Y. 㿘 h 0 HH /f * ' ` ` "@`2@``   @ sH 0㿘`  &` \ "` k`"`` ``?.``倢  @ 0 @ 㿘 .`㿘 .`P 㿘H /f * '   \`@  H 00T@b    @E/ "3 @L h@J `@H 8@F X@D @ @U@= H @h@6 P @k@/ 0 @h ?,    \`@ pKْ H 0 2 2" " 2 2 2" 㿘 "   2   ?* `6   㿘` 2 `.`䀢  `h  `.͐`@``&`㿘`倢  .`ې`"`` `  ` `䀠 *` @   " 㿈. 6`. 6`. 6`@6 //////.6.6.6@6//////ϒ耠`?㿘` @ܐ0u "  !  `  6  ̬    , +`j4 (  @  - 5@   ,5`- -  -`   > > &6(6*>``pJ \`@"  2pJ֒    X * 4 V 2 /㿘H /f * '    & & "/ !#  6 Z6 ^6 \6 j6 h6 V. l. T  > Iaa &" "a& H 0㿘 ( > q"#H /f * ' `"  "` ?"&& z H 0㿘 "  `   J p㿘`h  !    4   0. . & & & . ;  TR  5&  &"  & $   .  & ؐ!`( >2i & 㿘   > p#Ѐ`" `( "2s `"  "` ?"&& & .   T ` `䀠    " 㿘`0`    ` 0 ` & 3`  ?& ` . . `    `@ & /`@ ?& `@ . . 㿘 aU"@ ! aT@ r 2`H 2 "   2 2   2  2 aZ@"aR@"X aP@)aQ@@0aS@/aY@Q00!P@ "`j  aT@UaU@]0!R@ "1`\ !S@06<~ 04`jx `Z."@8n 4`Z`^ `T .c !8_ 4`^2 Z.."@8S 4`\ 8L ` H,`l,  2, B&C  ?, ("40 2    $ $ $  $ 2 `",`T 4`^ , , `T< J  X 2,   t㿘> I  0 > I "a> oC#> nI!,㿘"   >   $"$p 0!>#>’` $!t$!x$!$!kr|7  , j, h  㿘@Đ|Nl?}  㿘&"㿀 \x$6 \!Ā *!! 2!!! " \  &!&!$ !?&! " \`\ A Aa`$a Bŵ> !Đ!€ =4  D b a$  ₑ*  ` 4 &4  +  !77ℐₕ* @ 7    : F  ` ; B<` ""a``B <`a aa aa@&$ Z  7a 2" $aa$a $a `"  a $a"  `B i> Bk> c!Đ ;6 \㿘` ``& /`    2 `` `B h<`` o> Ia> I * @ `"x @  "x2""2" 2 \F  A A"`> ` &`?#ߐ @6`` 6 ` ```?&` &`&` D  af ` # 2 `\!"  \!2  "`@}g  " Ð  B< xڔ 㿘`h  +"x."2 @"y "&"xt a$ "`l`l & l>  & l  0o@`0`\?  @6 \`h. h`x> xa$ "`X &!$`X> *  X *`  **  `  fې "` fՔ 6"H /f * ' > I,`a2 > I! *` &" ""ba! * @"@&"`(>/ &"`,>̒ /&"@RH 0 㿘"x AH /f * ' "`""""b"?""&"&""`""/ ("`/ ,H 0@>  % X& l&"x*    * @m*"`@mϒ  㿘"x k k . kx> xn㿘 \!" "xuV  " "  "xuI " ?$" x> )#H>'`0` a9@@X a@""xa @"%"x a1@ΐa2@Ӱ H0!@%"` a@%a@ H:@w@ H " `\ 4`\ ` H@;HHeՔ H"x`" a$ `l?@4 `-$ $`l  Hdz  HO؀  H /f * ' `\`"`\ms`\ ?4`\H 0jHn b  ^ ` ZH`\`@74`\SHؐ@l "x >  H0mݐ"7$  ;Hd"  4H耢 80 -4"ؒ @lɐ"x``0@{ "7d  H"x @ "x @i H > Hѐ P㿈xy 4P!    `E yWh$ $ @{)   @{"  2`d~ $" $%x a1 2 `""`?"$$ y㿈x  y ` Ch @z  2  @zܔ  2  / ∀``2@`" y 4 !xa2 @`"``"``?@"$@$` 0y㾀> )"x cH'`0'`4$`8$"`< $ ?  cax a2`"  "` "@$ $r " 2 #H > G `R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @:  2  @>       2 `  @ `>   8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` e` 20_: "  :  ,@8 ` V`4 `E ?``2` `@ 2@  "` T4& + @8          2  T    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&& "@ *:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  㿐> I!( @ " @> I!   )> > `   b` @b$ -> I@ '> ׀  L? "? $@4 TT6$T n 6 "@@iܐ $T*@ ! `  @x 2 T`R(  0   I (@i`0 0 b: C` > `xi-  Q 0-   "  $L  :  `> א!H*`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  㿘> Ia$    L   > `hА   "a$@iA  6 .  " & & & $㿐   ` ?   2N  8`x,: ,@2 @:`@. 943@ۀ`-`"T (a # z   @ "  @2  @ vê @ ``$  ` , `$ $``2"`"``2`$ ` 2" > g `$  $`$ $`  $ " ? . & 6` $ 4  ` ,  U ``@8 `T 65 F*: `@`@  2$  "  T& 2  &؀`` *V: @ "$@V &$@&`f-T`:  0``g \ `T`@2H,V: @&84A # ``  &`@2``>   & )$ > a g|  \ v 2<`V@&$~&㿘 V  @@vy" 2$ `       2  "    12  `"k f ( `> aP"  Q"  $!` `"> @ > af ذ " <" > af 5  ? /" `T V 8 4)  V 2> I 2"$""$ 2 >  fa   ` / 2  & 2 & & &   "   v & & & &  & & `2"`"`" _"`   `2"`"`&`7 V  "/"2(" > I& ? " $""$  2 `2> > bfB "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘V  6   `2  "   V ` V  6    @   2  "  㿘  l   X  " &@㿘@fP l> ` ͒  P * " " @8*` 2`& P`!> # `># ` ># `># `> ># # 8bန&& & & & &  㿘> E  !> I((@4$!(2(!(`*`> b0e 0)   #>  $`> e9"h!(*@e@ !(> `>   " " *  **> I!  > e"p h "  2  ` v v2  `@0 "   ` v 8  2  㿘 v  . v ƒ  2    @ `$ $` 2$`> dÐ" 2$ $  ``   @"      @2   v4 @G2 @:`z `4   &  & $  `2"`"`2 `& `" `&  $`& $`  & " ` `"  ""`02"`㿘 7 2 㿘 @` v ``! `2 0 `  @@ @s    ڐ㿘 `  "l 2h  ` @2a @s 2\   +)` @@@L $`v4!`v@$@@se 2@  @ J  1  `v`, )`v v   0`0 @ @s2  v`v@ ꀤ 㿘` `<  `4 @ @  :& 4@5> #`>    > !``)  %+@8?c  @eH &@@ Q 2@&8 &8㿘>  $`\ $ $`"  " h > '$Ṁ  0 `@`@@@"2 "  *  "0 ""2 "  *  "0""2"  * ""0  ` `"2 "  *  "0 ""2 "  *  "0""2"  * ""0 ` `"2 "  *  "0 ""2 "  *  "0""2"  * ""0 `` "2 "  *  "0 ""2 "  *  "0""2"  * "0" 㿘  >  7> !X\ "$   `4 4 > Ia,a, $a," "a,$  㿘  "``"  "` ?"&&  㿘  `5x55L5L5L5L555(56D66d5(5L6l65L> I ,㿀> I!,'T'X'P'H'L H  @@2@ `" `@28  "  @q 2.  @qy 2$沔   Ls   X฀    2 LV 0 <฀  0 㿘 `  k -    \ -J`U.`>̐" €  M I "F 93C "> 9A0 ˴8 1 8$ + 9 `€"  $ #ʱ   2   2   9Z& > aM"%> I$㿘> I a<  *   > E?  "&> I" "    $* €@  2 & 㿐> I>   b"#\ xY !> I"@aђ $> E > I *<"   !< +@ +!<2 @  ?> `"㿘 A > !` -> I *    2   %> IE (?8'> ׀ )> I`Z*`!@Z *80 $8%!@$`> I8. @ 2 ?> I!@"@8n?> `> I@* @ 㿘@  @  > I!@. " ` > `@> I8*`@  㿘` `<  `4  @ &`` 2   H'H /f * ' @a D  @' `2 `€ -> I *aD`!' 4!" 8Ȓ   8@ ' 8 & 8  4"  ` 8 & 8> IaD`  "` `  @ t H 0㿘`  `<  `4   @ &H'H /` * ! @` D @' G  € "A  2= `5' 4!1  8@< "' 8 0$ 8  4") @`j D ' ' 0' < "  < ' @' < 4 @  0 8 $ 8  > IaD`  "` `   @`= D' @  H 0㿘 2 8> _a"?3& 8 4 / *  > I> _M"a0? "a0> "`ϒ0@ 0 @j @`` ?"` @ t  > I"Y㿘 2 > _## ? 0& H\  > #Ȁ` > c@ɟ ^ 2`  3t @' " 0 @2 @nm 2  @@ ^f 2 AC`` "`4  `4 2 #  ^@_ D''''''  8@7``4> I!H> I4aL "4  @ A  `'@+> IaD "aD" $@_E D''''̒@  P'D@_2 DDD` '`'`0 '`4' `v@`< @ Ƙ  D`8  "`8D㿘 4@@ l̒  㿘`> 4!2 > ^1#2>> ^+#Hbȁ -㿘` `  אE  ]͒  ]]Ò  ] 2S "   8 4?` & 8 `  2 @  @ " `   ^@ "㿘 8   `" 4 ` 2  4 ] " 4` & 8 4 2  4  " 4]6& 4 4 2( 4    "  "   8`" ^& 4`   0  0 i& 4 4`" 3 8 ` & 8h> )#H'H o *@a` @% 2`0 / 2&` "   "`40y0`` " 4  ` "w  `` l  4!  "  h> ](#h  " `l 8 ?$ 8$ h`l``8?"`8$`l  `` "  4 2 4`4*@$`4 4 @ ? $ 4 > Ia0 "a0& 8  $ 8z0"  "  4a2 @   v@@&`0 0&` D`&` &`0 t@| &`, 2 `4 `4> I"U! 2`0 7 $ 4 !n`, v `k? (  4`\ $ 4 4 v ?`$ 4, v$ p`@` V 7`  `@-0`U ` `0 ` V " `,_ hH`<L 4`, " @ 4 t  $ $ @ $ < P< P X< X `< ` v, v$ l`8 "`8 `  v@  Q @4@  `  v@8 ?$8`  ?$  4@@"  h l " h h "  w Vc6   `` " "ג 2`4`4*@ $`4" 4& 8 $ 8 4!` c`H 0> )#H > 8#㿘@ ?     0 "  ?  8  (   R  2 & : & & h @& 0T͐Tǔ  h `8 ?"`8& h 4 " Ð  & h X 2   \" `\8& \ 㿘@.@ @`.@ `     .@`@ *@ @["> )#H  '!*'| `=     2 7 - 2$ "" 8 @?@ $ 8   @2   3 Ap Z$ @@[ D `'''' @l - ''3  Q|``|   @z 8  $ 8Q`K`4`2cH| . 8 @?!$ 8> \)# @`   @` ?"` $ @ $ <   &   |@9cH > 7p# 㿐#> al "> I> Zj#> c!X#\   Rf > I"!4!>  (>Ք2cp (3  $al㿘> !l`     @[ && &  & > I44`&  "`"4& "P  "D ? `"  "`   "@$ $ ` "`&  "@$ `$  D €> I@ZŐ  `  '  v{ > I!XTT  "> ?& [u#  2  `"  "` ? "& &  㿘 p -? `"  "`   "@$ $ `"  "` "`  "@$ $ ` "> ?"`[9 > IT !X p 2 㿘> + @> +`D#> I p 2& `? 2*  `"  "`   "@$ $ `"  "` "`  "@$$  ` "> ?"`Z PSΐaXaX 2 aXR! 2$  7$ $ $  p $  p "`  p& p$ $ $  "@&  `  "`> `@ > I8*``> I (@ 㿘   P> + @H /`4> I* !> I!4`U ` "N` @ 6H`? `"  "`   "@$ $ ` "`$`  "@$ $  D €> I@Y  `  '  vZ > I!XS3` "> ?$`ZT x` " ` @ & ``2`H 02  㿘N 0 > !d  @hX  "7 , d , (,``* `(2 @"@,02`#P@ 0 >    @hi  ,4 (`` $ ,`$$ `" $` (  $ ,$d $  ""  (> d * 0(22( 㿘. 6     @X " "..  @h& 㿘. 6  "> !d!d?(,? ",`"`# "@""  0`2(㿘> !`   `  `%> P #" `# `a` 㿘 <   4 al( 2  # 㿘> I!8`%> !`    ` `  #> aH #" `# `a` 㿘 <@" `k? ( 4`\   4 2   v& 4 `    ? v& 4` _^  ef4flfllllfl㿘H /` * ! ` `>U   > 0&  ` Ր`  H 00@   > Ibؖ  "b> I` "`> א!$  `4"   @6     > Ibؖ ?"b> I`?"`` ?"` ZH 0㿘`  1 . *   2%2  *"   " $ w 2  * Đ ' "  "@㿀 'X'T 'H'Lb'P> I!,R @2J`" @2B "  @f# 28 "  @f 2.   *@ "$ 沔 :   L  X    2  L ;0 Ґ   0.> )#H'L'P'T'X''H  't     '  Β  2  7  2 > V( `(3  @@2.  ` 2* +`W) Ք  ^ > 0 `8 & X6@& s 2   2  "    . `?8    @( 8 @V D '@S`' ` "8ע  "  "8Ϣ  " b   @ @e+` " 7 '  >`0`" " ?`>א!*` €   t tP$@(t`8?"`8t"Dt`< X6t `v }. t ut8 i&8  f /( "`  ` 2\  3 2`C @ v 8  E&8  ` 2 `   ֔"& 8 &8` `? `?"  "    f0 0 '0''D't Ȑ@U " "/t @dӔ ''' 0"<"'@'\ "'@ 'X6  @ @  y  2â 7M!  @ 4  &>(vP `. @(& ƒ   Ԗ  E "Tp " `    "TגC .&@ S 2  47 "# "@ " @  @` ?"` &@  $ &<> " $4*@ @&4$(@P< X6v . 4&@ "    2&D  tؠ X6t[X$* &X$0v &X .  -`"&  @&" @`> I"䀢`4 J 1`25`  > 2! m   "@&   > > > אap` 5`H > 0   ` " `"㿘@TP 0 &` &`  &`>@㿘@TA , :  *" ?  @  *㿘` `  X `    X$ > SI `     Q( ` Ґ 2 & & & @S `,``  @*@&@ ?   `` 怦`  ,44, 㿘 &    X  а X ,` *@& ?    L`` ,` )? %$  '      "#  l  ' '    '  @S_ 4,,4㿘> I"`"`) @ "" 2@" X2 2 > אa2 > אa2 > > א ap㿘> I"䀢`   ` X h4 V \ $  `K3$ > ט!$ > > א p3 P> I" ` `k > ת! @R D   "     @' `'`''Т C  X`2`$"`"" !*2  # ", '0'' ` X24 "v `* " " !*22 5`> > 5`> > גap㿘> I"䀢` l  ` X 04 @a > ט!4 > > א p3  > )#H@'    4`@] @Rf D <  0' ' D'' @''\`" t' t Ȓ "@RH t "&/Ȁ @al '   s` "%` "!` 4 4 P$  v ( ,  8$ < <X4 $ Ii` "`&`&`H > .> ȁP@R D> I 0"t ``"X@2h`c @'Ē  $``` "M'` 4I'Xh4 T\ $ I $ `I  2D`&`3'@ `2.`'` '` 'Д ```"`` 4`` `X2`"`$"" `H` "`&```̀ '''2` x      @Qx `   '''' '  e H /`4ؐ* !؀ "  #> I00 . 1>ݲ``#(`?  ``@2` ! `0 `1D H 0#H 0 Œ 䀦@ '"  &  *` * " @R &,xP㿘b@P ( .t-* "?  .L$,   6 &. . 㿘  (b @P͐ @PȒ/@/h@PŒ/@`.`"* * ? @* "?  "* * $,   6 &. . 㿀> )#H'@?`@    ',@   @ @ &` `@2``@2  ` *  @ @ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 2 @`` @ ,``@``@ 2 ܐ  ?*`@^ޒ` Ґ 2   ?* @^Ғ Ɛ "  * 2`* 2  2`, , , ,  @ " * 2  2 , , , , ` @?#,2  4, ,,  , `  ?#x*2  2, ,,  , ``!>ސ#-` €`` ^@\`2`` "2 ` ` "2` `` "* 2  2, ,,  , ` 2` `H$ `@"  `.$ `@.@ `@ ,$ @.@  4 "@& & , , Gߔ     & `G֔ ` p.` `.#H > +z 㿈  #\@  @` & G&@   G$㿘\p"3   ? # @7 / *" *  * ./h ( ` 2 * …`Gk4`   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` .*@@ 3     + `   `0` ` "@    # W# `  `@"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` "` `2 `   * ` @ 4`    ` 4`   4` &@ ``" 4` 4` @@`?# @3`@ @3` 8 4`'@` $ ? ` ' 7 㿘!> I#@M"`# D 1> />->+>)> ՠ 0  N А&pcȘ  $`l$ax$ap$at,`h$a,`jIj$@H Ad `"`ߢb`㿘H /f * ' ! &!!` ` &!&!"`!?&!H 0 ` 0ځ㿘  @" \8 @"  \ @ @2   \"@2 \2 \ 㿘> J"!p> K!㿘" n  2 K >  N` 0?`@ >>  # aT %Ğ /, h< < < < < , j$ l$!p$!x,"4 \$, i$"hH$"lH D @ϖ H /f * ' > Jpp`$"`"`"bd$"d"pH 0  㿘H /f * ' "``""d"d"bd"d?"`"$"`$"dH 0 Ioﭒ  㿈 \ `'D  bh bl v 2{`(D!(@`(s 0Da(> !M   D@[    U      cD EA  `?` 6`D`D ?a  b 7 /> "`D ̐` n  D`` * @ a D`@L  * 7 'bl&  bh@    7 'bh& 7@7``<" G   2 `D`p" 7?$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4`8$ 8` 6`> G < ` *`  $ $ `$  ` `*` &`` `*`" &` D $` &``@&` &`  D*` D ;6 2D> "`2 D`" D`    D`(  !"`"i / o  `"\ `2 bD 7a S"aD`"K  / ` @K ,2 2 , ,  b, b`7!bh2 , 2 2 , , , bl@* 2`, 2`2`$, , , > #, , `* 2 2 , , D`B :D`చ 8B 8bk&`(bp   @L&  D`B :㿀> )H>' 0  H /f * '  ai@r %a2@a1@_a@a @" \ a@"A  aI@ϐ af@ae@  0j0h@"a@ߐ a@",  !J@g@{ ~@"!`lj@"A bٰ @0!K@"bhϰ @ /,b 7,b"?$ð $ l&" /   / `/,b`7"  \ + \ 4 \?Đ*@4 \6ꛐ %$bp}  ae@$bhaf@2bh$blbh bl }bp``8 ݐ?"`8$bp@ \ m4 \@J   // bh@J   //bl'B 0U < P 2L / 2H / 2D  2@ $bh$bl" 6$bl3$bh "0 1bl * 1@JU   //bh'>> bl'> >  8  2 $bb& H 0H > &X!X㿘"p@J "l  $ , ,  \#2 ""l `   $ " ["t &"p`<2  \`8 ?"`8 $ː $"l$ 2`  ` ? ( ? 228 * 2 㿘> J> "atH" 㿘" 괔  > T !p$bx`$b|`  2 $b| @  bK 0;  b>>0`$bx   x x >!>>?c$at$a$ax4`\$@@v $a$a$a $a`0> Jc DU> J!t"!t$b 㿘@H /f  "H 002* ' @K " ?y"UE> Jat" "at⬀2⬔?""$"ђ H 0 㿘 X> `*  @  ` *A*"`A 㿘$?⨰ @?,!$ \  0?> I!?2p> )#H' \ 9HH /f * '  \А ?! !x6 \! \!6 \!xH 0  H "    2 @  2H > $А!ȁ㿘" (`\z $2w  @h "`ho  j +P!  2e 0 r  > J\  X !t "`h@2 "``@N$` " @`h a>ax ,`.`h$`$&a>a $`(&ax&`L`b`$@$`@˔ " 2 "` $`&"""S`"$`,&"" &",&!$ a1@`( >Ԓ  $` "Ā "㿘"` ` "`,@`,`2` 㿐 Ȁ`@ a2@M \` HH O , h $$! ( ($!x$ L   ,$ , ,,2,,? ,",& ,? "$`2@@G  "`@4  $`$` `,`2E $$ 㿘 h  L` ` `$`@㿘  H /4 h* ' h   L",  0& !@2" N " Hk"$    @(   @IH 00H 0(㿘 L - > J" "!   , 2 t ⨀ "    , 2⬀2⨐ 㿘  0@V$  `0@V` &` "܀€`("|?`$>#Г*` € &`$@"`$  &`$ `k?  `\ &`$@Ȑ&`$H> )cH 'H /f * ' @F H !@"b> a@" a @֐a@a1@ڐa2@ܒ0!5@ے  a@a@>0!@"|0 !6@Ē֔0!@Yϔ&؀€ &  &`,` H S@= H 쀦 40`0` 2  8 +|  @  4> !p > @@ 2 \ 0F`$|`@ `~ +N "z G! "u $   6h 4>`0` _ N [ G V SR`0` K N G F 2$@    5 ΐ1\ 4\ ` ) 4@$ 4@C@t` 4`,` 4N 4\  @  @  @ H 0cH > !!㿈R 4=! c  3`R6bh$ $ @T    @T  2`=ʒb$%b a1@Д @ 0 Rܒ 㿈  Q` 2L"h @SՔ  2  @SΔ  2  "8 "`@2a`+ R 4 $a2@ " " \ > "E 0"a &"2?!"$a牒  㾀> )"#H' #H `=P  a2@Y"! &"2?!"$!` " 2 H >  ݐ"@㾀> )#H  ' 0=Ⰰ` +> ``= ( "a\ bX00EDa`2 `H >  "x㿘  '>  0<  ( " ,\ X00E , 2㿘!Ā 4!! 2+!!    &!&!$ !?&! / D 6 b| b b€ 2  `B > !€  ݠ$b| "! `B > 㿘> #Ȁ`> b@Ő `!  `!! !!@&&`  7! 2" $!!$! $! ! $!?  <`B<  `B <  @> )#H  '     ` ` .`   `?  (.`   `?  & /7 .`   `?  3`!@  @ scH@ /7 .    `?` h!"݀@#cH0Y @n Q   .    `?  .    `?:cH (@NȀ 1       .    `?  .    `?+( (@@ ?*@' .    ` cH > 7"㿘H /f * '  \ @ ;6 \Ѐ`@ H 0㿘H /f * '  \ ;6 \Ԁ`@ H 0㿘|  @  `B > 㿘 h  ) + L "%   "! "|`2D  ` 56 "   `B  < `B :㿘 \`> > "C1b   "`"` k(  ,\" ,`"` , 2㿘     "̀`@@㿘 ` @ `k? (`,`\ 2 k`,`""@ `k? ( "`\ "" k"` k@ `k? (`,`\ 2`,`2@  @!$@""   k . kB㿘 @ :     ">>>> `@"""""""""""!$""""""""""܁ ""  ⤀" ⤁㿘" 2 z 2Đ   2 ,k&" " >>>a,""""""""""""""""""""؁  㿘L" ~ 㿘"@  k` 2    2 Dv ?  3 & 㿘  F  >>>>>"Lc0#@&"&"&"&"&"&!$&"&"{&"&"$  㿘" Ԓ  㿘" @A"  '> `$ \  0 0AҖ,`" ` , 쀤 㿘 ڒ 㿘`㿘"3@CH"*    " >>>`""""""""""""""""""""؁  㿘" &  `k? ( ,`\  沒   2| 7  2` , 2 @  f " 㿘>!>>>>>>>>!>#\`㔘!Кb,`&"&"&"&"&"&"&"&"&"&"@)  " @Đ , 㿘" @ , @2㿘@] DW 㿘@ "?"  `tP`xאװ㿘 "`  @|      < @ @h <  `   㿘 n% m  n 2 > b@N  >  n @ @D    *@*` `*` a*` b*` c*` d*` e*` *`*`  X(00*` *` <*` X(00*@*` 0*` 1*` 2*` 3*` 4*` 5*` *`*`*` *` 㿘     |K $ $> b"b2`` 2`2  2  n2 2 2 @N8 ,, ,  ,  .7  , , & 7z   , *, +, ,, -"4H /f * '  JH p@㿘     |Z $ $> b"b2`` 2`2  2  n2 2 2 `@M ,` ,  H & H,  ,  @,  A,  B,  C,  D,  E,  F,  G,  H,  I,  J,  K,  L,  M, "4H /f * '  H p@㿘  k <  6 @0@@ < ` 4 6,*@$ `㿘 D  , < "  @@@&@@  2 < ,7 p> )#H'b@>  /> "/7 K  4 > > #(cH?C0,#H  q  2$ " $$ $ `D $ `D "` `D$`D$  . @ @  2`, <@$ |y #H > #`㿘   t"?@x@~@ `"  "`  ? "& & ؒ 㿘"  @>" " *6@ ,6` .6` 06` 26` 46`  66`  8.` 6` 6` 6` 6` 6` "6` $6` &.` `| `@? `<2  2  .2@02`22`42`62`82` :2` <*`2`2` 2`"2`$2`&2`(2`**` <* < <* <㿘 |E  < A 2  > > > #xc<֔"`4 > > > #xc<˔" 6 > > > #xc<"` "`" ?"&&  ?"  @ 2  < @@@E < . <㿘 < | *  @4 > > > #xc<" &" ""&  `"  < . < @ @ @0@" 㿘!X 9  2&" ~$$!T$ $  $ $ D >a> ,` \ @" @' 㿘"  "  > > > #xc <<" " &"> > > #xcH<1"  ,߬  㿘"  ,㿘"ߐ ݐ ,㿘"  ! !P* @*``H  !T@?2* `@ `< 2 `> > > #xcp;#&㿘   D& `  `d`z&`d``2`d^+㿘@KN 㿘@KG 㿘 `"   `: @:m x  㿘   )  ""`  `@* 8 2 2 2  2   2 `" `  `> > > #xc;~#" ` 2  > > > #xc;p# & @ `u㿘!P `?,*  H @<*  & `  `*"@`@ > > > #xc;8#&!P  <  X\ x  A 8 2= Є@@ 6 8 22 &%@ + 8 2' }x@   8 2 沄@  8 2 @   8  2 @8  X k( \@?А*?** 2 㿘` 4 ` > > > #xc :$   &`> > > #xc:$㿘`` @ > > > #xc:$# &&`"  > > > #xc8:$(2 @> > > #xcP:$)``"`& `?@"&@&` 㿘 @ E    & & &  & & <& & "$ 㿘 @ ` *@`.`< . 8㿘 @I @.`. `. `. `. `. `. `. `` *` * 2 2 . . 㿘`< " `* "  8   @ `  *@`.@  㿘@I  2  `@I `? <* <㿘@ʒ  <& ` . <@Ð * < ` . <. *㿘 | +  t $ `> > > #xcx9$  " 2  a r   & `& |㿘 t    |> > > #xcx9$π`& | 㿘 *'>2 2  ` `  \ |     > > > #xc9$ LD* € 2J I@  <  t  > > > #xc9$  `! "0 /@ 2+ `2(  2% $@ 2  `   2 `@   2 ` @  > > "(9Yb@@  @ \㿘 \G |`>>"X.` € < `E. <;@8 t $& t <  ?> > > #xcP9%"$ <& tN & \ & t < $ < <`. <0@ & \_& \> > "(9bh& \㿘 |`<  ?> > > #xcP8%K"`<㿘 *@``" p@ <2 p *2 p " p *  " p㿘@̐㿘 < ` . @@]@) <  Z  . <& l@ *  <* <* *" l㿘 < 0@o@I < . <㿘`   * <  `&    `1_  " * <`& 2 `& .` "  <`& " < * . * < `. <s `㿘 .v` `& < @Q㿘 *> c 1)  <`@. <S 㿘 V 2& `` * 2& `㿘`㿘> c㿘 <  2  d * 2 d d ?& d d  P Xb   >  d ?& d d" d㿘> # l '> )> +>   #xbx7ߔ&Q"  ? $`" @ 㿘   n h "d m e n 2\ #> b@G)  P  L    > 0D>  n @C  ; , bb6@6`6`6` 6` 6` ] & n @'    @@F   d ?& d`D` `d "`  "$NJ "  "  2   "      "`"`㿘> J"!x> 6K"8㿘"   > K  8 0?`6 \D&>  >>aԐ &!x&!t&!&! &! "x&!$>>⼐f֒   fڒ  f3\D!H /f * ' > Jxx`&"""b&""xH 0  㿘H /f * ' "`""""b"?""$"$"H 0 D37  㿘H /f  !!!€!* ' !Ā  ! 2!!` ` &!&!"`!?&!H 0`  Bg> 0ȁ㿘 !  !  0 0!5%0 !6! %  \ 6 \ ` 2 \ @ \   @6 \ ?6 \  k . k70 f`x?㿘H /` * ! > "P> J!`#> +` `@`D8@u `2`H 0㿘> J`0 `H> +D `"D "D!>  @>b @X `4 `< `h `l!@8&`\0倦 "` 0"B 02 `4` &`4`4a(> `<!(|` `<> + `h`0,`< XD4`<&`` h `X `\!@ `l &`\@" ` ``< @  > 8`<b` `h,`<`X4  M   &`H> b5Ґ 0~\ O > J> J!ᜒ`#!"@6; $``4$&`4> Jaa $@a" "a$`> [" ] `<   U  2 0`  <  2 0 H &```< ,` "`. > "x`> I!&`<`@ 4` ?"`   $ *&`@(> Ja?"a@`"``"``?@"$@$`&`H`4 ;&`4` "!> J` !`$` $!` 2` { 㿀)> )#H '  7 $$ !($(` @5$> Ր .7 (4  4`(  4 4 , , .( `.$ `.  `. !p  // #H > "㿐!> Ր Q "  ^// /  / / / ذ `"`H @'> c4   !(@ "  @s'> c84͐  `2``X `0> + D ( \  2  \   - 0 \ > J!`c*>  @ & ?: @6"     $ $   !$ '!  2" $  $ ! $ `'! 9> J  !`$ '! 2 $ $ `` 2 ``> 5#`> +`D&````"C `4 ?&`4 `> +D"8 D> &`` t @ $ `@`< h `"`"` > "X`4``` &``&`4 $ 1> J  !`$ &! 2 $ $  㿘H /f * ' > b\ b\ "b\""?"H 0 1 2 > 3#  8      *   @  %  h@@ 0Y 0h> )`#H''` ]'ȢԐ, , > ["@Ȁ  0D`0<@20 `h  `\ A A`@20ސ"< @ <20 `@20`  `22 ̀ b`'̐<@B~    > Ւ`@Bs   А@'> c36 0ۀ Ѐ'@͐ܠ?> cД3# 'Ԑ`()`?В@J `0 = `@B4 c4@А@'ܠ?> ``02 0< `h @'< 0?u> 8`H@z'ܠ?l>  `2Ϙ`0 /$`<@", `H" `h`H "$  `h 2 `h`T"  `h 2`T А@N'< 0?>> ``02 0E  `, + ` > +> DT $`4 ?$4` +$`)> J $` $``!`$`%!ap `@2` $`$ $` `!$`%!` 2UcH +O ̒+K #V`(Ԓ @w  `< h`` h`+0 0   +)+% Ԓ+!  (55+ Ȁ 2'̒+ (4`   //ap cH >  P   > 1! 8 $ 0`"  ` 2*`&  4 ?$ 4@2W D ' ' < 2!( v   P>  *XX @ * " 2 я 2 8&  4? $& 8 0 `" H`򀢠4 @@2 D ' 0'  ' vі  㿘`< ?"``>c!&`&`㿘      *   h@@0㿘   /  > J0) '0%!` > J!|  #> Ja > J` @@v  > Ja *= > J a*8  $a> J!Đ㿀)> )#H '  4 $ $ @1$> Ւ *   54`  4(  "` 4 4 , , * * ) !p  // #H >  !㿘> J!` - > J> J "a|"!'> J%> #> ??a` ᔓ2 : k #"?a %!> J!) > J!)   3㿐ǒ㿘 2> 1Ӑ!(0> 1ϐ!0 > %> #> 1ǐ8? 1a@ 4> 1!H㿘 > 1!P> 1!` > 1!p >  $! 1 㿘 >  ! 1 㿘> 1! P>  T! ` 41 8> 1" > 1"  > 1z"( 0 <> 1t"0 <`"> > "@1l`0 @1h"H @> 1d"P @ > 1^"` D h>  H1W"p H㿘 ֓ > 1K" >c| 0> 1@"  @> J>   h㿘>  h  @2  $    2  8[       `h""" $`h$ ?㿘>  h "  2  9 8   h """ $ h  㿘>  h h  2   "͒ 8㿈> J'L'P'T'X'H! ` "!$ !``$`0  ` : ѐ 2 ` $` "& @& @ `"0  "@& & @```0v> [0s  $ \`m 2Mu  א0b"`"`8 @2D > ["'' ` ``h`0`'`'`F ` @2` 2@8 ? " &`tD 2 &` > J"! `` ``h`0`'`'`2`0< 8 2 `$ 0 " > ["'' ` ``h`0`'`'`` @2(@8 !@@ 2`?`> *` €` ( &`s &` > J"! &``2 `` ``h`0`'`'`2`0 "\`<  8 2" `"0?@> [b b 20(& b` ` 2`0```h` @@  ``"~@ 2``w&` ` "`` "` m k i&` `"d b " 20 <@R  # \`K<  8 2 "  `# 0<?@b`(& b` ` 2`0```h`# @@  ``@ 2``&`  `" `` > ؓ*` € &`@;㿘H /` * !   ?8 #&   "&  \ 2& Ð? H 00@  & rߐ 2 & > J"!& H 0㿘    8 ?    \    `@ 㿐> Ja R H /` * ! $a> ["'' `5 `h`0 ',  ? $   2  ` @M   @H  $  $a 2  ` `h`0 ' ' 2 H 0H(> h 2    2H㿈 В  @> G < `$`  $`$` 2* *2" ""` ` ?$` $`*, $ @4 4 `> `  $`$`    @ '//   @- > Ja`  "` 㿐` @ ` > J! ̚ $   *#\> א" 㿘˥> [""  !(@ 2 0,( 20 2  <  8  ?     * H"*  @"   *  @   :@2㿘@,   . ``:` `*`?&@ #: . 㿀> )#H !'@  !@ 00!@0  "{ v@~r > ["   2 0 a@"'a@"< a a@a@2 !0a#@ a!@y !@  !a%@o !      2 0 <@2 0 !@2  "% 1  M > +`"o    pH /` * ! > [$ 0b` 0$ 4`""`  8  H X $$ $ , X, 9, 8\ "$ , H, I$ $ h\ > JaА "aА3H 0/    ԰  "    < ``0` ` 2`0`< 2`0` ` "   1 !@ۖ  a@"\ a @a@E0a@Đa@@00!!@ " 8 0a4@wa3@ tn!#@ "\ !%@0h& <& @& Dn& \ i  H& L& P& T_& X& \& `& dV&\ S H /` * !  H' L' P' T'$ H$ L$ P$ Tx a $ H$ L$ P$ TH 0H   $   ( H$  " H 0 2 $ H$ L$ P$ TH /` * ! @    H 00$ H 0H$ ,$ \  H /`4 9* ! 9   2  8 & <& @& D& <@" 0 @0 $ X4$ \8$ `<$ ,$ d\ "! 2@  $ H$$ L($ P,$ T 2\`"\@r \  !   $ H$$ L($ P,$ T  H 00 $뗒 H 0UH H /`  f+$* ! @12Y 0`" 4 4"`4> ["" 4? 0"$ 0$ 4 l "$ @G$ l$  א?$ $X H 0H@ -x H H > 9"ȁ> )#H'2 > )/"ؒ!@ "!@"Ȱ -0!@2ð - @" 2  2  `  2  @  "  8  !@ "4l!@"  -0!@(l - @2 @) @"* "& ""  //ܐ ai@)  @0͐ll @@ 2[   !@l     `2 l  2  09 1!@p 8 8!ג\  H H!В0@)F!t \&&  @)= @!  8 8!\  H! H X! X aH > Q#㿘@x> )#H'H o&*@g`8 &`8'`<`@&`<''&`@ `D&`Dax' a  &`8&`<&`@&`DH 0a#HH 0> #Ȁ`> c@ &@`8&@`, 2`, ?0  ??&`,`,&`\`,`X &`(`p&`$`\  `,`(2@&`L `8 &`H`<`@&`L`D&`P &`T`I   @T`\  `l  #H8 'ܒ@&`l#H > #(㿘``L ` `  l   2$ `<`\ > [" "+` !( a( \  " < L \ 2 0@ 2 0  "  0 h  h 2\0 0 2 4  ` $`㿘` 2` T `\   `L`<`\ > [" ":`\ `\    L < \ (a(@2& 0 2# 0  2 0`\ ` `  ` $` \         $  2 `\ ` `  ֔ ` $`? `2!`> I0  "``"`2 <"L"  2`@ 2`\ p> )cH'H /` * ! > ["` ` 2`0` `h         2     j&  6Z  2 H 0b  && " 202&  6H 0I M 3 `" h & h "`h"h&  ax // ' a1Ѐ  `"  "` ? "& &  ` ϐ?"` ɲ 6H 0  H 0H > ##8p> )cH'H /`    # * !  ? &&  `"  "` ? "& &  ` ` ?"`   /' !xa2АY 6H 0H > Ԑ#H㿘&&   i  & > %ɐ#X  ^  & > %#x6 *`2``` >  * 2`> Jԇ(2`* d2 @2   > JԄ( ` * 㿐#> b  !> Z> !ؚc#\     $b!Ò! 2#` 7#`@> #> +` > +` c> +` >+` 0 `#`ܑH /f4@* '@#`#`` &`@" &@`>`` ` * ` #```` *` " ``>` ` * "@`>`` ` * @#` `<`(  ` ` *` #@`` * "``<`(`> `ܐ ` ` * "`<`(`> `ܐ ` ` * @#`H 0& ?#`  @2#`А!#`h#`а 㿈 @    ` @E> ["`" 1 > 2  8 2    ` ` `_` `ݰ `< 8 `6`@, ܐ'@  ,İ 1 2",2  3# 2 ` )> Z ܒ!#\ 5`@z  "   @ @ 2 0 ܒ!#\5` @h " ` @R  2` 0`& 826 > h > > "b  ג #r "X> > "b*`,` 2 2` 2 /> Zi$@4/> Z %?* 2`@45`: 4  m  ܘ#\Ԕ  8@ ސ26 >3 1@/> Zi@4/> Z  * 2`@ 45`( 4  <  ܘ#\Ԕ  8@ޚ ސ6 >@S 㿀 @  ``@u h!"` > #ʐ# " i  " d / N> ["" 8  ? <2  8  \`" 8L&  8 2 8 @R`  H@ ܢ 2  8쀢 ; 1'7 `'`'   >@ ܀ " 8% 0 2  > 2 `> 0   12` 1$ 8 $ ( @4 < #\#`    @u 㿘 @ `> "`"`` & `& (`& & $& (@6 < @ `@㿘 @ "` " Hz  H " h h!@& @ 0@0 H /`4 * !   ` "`" ? "& &  "  ` "`" ? "& &  Ȁ " @oE ̀ " @o? Ā @rH 0 ؀ 2" DH /f * '  `"  "`  ? "@& & ` "` "&&   @ "`"`  @ "@"`?& & H 0> Z!㿘`  @#S&`  , , >4  8$ 㿘 @  @2`@ 0   @#9&`  , , <4  ($ 㿘> #Ȁ`> c@ ` #`` h!2  (2  ܀2  @    瀤P H   D@"& H 4 L'' 0 ' ' 4  <ϔ  4  v ğ ³㿘 H ª& H㿘@ _\/  7  / @  .2  ܀2  >-`2 @2 `v  h!"  , 2 0 2  4 2 8   ,   ,  ,  ,@1A  2{   2  2   2  "    2@ 2 @ $ 2@ ( @  `   `  ` = @1   2D  <2@ 3 2/ ` 2+ ` 2' ` !  h!2,  (   2$  <2   8" 8  8 `2     `"  6    2Q ܁㿘 H ; H@!  @ `%20       $   (   . .   ,&  &  $ &  (o&  (   . .  (&  a 8㿘@ ` @28 8 =?"8&@2@@ "  < 2@  .`.` &` 5` @! @` `< \`"`@ 2  4   2 4   4 > [" 2  1M &@< 8 2 8" 8> ["  2 0  8 1'  8H("   ? " ">  ( "  ( >  ("@>  ("   ""h"1<(<>    @("   @( (<>   ("(<>    (/"(>܆    @("   @( <(>܄   ("<(>܄    ("H㿘@6.6/ 7 @    *  8? h!2. ( 2* <2& >2" 82 ܀ 2 `"  "` "@&&  &" "&  2 h > "` ,`, > #2!3 㿘` @. 6/  7   *  9 h!0 @.  2+ <2' >2# ,@.ٔ  2 `"  "` ?"&&  &" $&  2 h > "`>   (,`> 2`  H,>  ` 2`㿐@'|  : r     > Z> Z!!ԓ.Ե2`    * @   @ h!2 >2 < 2 8@2  ( 2 ܀  2 h /  )ԓ0  * @ !@   h!2 > 2 < 2 8 2  ( 2 ܀  2 h  > "`>  p *0 @`"  "` ?"&& @ &@" &@& 㿘  : r  ` #> >  "t "tbt .bt  2`    * @ *@ h!!7  >@2 < 2 ,@-  2  2 2  $ 2 (   2 h > @-  67 bt bt     * @ *@ h!!7  >@2 < 2 ,@-  2  2 2  $ 2 (   2 h  > "`>  o7  `"  "` ?"&&  &" && IJJhK<K<K<K<JKDJJKLK4KDK<K K K<K<K<K<K<㿘> "> Z֐"㿘t㿀& &  ܒ'T'X& ('P'H'L` to  :   @. :`U> ؐ""  ( 2  > Z`tX"W 1> ["& H /f * ' `` @``t?&`` >  > & ` 2" &@`&` &`> lHo  "`> @ibH 0> Z "  H 2  @ > Zb`  "` 㿀> Z> )b H '"b b   v    V$ p  `s"J#H@   //`> Z   `s"6#H% ` 2`'`@2``@L[ `@C L`@    ⬀@2`> #H`s"#H >  ؁㿘``   ɖ ``2t `n.`>  € i ` e H /` * ! > ZbH 0 M > > " D ``h ?"`hH /` * ! dH 0' x# %@#     - -> & 耧 rr㿘H o*@ aՠ H 0㿐6 @      0""`0 > ؒ Q" > ؒ H"  > Z" @   *> #\"qRRRRRRRRRRRRRRRRWWWRS(VWWTWWSSTWWWU\WWWWWWWWWWWWWWWWWWWWWWW㿘> "Ѐ 5> "bԁ㿘` @ , > ZbА "b`?@ ` 2%`!  @* @          > Zb` "` # ` @l ` 8  @ @*  8   (8' p<       q+( ` q d ( & ( &   " ?@& `( >  > Z"А .` ``" *"` "*  `2 *2* 22*sR   2    <?쀢 : > ϐ! ? & & & @& ? *@  #?* * 22` " `" :  : . :q0q 㿘" @㿀'L'P'T'X'H '@` $> Zb` "`@8 @ :  t 2 > Z}bА "@& & @ɒ > Zb` m"`  "@& & (`> Z"Е*  `" `(U >!*` €{> ؓ. €   lb gb bbд   `#xj`#b  *`@`<  8 "Ib  )2 > ؀`C0@6b`  "` `*``0s@ 2 b` "` * >  "&`  h` > [ @3` > [  @ > ב* * b * `@ ؐ ( 0Ғb` "`> "`2R/  # bK/> "`> "` `  # b`Đ "`Ā`o @/' 1' > "`` $db> >  " c"   `  /\'  2    \ 2L " L&   h`2   @ o  bwb``  "`* `@a" 0]  > w> "̀`Q|bЀ`#( `  `*` @`8 b` ;"`> آ#$` > ؠ#$ >  "&`  h`2  ( @n` % ( #\' 쀢 > "Ѐ`> "> f`쀢 m @&0oאp> )  cH'   `'칫-`   ?  o t> [ $b`` ( (!(@2`0`< ``  \`"`0`L2`0`2,`<@| ܐ * / (   " '> [T`o"T~ 9 `<P`B @:P`8 ?"`8`< $ ``,@    m    % "@ 8`  D 2     % $ $    (  `@ހ   4     *@   % "4@* @$  "`&  "&  x ? @6 @ cHncH > !㿘   , "@& & 4`@~a"@4`  "@& &    @o 㿐@48T@a* &. . @#㿐; @  " `0)3> ؐ :bа5> Ԁ  bЀ`  &pbЀ k& > Z"Д !l   *#\> ؐ"ؖNH  "3  4 @ 2, `> ؠ@P D' 0 ''  8  P:`P X:`X `:``> #>ch͐  㿘>  " < %X\  `   * $ > ؠ`< l> ؚ#( X c(*@( !' < l   "X\ "\ 8> )#H' 2 4> !(  20 X@Ӓ D  ' 0' 4'' ' ' ' v }'> [ `F> ב* *  *      cH "& \cH > Ր!X㿘> "> > Z"!bȀ`?P 2 4> Ő!p  @ D   ' 0' 4' v '4 㿐> l  ?> cp"l  \* @. 4@ 4@ ?#> c p#> ؐ[ cD @"  @. *`  + 4 2 4 $cDD@@@@@@@@@@@@@@@@@@@8<`@@ 㿈' `1> `> #\ ` pÒ  pX> a $ܤ"o""""(7777> [> 77ʐ"a7#\     > [> aؐ!T#\       io  > > Ґ!#@ *"@ *`" *  *  * " * "> [`@: > [> [#> J`*@@ 6*@> ؐ"X  @2> ט"+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > [ @ ``2 `4S```"`44`4:+ `4@ #> [b>  P"`  " > c > c> "ca@.  aԆ +` `* 2 *2  (@  +``+`   > R!ԓ+` `* 2 *2  (@  +``+`> > [a @%#"> > [a @%"> [> !@b@% 㿘H /f * ' > [` ` """`?"H 0 ` ` > "@ 0ց㿈> ["`['D> ["`""  "n|  'D  J$ D 2` 2``X ;"`X `<`` 3"` @ nZ 'D` '"`   "  2  $  \`2 $`p "`p`?`  t `" " t @z  ` "`# @3 $`t "`t @D` "` ` "`$ D 2"@ "" m D h` D     @  D D h D>    `@ ,``"`T@ D `: 2 `0" D 2 " @ 2  '`(@ "   \`2  < 8 \D`  m 'D > #|`>  `D@   L `$ "`$"D     0"  @20 h    22\ |8 "|  @ ( "(jD0(IGD h`>  > ؐ   @ > #x`> "H`*D q H o *@ g  ( @Z  D#\ @`I H 0 ƔD@T0 ?@~D`   m 'D`  "`  > [#    2  @2   @2  @"  2   "2  4 *` `" `` "``  * 4 *  3 %> `> `㴐  $`@ `d> [" R `d x$`d `$*D" @" n'D`@ $`@   `,`4 > @> "H`B ΐ < ` l9 7 )5 3 1D q( H o *@ g  ( @Z<  D#\ @_ H 0  (D`i"(04> [ "4 `@ @ > ב* *  *  D  0ipD㿘> [" 4 >  a( )  <*\ c , ( @c `" 0`2 0\ " 0 L2  0` `!6` 0 2  㿘`  ` *`  " & .& > [!T  4> [> [cc &@c" "c&` <.` ` .` `6` &`   &` &`3 `2k`` ``   `  `   + `2` 2> [` ` `  `@` ``  (```   $ `> [ k`2`"2`8``  /`)>  @ "@ "@h` @`"``"``?@"$@$`> [ "#?` %#`  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  u `? @c *   > [h`@g"hc ` !> [jq&@ "> c?`"c   #?$#jY2 5``%` `%`@`"``"``?@"&@&`> [!T  @ * @& @  *  "@&   @& > [`g"> [" a> c ?"c㿘 "?'> )> [g ` "` "$ $" B㸠? $`"  "` ?"&& > [!T ,㿘H /`  > [Y '$* ! > [#'> [> [" ? *`  `$` 2 䀢``8 ې?"`8$H 0㿘> [c  > [" `#`$`# 2`㿘 2#> [ `|"c> #*` > ؐ : @?> [x   `-` `  `5> ٲX``  ? $`D"{ ``Rت%@`2Ԫ%@> #`"   ߦX $ ( 2?`%@ն   '@%@ X `2  (Ő   (  (@'䀢  <`%  >  < , 8 @ @ ?  ? > ِ `\ % >  (Y X   <` (@'䀢  <    e,$  ꀢ{逢`w 2  `` ` ?*` `j'I%@ ?   "   -$@W %$@  O&`  ' <Δ   => ِ`\Ô  (X  /. v'ܒ ܒ  /%@` `` > #x`@3    ?  ?  $  > [b`P  "`P㿘> ["?` #> [` #> [`8 ?"`8> [""  , ,$ . $bb䀢   @ > [㿘> # `@> " + > `??2 > > "`T"㿈   //7'  "K  4 $$2A 8 0 `: 8j; %> I`0`.a(2'`` "#` 0  @2     `@, 2   8 ?$ 8 >  2``2a( 8 ǐ?$ 8 㿘!>  T  cy   TH > #+ `& > "0   T> `* #  "@ > "P?  *`*` `   @   %> # "@ې`@$@ > # `$> "h˒ 㿘  @` , ?{"  "`&  "& @* @@ $@㿐> # `    > ` "p` `  #  > [`' 2 `> [(`d"(0瀢   2  %"> ["   (`@> [> ["̀ $)> [> ["䀢``8 ?"`8%"  ,,`` $"'"䀢` > [    0""̠ ` D8 eg    D`@8gF `?,` < @3>  4 0/>   )> #`%$>  ( >  @#,` ( >  4 "` 0 㜪   > " > #`  ! " @ܚ > ["(` "(> [b$  `-"$, ",,A>"* €  "    \   < lb`L "`L > ǐ %"䀤> c> #`"䀢 4@8 ?"8%"㿐` ? ?`>#*` €`> 3"` > ؐ Y#!> ؒ P##` !> # > cz$# v!> # r #< k$#!> ؒ +#> c_# 0Z > ["Ը Q > ["Ԯ G > [!@Ԥ => ["#\  *1`. > ["  $`! > [#Ĕ  4>   $>   -#\#p> )#H @' @(? z&  &@ h    z &@ h &̀ 2 ؐ@    /؀/X77ؐ///ݔ y &@@  h`@  y &@cH > "(<L\l|@ 2 22 > ^2  > [ (   2   @2 2 L2㿘`d>  25 *` 0>"#*` €@'@#@@@@@@ @@  * b㿘>  ) * `e `k&`m`j  * `n * @w @ @@ a㿘>   0a3@a4@ 0@40@㿘H /` * ! :  4& 8& <& H 0  H 0?& & &  1> ܀@*` (> \!@ (  " "@ "  " 㿘#> `Ā >  R bV / V 2M - R ``F -"D ` (@ ``> 9 ` ""`3 0> ^  8Z!> ["c> \ (@ ~!> !> \" >* !(H``!(! !> \>0  ?` #!> [>0``#6 ##`Ā > b   㿘H /` * ! >  ܰ `#> [> \!@, 2 * @*`"@*`@`  @w  *  ܓ2`@ > > > \"!("`6 > \ > [ # c*@ @d c> \ (@ !c 8> " >  @ $c> > " "`H 0>  Ā`> c v  㿘>  ܢ @ > \!@ `@ L@܀@& > [> \#`( @ *@ L" ""22L $ @  #"@ "  "  8  >  @ "`>    " "$  >  ܀ > > ["  *```*`> ل "  "   8  #   "   >    "@h> )#H' "  (|  `( u *` * " > \* a@  > e 0  "  2 \ 1 2Y -` T`\ > ZQ -!Ԓ  //'ax a1Ѐ @H /` * !   4, ,  $  $ $ $ $ $ $ H 0> ܔ `2>  Ā`"   "> > #X#` > #\ c(  Q  H > #hp> )#H' > Z!  //' !xa2А@  L#H > Ӑ#p㿘 "Y  >  `܀  M * > \* "  * a@  > 1H o*@ a `ܒ> ْ*` * " @* `24`ܒ*`2    ?* @*`"@*` 4`ܑH 0 Ā > c`ǐ  㿘>  ܠ > \!@`   L`L@ +܀&` ܀ > [?* > \* " a@*  @  > [@ ?@ > [#4> \ ( @  ,  L`" `""```2`2L $ @㿘 >  ܴ `6 > ق `  P`* @(@ / ܴ&@ 䀈> Z`L& p& p㿘@& `& & D& 4& 8& <& H㿘@ t L`" @^`U 8 2@`"  "` ?"&& C 88>  > )H c' , P "  `   P   ,@p $H /` * !  >  Ā`> c kH 0 > ^2` 2`2 2   > [ c, J > \ (7> 5> 3>  2= 28 L"4 *`2    #\>  Ā` c L LD$ L$ @ @ ?-@ ` @^ 8`2  2 -  J>  Ā`> ` d,@  @2 @2 @ > \`( @?*@$ @   x 8   H 0 7$ @$ L$ t@ $@" "$ H 0 #H > ǐ @@> )#H  '"J  , F   ,@y $>  Ā`> `H  H /` * !    H 0 1@ t& t`"  "` ?"&&  8H 0 cH > l h㿘  Lq  pؐ    ]3?㿘> ٴ Ĩ` >  `p   $   2 #> `#@   $`>  `w F  B8 ? > H /` * ! > [Ķ `"ĢĐ  " H 0@t` `   Ē`$` $`,>  `9   8   沑H 0 7 ]     _g 2  8 8H 0ڰ 7> ^2` 2`@@ 2 @2 @ "> [@ @,`@   2 @2 L " 2 L 1> ّ-` ܗ2  * * > \@" *  @2`  x 8>  4 ]*  *      _   *` *`*` > ِ $`>  " 6 >  `0 $0 8 8\"H 0Y 7 $ > \$ $ @($ 4$ 8$ <   ܐ *< ,` #  P+ *@  ܖ&+ 4 > Z!$ t$ pc@ $@ " c " $  $ L  L` "`r 8[ېH 0  ` "%%%H 0 㿘H /` * !  1> \ (  4`> [#,` -> [#Ĩ  @ $?  $ @ ?- t` %>  t &$ t t  ` Đ `%` >  a   2 @`Ȗ (H 0> \!( 㿐 >   `ܖ*  $@* > \* "  a@* ` @ `>  Ā`  * * > \a@" * ` @ > aH > [ >  "<༒` &<, ܕ2  ܑ* * > \a@" ` * `"Ұ      *`2    * * " * @  P `2 @ cHD"@ "   +  "@ + А"@"@"@ *`" *  *  q" `.` [  `  `  ]`u 7 c&D&H`> *`*` *` `> ِ $`` ༒ b" ^ >  ``0 7 U$`0  @ `` ` ` `" " 4@8 ܒ@&4&8' , 2  @`    `` @&`&`@ @B @ * ܓ2`@ `L ݠt @t"  @ 㿘沒 [   . `  `  \`@_㿘$    @$?# @6$ XX  G!> G <  &  & 沐&  Z  &Z03 < Ē" @4\ )>   Ȣ  $ $  $  $  d$ 4 4 `$ `$  `4` ,` `&   `@iW*`4`  & @㿈H /`4* !       @T 0&`  '  //  @D >  Ā`> \a@& *`" * " * "* > ap: H 0  2 2 㿈 ' ' ?>  䀊b  -    "     & 0 ΐH /` * ! |  2 tH 0g 1`* P ` 2!@` @2@`  @2@`$ @2@`( @2 @`, $@2@` 2@`2` P   / $` @o$` $`H $`L $<`  <`(<`@$`$`<`8$`$` t$@@$tH 0 H 0  H 0 7㿘  @)d 㿘 "  ?{>  䀊b v -H /` * ! ߒ  2  H 0] 1   t$ tH 0O  t +    2!  @2  @2 $ @2 ( @2  , $@2     2  " ""`t@H 0   H 0 㿐 H L"" ''Вb@ ??  O @ @4 8$ 8@ & H  + & L> @& > 8 8 @`C >` B@> 8> @"   8@8   $ <@  ~ ( @@y , D@r@r @ k& h @  @) 8& 8 @8  < $@ @ (@  D ,@@>@ @Ԓ 8 @`C >` B> 8> @ 8 @8  # < $@  " @ (@8  D ,@@ & H  +& & L> @> 8㿐`@ H L"" ''Вb@ ??3> ` ( @< > ` *"@ @ &`#` #` #` ;` (;` #`(#`, 8;`0 @#`;`8   #`   ` #`  " ` #`  ` #`㿀> )#H>  '  *'//ဢ''0'#  UO  > > az $H  $ X$ >  Xɖ> [#`> `$` 6 H>  Za`0 $`0H > !.@@"H`(  :@""L:8В@?@#`#d?/@#`#dd``` c"@> ഑*`" "#㿘  " c> *`      `@2 ` > !" " " $& & 㿀@> @" "ఔ$H /` * ! "  >  4 ,@`v%@?/"?a` H' L' @' @'@?@@4 H0 $.  H' L' @' @'@?䀢   <" *@*4 *@ $ %@ %$   8 @8  < $@ @ (@  D ,@t `2H 0㿘H /`* ! H 0> \ X#㿘>  䀊b> [7> [#J#,D\t| `hܘܼ(܀LLx> )#H''L'T'H'P'X'l 'p   'hh!l> p"(l `> h"H @tt'll` <* @ &6> `* *` > [6&8 "8. > @ J'pϐ $@` Ȑ@ @`4 "8@" @8 ?"8$@@ `  ,,$l( 2  l( > [   lE.< 8 2@ "@` > ["0 l "-0") 20#@ 2@l`(+ @2\> [" Tr A@< lP`B :P@`4 2`0< 8 > <& > bH H /f * ' l [ l``$"`> "` $` @E`( l?'pl[ #\ p @JD lH 0p ?P "'p0H 0E [  l`@` @ l` @ Ŕ  l[ޒ`2` 'dH 0l`$  " @ ϐ l? $c 2 $< 8 Ph@ @` < l$@ $@2`2@Ȑ@ʒ @`4 "8@" @8 ?"8$@@ `  ,,$l( 2  l( > [   lE.< 8 2@ "@` > ["0 l "- 0")  20# @ 2@l`( @2\> [" TL A@< lP`B :P@`4 2`0 2<& < 8  l !"2``    .> [" T Al  T \@ "  \ 2  2  > [" T 3`" Te'p  > [`" ` 2`0`<& ` ` 2`0``h+   "  2 l  > `$  " l@  l? $c 2 $l@ > #|`>  ` `2 l z v \ 'h0pl|'| l \ `  1'p2 'p l@l`!2`? b 2 h` @ "   X   6 H /f * ' > Ic lO[   A'pH 00l 2  H 0Ȕd@C 2> ؐ A'pH 0R_l#`k@hl d`> + D D:` 8  Wl T?     `?'hH 0`2@`   '$@"' 4  '  /'/''l'(㏤  `$ \@``8 ې?"`8$@l``(5  ( (&'pl? @2l @Zٖ 'pH 0&p> bH l YH l!$ 2 `$@G`Ql A'pl`$  !$  H  @ l? $c !$  H   @n l? $c 2 $ lNo * Al : `! ! .` `*:  `*:> bH `> #x`dl X  d AlQm'pȀd"@ 4@"< 2! 816 !$ l H  ll> [$`2$x "x@`6 l $ > aa,  "a, > `<`0 "`0!pl@N'p@l l'h ('p@> [4  bX   l\ 8"\> [b`L @"`L@\  'p 7'l Gpl pl`"`p  !pl@'pPl 'lp > [b`D "`DȀ@#p` Ȁ`> )`8 ϐ?"`8p (> #` h`l @\Pސ> )#H > ͐"㿐  -&'P ( $  " '@_ $?# @6 $' r > [" N  > G' <  & $$ $  $ $ `  #@6 `(& (@ = `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 Q  F&& & `4 a$ `H   $ 6 $x`&x@_4 H &H  '$ R}&   44`4 a$ `H  $> [ 6 $b`x  "`x> [b`< 7 "`<@_j4 `)`a %`H /f * ' aa"   ` > [< 7`"<a &aH 0 `  O& `2`㿘 !?` #` Y`@ 2$`     <" 6 Mג  F# #  #  #  #  $# $ (# ( ,# , 0# 0 4# 4 8# 8  6  @#  > G  & & # <   & & ؔ    @& &  & ˔  ``Ŕ&`4`㿘  `,`쀤`'`  $?'> `,  8 \⠀  U$@` 〢 ?& ,   㿐> 0  `     2I  6}`܀ `4 *} 0"v x 0" !, p -  !F h *@\X "`  2\  `W>0!,*` €O.`m 8K I.`t 8E C.``h =&`h ?:&`h`h 4&`h ?1&`h`h +&`h ?(&`h`h "&`h ?&`h`h @&`h ?&`h`h"&`h = &`h`@f"  2  "`h"`h " `h  ?&`h ?ߐ &`h ? &`h"  2  8ۢ ` "#`H /` * ! ``"``"``"b`?`"&`&`H 0 ` #H /` * ! ``"``"``"b`?`"&`&`H 0 > `09)`04> # 6/.`  2) '.`# 6#.`  2 .`> # 6.` w 2 .`> # 6 .` j ".` `Q @B~`<*@ * G&`"E  >  OF 2F "`  0 * * `Ā &  " @C  `'" $   @B`" `Ā    @B`" `Ā    @B `"  " `Ā 2   @F   &`  n 4   ݢ 7 n&& 6 6  Nؔ"%" Y`2"AS`?* 2  ?VJ `9` "`@B`<" ?* 2  )VJ `#` "`@B`&" ?* 2  ` "`@Bq`" ?* 2   n  ` "`@B]`" ` "#`H /` * ! ``"``"``"b`?`"&`&`H 0 ` H H /` * ! ``"``"``"b`?`"&`&`H 0 & "#  (     @  '   "  "&`  * L)m  ހܒ 0$KO ֢ *X q! ! ʢ *JU '` "$  $ ``  JD ' `L$ >0 *` €D`mB`t@``h= `h 2 `h 2 `h2 `h2 `h2 -`@eJ ' $ `h  2  J  ' $ " `  "` `` c" I ' $ `$ >0 *` €`Ā 2 7`Ā 2 7`Ā 2   7 ``Ā 2 7`72V /2@  h`K`&   Jі( `2$ KR 7$   2VMW I ' $  `"@ *㿘 `K0`&`  `U K$Q La`   F `&`  Œ`@< `$4`  "0`   `- )'``2$@` ?&` ,`훔 햔$@` ֐ ` ,& JԐ x> )#H@'  5   5  <&@  ,4$ $,4?`6>0!*` €"/  2+ > [$$"`" ` W!(@2`0`<2`0` `  V\@"  1$"  2  ,"  2  8 ,"  2 <8 @@ 2  #> [ /'ؔܐ *"؀`  `<  `4 ؐ  '؀ " 18 <"`" ` !(@2`0`<@2`0` `  V\@  ,  ` 2 @2  6 0*  o ,` 5   *졒ƒ 54$ l ;y ,  " c 7 _4"\  2X <8 @@ "N  > [ "`" ` |!(@2`0`<@2`0` ` "2 1   ,   ` 2   2  2  1, @ Ҡ 6  , @  "? & ?4 - cH@@@ cH I 5@F 5&@cH > Ɛ"Ё㿘 G   &0  # -0+ ``"` @`> ["`""` 2`0`""`<"" `` "` ` ``"` `*  -㿘   6   , @ ]  &   5 5㿘沐 J)  ` 4 `@X*`4  j 㿐  @ +   " @Y] * ` 7 `  <c7 `   0 , 2      Jܖ0 2@ PpH 4㿘> ^"A 㿐 > ^> "Ĩ  a""`@ l'`h!2d`X (`܀@2^` `u`" : @2V` : " `8Ey "M``8 `"`(@2B``(` @2:`5沔 I  ".h"@ hd@! L]B 2 @H "'H '\! L@ "'  '`bĀ@2`h"+ h"@ h!0@! L] 2 @H] #HW|[ L@   0      > [H@> [" 0 4" 4" 0㿈 'P'T'X 'H'L h d !`  ?`#@  H  2 mI 7 .`6` u.`  6` 8&`&` t " /.` ?#H/ ( @ "`  `@ *@6`G  > [Z6`> [b`\ "`\ ܐ& (  k H㿘`  P  LG{ k pd1  0<;m9 0' `" ` 8`  ` h  ?$ h #GR| E ' "  h "@       !b㿐``  Ķ ``2 `.`><#< € "`> w" >  > ! $Z > ^bѐ `|, u` "w 9Y 2> > T" @ f $> I 0`"\ 1? 8V 1`@2 ' ܐݟ "F 1C$ 8 = > I 0`2 6 1? (/ /Y$ (+Z='`   8 (2 9    -] h> #F㿘> p> ^* b* @d"p"p$@4 4 $  t襔!t t@!t``* 4蕔 <"4 8 4@u <4 p $ $ $  $ $ $ $ $$ ( $ ,$4 $ 0@X (4 p   $$ $,,--.<.<-(.<.<.<.<.<.<.<.<.<.<.㿘 |` @!> #H讒 /  @` Ԁ@F; `"`& ?"$$` Ԁ@"@!ڐ> `F"  '>  ``"      `" $ )   ` $@ `$!`@` #`` ; BE;`Hg0HJ"&`@&``?#``Ȓ ; B;`E ` "`&  "@$ $H@ "$  ` " $$ 6 " "2 H $  6` $ $" & & $ $" & %$V h $T  "P     a -> `L `&   ` `  $` &  ?"$ $  |`" ``h!" ``H  @- ` " EO Ye̐H``   ǔ X֐`  㿘@@!>  a`|> )H'L "`|'X'P'T''H'7  # 't'p 'l7f '\ @2     ` ```'0 `8 0 8 0 `@ K   @: > #     "'x`'`"% |  'xx<`8   ̀'   ƀx $ ` \/W`@F @TޔL * *` @2` /W 2   ?#@   2    2   ?#@   2  2   2       $` ?`@ !( `"  q"!( @g ( `  e"`?#ߐ @6 $a( "a( 2 , "`  O"` ?' @@JS   @: > P#   `  N"`'p 't$ 0 ` 2 0@B @2 0 2  0t '''t' 0   D`2S`` `2 0>   ͎ x 'x> ` '! ( 0 `" D 0'`؀`2*` : @ `` "``>   c x>  ' (ͱ`2`a "a`x @`D~> Vh `'LH-`@  ʐЦ@t @p ``Ea x//` '/x7/'7 // ' ' ' '/7/ ' ' ' $'7  `h7f`2 > ax巔 (> a岔   x> a@嫔 > aT妔   o ` &``ܒ@3 ` 瀌`#\@ ۀ?"   `DՒ T@IVh > !`2 @\  "  " @2W 2` `2W 2  @  x  2W 2a "aW 4@倦#dtp#\\#`#h@a ӀѰ Vh 2 0> #( "" D 0'`ؐ J+ H o *@ g  ( @3?  #\ @8`" `H 0Q A@7n `Ā 2`Đ@;   '`đH 0}`` 2 `!x "`"`!x` "``Ȁ 2 `!t "`'`!t` "``̀ ! '`!` "````"`"`?`"'`'`'`H 0> !lVh &,>  > 2`@毓:`8 @ Lt`t$ #\tp@G    lP" " "''W  2 Vht@ &ta< "a`B ;`#`|`  `h! `H  @K  W̒t h" *&t`*&`̐"@ &&AU@24# 2 >  2`@Vlȓ:` Tѐ  @2l T 2h T L T"@ \ X" 4 4\ T  䀢 "a @ pa  #a Ԗ@&ԕ: ``@ B  ;`#`|`"  `h!"  `H  @͔   @  LCU@ LUT~   t > !```&t>  &t†t@'h L" \ X"@@ 4 `& Ԑ" & Vh` &` `耢 䀢 `L``a"@ ~`"@ y`` `"@ n`"@ i`> !d`t@|@ =xL t &&7&@ MVj`$tp& tܔ `&t& &Ԑ &> !d` `Ѐ P  `t  &ta0 ? "a0`4 " -`RS">  > 2`@ :`6hې8t ` ` KJ.H.I 0l@"@  p &  6h &Ѐ@"@Ba `ؒЖ < `ДB;`ؘ '#`Т  `?&G&ؐ `  L@ " -  *  @ |'|@0'\Ǵ !`2 L` <lT" 4&LȒ :`` aB #a#`r;`" BL  &` 6 ߠ?4tȀ`2`tȔ&t `` < B #` ;``` < B ;`#`h'h@&"'"6 6  Vh  " @`0" В@ $ +   # В : ؖ B; Ѐ `Ԁ@`t &t `#  ؒ < B; ؐA  "' L@  X" `` " $ &L&L"@ 4&L&Ll&T`/`X@" hԀ@ @񀦠h?* : `>?!*` €> !d`t@܀ = 67 86h `" `> ِ`t `ŀVh   (> `P">  > 2`@ :`*6h^8t ` `  KJ.H.I-   >&> !d`*`@( t@!̀@  8 p@ 2 t@ &t& &&$aL "aLa4 "a4` @t*@&ta8 "a8" 4  Ԁ@ @" ` E"`26nn  $ `i> n (* :`@ V6n  p2 @’̀@6n( ☐ &$ &ސt &t&0!!P`B  Vn!( '@    'lp & Vn!( @ 2Vn$& @$ :6n@& 6nVn(@&6n" ` R"`Ȳ"   >`B`;  # l@"@ 0" 4" l@"@ @244 'l 2 >  2`@Vlؓ:`  $p ͒@(Vn  H?# * 8 & " |`"  `h!"  `H  @  @   " & Sv  Sq"&  Pt" `h" *&t`*&`̐"@ && ,&Vh "$    0E/ 5 0@ >    OB>  > 2`@R:`P )6h' 6h@1>  2 :*"@ Pt*`O#  @>  2 :*"@ P^*`p` 0` @ @)` @ @"` `  2&@2 &a "a&&@&&@ 'l` ":"6Vh 42 L> ` (6- ؔ@ " $& L"  ? ' H  @7 M{D ?.D@ !h@ؐ"@ 4&2Vh`xVh` tԀZ  2Wh`Tht  > !``` &t>  &tԔ & ;`  B 8 ` |`"  `h!"  `H  @   h;ڐ  L>@ LOOi   h>-lt`&t  @ `; `"A Vh <  NtԐ `&t&Vh "    (  > " 6h6h 6h@>  2 :*"@ P8*`M   2 :*"@ P+*`  "lt  lf> *:`x   lf> * :`@  l`t s> )@ڐo> )a  ""a> !8> > !pa< :`7;,t`@&tS> )> !0> > !ha4 $`!` #\  @ 0` '#\   @ :(> )"| @`t  f> *:`x ' 0 f> * :`@  :Ր> )H > #@0> )\7#H '  y`s>?!̓*` €`2l@ "h@V h 4d@` \4 `2Z@ "V@V h 4R@ t  @& t`@8G.!K` 2E@ $` `  "7@V h 43@ t> ِ!& tl&!T)&!L %`2$@ " @V h 4@ t"& t@e@`2@ `@  2?@&`$ t@``~ $  t``@$w t$I !t ????'??  '  + &   // /'/'  //' ''/'/'' '$'Đ Д@*  2  tV h  t ;& t t $ 0 > # !t#\@]  ?@g   > > aa? "a `B :  cH > ΐ#P" X   #?쀢 ''`` Ԑ" 4""`""   "  & @ؐ Ԁ & & &  6 Ԗ ""  Ԁk  䀣'"'`쀢 `" 4 䀢"" "`쀢 $ < "`"`   `''?+ 䀢  쀢 ''`"?"`"?  $& Ĕ  "" 耢 4  &  ?  + ??"" & & 㿐 ` ` @ !"@   > !!ؖB:! `&  p > #`8 4 "  " 䀦`"@  ݀!" ؀ `" >    & `$ $ $ $ & &   p@9"> a( 8 $ $ " )> '>   ,   $  p4" " 4 @  $  &  V?  " $ $ @  $    $  $  p" @!( :$ 54 " / ژ ] $`$@  $` $` " `4$`  $    $  $  p@㸐" !( :$ $   & "  @&>  \ ! $@$` p@㑐"> a( 8 $` $`@$`$` $  & &  㿘 (V h $ `&@   #> `"& `" 4 @`;`  ?& <& ` &@&` &  "    㿘` ̀@< k &!0` ! "@" p  p&!  㿘 >  8  &> #p D D `*D*E " Ԕ ?& ` b4">  8* *`8 * 28 28(& :(8"(  2:  2:"2l`((282:<`"02j @88*`R:(88: 2l 2l2F㿐> !P | q`!t`< i` ( `\  ;"@d8$7"`W``\ `l,"> #``l""!('܀ `l"b0 @ `l "   ""@?쀦"`!t 2`lb0 @ `l * "   ""@"?aP * `45!*!*   ؀@* 8 @* t !5!(?􀊤2?쀦>  p*% t%!d %!`@! %! !h` !.  * .  8 %! %! 5 p t  ( tሀ  2 㿘 | p @ )`@: `T@@ʒګ> `@ 8 I``T@@@Ṓښ> `@ 8 I`L㿘``̀@& ``a $a0`$````p" @ @ $a `& `$a $```"@a " $a $a a  `p $a ` ` > " 2 l   ("0 l ` * (> ٔ"P쀢 * 㿐> !t` > !""   > >  |c#\    㿘>  x` #> #"a<> "`t U  " h & H> !<>  r V*`t@  X@  & H>  \>  r  V*a< t   * & H!> !t@ H* @> *`ጤ@ & DH /` * ! > !|@ `>  `B `:> ^#` 4`@`"`D` "`!*` * ` " `?@"@$`$@$```"``"```"@$`$`!`D`* @*`@ `2` x?% x` "` 4` `" >R`8 ?~ >R"`8>Ra| /> ٦ 5> ya\> !x9>  x/> ـ  5> oa\!!p->RB:!p`!t!* @*`@   :! " 2> #` 4`@`"`D` "`!*` * ` " `?@"@$`$@$```"``"```"@$`$`!`D`* @*`@ `d2` x?% x` "` 4B` `" |`8 ?~9 |"`8|.0 & 6 ሑ*` *  &    &   2 >Qb 2`@ ۓ:`a\ & a\ "`&a\& && "@$!!X x`4B % x;!XH 0㿘H /`4 * !   H 00 @>   a, 9& > `B :@  6 > ٕ*ሕ2 *` *  &    &    >Qb>  2`@  h:`H 00\> aahB:ah  6 `>   "` D*` *   "  ?"@& &&  `"  "`  "@& &  D * @*`@ `v2`> `x?"`x " 3S `" >R`8 ?}J >R"`8>Ra|>@ H 0㿘H / * ! >  |H 0㿘H /`4!\* !!\`Y > !?``> l#` 4`@`"`D`* @*``@"``@"@$`$@$```"``"```"@$`$``D*` *  `2 > `x?"`x` "` 2` `" >R`8 ?|ǐ >R"`8>Ra| 2`&!\H 0㿘    !> > !<> `*`t@ @ d > > ` *a< t T  * > !t@ * @> *`!@&H   H 000*     H2  T@? 2@ p@8 2 {{   2 HH 0 㿈\H /` * !  `ܔ{ 2 `H 0ް  @`"  `@ @"  @H 0°?` 4`@`> ` "``D*` * ` " `?@"@$`$@$```"``"```"@$`$``D`*@ *`@ `2`> `x?"`xH 0D  P`    l <2 * * @$ Ā " $ ` "` Ȁ " $ ` "` ̀ " h$ ` "` h  a h !$ h s, s`$ 4 >   `$ ,` $ 0`$ 4` $ 8`M$ 8 $ `$ $`F   ` $ H`$$ L`($ P`,$ T`0$ X$ H`$$ L`($ P`,$ T`0$ X`4$ \`8$ ``<$ d$`  /  "`( &` `    0 h!  @>H 1.`(1*  D`t D &`t`2`  2` .aK``2`.aJ&`t` `t!&`t@   &`x@  71J  ` &``P&aP`&``&`&`&`&a&`&``  '> `t  &`ta0 "a0`  `t"&`t` %> `t$&`t > !l> ٗ2``ܒ@ !, &a6`h&a,&`՗:`ː`8`"```"`Ȑ`  `p&a  ``&``2``@`V`l:`&`&`&ao&``@ $ ``Ԓ@a"@ 4&a`Ԓ&aXa`B:a`` "` 0` `" >R`8 ?z >R"`8>Ra|tv 03`(#\ ` @  0 "`9ݐ` "` 0]` `" >R`8 ?zT >R"`8>Ra|HJ > ?`B :㿐H  *   2 H 00i  ?" $  H 00Z 6 `>   "` D*` *   "  ?"@& &&  `"  "`  "@& &  D *@ *`@ `2`> `x?"`xH 0> x`B :x  / `" >R`8 ?yȐ >R"`8>Ra| 㿐H  *   2 H 00t @"  H 00i``  `6 H 00Z`6 `>   "` D*` *   "  ?"@& &&  `"  "`  "@& &  D *@ *`@ `p2`> `x?"`xH 0> `B :  /A `" >R`8 ?y8 >R"`8>Ra|,.   D T L" \ X\"@d@ h ?# @42tt$" 't> 'aX ' 't$d'ܐ 7В `#\hp "     ɿ `ܔd5 !>  `B  :ऀ "&.&&L@ǒ ° a h @`" @" h>  |c!    . `T \p  &&6&& 6`  `U 6&@&Lܐ !!࢐ 6&Pܐ ` `2**@ * c 2 &଀ #> !> ?# T* adଓ2 `*`  2  & T* * ad < &#> > ad   ࢐ 6 ܀"$࢐ 6܀$࢐ 6&@- 2ऐےdaȀ " .$ ` `8 ?x "`8>Ra| a`B : H> ) U cH ' `0    (  /.2} / 2     `  ` 2 `2  `.> G, <2`(  ,H  `<    -6(```- ``<B 7-`  2&`&`&` &` &`(@旒  U   ( `  X`%` t-` %`  V4 r5``  \ (%  `%  d%  h% $ x%  |%  %  - %  V4 r5 ( 4 $< *`* $  , > !d`$  R,  B  4,, 2 , , @A $ 2 `@#@$  @B $> al P $ L$  aА@Z @V  U T/ p/ q/ /! ` '` '`' '''`'' '$'Ĕ @    ` -3~ , , U #\@  6 `k -g  ,, U   % %5`64@<4* 2 2 - - 6"4 @P4   | U   0`5` `t-`> # -` %*`2`  `2`-- -  U   /> # `   `    <@S - #\   @ #H > ː ` ` > (  &    < `  2   `  ``  ` " ``<" > )#H'l|' @ 'h 'dt$$ t@'p@p 'pp  > !l,Tl"@ @ pp* $ p` @t $t'pt*@$t  @< "@ > ْ@Th# @l 2 Lr> !(Tn@ &Lr_ "Lr`  'h`" p "@  ̀  " $ Lr 'l @* ?  4jh  `  "`6p  4j4 $@p2`  @   'l@ ?TL "@\X"@ 4 `%@ vpt  @"jtLr 2ft@2`@ `2_t@ Yh 2Wt`? I#* 4(Ԑ" " 6Ft*  6Btt2>t 2;t" 45t "0t ",t"  4 >  2`@Tl͓:`     > )4 H@ 4j t      .> ) .> ) ( < 6t`1$  // 7~~x   ͐  @At"@A $ t   @" t J@#@%t ` 2t 2t  a"t> lP@B` "L  " " t9> $!> G@ *@` *@`'` *@  ` *` *@ F(Th B(t ""=(䀢 8 $!Ș"`B 3  :    6*  쀢 ''`" ""`@ & *@Aa  (((> ӊ 0"@ 'l ? <(`> z P"itLr  `2!`l "`l@ !`X`P =`B ;`X #`P`H`D =`B ;`H#`D (k   <    )Y( ` *  < 7'x & @ /& @*ߖ  &) 7}'x + & @ C@"= < !`h "`h "`x "`x" !`p "`p`t "`t (    <    (( ` )  < 74'x &  & & & x`2` > ΐ `&"`> ǐ p x   @  t  `@`$`2  24 "$hl 2'l` !$` '` Б=`Ȗ B`C 88Ԁ$Ҕ 2`<**` $ > ad (@t@!aD @ "aDt `  `" @t 2 , *$t!aH  "aH, T2 @?p@& ? I#* 4Ԓ"@ & 2 > 4"@` @ 8 4 , $t$YА@ @ t     /+ //  '\ /'/  ' //  ('\' ''/'/ '' '$'Ē @~  2  `" t #\\@> 6tw t "  $  " $LrLr@ 6 $*`2`?# 8"4  @K (4Lr  4 2k  $ " t `$$t  h"` 2@"@ $0  $> !l!$0$4 " h  2:@>  2`@TlÓ:`4 " 4j 2 @>  2`@Tl̩:`ݐ4 "  4j@"@ 4$  Th  L> ad  t @`"|@,|Lr `"|!a@  "a@| & (t "   xV"xR ` 2|  `t't*| m* *> #|``H `U 2'x  ?ؑ*  2 2 , ,  't, |@Nu `,   *  * *`@   2 2 2 , ,, , | H#\  @Ԛ 'xx"'dx 7xp J$ `(x|@(?B A22 tTh x 64Ft >  "-xt@8$d!@  @t`   $ t@"@ 4$tԒ $X$t $tld? 'd > )H > L 㿘!8V!:* :   `:> B  !<&V j> ِ!* ˙  񀢠x4 x>    2`@ ˋ:`V j  j`6 j㿐>  "> > #\`Ȑ ̒!   !> > #\`А#H     > ! #H !> > `#\     > !    > p>  > E` ; <"`> G`< < (>c> ڐ @TX!l@㿘 x`2 | $  2!t "   > G  <> G <  ($` > G <` `( `$`   %(``2!t&8g !t  "'`N>` @U  4 , 8?$ * 2 ( 2` 2* 2 + $ 2``3  # *4 ?,$ 0 $ 4 $ 8$  $  $ $$ ($ $l*  3 3 3 ,, , , , , @L, , ` (4 > 4* <*@< $ 4 4 $ $ , 4 x> )#H '   |`@ X T L \" " 4 !t `H@2     $/  > G <   0$ D (# <K (G  ' ' ' $'  $  $ $ $ $ $ $ $ $ * < (   $ $ (" `@4@4`$ $$` * <*@ $` $`$` ,` !I=?#44` 4` | $(\$( > 2Y> ) ` ,, , , ,    |@L4 ؓ*`2`2`, , , 4`  *@  @H{ (4`  *` * 2 2 , ,  |  "#\ |#\  @} > )@" 4 4`@44`> 4 #> , `  ( | Ϻ > )#H > 7 㿘>  t! 2&T <6 l& > !R>e6 p `6!(> !x!x  ,``` >aa> !\ > !X`&  > !T *`& t6!:& |6!86!<*`:` 6 l $ 6 l&!$&! &!d&!` h!  &!t h!> !k- s> #- t% D㿘 |V h  `@6 hF> a`  "` > a` "``<V!F 2@4 8㿘 |@I@@ t  ?& t_ ( ` !x#> `` 2` x " t$3 t & t .6$DV 㿘H / * ! > ݐ ̑H 0> a` "`㿘  ?'> ` "`$ "@$ $$6 ǷH  ?  *!J !J *!J* * !J㿘 DR`h   @`A!`3`@ 4 2aFR`j $2aFRaF "2aF4 8A 67 L   7 x`>a`"@ ` `  `` `` ` `  `?#@v t r? > #  >  " ``>  #  H`@ N@͆  %3>  1`  @W;@ 05> @ /D`+` 'a#> "  0 x`> "  A 3 @e 0 > #` #\ @0 x> )#H`>a' Ħ`  > ٬.  h  ? > b# T > #`NL> ( `' '`^ H D   !!d@캐!` @  t*@$ t >c t  !h<$!hjH$ t$!h$!l 4!p _4!r"  >c" RH G>  `' *`'ܢ   `ؖ >  @ 7` D 4H  0!,(H x`#h A 3 @H@̄   //@7 ' H AH > !0 h%> )H'@]  >c b   //'#`> > Ԓ''' #\  @/ H > s!@㿘 D0 & ` p`4 2  pO   p@2 `X ? ?  $ `㿘 D    4 $?(> )#H)>  ' %> !>  !@T!@T͔  % ?`| P>?     ( 0 8 @ H?????????@T `|`<@T at  `|`,@T `|`@T  `8@T `|`(@T @T> "0"@'aP'`> )H > ʐ!X 㿘 * 2  O   Ll|   $!\   4  㿘!\ @m !\n L&!\   㿘@TG > )\pH  '@T*`" ``"8"4  'HH "7R'L/Q/P@T $Ȓ (@/ ' ' ' ' ' ' ' $@H'@H "/'@S ('h'X '\ 'dX'`@S7h 2 * "@" >dt& "!\ ?!\@S @T #H > !h㿘> ` 2>  @"`> ` 2>  "`> ` !>  @"` > ` @Ғ $ 㿘H /` * !  t@ `H 00 & tQH 0H(> > > *`!l > "#!lH 㿘  a? 㿘 " & #>  ` & `> )cH'H /`4 t* ! t  H 0 cH7 |`3!h . p@)!p7!r* !n+ * & t'7`(!> ؠ"$  | |> `>c " (H 0cH j`*`:  6 j > 6 ja`$ "`$V!F  <T 0$6 l>  a`( "`(!8V!:* : !< : * V j> ِ!* w !<* :`@ 6 l`$>  6 l>   2`@V ld:`> #`">V j |":V jV h 6V j 4 @ `".V j " !t 4 "!t X 2!V j!t` @ɗ  //('*ܠ " V j X  $ X iWV j $  h} |!8!:* : @6!:6!8 h&!0?*  2 !&  & > !d` t 2  & t ! 8  p2 @ ( &!  t!@ &!$& & t!6 nT`"TH 0cH > j!㿘H /` * !  t@   > H 005a`, $`,!8V!:* : !< ;  * V j > > !l!," > !Ø  `0`$`0R <0ې . r. rH 0㿐H /` * !  t@ > H 00Xa`4 #`4V hD  | @`,+> >    > l> !, "@ @/`8 #\ #`8 x  ?  8>  > 2`@3:`g0 >  > 2`@':`[ 8H 00<`"<ْ  > !l!,"@ @ >  > 2`@ޓ:` P0H 0H0 ,@h\D` Xȝ㿐 `  `  @@- V     H /`4`* !`  ` `8 " H 0` `Ԑ0  D h`d.`>g"@ € _ 8@J [ ` " `T` 2` x4``M D h!@)3Dڔ? >   h!@)! Ȓ  ,  )4 h  D   2  2  "  "  2 > 2 >?#@2 > `< @8 '}   >  @(֒ 瀤 @*"! < 8 '\ а  >  a ƀ l  t $ x 7` `T4`/5>  > > ِ "ȕ2`!,@  4 h:` 8 $ $ $!$ &$  -@ h!|0~`  08@ |0`  v or `0gi 5d`&HH 0n `H 2`` @"R `!2N  !D  H  D #&  !E>*@ !D :,!D``"@``" 4 `* 70`  , r $ , r h!@+   h!@+"   > Ŋ!  `  ,:`  ՞ H 0㿘 H /`4`* !`  H 0 6 Ѐ D`  @` ` / @{ H 00i  Y *>'S *"P  (L ` t D$ t ?A$ t"?  (: `$5  p@41 /4 p"-  () T h 4%  t$2! `"$ $ "  8T h  $  ` t$ $$ t ;$ t*d 0&  ' " "  t *"  *  "@ p "@ "@ t $"@H 0㿘` > `T  > > > !/ !> `  `H 2 2`h` ? ?4`` 7 4` h!  "at 㿘 |V h` @   T  |  -1= L@  㿘V h`>g"*` €6 h  6 h V h  |-u`@V h  >  > 2`@:` PX> )#H'   @ H   @"  " Hဢ   В @A  @A    H /`4* !ဢ   `>  1> ' ' `" `D"  `@ `2   5H 0AH!> aa "a`>     > '  I ` `@  ?'`@`'?''H 0"&@g"H > C!㿈` ?`>g"*` € > ْ !\|   u  > J!k   c   [ > ْ m!dR1> ! ' b 2F!@&> #H  2:&!1> ! ' G 2+!@ >    2&! `  > !Ȕ -! >   *#\!ȔZL`LˈxT̈\DTLLLLLL㿘> "D>  p㿘@@!> <> )cH 'L'P'T'X'"<'H    2  '|   0  /   /Ѹ  `@ R   @:> O!   `Ӓ<`  <` e"`` "< $x R  ?#"@4 " <` A"` " `' ' ' ' '`@ 2  2 ?#@"    ?#@2 $<`   "` `@?a <  (`" ("  @;Ҕ* `87`<` "`-` ,< $` ?a <``("`("`H @(* `7`<`"H# @6 $<`( "`(`  "` > #``9> #d`6` 3 " dH    2 <` "`  > pTђ`"T  2@  Hр0/@  //@7  @'//`7 'А@  //@7 @?G @//`7 @?;   <  8  >  '  􀦠>  p p h!h!2`U (܀@2>`@2"8, ,0  ,4 ,8 ,@Y  ` @2z"(   $ ( @:  ` ` @2[<@@2V`L沔 Z  D0?`h@`@ h@]| `h"`@ h|,˒`@| L, 2`@V| <P<`   "` * L`@ "'|  '|@` " `pP`<` v"`0?`h@`@ h@]>| `h"`@ h|זv`@| L+ I<`@* L;`@# > @ p` '  p'@`& ( 0 " D 0&؀I :<$ @ ` "$> ` pk  > '` p (*< "  c` " 7`  @Dk H' '  '  '  ' 7`H  H o *@ g  ( @  є#\x @ _x`" H 00U@ `P @@ A Ā 2ѐ@   &đH 00` 2 !x ""`!x` "`Ȁ 2 !t "&!t` "`̀ ! &!` "``"`"?"&&&H 0'|h0?@@ h@\| %h"@ h| h"|` | 2   !,Ԗ $<@| L*x <@)` L@ H  H`  "` | HH > ǐ!Ё㿘 @2 8 @); L @    @)0 @> )#H>p' Ȁ`ƨ ` 2H@ 2H ? > #    > " `H @` '`'`  '` '` '`''Ȑ@<% H "`  @'   // ''' ' @/'  `@'`'`'` '`'` ''Ē@; RH`C@ J@  А@   //``'` '`'`'@/' @;Ŗ &H  #> ~`p@ @H#\#``p@"qH> > #\#` p @"d H > ܐ!㿐>p`Z ` V@ R` N L> ِ h. ?򀢠 > #  0< 2  *  > #`> #``> #d`"  2 @ 0> ' ' p `@   ƀ0>  p  㿀'T'X'H'L'P h ! > n!?`#@  ( (  8} 8H /` * ! r H 00d ` 9   2 J 7 @` .` 6`  8> &`  (&` >6`  < 6`6` $/` 7 $` 3 *``2`  2* 22  + 2`3 ?# 8#6`6`6` t> .` m<.`,`", ܔ H' ( @` 0g $ 8H 0㿘 `   h! @#{ 5/ ``2 `.`>l!4 €  H /` * ! > `pH 0` > > "$('!    h!> !k. s> #. tH /`4 h* ! h! @ؔ~H 0ŀ  h!") (   8   $   (  H /` * ! @H 0`  8H /` * ! JH 0` %"{  h!" (     $  ( d 9H /`4 h* ! h!  > "`"`` $ ,`$ 8`$ 0$ 4$ 8H 0  ?>6 & ;  h!@;O4%@2$  h!@!0 %  h!@!@ )   - -> " zu㿘H o*@ aP H 0㿐' @  " `0 > R! >  < ˚ 4   *#\> ِ",㿘@ "   ݒ  2&  7& !(& (  `B <    @ ; B `/I< 0* @@ ``@2} @2`@2`!* @݀@ "> 4"h > [e  >@2a > "`> [" !x> l@Ho  "`> @%b A  @9   D L H /f * '  @ `& 0 &  2" && &H 0 㿐> "'L'P'T'X`'Hr0 B / x /㿐> "'H'L'P'T`]'X@ 7 W   &  `B >  @ ; B >` ``*`*`@ * ` 222.` .` .`.` @ *  @ ے s ``*`*`@ * ` 22`2.`.`.`.`.` `q*  "@0T. ** @ *`@ "* " \@ "& `"@6` "& @6` `@ \*`6` D> [`"  r H /f * ' `` @ ``&`` A0 & ` 2" &@`&` &`H 0㿘> J!p !"l` @2"`"h`@2"`"`@2"`Y "Y (2"` \ "` 2"l 㿘`    *0 > "> ט"㿘`    *> א"㿘ך㿘> #` '> k $c b $ c     ,   ?& 2  @  &   @ > #8   @    @@ @ @ 㿘 l@ ` lp  l @ `;#@ b  (! l?#8@8G dE L&@ (=H /` * ! @6H 0 2$@j$ ! !$ $,! $ $@{,!> #L   $:< $ $ (  '@ 㿘%>   * @  2!2@!@ 2p> )#H> ٦c ' d   * @ '!2 `" $ 2  $ 2 ! !@Ƕ 2  @!$@ǯ    2! 4HА@  /В * @ $H!2 `" $ 2  $ 2 ! !@ 2 !% "H  2!H > "㿘` !x "< @ 4 !| "1 @ ) !p "& @  " !!t " @w " ! !@5 0 2  \!@. 0    㿐#> b` d+ ` 2 b* @  !2  $ 2  !@ 2 #\    2!㿐#> c\ `+ `  c* @  !2  $ 2  !$@В 2 #\  ]   2!X!> " > "06@ @> # @",`   `` 2`*` ` @ " > " )> '> %>   "Ѐ`}`` 㿘> "` * > # $ b,`@ ``#@@       ##@b㿘 $  @ @ 㿘 $$   ̀@@ @㿘 $  @ $ & $㿘 $$   ̀@@  $ ;& $㿘!> # K-$# XE* # K  X>* #   KX7*  1> 3> ;5> "*@ !  !* @$%@`2b  ! ! * $ %`2   !$ !ڐ * $ $`2 (""Y Kb KY&"&bY K&㿘H /` * ! > "'> ـ`)> !> # K  Wϑ* #$b`*` KWȔ #$`*` KW %#!  !%> b+ @ b > c* *   bV x!b+  &" !n * !$& "!e #* > +& "D> D; $;bPH 0㿘> "`f! D!H *  b*  2 #> " !$)> '> #> ٠!$)> '> " !2"!& b*  2  " " !2 "! #*  2  "  2 "@7& ?$H 0㿘 K W" &""&"&!!&"&" " &"> +`D`D: > >x`Đ (ɔ>x` @Ĕ>xa8 X>xah p㿘   @& s! ( @ X p?`"`&""@"""!2"?`"`&""@""""2" ?  Ā`"`&""@""":" 2 $ {]~& $|zx! "!@&!! "!x@&!!x "!|@ &!x!| "!p@&!|!p "!t@&!p!t "!@&!t! " '6! `" ` ""`  ``""`W K㿘> > "bh@ .`2 @` `@*@     @?    >   >   > @   `  3`` ""`?`""`"`"`"``"` "`  `` ""`?`""`"`"`"``"` "㿈#> c' `  `" *` ` !>  * $c>  #\c*` . 㿐 ``  1>  '@$ # " "  `?2  2   2      㿘 `4  > V #  ) ? & W 㿘H o *@ a     > +D D`$;  ;`#`$H 0㿘H o *@ a     > +D D`$; * ;`#`$H 0㿘@@2  V ` @   > "H> )\H''t &    ?&@ܒ 4@ؒ x@Ԓ  , 0`,`< /&   4,   l    g   b //y//x'| '   24 @ l  J  E0@?4'^  Y  4,   3   -,  (  //x/y/ @0@0 (  24* @ .  .  004,R20#\&#`S  A`"8`  8 ?"8 AS  `?"8 2  A`>{"*` € A }  "   a ?0 >   b >  "  b @  2 a  a  " h  d 2  l 2   p 2   t 2  't  $   Ā` "`" Ȓ? "$ $ $ ` "  ?2 `2&@l | 2 &#> ـ <bP  bP2#  ( @2 Ā` | @K 2 Đ 0#\     H Ā`"  "` "b Ȓ? "$ $ $   < bP 4bP` -``> + D D:`< ` |  0#d#\#`    $ $ " $ "" "b&#\#` "`ƀ   &` |t   `@X  ?Ԓ |Ғ"P  Հ` |a$@Ēa$ 2C a@2>  "  a|`"6  "1  "  ax`")  $ "$  Ā` "`" Ȓ? "$ $ $ $ b $ b"@'b&#\#`%> @2  Đ$` |@q $ "C  Ā`"  "` "b Ȕ? "@$ $ Ȑ  < $ > "P @ )"P`  "``> + D D:`< ` |  0#`#\   J  $ $ " $ "" "b "%   0 =&  7& 2?ꀥ` |t   `@ #& ?ꀢ ` |t   `@v #\#`&@ & > )#H > ]#xP  ? & _  2 @ D 0''  8 Rʘ  "  Ā` "`" Ȓ? "& & @  ̀`"  "`> ""\ В? "& &  " q " k " e "> _> "Pc > bH?"bH㿐> c  !>  "c> c"P#\ ؔ   "P#! 2 "     2& . . . &  & > bX bX& X "`А "`"XX& А@㿘 0 (@(`(`0(`1(`}(`a% 0f 0`0`2 8? ` (< `  > 0` < 0` @  `<(`0`B(`@(`4(`|(` `80`D(`` 8 `d (E `0`0`2 ,1> ` 0" `  4< ` 8  `  ` ` $ `  ( `$ >0`* <0`, @ " (`( (` `8 `< `@ `D `H `L `P `T0`\(`X(`4(`|0`Z(`` , `h 0 `l 4 `p 8 `t  ` ` $ ` ( `㿘  `"  "`> ""d ? "& &  >  ` "`" ? "& & > !}㿘 " @@  2@ p  $  >  c  !>  "c> c!#\    !#!  % `>bk 0 ,` ,`!,`P,`Q   "P4`"ϐ!4`"4`R ,`$ 4,`T | ' ' ' ' ' '' ?$`( $`( 8$`X | ' ' ' ' ' '' ? $`, $`, <$`\ ,`0 @,``  ">  4`2 B4`b 4`4 D4`d4`R ,`$ 4,`T | ' ' ' ' ' '' > $`( $`,$`0 $`4$`X$`\$``$`d $`( $`, $`0 $`4 8$`X <$`\ @$`` D$`d | ' ' ' ' ' 'h' > $`8$`< $`@$ $`D$`h$`l$`p$`t $`8 $`< $`@ $$`D H$`h L$`l P$`p T$`t (,`H X,`x X ">  *4`J Z4`z ,4`L \4`|Y > #tL$`> ْb```$``""`$` `$` "& $``@ݘ㾨\> )` H '`; `?7  ?& `? 8` `? 8 ` `?  `Ā 2 `  $` 7` ( `2`? ۔`a ࢀ@?a$|@a$ ?`Đ0#\ଚ ఘ  쀤ؐ?`Đ `> `a ࢀ@> a$|@a$ > `Đ0#\ଚ ఘ n Ȁ> `Ĕ"P "P@8`2> + > +DD:; `Ę  0#\#`  Ɛ | ?`Ę | `+?& `  cH਀ q`Ā #> "P @ 1"P> +  +DD:; `ĔH `Ě0#d#\#`|6 H#d#`#\ 2   < N਀`"KcH`@F &CcH `  8 %?`Ā  Ȕ  $` 7`Ę | ` &?& ?  $   2ਐ u& $  , ( !!  cH > #> `"  22 㿘> # `` , 2 > c` ! "` <0!@@! 㿐> # 'H'L'P'T`'X  ,  H>  `" 0H@ 㿐> #`"#  2   cB(  (  D2    > 0  / *`*  2 /#H  c`"0'  h2   c(   (`"(0  t c` "`2    > 0B  @  2> 0  *`*  2 / @  2 0 * *`@ *  * 22 2 ` ,,,** , *`@  * 222,,,,#  ">  \ 2; > # `"6 J (> I 0`". a(2&`` ""`  ` 2 ` @d"  ` 2  `@ϔ  "Wc  䀤``2a( c" :` B3  ;` > 0 > [" > !x -#D > ["   ΐH /f * '   @ `$ c`  "` H 00,c$`"$0%&   2" $ $  $  > *lHo  "`> @bH 0㿈  ?a 2 `/`"]a0a%  > a( a  > ,`",&,    < * @ *@@ $ > 4  4 , a($ a $ 4 ``   ,     4    )2 /, 4  /@ ,  2a%a 2 a%a 2a%a > a% > a, a0 a4 a8  > ,`",& 7 & ??   ? ? ?@2* * ? ?  ? ? ?@** (j  2  > c` 7 "`& `,, , ,  > ؐ?ؑ* 2 2 , ,  ㏒a$,   @'  a @' ` ` ) W , % ( O )2 /,  @ / *  *`@*  *  2 2 2 , ,,  , > &c`( / 3"`(> #``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` # ?ؒB;   "   㿘> # J㿘`    *0> p˜#   > # q 00> #@> #$> )  H'L`'P'T'X'# 'H  , 2   ` # cH #@`$#@cH  `  #@ ` 2 "  `"cH  В#@` "`к@ @   2``` 0$    ///S/  N   ///B/  =#@ $#@ #@  @ :C  8 %  4 @6   > Ր @   !"6 > "p`%b``"bbd "b`\ A  @ 2bbd@ 2b`H `b`2b``2 `D#@`H"5cH  ݖ  &  a( # & (``B >`H /f * ' "5H 0 #@`"cH > * 㿐a%   > a   > a% `@ > `` (@  @`"   `   2 `> @`"ϰ 70' ` 4`  @4` $` ?$` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 8$`8  6 ```<$`, ` 3` > $`$@$` @ `(#  ; B8(a    B/`<* @ *@@ $`> 4  # a, , , 4 4 4 a($ a $$ ` a `*@*`*`*`*``> ؐ?ؑ* 2 2 *`*` *`a"`a"`a"` a"`$a,"`a0"` a4"`a8"` /4/ & 㿘`    *0> n#$  > #@ o 0`> )#H' 2 3> cp`, "`,> > c`( "`(`` "`  20 3> cp "cp> cА "c 3> #(` 3 l> #,` l2  > #0`2  "  2֐ 2Ԁ 3> ` "` 3 l` Z  А` Q'ĐТ@ /р  0 /А  =0 /А  5@$˔ 0 2 3> cp2> > cВ`` "` .H /` * ! Ē 2 $H 0j 2 3> cp2> > cВ`` "` `!`H 0N 2 3> cp`4 "`4> > c`0 "`0``$ "`$j @2 H 0*> cp`\  V"`\   lH 0 2 3> cp2> > cВ`` "`9 > I#&   ̀@2# > +DD:< '  ܐ ' $` " #[Ȓ~ @  ̐ ' $d" #NȒ~ p `H p@H >  8> )#H> +'DD :a >`a`2`3> cp2> > cВ``  "`   Z 2 `2`3> cp  "cp> > cА "c` "` 7    `*`4 @ 4 4  9/ " p`2`3> cp "cp> > cА "c` "` aA  aD` aA   F`2`3> cp )I " '5`2`3> cp "cp> > cА "c` |"` (aA aH aL  aP aT ВaH@  aA   `2`3> cp2a ' ( 2 `2`3> cp "cp> > cА "c` "` "@*` 2`2`** c ; ) " `2`3> cp "cp> > cА  "c` "` AaA  aD` aA   `2O`3> Pcp )2Wa " '`2`3> cp "cp> > cА "c` "` (aA aH aL  aP aT ВaH@  aA  "aK`2`3> cp> > c`L "`L``< "`< a l) $ [  a+`2`3> cp  "cp> > cА "c` "`   a *` `$ H`2`3` "` $6 ` " a (2a   6 aʔ?Ő`$ > I  6 # `B ;    @  D;`B ; ` ''  @'X `302`3`l`20) 0&@&@"@f`l`20 0@L@Ŕ @ .H >  0㿐` @ ` > #p l `   *#\> ِ#4k1 㿐` @ ` > #Д kޚ X   *#\> ِ#Hk  㿐` @ ` >   k H   *#\> ِ#Tj 㿐'L'P'T'X'H   3 㿘> ["H /f * '  @>  `""H 0% 7&  2" "" "> lHo  "`> @ bH 0 㿘 `  @  @ 3㿐'L'P'T'X'H   2 㿘> ["H /f * '  @> p `""H 0% 7&  2" "" "> lHo  "`> @ bH 0 㿐'L'P'T'X'H   l/ 㿘> ["H /f * '  @>  `""H 0)% 7&  2" "" "> lHo  "`> @ YbH 0 x> )#H' dHa> #`]H2` 2XH2`a'R <@̒   //'H H /* ! f  $ " 7> +H 0(H5>  $ @ H 0HD$@   $! ~ H p> )#H''\cH@i Р  '//@_  //'ԑH /`* !    2 /#+> +)> ! 22%  $` 2  !@ 2 !$@ 2 @I"  `D$ #  $! ~C ` 㿘 `  @   2㿐@ '3 () @ (  `'>  @  3 *  * 4@x  > cа! "c@ $@@@  !㿐'D 'Hi2 >  > > ߠc!> ! D 4%> H 6 ``B >` "D"0`0B:`0* @*`@*` DH>   `B :D 㿐@ '3 () @ (  `'>  @  3 *  * 4@ࠐ  > cp! "cpb@ $@@@ ; !㿘{㿐@ '3 () @ (  `'>  @ Ӗ 3 *  * 4@PȐ  > `! "`!@ $@@@  !㿘:㿀a 2 > #(`3l> #,` l2`> #0`` 2`$R A a  ``̀@#> +D'D:>````$` '`@<x```$ '`p/x|2`a " " ( h " 7 ` * 2 a   0`$@+``% a ``@2`a a  aa aa "p`a@   "j`   "Ű 7  @  `4`*`@4` 4`  '  ( " 7 ?ؐ#@( @ ?ؑ*  2 2 ,,  䀢` "   䀢 "'a 䀢 '䀥"`$  ϒ  2 s 7 ` 4``$@ &`$``2a @d``2a @[W  "  4a  @ -, (   3 < 2$  + <a2a < <  < + "  [ * @  a l2``   "@@  > D`"D@ ``@ 㿐> +DD`$;  $>`> #``H> cd Dcd  q  L  22a 22 > ?22cp`X "`Xa  " 0#  2`$"!`$ * `'?ؐ#@ ?ؑ* 2  2 **`$@ "   *CE `$ @   $c  a35   a *` `$ b``"aa   ?a          #\    @MG  a2"`3?09?06`$( #`$a  2 `" ` `$   ?D  a " (0 㿘H /` * !   )> +'>  D&@ 㔔  )#H ? '"  E ",>  " >   >   >  ">   >   >  "|!8 !\ !> "!!!` *| `8x & `  $ @6!*`2 6! `"`>!h*` €> ">  ">  "> #> # > ڔ#@ @"& K   & &!d`&!h L6 * >ԑ2 &!`Z @ђ $  '''* ''   L 6 * >2 &!\: @ $ @ * ''''   @P #H > yΐ 㿘!\ " !`@ !\@9 L&!\!` @ !`@/ L&!`@P   > 㿐`$` `a a ` `  "@` "a ?@" a> p`l"   4`$@21   aadah@    " 00 I> cp`  "`@ް <> cp`(  "`( ##`# ; B>` > """ : #p 8@ B ; 8`$"`$``@8`$``@ @' w `$! ``@8` ``@ @`$ ~&`$ `  2 @R `p0 0 L=   `Ԑ@Rp`P 7 l"`P$ ,<" "@" ""@"a\"`4*  " "@J 0 < >! $0$@$ $4` <$8$ ($ $`a$a , ,@$@ " $`a%@ $``$ @` a a '  8* a` '`  $` $`a`$``* $`@ @Q `> )`8 `4cH '`(`$`, L>@R)> cp`P  @"`PH /` * ! @` ` 2 `,>ǒ L> cp`  "`  #@` L> cp` "``,   "  @`0  > L> cp`$  "`$ U >} L  .$@*Đu Ē dh@  >   cp >  Y 0 cp`  "`cp`(  "`(@Q$@    > #p`"#pH 00j2    25  "0% @ *! ( "@   " "@% $ "   2$  " "@%  $"  Ӑ "$  "@%    "@ > #p `" H 00$@2Ȁ> #p `" H 01( ɐ` ʐ \H 0HH 0  @PH > w!㿀> I# ```B <    ; @  DB < @ϒ a `''$'(' D a `$@a " @`@$   > cp 0 $ 0a  @?@#@  H ( P$ Hp` . H"` p`# ; B>` `@# ; B;`@`$ !``@8`$``@ @ ߐp `$! ``@8  ``@ @w`$ ~&`$   "    X @ $  "   X" 沔    `p`*%pٰ 7"$@#   2 `p 7 %p`~ `$@ad'`&ad` p`W @` 2`$ 7@   ,@  &_*u  2/ 〦 2 @O ȐCp4@`<'  " ' ' a%@' `$ @ 4ala}a a 6   @ 8* a &   ' ' a`' `* ' `< 0 L:o  2 `@Oap`P 7 1"`Paa$,    >"( $` $`0$`@$`8$`4`<`$ "@$ "$$a\$`* $`$ @@ @M㿘 4 8 L;ܐ@O > cp`P  f"`PH /` * ! @` ` 2  ,; L> cp`  <"`  #  @ < H 0@M4; L> cp` "` ,; L@Nِ $ @! " !lYH 0H 0ݐ@N` #dd#``2+   "@ : ( # " @ > p  0 2>  ( # p(  (#㿘`/    "  *      2     !    섒  2&k 0 &  &   $   h> )  cH'"$> "> > L > H > > > "" " # # > #@> #`#  ` $  &!d& & &!h  L6 * 82 &!\ {Ȑ@ $   *'''@JY cH > t!㿘!\ @ !\:~ L&!\@J   > X> )#H`'`q H &> cа 7 "c ,,4  44 {  @` `>  ` 6! "9  *  $ `4 `&    5 `.  ?  # >  ܒ> & @-    ( 2 '> А`W" (/  ``/ "7€`   `   `7Ѐ``ѐ ``ѐ   ` ѐ  7Ґ  ((߰  ؐ L7   > А`"̰ 7 ( آ (  `+"K `<` 0 @  * 6%> @2*  *  А`$Ѐ 9a L   `>  / А`$Ѐ m9J Ly  * & @QN@ 2K %?????@ @ @ 22+ ?'? '?'?'*  ( А&Ԓ & ؔ (& ܖ& ''')'. * 8 L> А`L"  T`+   ( 8Ғ L H > rR!㿐`$!`'D   a "3 `$2/ D  aadah:  >   " >  D 7D`"0 70  7D`" 0*`? > $ D`"$0D> ` `""B>``# 8""@ B ; 8`$ !``@8`$``@ @ג 'D뷰 0v`$!``@ ``@ @`$ ~&`$@K  D뚰 7#Т <0"  "" L"a\"` * " 6f 2  D~ 7@KW#`P 8"`P 0D  @ D>  8Da   '7 L@K9D `>$ $ 0D"h$ 4$ @`a$ 8< ` & (a. & $& & ,@I@> )#H'84 (` $ , L7Đ@K> c`P  "`PH /` * !  ۰ 2  ,7 L> c`  "`  #@  c` "` ,@JÐ$@    @t 0 @q  7b L> c`  "`. 싔  R 쀖7F L  /$@,`>  dhȚ  >   c> y 7RN c` 7 o"`c`  7 i"` T > #В`"#БH 0md  2   Β   ;4   *# (콒"    `" "@$`& 쭒"   2& `" "@$`&" @ @   "@&  `"@$`_H 0#HH 0`#H@I#H > p!0㿀> I#```B <``` @ ; `DB <` 'D@Β a  ` '@`D ''Df> # ,`$ ,ad 2`$a  `$@ Dİ   X$ `$@  a  2DD? c  騰 (`H ;"`H顰 .` 4"` `# D; B>```@# ; B;`@`$ !``@8`$``@ @ Ds 0 `$!D``@  ``@  @{`$ ~&`$D  $  "   X" 沔 !   `а 7`D:$0"'D$@4 D   2  D( 7А $ВD긔  ?2 , 4 `> $ D ܖ`$@ad$ `&adPŒ @I  DD 7  `<""`""a\"`* "`$@  00 L3Ȕ  2 `$D 7@H`P q"`P @D 3D i 0a  " 3 2 1  7D ꆖ 4 !  7D v 3* 0D/m Da    5+ L@Ho0*/D YD `>$` $`0D!$`4$`@` <`$`8$ ($ $`a$a , `$ @@ @G㿘 8 4 0 ( L4@H7> c`P  e"`PH /` * !   2  ,4Ւ L> c`  ;"`  #``@ <`H 0@Fϐ34 L> c` "` ,`$ @ܒ 4 L@GpH p@H 0@Gΐ㿘"   @      > )#H     p/G/F'/E@ @ 6p @  6*@ ?( @ `* @*`` @-`@-o @G@-k F@-g   `@-HH $(PT@$,  `!p@.  @-G ,*  E@-> '@@?'@` @ ` `< @:`'@```2@`@@- `@  ?x?pp't |'x'' @ `=``0?'``4 'd`8?'h`<  'l? ? ?@2@" `7b@ `2``@  @  6 ```'pdh'tl'x'|``2`0` ,*  @,Ô `p @  j*@ ?( @ H > m!H0.#> )cH* ' N ` @,@,’@, p@, @@, @,cH > l!`x> )#H' ؐʖ @R     H > l!x > )cH'H /`4 * ! `Զ p@   "#`@d D!( @ 't' 2  !( <@ 6F  @€ " @ <@ 4! @ @ @ ``  '`6=!(  <`?@$ "  t   "//6 t @A 2o` ` ~$` D@$`@ 't@!( 'x' 1  !(<  2K`"` 4!2`@ D't`!( '| 1  !(<~ `>#a$`$` D@ɐ't@ 'x`!( '|'1}  ` $`!( <]`  @`@,``23@H 0#H > kɐ!㿐> >  ( 'X'H'L'P'Th`B     ; (< 8 `h`?  2%  `(`T 2`(`B :#h `" > > a ڔ 0 aՐ  > t!  `(`B :#h m`> a  0 > a  > !0 V> `.` `$#h8`B :8 H`> a  0 > a  >  "02> u 2 `( `B 3: && @*  "`((`B :(#h `> a h 0 > ab  > "(`0> !0  "@& @ 㿐>  (>  h` B  : ̐0  h`" `B :  > a)  > !w`0> t!䱐0 " `B : >  a > !0\ > Y!䖐0o  @`$@ $꥖   $@:> "@   2   (8`B :8h I> a ֔ 0> > aА > "X> !04@ $ @& *  "h ((`B :( > a  0 > a  > "x`0> !10 @ " &  @ !㿈  `h `T T`!<82 bc<  `? 2bb" b`  `2b`瀢`> `\ A A(H`B p:H ݐ``B<` ` ; B<`@2  >  ( 0`B ; 0`B<`> #t`P> a 8`0@> "2` B> `` >  ( @`B ; @`B<`> #t`.>  a`0> ""h@@  2#c`T \h>  ( @`B ; @`B<`> #t` >  a`0> "D> A!~0{'*"@ *`" *  *  & `: *"@ *`" *  `* ' ' : ' "/> W U @ 4 `耢@ `쀢@@ `@ ;f@ C @   / 0+#p` @ `0 `@ ʐ`@ Đc* @@ '쀢@0@0@ے㿘`   ? >  ( T}    > ّ. #h So *㿘> .!@ "> ` "`> #|㿘#H -  I$b$b @G ?  $c,b  5$b$c $c- < > $b 4b $c@$@`0>  ?a>!>>`̖Ԙ    %$ax4`\$at$ap,`h,`i,`j$`l$a$a:$bh`D   /  㿘! -Y  >1 $`$`$`a`d$!>`4!d`L!d"   $` $@"$`&"&"`"@@ 2@@ $@@" "@$`" &" 㿘 @!@b.ǒ 5.Ē 㿘"  d d 4d L 㿘" @ ~?"&"* "@ @ t?&"@   \ 6 \@Ȓ @`H /f4 T* ' T % "|`" TL ( T"` T""b"$ "?""&"&" ?  $  T[  T"`T.a & TH 0㿘 T " 㿘" " &".C  2&"&"㿘`h`l@`h `h   㿘> I 0``T`"` `h "`@ "` \ A A2"@ " 2 \``2`T㿘"    2@ 2 H> )#H '`T ``B <`H /`4b* !b     -"@*`" * c*  ' : 'c  <`<` (X `B h`B  > a `0> a > "L> I!``bB  <`$bbb* @ 2$b@ ޒ $bbb* @ & $bb  $b@ ͒?$b "c c8 ?$c8c8 2c @ݐ?$c8c  ކ  2 `> `B <`(h`B :h Lb x4 ($$$ @$ x  `- x p,,@   /`T  0 @       (,,,'Ȓw $a 2s$cD $ ($@y* 2 2 , , `ؒ$` L`  B`C > <`<` (` `B <`#\  b@8# 7 7> h`B  > a 4`0> a/ > #~> {!``bB  <`$bbb* @ 2$b@  $bbb* @ & $bb  $b@?$b$cDH 0 H4a?H > e#㿐H /`4 * !    `2   < T"`'Sy>#  2H 0㿘H /`4 * !   %>  `2   T 0 @[ #  2H 0㿘#'`(#,.#Ṷ`/ ##(/`#+``* (@`  6 &(&&6 & 6 &(&&6& 6 &&( &6&㿘# / "�> ٘  2 + #0 �ch ` > a & 0#0> a  #0> o#(> l!㿘 # #"#4 "0 y@#4#0, "& "    `p& ?   2   T"` &   㿘# &"`"( #4 "$ ;@#4#0, " "    ` v&    㿘2` "1  \ A A2("#`""!" 2 p@  2" `( ""`@  " 2 \ 㿘#? #D  "`\ 0pX 㿘# "`@ `? 㿈  T? ; 7  2!&   #  @ #沐 bޕ  " В"  2&   D  z+  B<  㿘  # ($   #  ``#4    @ `  @ #0 *@ @ `? 㿘   (> #@  00#@d  #   " ِ $#8@   > (x`B :x㿘" @` 㿐 `T 2 `\`\ 4`\@ 0    c 2bc  b  `@ 4`\ 4`\ `dd 0`    "E 0W@  Q  0J_  *"@ *`c" *  *@ *  '  : `'?$c8``` Lc 4 " c  4r^}c  Li^t0*"@ *`" * c *  ' : ' T^_㿘"?c* "   ,  2 @ "_ "*  $4 "$?`"`"""@@ `2$@㿘 T @  ` V`\@2`h 1  `T`  ',   7͒  (Ӓ 0$` $@$`@.   T "## 6 # @ `v( 0r# `@Y  `( t0b2&`T$ T`T@ " ""`& " 2#2 $"`"$"`"@ #``$"""b"#`$$"` #`# 2 \#  \ 4 \@OH /f * ' `(>< F$"|@uH 0  \ ?4 \ 㿘  ! `T !p ".!p c 2.!p .!p ^    .!r.!t.!w.!u.!|!~.!q.!s!p} 0!p@m 㿘"` "aҐ@`"a"aq@   "`"` 2 ""d?@2""`ap}є "@  !  `}Ò  }@ @I  㿘  ` ??@    2``0 2 ``2@#&#<# C#<< 8 &#)&# > ["` ` 2`0` `h 22#"""@  T&" 6"# @#  #   \ 6 \@  㿘`  T \ 2#@ђ #  \ 6 \ ^ > [""   @"0 `h "0R`\"0a(!(@2 0`,( 20 " 02  `"  @ . 1 1 2( T "$ 1# 2  T@  "# T `&# \ 6 \@u "x 2   $>H EM&"x 㿐#<< 8 " '\    "4 &" , ,   7㿘`  T` > ` > ` >  \ 2# @2 # k \ f6 \> !`( `#  ` ` (`0 `  ""h " P\2`" `2߄ `  T`"` ` @2 1 2, T "( 1# 2 `@$ "`? ? " T#  &#  T  #  \ 6 \@ƒ   h> )#H'В @"< X   ///77ؐ@c̠ ,@  X ' 7'/7ؒ'@O 2&"@b` $ ` "`"$`$ ` "`"`$`" #H > _#h> )#H>'`0` ! @ 6  @"F @" 6`1@2@ -`!@ "$ !@"! 0@K@Ѱ `    /`\> 4\㔔&&B\`4\`  2`\  4\$\ 4\ @$ ܐ` א\`4\1!V ͐`Xz Ő`O\  ؐ\ İ  2$<8 $<j #H``!X   0[`@    ` F@`@Ґ #HЀ  ~ $?@3 `   &`@`z    `[ ,Ԓzޔ  P  3 K`X @KT``0\@r ` l`+@ `+ `* @`' /0!V 2<z <'yq @$@}   @ʔ`@``@  '#H > ^+#@`"2 @"+bb "'b    @@ 2 @""  2 2 b`Ԁ@ 㾐> )#H`' e"Ē` @f ]@!   T` , `T 2J `4 `  @ 2 @4`t .`t:  #  .`tk@x     "" 2`4 @ 2 - @-  $ @f  H > ]~#㿘> c@2 "  @( 2  a@2a`  @2  ` ?"`  2㿘   \ A A㿘#D " T` # 2ap  ap  3㿘" @ 㿘 \  `  " "> #t@ ; >  aM 0 >  Ga > ْc.`+ @@ >  #> ! #t@   > >  a, 0> ِ 'a> ٖ㤑.` + >  p#> m!&  `` , k , k, kO㿘  9 > ٪#h/> )> '> %> @b㨀 "* ` `"`"``$ ` @ 2` ` ! ڔ 0@ Ւ@# 0>  !  2 ` @`` 4 㿘 h 4 T / T `k "`\  \ 6 \,  &" 2" " &" ?" 2 T㿈TV  4P!    `E h$@ $ @   @~  2`wڒ@ $" $%@x a1 2 `""`?"$$"M G㿈 T)  f` C"h @=  2  @6  2  / #@``2@`"  4 xa2 @`"``"``?@"$@$`! 0v㾀> ) T cH`'+#H`0'`4$`8$#@`< $ ?  wJax a2`"  "` "@$ $!ɒ #@ 2 #H > [F 0 h> )#H'  >  > ##cH& & &!h $@~  @'Ȓ@1] cH > [ H㿘@1   > 㿘` @4   00>  LÔ  % <" >" ""#`,@ "  " $ 4$ @$ $ 0` l< $ 8`a#@#`(#`$`+` w, @3g Թ@4> ``@ 7 "`@㿐 8 4 ( $ L!9@4}> ``@  "`@H /` * !  % 2 ! L> ``  "` `#  ; B<`> "  :   (@ B ; (`$ ``@8`$``@   L @tr `$!" ,``@8 , ``@ @t\`$ ~$`$ ,  #``@ <`H 0@2Ӑ  L` "`t ,  L $  @ $ϒ b 7 2ਰ  V$  /c   5?1$ @ *! ( Q"@   " "@$$ C"   2$ " "@$ $"  v5  ?$ $@3Շ  H 00H 0Ӣ@3{㿈> I#`D ` @}z a `'`D 'p > `  $ a  "  0 ?# @$`0?`#@ l 8 ( $ 8e` . "`# ; B>`  0# ; B< 0`$ !``@8`$``@ @sZ ƪ; `$! ``@8  ``@ @sB`$ ~&`$   "    X  $  "   X" 沔 ۖ   ``$@ 7"$@@2  2 <. "  0"@"" " L"   `$`(a$@,` au:` >  $ 4$ @$ $ 0$ 8`@1j<  Ҽ@2`@ 7 "`@㿘84 ( " L<@2> ``@  "`@H /` * !  ( 2 , L> ``  n"`  #``@<`H 0@1e L> `` "`O, L$@@25ܿH 00G :  2  > `` 7 -"` @|%`4  a   > ` l , *  l ,* ` . "`@1܆H 00H 0 @1㿘@`(`(`.  @` `(`(`.  ``` (` (` .  `` ` (`(`. 3 ` > X?> X??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `> X?> X??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `> X?> X??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐ސ *  '* @ ?"@"` "`"`"`"`  "` " `􀠠> `X`@?`2  c@ 2`(`2`@@2, @2 @2  @2 2`* c` 2@ @ ` * *`@3 @3 @ - * @3 @ @ `> >  X`X c-+`@  @ > + (, X @@ -(  !> >  X,X,  `+,` > X@ -  `> `X . .`.@@> @X. `!> -` X@'@@  '`'`y'` h>`'D) /`-` *  +`(( @ . @+@(`@/  @D/`@@`@`@` @'P@@@M'2`665 . .5 6'Ԑ #@45 '̪#c4@42`(2`# `@+ c. @  `.`( (@̪ D@@@ @ @ @@@5> 1 X0`(7> 5`X5` '0`* 3`0``> Xc3`'@1  #@3` # ` 7> ܆ 'X(5`. (@ *1 DDc ``. @ @D@+  @@ ''D['2`6`9>  X(@?5  #(@ %?@?@#@D7`(@ 5 #@ `4P(@1 @/` 1 1 4/@/`/`@#D5 @(@@ 2` @(@@@5`P5`5` /`/`/`/`@D2`@4(#@2`@@  (@@P@0`/ 0`0`/ / / @ D@` @@@3`/ 3`/ 3`/ / 㿀>`'D, /`+` *  ((@. (`@ @+ ) / /` D@@D@` 'P@@J'5 (22 #2 466. *`4 65 c4 5 # . @+c .`(@ @(@D@@@D@ `@ @@4 9>  X(;> 0``X3`'3`1 *  c> 1  0`X3`#'. 1  # ` 9>   X4 (` . @(0`@*@4 D Dc @ @ @  @+'D  @` 'D`'7> 2X(?@4 @ (@5 @#@7`D%?(?@# (25 @#P4 @/@@4 4 /`/`/` 4@(D@0@ 2 #@(@@@3`@3`P3`/`/`/`/` D`5 4(#6@@ @ (@P1 / 1 1 / / / @ D@` @@@0`/ 0`/ 0`/ / 㿘l   &&  ?㿘 ]  u 2?& & ?㿘 { 㿘  H;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `` o@h &@ @b`@?` op㿀;> )cH'D'`2*@`*2*2222 ///////*2@ `? @" / @?> ِ'c D   . . 2 .  . @v XcH > Rϐ X< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@kq @r  @m @ @@@& k]@㿀;> )cH'D'`2*@`*2*2222 ///////*2@ `? @" /@> ِ'c D   . . 2 .  .   8`X8@8`8`8`8` 8`(8`08`88`@8`H8`PcH > O H<'D (. .`&D @0( 1 ) @ 0(5`-` @ 0(5- Ć0( 0`(` Ȅ@ 0(5- @̆0(1 ) Є@0(5`-` @Ԇ0( 5- ؄ 0( 0`(` ܆@0( 5- @0(1 ) @0(5`-` @0(5- 0(0`(` @ 0( 5- @0(1 )  )@3a6 . 5`-` @-@ 0(5-  -0(0`(`  (@@ 0( 5-  @-0( 1 )  )Є@0( 5`-` @-@0(5-  -0(0`(`  (@@0(5-  @-0( 1 )  )@0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0(5-  @-0( 1 )  8@ 0( 5`-` @3zc6 . 5- 50( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5 0( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5Є0(0`(` 1@0(5- 5@0( 1 ) 5@0(5`-` 0@0(5-  (@3# `܆0( 0`(`  -@0( 5-  @)0(1 )  -@@0(5`-` @-0(5-  (@ 0(0`(`  -@0( 5-  @) 0(1 )  -@@0( 5`-` @-0(5-  (@0(0`(`  -@0(5-  @) 0(1 )  -@@0(5`-` @-І0(5-  (@ #܄0( 0`(` 5@3*T aN0( 5- 1@ 0(1 ) 5@@0(5`-` 5@܄0( 5- 0@Ԇ0(0`(` 5@6 . 5- 1@0( 1 ) 5@@0( 5`-` 5@ 0(5- 0@ 0( 0`(` 5Ą@ 0( 5- 1@؆ 0(1 ) 5@@ 0( 5`-` 5@І0(5- 0@0(0`(` 5@6.5- 'D'''    1@3(c0(1 ) 5@@ 0( 5`-` 5@0( 5- 0@ 0( 0`(` 5@0( 5- 1@0(1 ) 5@@ 0(5`-` 5Ȅ@0(5- 0@0(0`(` 5@0(5- 1@0(1 ) 5@@ 0( 5`-` 5@0(5- 0@0(0`(` 5@ 0( 5- 1@0(1 )  -@@3ta$0( 5`-` @- 0( 5-  (@ 0(0`(`  -@0(5-  @) 0( 1 )  -@@0(5`-` @-0( 5-  (@0( 0`(`  -@ 0(5-  @)0(1 )  -@@ 0( 5`-` @-0(5-  (@Ȇ0(0`(`  -@0(5-  @)0( 1 )  -@@0( 5`-` 0@3\b0( 5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@0(5`-` 0@ 0(5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@ 0( 5`-` 0@0(5- 50(0`(` 1@3\ b0( 5- 5@ 0( 1 ) 5Ȇ@0(5`-` 0@ 0(5-  -ذ3]b6 . 0`(`  (@І@0(5-  @-0(1 )  )@0( 5`-` @-@Ą0(5-  - 0(0`(`  (@@6 . 5-  @- 0(1 )  )@ 0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0( 5-  @-܆0( 1 )  )԰@6 . 5`-` @-@ 0(5-  -0(0`(` @0(5- @0(1 ) @ 0( 5`-` @0( 5- 0( 0`(` @ 0(5- @0(1 ) @0(5`-` @0(5-  0( 0`(` @ 0(5- @0(1 ) @ 0(5`-` @Ć0( 5- 0( 0`(` @0( 5- D    D@D@&&&& &> )#H'c/ @   @ 0`(`@ @7`/` @  @`1 @)    0`(`@ @7 / ` @1 )  @@  ` 6.  7 / @  @` 7`/`@@ 6. @ @ `@0`(`  7`/`@  @`@ 1 ) @@ 0`(` @  @`7  /    1 ) @ 6.`  @7 /  @ @ @ `$7`/`  6.@  @`(@ 0`(`@@ 7`/` @ @ `,@1 )   0`(`@  @`0 7 / @@ 1 )  @  `46.  7 / @  @`87` /`@@ @ 6. @  0`(`@`<3 @ + @  7`/`  1 ) '`(@`8@ `$@`< ` ``@ `0`@(` @ @ 5`5 -`-@ @7  / $`$`@`,@@ ` 1 ) @ 6@.@ 3`+`@ 7 / $`   @`0`7` /`@@@ 6. @ @ 2`4@0`(`*)z#`  @@ @7`/`  3 @1 ) +  @@ `8@` @ 0`(` ` )#H@ > @w H;j&. 0㉘ `va  " : "" " " 㿘 + 3` .@ `?C @ ?>  @" `  \d  ?` @ ? @  `  &\@㿈> )#H` '  % *@a,@   > `> ` `  aa>   cH   ? @" *`2 .   ?cH > ? 㿘  > !\=  P@c @  > @㿘> P   22 **@2*`, ` `@. .`.3 3 + + 3 +  @ @  @ "`Ȑ  ``( @(@1 ) 1 22 ) **@@2*0`0`@(`(`1 0` ` ,  3> ,`+`@ `@/`@3 + 3 + @3 @+  @  @ @@  `?%@ @  @ $$$$$ $$$㿘7 @*2@ `?"2 @" `P! `P [c @, B> @@&& P ?" @bB > @`@?  P[F @.B> @㿘 6`@*2@ 2`?`P`P *@ 8  P 8"@ @b@`@?P @"@ @b@@b 8`@@b 8 .`P`@>`ِ[ @b Ё㿘  >  Z @ P@br   > @> H 'D P'@??'`?`? ?в`( D?0D?`8?` Ի0й(`@ `+` ` 3 6.7 '`(І '0  + Ї5`- `.*.' (0  ?3@@@ @ ?Ц -`,@4   @ /  @й,Ȗ?@  @   ,, - @@D   E ?6 > ,6.@ @Ȕ?E   +`4,3@й2?Ȳ   *@ ع6`/`E@  @ @ @ B @@@E??E@????@`?C'   '( ?(@ ?ԡ+ *24`6. (0+,`4  34 ,` * ,`Ԡ 3, 2`2`4`4`, @ *  , 2`@@+*`2  2 2` Ժ@ -*  @ 3 @ иȺ@?  ,,@ @D4?@ D @ @ F ,*@> @) @C@ B ?@6F,6Ȗ 4`?@   F3 ?ȵ,+`؆  *4`2,@@F?@@   @  @@@E??E??@ O&<@D@C@DB (@АBȺ@GDF08@FD@<8<<<<< <(<0㿘e @*2@ `@2 "  "`P X @,  @  B > @ @8  H2 @ D(@ H`B > H@& P`P  @dB > @ @ 8 2 H D#8 H`B > H` PX @. @  B > @ @8  H  D H`B > H㿘 @*2@ 2` P *@ p  P p"@ @` HP "@ @_@_ ~  H P@_ p . P H @> > 㿘  ȐXc @@_ڒ Ё㿘  >  pXV @ P@_͒   > @> H㿘@㿘  X< 0@_ Ё㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`㿘> `U H*`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H', 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  V *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?G 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐 ;*(*`*@ + +` @ @ ?ђ?000000 ........ @ .( ɴ(+ (*`  **    ? 000000........@ .(㿘``) `((`@ #3+3> 83> /`83 #> @8@` > `8/ +(`@`( @&@D@#@3+33c. 3 @. H#&3+33c. 3 @. L@ #3+33c. 3 @. P#3+33c. 3 @. T@#&3+33c. 3 @. X#3+33c. 3 @. \@#3+33c. 3 @. ` #&3+33c. 3 @. d@$#3+33c. 3 @. h(#3+3. 3@c3 . l@,# 3+33(c@3# (  ^p0#3+33c. 3 @. t@4#3+33c. 3 @. x8#&3+3. 3@c3 . |@<#3+33(c@3# ( 1 1 1 0`0`0`/ // / / / / / 㿘@`) `.``(((``@. `@`@ > > !> c#> | <'6.6a866c!8@. !8a8@. x8'&6.666c@. @. t@4'6.6. 6c@6@. p0'.666(c6@#@( @l ,'&6.6!8.`66a8!8@a8. @ h('6.666c@(#.@ d@$'6.666c@(#.@ ` ' 6.666c@(#.@ \@'6.666c@(#.@ X'6.666c@(#.@ T@' 6.666c@(#.@ P'6.666c@(#.@ L@ '6.666c@(#.@ H' 6.666c@(#.@ D@'6.6(6c@6#.@ @'.666(c@6#(@ @0`*0`0`1 1 1 *******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'> 8> > 88'Ąd„ > ׅ(!8. > г7`7`ȳ.`@2 (7 8('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%> ߤ8܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3> 000(a8@> 86  #6 /`+6 #> +`!8 + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%> 80(. 0* *`67` 7` > c7 !8 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A> ޱ. .`((8$%> ձ. ˳.`χ((87> . ڶ8޳.`( (> ϱ. г.`Շ((!8@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘> !8  !Z l,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`.@@7`?.@@0` ̄3.@@7`?.@@0`UUU.@0`@(`7`/``@> 8!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`> 8!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU. @1 ?. @0` ̄3. @1 ?. @0`ð. @$$㿘0`(`7`/``@> 8!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3> 8!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$> X * ``( > X ` `(  㿘> ڢ 8 @]     ` 㿘>  4`" א ? " ? *` @  *  @*   *`*@  * 0`#@ @ ,`) 33@ @ @4`(`@ @ 4`@@ 0`UUU@ @ ,`@1 ? @ @,`@ 0`@ @ ,`?@c`c@ *@  > <#X 3 c 2> ڸ$'!%  @  - `) (`1 0`) (`1 0` @ 1 1  < 1 1  1 1  `1 @ 0@ 8@0`0` `<*(" ?`? * + 0`0` 0#( `0` +`@  &*`  @@ @ ? @,`4 @ &@4 , ` &@  ` 㿘4㿐 + *`   *   **`  *  * 0c@ @*` 0)?#@ @*` 0' ̦3@ @*` 0%?@ @*` 0#UUaU@ @*` ?`?0@ @*` 0@ @*` 0@ @*` 0@ @*` 0@ @*` 000000.`.`.`.`.`.`.@.`㿐>  `?  H /f * ' >   C> >  `+  *  * `1  2. '` @ * `2 2 ?,  *`* @ *`*  `  8    ő+ ?, " ? , H 0" * * @`€'     @ < "H 0㿘>  ` = > @ 5 H /4*`* '*` *  `* @`  ?"`` €` `  @L H 0㿘H /f * ' > `   %  l"혔 > ڀ` " % H 0y?  *@ *`@ @L*`   >    ` 2   ` 2 ` L    M.  . H 0I?* , lS    H 07?!> ڕ* * *Dʒ *` *  * @L;@ , @ *`* % "`ޒ l$ H 00*"H 00H 0?> @`> + H(+` > څ( ( x   " ( ( ࠅH 㿘>  `> . H() @> څ((   &@(( H 㿘 H /f * ' >  >  `  . * * @ .`@  . H 02 `"@ `    *`"`* * ` @KR ` ` `* `"H 0 㿘H /f * '   >   +  > ڑ* ` * `"H 0 > "p  >ଔ  & 0@z 㿘> "p  >  &s 0@  㿘 "a  d [ H /f * ' >   >  > ښ  a(x "  ࠀ "   * `  +  & @QH 0  * > ` * & `B : & @4H 0 㿐 "  @ } H /f4 <* ' <  >  2  & ,@H 0^ >   5* *  *  ` `?`#`_ ' <` " `B ; ` ;  B`;`  ?2& ,    #& ,@H 0 㿘 $H /f * '  <`" > !> `4& <C! <`2`4>  CH 0㿐H /f * ' '>  !> > cX #\ H  A  > > !c`#\ 8  A  $ B8 H 0' H 0 @I H'> B @I 8 <$ 4&  #p$ > "bp㿘 0  & 0 @@0 > p `@ $ 㿘> p `d $ך 㿘> $/ > @* > > (.((@ ࠀx  .`/@``.`." T\p  > )#H'0#e ( @   #g#i@ #f@ H@0#h@ϰ H`>"X*` €> !8> !\> !> !> !>  !>  "> "4> "X> ڠ"|  @H $Ȳ@H $ &*`'' @h  @ d &  L 隑: ' ?: R2'#  * ''  @  &  L t: ̒'Ԕ?: , > !( `?א ̚  ::;`#\#l#h#p@#t 2`N  & / " LԀ 'H L#H@ @@@ @ @_ H > $C#x㿘`?#  )    "#  @JR ! ! X@G   p&  t&  \&  l X&  &@Gߒ L` "` h"@  @  @& 2     <4 մ  < X` >` ˀ  $`$$ $ <$ @* $`    ?$ `$$ $ $$ (* $` X>$ $ 4$ @ $ 8< ``    ,   >   `?  $ $   $"`  $  `$ `" $`  De $ D  >   $ 0+  > ڑ* ` *  `  " $ 0€ $ , $ 0H /f4 0* ' 0   %>  ;  0`H 0! x 2 , 2`` X>F`  ``   >; D א X@ 鈒 L㿘 8 , x" ,`# %  & 0㿘 㿘     `>"*` € 2  2  2   L  珐 h >$ ( #4 @ $4$d$   @\#@   " @ 2   L b$" 6  @ = 9 `F ->  n $ ",@ 2   $@ =~   ` % $, "Ò L,輒 L   -㿘 (?`"`$ "@""@ 2蘒 L& ( >      㿐0#d@1  L Ȑ &@&`&` n L0 2` 2 > ڐ!""`(&, ?",`0?"`0`, `0㿘Y  2  " ? 2 "  ""   "@ "`  "  "`"  㿘`  LX  / 7`4`, @ & (\& $h& <l& & p& @t& & > Ғ0 㿘A  $ " < L < "ے Lؒ L㿘 `> #D[6> > #DT ` `2 DK#Ѐ@ :&@ %> `2 D@"=&  㿘 `>  D$6> >  (D ` `2 D H@ :&@ %> `2 D h"@=I&  `    @   &  `2 ??* ""?㿘`>  CȒ >  C’5> `` @ &C,`  @6&@$ %>  @ &C,`  "@   @ Ҵ& `    ||   DP\ht$04@(hhhhhh44h4hhlllllÈÈÈÈÈlÈÈôÈÈÈllX> )` cH '   @F 1 2 !   "㾀> )#H'?` :[  @`W` `4` "C?`1>!ē*` € `€:2`` ``€ `2 ``€ `€ 2  D`` k :`  H > " 㿐` l k     ; "    l 2&`;   /& L  $  "@?" ?&?  + @` :"`" "`Œ l 㿘 }`{> !,`#> a0 :,` " ,a0  ,`2,`a02,,`a0 $a0 * $a0a0 l* ܔ  ,a0 2 $a0$a0 @MI 7  a029P*,u l$,,,@`7&  lᷔ  $@?`>"*` €> !8> !\> !> !>  !>  !> "> "4> ڰ"|`  :`  " > ">  ">  "> #> # > ڰ#@  lk "` `   l` "` ` #> '> @  6*@ ` & : &`  €``* ` 2  `   : "`* 2a @  j*@ ` & : &`  €``* ` 2  `   : "`* 2 @  \*@ ` & : &` Z> #`> ڰ#  l "` ` ` &  l: ڔ "``  ` & : "` ` :8O`  €``` *  2   € > #> ڰ#  l॔ "`  "А  @ " > #"` @  @"` `͠ 㿘> !0@  > !,`.`@O `L   a,"`:>"X*` €  1 `@ -   @?W`  l  " `   @?H`  l  " @?>  l   " lޒ la, 2  㿘 2 <f  Z  4 U> !0    > !,*   K& , 0    !, : `    1  2  * ?`$>"*` € 4  4 & ,`4 4Z  & , & $ & ,`4`!,A 8 #> ڀ $a4> ="8@> \ >>>a4'"`'''''''''''''''''''㿘a 㿘Y 㿘  lt  &  @?㿘@>f  l&㿘Q 㿘! G 㿘 l B!&l `f` ``a 6 @?㿘@>+!֒ l&㿘8 㿘d 㿘 l   H.&6 㿘@>`Hఒ l& 㿘$ 㿘 㿘 l ߐ &] 㿘@=ڒ  l&㿘脒㿘ꐒ㿘 l ޼ (&W 㿘 ,` " `@=! l[`` @= (R l&㿘m 㿘^ 㿘 l މ!.=&  @?㿘@={!& l&㿘 5  @=m 㿀> )   #H`'`.   ?  @   *@ !7  @  .@   $@ cH > t#㿘  l/!*&B  $!@? 5  @?㿘@=!ƒ l&㿐5 #в `+ 3` +3 ?#@< !˔ 㿀> )#H#Т' @  + (@ ű Ť @  .@ (@   @ *  +  #А .#А@< H > #㿘 㿘 㿘 @ l? l ݑ#.&D6 :`@ != 㿘@<#- l&㿘. 2 㿘.W2 㿘.=2 㿘.l2 㿘.ܑ2 㿘.̕2 㿘@ 㿘@ " Ȧ@<4 0XP "? 6">>a@!d'''' '̔  l,` % T "@ .`   l,` % T"@  $   PT''>   > ے  #\?    2e,`* ْ  Ւ  T̀ ؀`2܀`K`I lɔ  C&'& &`'ܰ  lܹ  2&Sb # @ 4+@@ l@L&@ $4@ l@@& ` @ 2@&  &/ l` @   $ 㿘6  ld 㿘 l㿘     *@  (*@  @ @@  @ ,@,@  @=  ( ..  @  ` @+@  `+`  + `+ @ `    *`@ * @ @    +  +   * *    (@ `@ * `  +  +   * *P> )#H'@ Xóÿ X & 3Q& @:Œ @ 3G  6* ``?$ ÎÚ @@: @cH > ݐ#㿘ÈP> )#H'ï@: @`3`X  \* ``?$ Zf @b Ð@:s @H > #P> )#H'@ `#2 `X & 2֔& @:J @ 2̐  6* ``?$   @@:3 @cH > b#㿘P> )#H'@: @`2``  \* ``?$ ʐٔ @Ք @9 @H > '#ЁP> )#H'@ ' А% &!2[&!@9ϒ @!2Q  6* ``?$ ɔ @@9 @cH > #㿘ַP> )#H'@9 @a2`Т  \* ``?$ ΐ֕ @֑ ɒ@9} @H > #*` `  @>  ` `* 2  ` `  ` ` @  *`  㿘#6` @  ,`2ѐ@ ,2ɐ @ . 6 * . 2 㿘   & }c&&  } > +`D"X& ,㿘 0@9}S & 㿘%#> +  @ & ,`D@ ΐ " 㿘> ` 1>  "`ΐ!ِ!㿈a"@  o6.  ' "  "`"@"`"`  o6 ?#\  @ `     ' 7  6X  \H /'̐ Д z  +   'Ȗ "  "`"@!?# ``  'Ȓ` "` "В# `   " "В   `  'Ȓ` "` ,@,`4`$`> *а^Ȁ > 9!ۀ` e " "В Д  ̀` W  ` %` 0 w  <$$ @8 <1> "` $$ $ $ $ $ $ 8$ $ 4   'Ȓ` @`'$$m 沖  o'В   h' `!'Ԓ> `!88F̀ "'Ȁ !@''''#\̔ؖȘ İ # R$ ܀ ׀ Ҁ@̀ >  8c!hĀ` > 8[!) <   ]   ' 7> ! 8E``    ? Ȁ`' `''@`zù o5Ё㿘` ? (  p    ( `2    & /"㿘   "    `   Ŗ.@&$ 㿘 -   "  " " " " "㿘  ’  2    "  &@.@ .` .` .`Y  X"   'P   > 5!  2  6`$ " @b P@Q  `P%Җ o'%PȖ e@PȀ@" @ 0S@]OF0KC0H%% "PJPP%@P "@ <`P`'`> <>  H 0`> B  H; 0 @3˕=`  @`=`a:` :`@4?> # `\'`Ȁ X? `B D`a; ; @3  2%`Ȓ@Q "  8" 8@ $ 8@ " ` 8 $ 8Đ``Ȩ  = `B  @3D   @ "  8"   8 $ 8@Œ J' %@@8  <` b @    %`$$  @@ $  8  $ 8 8 > 4Ԑ!w ` W @ "@&. -`> H`$`B :`  @ "C  8"2  H 8 $ 8@c  H$ " @ 8    6 !`  2 P'@z<``>  6!    `4@0    X` `` "> 4\!` 2 <> 0  "<> 4O! K ඀  ?D4`$" @b@P3"`඀  $ @` ) $ =`` 6` "  ``@ B 2 ` a   8h$ 8 "$ $  $`7> ܀`@ H H`B ; H`@2=  ` ? @`%8 !:` :` @2g  @Ę B<ඔ4` B 2`(`` B<   @   B 8  2  (   @ @ 6  P($ 4 }  Pk y `@ 8@ $ $ $ $     &   @   $  $ 8  @ $  $ X"`$ 0^ 8   8 $ 8@G^@Fm 8 ?$ 8$ 4 "`0!  8`$ 8$ 4@rq `` '`    `2`T 㿘 X"`$ @"! 2 5>  @:,  +` "    r 㿘 X " $ @ >  !*` )>  4  `"  `  @9 " 7  `4   @9ٔ  ? 4 ?4     䀤` ? 4 ?4   㿘> #`!> > "t"x@ >  8@>  8@ & 8> & "|  & $ "@" "x`#"x   > HH `B :Hh  8''Ȃ @ &`&`+&` x D2 P* @ &`*  8?Ѐ >`> H@`B :@&`@Y> HXȒ`B ':X&`@Z 8@")>  D P&`''&`<  S> o< x!> 2`* @  H 8> GH8`*` C H@`B < 8;H>`;8@Y ``&  D |"@ * $   @8 P @2&  D& `8 @ 4 L@> P )> 2"  #   > >`Hh> GH8B>H`0C `;hB 8H88 `@X3"@  8& <(& 8Ȩ H x> G PH04, @ @@` D  ` PC = P;@;0%@&`, 'ԑ= 8B >`  @'Ѐ`&`'̐ ' 8@ & 8̖@Y0d  ̀   8`& 8@E60 8 & 8@Dl 8@*@& 8  % 8 ! H /d * % iH 0 8 Ȁ "` 8$& 8" &  8(& 8&& < 6& & ``& H@CXH /d * % -H 0H> b> )#H'> I2 +> /> 1> 37> 5> 3 0Ѐ +> /> 1> 37> 5> 3   \  2   > 0"` 0)2/b  I "> 0"0a2 "> 0"- `72s "> 0" "> 0x#a'1P@13  / , $2Q > 0_#p@1 ?'//!&"@l "> 0J#3'1ΐ㸐) cH >  2# 㻐> )#H'@ >  #@j >  1&ab  >  01@0iO :.` K.  * . H >   X 㿈 ϐ '` "` #a b$$ $  "@  o$ 4?#\b'  >`  U  %'   > 3 > 34c$>" '> 4"> 3a5 'k '> 1 h H "h b㿀> 3"> 3#  '@0p "@5 a#\b   ) Y' '+쒒 '#' 耢  '@0    &..> 0ʐ  㿈#ab   2@0% '( ?#\b  @ `  H` #    $ '  (M 0 H㿘N> `f >0>#p`?-m4㿈>    $ ( 0ƀ 8`>   ,>  4 #\ a(#` #d ƀ 㿘N> `f >0>"`?-C܁㿈> V !8   ƀ `> !(!$!`! ;`#\!!!ƀ!> !8ƀ!`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   V`V "`@<)  &` &`&` &@6$ $$@ 㿘 " V`V "`@< & 㿘 "V`V "`@;   "  20   " " "     2 0   " "  `H> )#H>'`0`b%> ۦ1'@7dl  E  k `&:> #  &+OH@@ "@D NJ0> !%" @* & @& > !0aM$ `p `0@;C    < 2 @ & < @ & @  $$ 4  " ?> > > !Ȓaؖ+ $ u& H > "㿘> "`` ``D > O"`@ )  2<> "8+|   $  > 0 `@YȐŻ ג   4 ` `㿘 > b`  D > "h  @ & 2X> "8+?#> "Y`r` "  Ґ> %"$ 0> #H+> /> 3> 1> 5` ({(@; 2o ` `B$  F $ ND 0J@@8      "0@2@   $$@2@  "  $$ @  " $ Ɛ`  `$ $ 2( > > ې "cH" ː` `  * 2 H:q"0l㿘 <  $ '> %> '> ۀ%> 2? "& І ( 8 21 `> ۠ #> `& В b =m ``  ?& ( $(2?"&ͤ 0 2 h <`@ 4$ " @  2  , `@  " "  @  2  0 >T` 0    2_ > "$`8> "$`8$`<  ?????????????ː> ۨ > #H` #H>> #l+ ->  (  2 " p $ """ """"" ("$(H $`$ Ԑ 㾰> )$#H'' ''>'  "    ' @7՘$ n$ ' H  $  H@/5   H@/, "/' & 逦 H   @ "  ' @7$ 0$"x    @ " @7Ք  0 '  @ " ' @7i$  $ #\ @;\ "0  $ @.  @. "' & o Hy  @: q  ! @( 2 `<       @( 2,`<       @@(z 2,( ე¬ $   @.R  \@.G "J'  &  H  @:+@= "cH > I"؁ 㾰> )cH ``$` ` `@'''''>'  "  ` ' @6$ X$@ ' H`  $`  H@-   H@- "~' &`  H   @ "` ' @6K$ $ !, `    @ " @6  ~ ~ ' #\ @:% )(`  $` @-  @-} "~' D&` < H: I  $``   @-T`  D T @-E "~H'  &`  H  "`   D T@<@97#H > B" @> )cH$     ''''''>  "  ` ' @5 @ ' H  $  H@,   H@,ך "}' &  HƖ   @ "` ' @5B v  #  (  @ " @5  0\ '( @`' @<   @ "` ' @5 4@`g  @ "` ' @4 @'`N'  @ "$ ' @4Θ }E :?# @@>  /', D@2'4 D@2'8  D :?H D@"'T'X D@'\*`" *  * '`'`#\ @8 0  $ @+  @+ "|' &  HӖ    O  ` @ @ # 8H  $ @+   x @+ "|' & n H p H?L?2`< &  X`$0`<    @%j  ޅo  $  @+:  D x @+* "|-'  &  H   @6   D@:e@7> )#H >  " `> ) ``$` ` @ cH'L''H'X'`'d?  "   '`X` @3^t oLt )X` H  $`  HH@*\ L  HH@*\L "H{'LH &` ̀ HB X  `@ " '`X` @3t 0Lt  ` X  `@ " `X@3]  L0 '`X  `@ "'`X` @2t L{h t 4 ? $ H H'\`  $` @*F L @*=L "H{@'LH &` V H˖  `p'#\#`''#dh@5Xp` d  x.p 3`  $` @)Ld   X @)L "Hz'LH &`  H"~ @5֔xw Up> H_ (x@$ @ X % %  X$  ے $``  d @)Ld`  `DX`2 X@)L "Hz'LH  &`  H% @5{x d@9  @5n@5ix  D@8Ɛ@5wcH > # 㾈> )cH $    ''''''>  "  ` ' @1 X@ ' H  $  H@)    H@) "z' & ـ H   @ "` ' @1  c    @ " @1  y Ȗ '#\ @5\ 0  $ @(  @( "y' & t H  @4   <`  "   w   xǖ($$ '    ?''$'''''ܑ  ۋ  yk $  @(R   \ @(B "yE'  &  H!   @4#    $%  "@ "@3@7r ""H > /# 㾀 > ) $cH'     'H' 'p'L'P'''''?'  "   ' @0h  ( H   ' H  H@'Ț H  H@' "x' P"@  ! H    @ " ' @0) j      @ " @0f  0P '    @ " ' @/ 8     @ " ' @/٘    @ "' @/ x8     @@4 `'.  H  ' H  H@'  'H  H@'' x' P"@  a H` #\H @3u ' <`   `   ! @ L   @ @ LL ' (  ,  ?`E , ,,& '    H @&  `P`dH@& "w' P"@  ဦ H    d@5Ő> b$'T@5 H'D m `}@``$@ ` uY a  vv($ $`-   "` 1>  L#(|@` $@   @$$  $ ` "`:`"`"`"` <×   L  ' "v0+" 0@1`%@4  @ "@@@1h%@   @$> "> "$$2 '    H @% H @% "v' P"@   H @1 > )#H > #8 `> ) @``$``cH'L' ' ''''''&`>  "   ' @-  ' H`  %`  H@%C   H@%: "v=' &`  H   @ " ' @- V `   @ " @-  0< ' $  @ " ' @-s $    '    @ "' @-Q uȰ :   `.* `  "@ " " ` "`" " `" #"@"   2@@ʰ #\ @1  L׉' <`   `   L@c  `3( .8 &`&@ "" "2     &`>`&`&`&`y> `HbhB:bh L:c " %``   @$`  `L``2 @# "t' &` ` H_  !@/  @3/      > *#0#0    D@3@/˒3 %``   @#  @# "t' &`  H   @/[( > )#H > #H 㽈> )#H $ ``  ''T' ''P'`'h'l',?  "    'h`h @+ݘ lT )` H  $  HP@#<d T  HP@#3dT "Pt6'TP &  H. `  h@ "(` 'hh @+ -T   `  h@ " h`@+ܔ  T0 'h`  h@ "$` 'hh @+p T 4 ? $ H (  $ P@"ʚd T P@"dT "Ps'TP &  H"   h`','0#` '8#\#d@-`l  ؔկ  ' =@  $P @"|dTl   xP @"mdT "Psp'TP & D Hh ؖ @.*pl ] Y ]l S`  h@ "$ 'h @*Ę ST "     q'@ m'@ * T@1 ,! `  h@ "` 'h @* "T t   'D ?'@  h@ "$ 'h @*s Tr Ǡ,> ґ2 a <@'@ '@@ /` 'D``  `    :?`  @``!-,x > H</ ( l Ö ``@  '@@ !,: ,<> H (,՞ $ X \': 0> H<ߐ ( $ ; ??# @'0','4'8 <> H ( $  "> H (0@@; fE` $  P@! d T  P@!dT "Pr'TP & ۀ H ٰ n <> Hx (,15a> H<k (V,`0d?   @Κ  `ΐ?`   l@ @X %@ %`X$` Ӹl    l@*2  2 ӡp' $ lPd @ oTl`  `DT`2 xPd@ YT "Pq\'TP & 0 HT l  2 $@/> b" " @,,@+p3  @/ D@/~@,/&  ",, " > H< (4@ H  B> )#H > #X 㽘> )cH$    ''\''X'h'p't'4?  "    'php @(P =\  )h H  $  HX@l \  HX@l\ "Xp'\X & ŀ H h  p@ "(h 'pp @( \    h  p@ " ph@(O  \0 'ph  p@ "$h 'pp @' \  4 ? $ H 'X  $ @=l \ @4l\ "Xp7'\X & S H"   ph'4'8#` '@#\#d@*` % 2h  $ @l \ x@l\ "Xo'\X &  H"V  @*xSK   p@ "$ 'p @'O <\ > ې aؑ* @` ` H-D> H7 ( \cH\@.4  &h  p@ "$'p @' \o  ?c *   *` '  `'H$ 34 L > HD (E `4 D> Hڐ ($w4$0 4$  8# ? # @'8'4'<'@> HD ( 2 8@@ $ g $F x@ @ X % %  X$  HHx s $  l @ \l @ܚ\ "Xn'\X  &  HD 2 $@-#> b" "1 H@)@)&  "4&4 " $ > HD* ($ǒ4 @  ې  > )#H > #h > )cH $    ''L 'H'X'`'d?  "   '`X` @%t oLt )X H  $  HH@C\ L  HH@:\L "Hn='LH &  H X  `@ " '`X` @%t 0Lt   X  `@ " `X@%  L0 '`X  `@ "'`X` @%wt Lm ɖt 4 ? $ H H'\  $ @̖ L @ÖL "Hm'LH &  H `p  ''#\#`'#dh@'Xp`d  ϴ 'p ,px < 2 @B | @    @rݐ |xМ|0p` d   xxp $  d @HLd   x @:L "Hm='LH &  H d  @'x cH > ;#x 㼐> )#H``$@ ```` ` 'T ''' '''''P'`'h'lp',?'  "   'h`h @$p T )`` H  $`  HP@Ϛd T  HP@ƚdT "Pl'TP &` m H `  h@ " 'h`h @$1 MT  ` `  h@ " h`@$o  T04 'h`  h@ " 'h`h @$ T 4 ? $ H "(`  $` P@]d T P@TdT "PlW'TP &`  H+ h` `','0#`#\  '8#d@&.`l  XA' ' C`  $`P @dTl   P @dT "Pl'TP &`  Hז X @&  @& l Ŗ Z @`  h@ " 'h @#R nT ' H`  $`  HP@d T  HP@dT "Pk'TP &` P H `  h@ " 'h @# 0T   ` `  h@ " @#R  T0 'h`  h@ "'h @" Tk]  TkT H$ , #`'' #\'#d@%7`l  J' '  N,!> HxԀ  <` < `l  l  25 4 ` l`2 X l XX@l  B l  B   D @@#| "? 2 ,͑䀤=  "ߒ,/-?" '!> H2 ( ̽'  ̳ '< ( $``  lP @}dTl   P @ndT "Pjq'TP &`  HE l  X@%(@%! 2 " "䀢 " ,> H  (,  "V,`@  > )#H > 8# H> )#H   $  ` `   ''T'''P'`'h'l?p  "   'h`h @!s̖ T )`  H  $   HP@Қd T  HP@ɚdT "Pi'TP &  ƀ Hז `  h@ " 'h`h @!4̖ T̐     `  h@ " h`@!r  T0 'h  @`  h@ " 'h`h @!̖ oT )`  H  $   HP@bd T  HP@YdT "Pi\'TP &  V Hg `  h@ " 'h`h @ Ę̖ 0T̐     `  h@ " h`@!  T0 'h`  h@ "'h`h @ ̖ Ti  !4 ?$ H P'd   $  @ T @T "Ph'TP &  ߀ H #\ Ė@$Y 9   $  @Tl`  X`2 x@T "Ph'TP &   H В @#   <`hD Nlh  ','0#\#`'8#d@"t``l  ʇ ' 2)l` `X X@ 2  , w,@Ð   "ll ĒДQ I8'Ā $    l @Tl`  X`2 x@T "Ph 'TP  &   Hl l В@"@"8 > )#H > # h> )#H $ ``  '''''' '(','T?  "    '( ( @<䖒 ( )  H  $  H@$   H@$ "g' & Ā H    (@ "(  '(( @䖒   ޔ     (@ " ( @;  0А '(   (@ "$  '(( @Ϙ䖒  4 ? $ H (  $ @)$  @ $ "g#' & R H"z  (0 'T'X#` '`#\#d@ `,   i ' Ā`H, @%p T   (@ "$ '( @S䖒 ?$fŰ HT      ?'''''''  ' @X , 2-@   (@ "` '( @䖒 f T`'L-@@ "D8d> H  (DɞT@@ @ @ @`@TX ,84` *X?# @`'X'T'\'`  > H@3 @@X$$@ X $ @Ox@> H8> Hd  (`  8x' $ ,$ @,`  `2 X`2 x$@ "e' & # HK ,  2ܒ $@$5> b" "C H@ Ėܐ@ x* " 98> Hd C ( "D/DڒT@@& @ @ ``6 > )#H > 뵐# 㽘> )#H$ ``  '' ''' '(',?  "    '( ( @ $  )  H  $  H@P$   H@G$ "eJ' &  H    (@ "(  '(( @        (@ " ( @  0̐ '(   (@ "$  '(( @   4 ? $ H ((  $ @ޚ$  @՚$ "d' & 3 H"L (   'T'X#`#\  '`#d0@`,  Ė  ' =H  $ @$,   x @$ "d' &  H  @?x,   r,  @" @   (@ "$'( @Ϙ dF   /'L@  'HD\TD0q# D@T @@ @ X $ $ X$ #L xv $ ,$ @,`  `2 X`2 x$@Қ "c' & 0 HI ,   $@"> b" "$ @@wx(  @"% D@!@ "D DƸT@@ @̐ @ cH > 限# > )#H$ ``  '' 'p''''?  "   ' @՘t ot ) H  $  H@4   H@+ "c.' & 3 H?   @ " ' @t 0t w    @ " @Ԕ  0 '  @ "' @ht b߰ t 4 ? $ H '  $ @  @ "b' &  HȖ p  ''#\#`'#dx@p`  (ĥ 'p ;  $ @s   x @e "bh' & m Hy ( @" n pj  <   2 @  2  Z@ 0o mp :p $   @    x @ "a'  &  H   (@ cH > #ȁ h$> )'cH  'L'P''''''?'  "    ' @8  ( H  %  H@   H@ "a' P"@  H   @ "  ' @ Sڔ    @ " @6  09 ' !  @ "  ' @ǘ !       @ " ' @ a :  #\ @ /  % @ 'ܠ @' "`' P" u Hߖ ܐ͒ (L  ' @ @ L !P  % @'   X @'ܶ `  @  4 4 L   q''' ?''''' '' '$`'   'L&`Ԗk` "   (nL ' íL ?ݒ 耢 "ג   %ܔ @.   X ܔ@  "`#' P"@  H @(  FC~ % X ``ܔ @ _'`P"@ٔ(@8  $$  @- > "> $$ c ` İ 쀢` ` '쀢` "쀢 2   %  ܔ @   X @@ܔ@{ "_~' P "@  Hl  @[(@  $$ *-> @> b$  $@ $@ @ " @@"` ?'쀢    ? `Œ ' @o$  > "$$  > )H > #؁ p > )cH $'     'H''px'L'P''''''?'  "    ' @S o  ( H   % H  H@  H  H@  "^' P"@  ـ Hx   @ "  ' @ 0      @ " @R  0 '  @ " ' @ ^] 2      @ #\ H @Д 0    % H @ 0 'ؠH @ &' "^(' P"  T H ؐ Ĕ 'L   @ @ L "D   % H @ 'ؠH X@ 'ظ8 @  '` @  @ @ 4  4'L )'ܐ  'ܐ ?''''''''`' D 'L``L L` "  " ; "     % Hؐ @ k Hؐ X@ b "]e' P"@   H0 ؐ@F ( 7@4H h% ؒ @ 8 ];'P "ؔ@$ @h $l> $ b $> " $  `@ @@@ '`@@ "@ 2 h6ܺ h %    H ؒ@ ޚ H@ ՚ "\' P "@   H ؔ@@ h $l@v$  r9> '`_ X   ` `" 2S@ X ""  X $  L 2t @  @ @ 41'܀@  +'@"$ $$ @ђ@h" 'l''h'' @ @ ?@' 4 @> $  > "$> b$Ē  > )H > @# H> )cH $  '''''>'  "    'ؐВؔ @ m ' H  $  H@  Đ  H@ ךĀ "[' & ŀ Hږ   ؖ@ "(Ж 'ؒؔ @B / #    ؖ@ " ؐ@  0 '  ؖ@ "  'ؐВؔ @ [ #\ @  2H  $ @ i Ġ @ _Ā "[b' & M Hb  H @X  _֔  R{ $  Ԕ @ ! ĠԔ @ Ā "['  &  H @њ 2   @T> *c0"c0`"H >    > )cH $  '''''>'  "  ` ' @M< X<@ ' H  $  H@    H@  "Z' &  H   @ "` ' @< <   8  @ " @L  Zn ˖ '8#\ 4@ 04  $ @ I  @ ? "ZB' & P H  @%@ `X `@4 8a4 $ Ġ @ Ā   X ``4@ "Y'  &  HH Ā @Ԗ :   4@+Ā &  @ $$  @ $ $   @{ $ $ ( $ $ 0 $ ($ ,$ 0$  $ $$$ $ $ $$ cH > ߹  㾰> )cH ``$` ` `@'''''>'  "  ` ' @$ X$@ ' H`  $`  H@Y   H@P "YS' &` i H   @ "` ' @$ $  `    @ " @  Y | ' #\ @ 2(`  $` @  @ "X'  &`  HE  @ϔ(=   $`  @ X'&@ 0@ ` R@ @ @"?  #`,#` #`#`#` #`(#@#`#`#`#`#`$#H > ޴  㾠> )cH $  '''''>'  "  ` ' @$ X$@ ' H  $  H@T   H@K "XN' &  Hז   @ "` ' @$ $      @ " @  X  ' #\ @ 0  $ @  @ "W' & W Hr  @̔(j  `  Z   S ( L ( ϔ $   @  p@ "W'  &  H @w   @Ґ> "> "  " "" " " #H > ݄ 0 x !    ''''' &  @E ܔ @<܀ "W?'؀ &  2 H x  L   ' ' '''  &   @ ܔ @܀ "W '؀ &  2 H 0`2 < X $`"  @ <    2 @#  @  @\=  ޖ`   @" 㿘> ` > 0@ *  "@@6"@  $?6$ 0> ے`L(@(  48`"@ `"  8"@ " 㿘> ې L.`  ?  *  @   : >    *  ` >   #> %> ` 0@d: @]: @Y* @*`0@Q` * @*`㿘$t t x^| t` R $ 24$ TK   " "@ e   T=   $ ** 2 " > *В^hV ͒ T(  " "@ e  $ " L 90_| H /` * ! ` %`8`# %> >   `6*@``"``8 2 ```8@; 2`` `8`>   4`8H 00sH 0>  *` 4`~$ A"4`4`x` `Ā@ ! ;a `༐!Ā@ *  /a"` >  H ` S   "?$ ce ` R `2 S   "$  d ༐!a* *i `|``@@4`4`|$$$  ?4`H 0@;㿘 %> =@4 #> ?*  `XH   H /` * !  ` `$"`( @"`$@`2`$H 0  㿘 t & td ]ѐ㿘$ "T 7 t 2 ? @&$T - &$ R    " V` @? ` ^Ә  $  @ &$ ? # 2 X> 0 &"@  x "+ t $@5 W   $`+  t!`@"- >  H 沔 Um a8B  H''?''''''آȐ @'#\   `( #  # $ 2   ( @  #b `B >b # @ 耢    (" > `h!   y *@@ ! ' >  (> `! d ' @'#\  _ݚ #"'Ȁ "'Ȁ?"'Ȁ M耢I>   (`h̘!" _ ? !'''آĀ "Ā  Ȓ '#\_Ā`SҐ #   # $ B #瀦 "Ȁ  > k ؀  " " '̀ M K?J S  & >  (`   @ $ 6M "  @G $, 2/ -    А"@'''̤آ'#\ _F # $ 䀦 #"'" '̀ S_&@ p>   H@  % ܰ@C`$  ? #` `t 22 80Ԁ "S+' '  @ "    ' @ Ѐ S0>  <   BS< 0H /`4`* !` 2  2+ 2'$ $ $ ``4 $:@@@ْ `@@ $`$` $ ?$ $`$` $ " $` $` 2 H 0  BR<0dc  > ѐ!h>   #p X " $`$`+> $`8$`0)> `/> -> ` @` Pɐ $`" 0`" @` ` @  x  ` R ` ?` "@`0$`(* $`4L@ $`$$`$$` H`B :H /`4 * !    0  $@ $` "@&  t = x   $(  @0H 0  $@沔  R  t `@ΐ $`$ @ !& `$` $`$H 0?$`4 H /` * ! @``"`& `?@"$@$`  ԯ H 0`$` $`$ ?& 2 ` `$ > a@_` '`'`'&   "    ' @ -̖ U> #h@  >  @  ߤ -   ?@ " 6 @ ^薒 0/'  @ "$ ' @̖  2P +  @ "$' @ژ̖ QQ 9`4 $"(  #$`FQ> > +`D''w> ( ? 0,@&` * "@*` 0@` * "@*``F`&&&`Qp㿐 OC > E"   '  P0( > E"`@ $` $` `> ` I&< & > > #h&   > b.& &` ?A$` >  @ & & 9& 8J& & & KH L  & &@  & & & &&@ @,&&`''@ > H`B : 㿘H /` * !   ˪ > ۬ ,> >`H 0 2 $ 2 8@Œ " 4 $ $ $  $ 4 $h" 0  `?* ʐ  4 ``&  $ 2  ( ( > @͒a8 $ $ $ ( @&  x`B < $u$ $ ` do$ ( dl$ ( t`h?$ 4``"@``" 4    &Z $(2   $ 2   @6M 沔 PƖ  "D $  `            *?( #"' ""4`8! $`"` (  $ $ d$ ( d$ ( :  & !& 8`B <8$ $ !& $ 4 2@ H 0>  0]`" $`$" $ @" ` *@!(  㿘 ` ``$`8*  ! @@#@'> ``͔ 2  & Hk!2>   *`@@倦`@@& 㿘@@*@> d!X & *&y㿘  $ $*` @ % !'>   8 "   $`h) `a %2>   *`@2  $ 㿘@*@> !x & *&1㿘@@ 2@#>  #` ` ? " 8T(`a`  ; ` @&` Q2&` `2㿐> `  "`' `    "L  ` a  MՖ($` `> `  "` P^    ' N&p  ''!'  & '(  ' (@԰ >  $ 4    &    ' @ɘ԰ $ $ > #l@  & I> #d@   J    K`2 $  `$  `8  L   ` L $ $  2  > ےa* @$  r > #`  i ?@ & 6 @ 0o'  @ &   ' @T԰ ZԐ $@ P $ $ $ ($ , 1 * @ & &  '@/԰ 5Ԕ  44*"  4 4 0 M H0% ?@ & &'@Q  Ms0   $ $   $ $ 㿘 8   >  (a–``(`V I'` 沐`r&`(沒 "'̖А'#\Ԕؘ Y̖ #Ѐ 2`##`(%   "`0" $&`&`0 "&` 2&`@M ;`( 6&`( 3&`(沨"ؤԢР̐ '̒'#\ XĚЀ`Ԁ " ` "&`" &` "   `#2`(Ѐ ؐ  ` `( @㿐 ( " > ې!$ ( 4 G 0 $ (       `?& &      *   `?& &   0* ?$ 0$ 4 (  ( ?$ ( 4@!@ G ( 0   $ $ $ 4@$ 09   /  @ "@ M) $  4 "@&  4 ""@&  4 ( #  $ 4@Ւ 0$ "$ 0$ 4 ( ?$ ( $  $@@ 2@"@ ( "d 4 ` $"`$  $$ $X$ 㿐& ( "7 7 `'1 7` & "`& R`   @'$@%>  NĠ* ($ $$  `$  &&` KӐT㿘 ( $> #" (>   ? `"ݐ 8 `& 8" Ț 0 2 (>  & (`"㿘   @K   @" KT   . 㿘> `>  4LH > "cT> #X"#X"`㿐 " @g Y> `? "` "@$ $> X$ "@"   > !2 > H( `B ,:( > H8`B :8  >  >  H"8 B:"8 沔L  &   H"0 B:"0,    ,  , d0H> 3> @cP`B :@ 4  cP`&cP , 5> %> :#> > #X %> #> 3>  ,  a X     ,  `"  "`  ? "$ $ `"  "`X"  ?"$$ 1  , $X$ "@" ,  $    `  ,  $ 沐 @,   K $  4  L2  cT * ` $   2  * "`  L2`@cT @ *`"  2  * $  ,  , Ɛ 㿘 ;@f 6 `',  > ە* `@ "   2> ې"T > ےa*@    $  ,  K& $ `,   ,  , Dž㿘> #X "$> #X? ` "`   "@$ $ ` "`$ "@$ $~ 42 > "#P㿘'> %>  L2  T* @ ") #>   @2    2  2   @  "    a .     .  2  㿘 G    I ($ 㿘> a 1>  "a!D!D㿐"  > > > "b0ʔ"0 ,  V` ',` "@""  @Ҡ& $>  4 $> #l $> #d $ $"  $ 0 $  $ 0> ې"T*` $ $`@А$ $ $ $` $` $ $   `*@$ $ $ `(@" "㿘   @$P%` $] @`2`W @@`*0"L H "@` 돔`V`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @Ɩ&㿘  &`$&`!N8`` ` @$`  Fؒ   G($ $@"&N}( ` FÒ $ $@`` @` $` &p '''''''Ё`Ē   ?'''' ''?ȁ㿘 @`&` `&@&@@'@> ; H( > "PFn @$` $@"$`  '@꽒&  " H   ꩔ ' @"$ $  40$` & &@   "   H &" "@㿐> ` > ?a >  !> > > > "D#> %> '> )> +> -> $ 4 l##d$`<$h$8% @%b%` #⸐ d@ !> $ 0$ 0@ ] X> Вc> > #\#pb` <   㿐> "|""|"`#\> > "bp!@    㿈 DX@"  $ b"  T :쀢 `,@?`(#`' `D> ` 'ؕ*,` `H@  * @$'@> ې a* @`> ґ5 a <@``4'`8*`" *  * ''􀤠2<" <'$<> #$8<? > #X$8 "> Hb$ $8$͐!&&&&&& L /& 4& 8X`& ` ?` @ ? ? ?&& `0 (@"`X 8& (& (`* `& `  & `& ``     @ > ``       > P`8& `<& ,`@& 0`L& <`P> X& @,& H`& ` & `& ` > ` 82* @* > P`(& `,& ,`0*`" *  * & 0& 0& H`< & <& @`@ > X& D  2 $@ > + 2   8 2   $@( >  >@L$> +>> + D& h$!"&,&0" &4&8 㿘`> + X "D`@t" < 2    `     㿘 `` > + Dؠ$  > > H `B E:H``B :H ` 2` $`@ ` 2 `  8 `2  ` $@( `<  <``@K`<`荔 h`$!"`&`,`&`0`" `&`4`&`8 㿈\> H`$ $c ($ @  @@" $ "y H "K  /2 k `@$  ,@ @`,@ ?'@"& & 2N  $@$ #\$ 0 @= 2= `< ! 3  `$$ # !$ d$  2   @@`  ð  $@d$    (    +" ' (0! , " "   ( #2" 㿘` @`> b" @~`> b"   "$" 4 "8" < "@" @㿘` @^> b " X@W> b"@㿘`&` & `&  0> @* &`? /&` &`$&`P&`T& `N&$`L 3`  &(&,`&4&0`&8`,&<`0&@`4&D`8&H`<&L`@E&P@> ےap* @&@`2> > "H` *`"8 ` &`$&`(&@ ?`L&`P*2 @ & `&$`&(`,&,`0?"&0@#&0`4&4`8?"&8@#&8`<&<`@?"&@@w#&@㿐> 0 \&" 2 Z F`0 2Q `   H` ` 2`c  R`2 `212  $  ` &`&R 66     "R   6   $$` s      @  H( ``X2 `t `d88 8`2`XH  82  (::"8 4  2 ($(( :(4 (2 8,(8(:8  "8: :(㿘 a8  x. 6`.` ? @Ba 2aa  a2 a( 㿘 a8  x. 6`.` ? @Ba  2a(a$  a(2 a,( 㿘`x`7`/  /` 8: F`2`#8;;4 ;2@(;4;8;㿘 a8Dx6. @. a;F42aa-a)a#4@28aa@4 a28aa(8aaa`@g4 8a28a(8a8a8a㿘`x`7`/  /` !8: F`2! `&!8>! 4 >! 2!(!$(!(>! !(4 >!(!,@>!(㿘 a8Dx6. @. a(;F42a a,-a )a$#4@28a a$@4 a 28a(a,(8a(a a(`@g4 8a(28a (8a 8a(8a  `F > ܄ć(R   P?# @ > ۄ㿐`? ' @> b#@`#` @> b" ` ?  @> b#@` #` @v> b" `?  @j> b#@`#` @`> b" ` ? `$?" @P> b#@` ` #@`$#`@C> b"`,> + D   @6 #@`,`#@`0 #` @* "@$ "`4> + D   @ #@`4`#@`8 #` @  "@ "&㿘@  Gj @  ? `($> 꽐" $  $ $@㿘`R` `0`  㿘 0ה p@''  @ "    ' Ԗ %> "   @ "  ' ʘԖ    /&`  @ "  ' Ԗ "@  @ "  ' Ԗ &`   @ "  ' Ԗ "@  @ "  ' iԖ &`  @ "  ' RԖ "@!  @ "  ' 9Ԗ y       >`   @ "  ' Ԗ Z ! "`` ?&``` ` "    ' Ԗ <&`, &`0h`,  @ "  ' Ԗ   $ %`` ?&``` ` "   ' ˜Ԗ @9 0 &`4 &`8hC`4&$@@pƒ e> c  %> #> #`$# b  #`:G `7 Fl ]谒 @쀢`h'h]   l 0" 0l`, +%`00'l@'hl 0" 0l`,  `0 ` x  4  "`@"`  ? 㿘( R`   > #(`"T?r T @!!SO "T?0a`2  =  "?" cO   `2 |R 2 | =  " "  N  |4 ~  ?4 |4 4  2 D <"> # " "" ""   $ "H /` * ! >8" $ $  "(t H 0 㿐'H /` * ! > $$"@"> a$   "a$ 2( @ 2  (   @7 ?,$(   ﲐ`$ (  `> h"'H 0    `U,`` ""`F I  `2>  (*` `  > >@ > `HbB:b   ~>z `Ha@+ @  B8 "   @@!@ > "獒$  $  >   @"@`ڒ (    J>J  ">C  >< `@e`  ?> ᭐"@{H /`/ * !( >@>` `> ᔐ"'H /` * !  " $@K$ `""`" ?"$$H 0r 4a$? &a$@H 㿘 (  ? & ( 0 $ 0&    L"l   =w=   =  㿘 8? & 8 ( `"  "`> "# ?"&& ' 2㿐> # " > 橐"%# '> +> /> -> 3> 5> "7> ㄀ ㄢ? ( ` "`$ "@& & 2 2 ($& # `%# %#c" %c㐐 ?%㐒 2 ( <%㄀`""`& $" c#\Ě t  Y 㿘> #`!?  /> +> > G)> 9> ->     c+  2  +`~ c"  bt`H %@(08 @bt@ H bt`C + 3`  bt%bt"| i"|g !> ! "|" "|`[! W"|`" $ $"`$"|"  $? "$ $ $x 8@%x ="|?! H o *@ e  t   8 2  8`& 8`h   8 @& 8d! `x "`xH 0a 2 "| 2 ""|cbt?""@%%bt~ 㿐> #  > ܑ, `2  ,  )ᄐ  8 " "#>H!> b}і"а?   > #, @        , 0ᄀ 6"ᄁ㿘` "> #`!> %> `! `$`$! !$ ! ?,$! ` 㐀 "`2` > #`> #( ` 28  "("8$` 2` 㐐 ?$`  h"`$`0 "'`pܐ  4   > `$@2> @>  H!B:!`  D''ؐ  ''`'܀ #'  @ "` ' Ж 8@   ̒ ,̀ ;{0  @  " 3  ` `4'`  4ޘЖ ;U 0j``8 J&`"&`     @ (0  0 >`      @ (0  0 >`     @ @+ 3`  ; >`      @ >`( $    @  >`8&`h>`0&` ; >`  ; >`   ; >` >`0>`(:~_p> H`B : D''ؒF  ''%܀`#'  @ "` ' =Ԗ '@   В ܀ :0M  @ "/$0 ' 0Ԗ : 07 @a >&    & &  @a >&   & &  Ā@c <&  Ā & &  $@:X& $> )cH>' 0 Ȭ @1!(> c0? > ]# >  c8@{!> )@#h> #@ے> Ha&& a  """ z` #h* > 2#P@> ` > *{` #> > %#p`4?`4> #䨒5Hd> c  2&> >  c@/@\zU\ "`<\?"@\$`4% ` > ~#> #ztHv#$`4% H > ܐ  8>  z1 > Ӑ ($@"$@㐒 X    j'''''' 7  @$  @ٖ >  X⪒㿘H /` * !  $?` ` ` +@ @  @ & $H 0` 0 `, +%> #> 0@T` ސ @N & 0@J`  @6` ` @C0& 0@=* " *@@4* "@*`& ` "  $`0  d4 d&  $ 2` e& `"` @ ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  Ā 4& ` " ``4  $& ,`@" ``8  $& `@" ``H`?#@$`J6 `@"  `L`?#@$`N6   Ԁ 86 `@ `P`?#@$`R6 `@"  `T`?#@$`V6   ؀ 86  t " \ x 2 %> #> = !> a  m    &  &$ &( &, &0 ,&4 &8 &H &L &P &T0> )#H' i  2t   H^ ? e K XT * ['5@ "> a 6 $ "a  $"` C `$ b '!tv8 @3 " 2- YƖ 2$ Z$@Ő0ܒ Yظ 2$@Ḑ@Uy  2 '@ H > א 㿘`$@@ 7]   ܢxo&b>  0>  @$`($`     <  $`$`$`,$`$`p4`4`$`$`4`4``0` ``@Δ a Z` Zat X$`$@$``$`` >5a\"  `$`|$`x  &`8  F 7R㿘"6` {  3 7A  ђ 㿐"`p7`0  `&@㿘`& ` " X2`Ő 2 d t  y  2zG d 2 X -㿘`(7   $ -002"p&* "o"p&$ !>  H"p  bp   H"pd > ܐ!T X     - -E0E8E8EE8E8㿘``T  L"iɐx쾐  ''ذ6܁pX $ b $ " `<    2`˰ ` > + D$  ` ` @ `?` a 2 aa    @  {> H`B :j H''ؔ  !<@ ` 2  @2  "2 @2 " ? v܀`#'  @ "$ ' 페Ԗ '   В6 ܀ 50I  @ "$ ' iԖ 5 03 2 5 @& "`> +`?> +a> + a $aa " $a0  D$`  $`$a$a0 `<  ``> M k    ! " S $!@ "@  " ! " D $! @ "@    ͒  "B @:͐$ `< 2   <   { 0$ )$   o " "Ā@2`< Ȁ@"$ `< 2   <       @:$ $ $  㿘   < "    X"`$     @    4   i $   ? 4  p`Xb$` "'ඐ c d2 > -  H B: `  D ''ؐP ''-   'Ԑ 4ʰ 04܁㿘   H ?` - ? ?2`X ,?2 `X 4?2`X ?" `X $`  ? $?"D 4`<?`!>O *` €x  4?? ,?? ? ?? ? ??c ?4< `X $`[  $    K   <8@9<?2`< ,?"`<     2.  @+ "  ?2< $?"  <<8@9   $? 8  ` $@` `i``X> "H `$B ":'   D ` `<''ؐ  d    => b;"6 `>  D`<`> > "H@ *`"8  $` ?2$ >  D$ `?2$ >  D$ `$$ `,$ `0?"$ @ޯ#$ `4$ `8?"$ @ަ#$  ''`a܀ l  @ "@ ' ̖ U> "    @ " ' ̖ ;' '` @ ܀ !'  @ " ' ̖֘    Ȓ   'ĐĒr 34 031܁  X b $  "'*@ $  % X $`" <? m  < i  'dd x 2Y%@` "L%*@$  @ 2?%v!7%vQ3%2 p   @ # fd8" p  $` @ >  H B: ` ($  @3  fe@uՐ%v%>  H   B`B ; ;    `$`H'' 2m ?֔' 'ߵ  - &܀ #'h  @ " ' ɘl 1l   hq %h23R !  @ " ' 题l  l``@ 2 H0 ` ?@ "   'l l d R`2  X`@ꅒ 2 X1 08ߖd ld`M ܀ #'`  @ " ' Bl l   ` `܀ .'\  @ " ' l l  \Ŕ y \ 'XX麔 nX%1{( $ ϔ@$ư R`e`@ ^tK M܀ #'T  @ " ' ʘl 2l  T r &T܀ 4'P  @ " ' 襘l  l  PM P 'LLB L \@$ Xd ` *@z$d`M ܀ #'H  @ " ' Ql l  H  H܀ .'D  @ " ' ,l l D Ԕ  D '@@ɔ }@  ; 0s0*@y$ Xvd d0l0`M ܀ #'<  @ " ' ֘l >l  < ~ 2<܀ 2'8  @ " ' 籘l l  8Y  8 '44N 0 04 2  a@$  "($@"%  2%7%/܀8`@ `  #`" sB@#      X`$ ?  "%($%㿘 `< 2     㿘 `< 2     p`X> "H $`B :'  D''ؒ` ''ܿ`&܀ "'  @ " ' ԘԖ 5   В| )܀ )  @ " ' 沘Ԗ /$ H0 ː薒 / 0/܁h X $` ' X<`` B `ΰ .ʰ. HŰ. `>  H`B = @  , P 'ؒD'ؒ %؀` `"` ""` """` ' a  '`&܀ "'  @ "$ ' !Ԗ   Ж ɔ Ѐ   @ "$ ' Ԗ   '̐̒椔 x  @ "$ ' ܘԖ e Y   V.C$@  `2   ` ` `4J` X"  $ ` "` '> A &`` <B4 38 .0'- . )'H`B :  ?`4X''] ؒ :` $` $  $ $$  )` $ $ $ $ `' a  '`k܀ g   @ "@   ' (̖ > " &  @ "  ' ̖  `'  ' ` 2 ` @ ܀ !'  @ "  ' ̖ X Ȗ 吔 MȀ`@ W  @ "   ' 侘̖ /) 6@$ " "@;` `` b >`&` 2 $ "  $#2  ̐ u  $% $@埔   &e  ` 'ĐĒ( Ā`  L P" " ,$> '2&`X X " $ "'`'L pͰ ->  D>  H ؖB: `  `0`T  <''  , ? ! > ےa*@ "= ? 8; ҐN"L? @2  `@,"Ē `> "H > Ґ"8*`  >  D$$ $ $ ,$ 0?"$ @L#$ 4$ 8?"$ @C#$  ''ٖ    @ "$ ' 㭘̖  `E`!  @ "$ ' 㐘̖ l  @ + H뀦   ?@ "  @ 'm̖ I X A `/  @ "$ ' L̖ (̀`"   @ "S  T㉔ T 0'` 'ĐĒ۔ "+ `􀤠"o   @   m܀ j  @ "@  ' ̖ > " '  @ "$ ' ט̖ '  ' ` 2 ` @ ܀ #'  @ "$ ' ⯘̖    W +܀"n @V&@> H΃ ( ` 2` " nk㿐    2 n]  `T X` X `$` "` ''`  ` `9> ;> H( H B: `  `(`L  <''ؐ* ?     $ $ 3$$9 - ѐ`> "H  > Ґ"8*`   >  D$$ $ $  ,$  0?"$ @Y#$  4$  8?"$ @P#$ '  'ף    @ "  ' Ộ̖  `E !  @ "  ' ម̖ l  @ *  H퀦    ?@ "  @ '{̖ IX A  /  @ "  ' Z̖ (̀`"   @ "S  Tᗔ T 0'` 'ĐĒ " )   )  `􀥠"m  @   j܀ g  @ "@   ' ̖ > " &  @ "  ' ̖  '  '` 2 ` @ ܀ "'  @ "  ' ຘ̖   c )!܀    #U l    2 @I`"v`(` 2`" ` ^W lX0     $`>  `D`2`<> ! `2 ఀ #  Ԓ 2 (\      @6 "    ఀ 2 @ T > H ($ll`" ]  ] 㿘 `<     @  h X> "H`$ `B : ? ' $ Hށ''Ȓ (R ? (M | ߶ ''՗`k܀ g  @ "@  ' ̖߬ > " &  @ " ' ߒ̖ `'  ' ` 2 ` @ ܀ "'  @ " ' k̖   Ȓ Ȁ`' `` 2` " 㿐  $     $2`X> ڐ!(`X@K  "$  X@D "  D (   `2  < @ U 2  ] k  #\#`  @A"`\ `"`<\ `< @  < [9[7@jې j jjАjΐ " 㿐` ` #\`#`@`` X> "H`$ `B `:  '  ?  HO@''喒آތ劒` ' ? '  x`\? X`բ܀ i  @ "@  ' l̖ > " &  @ " ' R̖ '  ' ` 2 ` @ ܀ "'  @ " ' +̖  Ȗ Ԕ Ȁ`g  @ "@  ' ̖ m> " &  @ " ' ̖ S '  '` 2 ` @ ܀ "'  @ " ' ˜̖ ,`  Ēk "Ā &)  2` 2` " " `  `Xb$  " ' X`X@ > Hɇ (@it i<   > H`B : D''ؐMI%Ұ ?<' ' `܀ -'  @ " ' 0̖  Ȓؔ  ܰ % u% p܀ h  @ "@  ' ̖ > " &  @ " ' ̖ `'  ' ` 2 ` @ ܀ "'  @ " ' ̖ܿ    Ēh Ā`%&> HȦ ( ` 2``" `` " `" Z  Z~ hK` > X H Ш ` B $   ;  @'``  L(@ ` `< ''  Iؠ? ⁔ d$İ ?B` - 2#  > "L> D@&& & & ,& 0?"& @Ϟ#& 4& 8?"& @ϕ#& ' ' `    @ " ' ̖ `E !  @ " ' ̖ l  @ $R HЀ`   ?@ "  @ '̖ IX8 A  /  @ " ' ̖۟ (̀`"   @ "S  Tܔ T 0'` 'ĐĒ. "# n`܀ g  @ "@  ' ]̖ > " &  @ " ' C̖  '  '` 2 ` @ ܀ "'  @ " ' ̖ `  Ŕ  #܀`"f> H ( ` 2`" X fX`> X H $  Ȕ ` ``B '' ; Ȁ$H` `<l''ؐ  Გ#< ?Kڤ  " > "@> `D@$$ $ $ `,$ `0?"$ @#$ `4$ `8?"$ @#$ ' '[    @ " ' r̖  `E`!  @ " ' U̖ l  @ "İ H   ?@ "  @ '2̖ IX A `/  @ " ' ̖ (̀`"   @ "S  TN T 0'` 'ĐĒڠ ""b q j܀ g  @ "@  ' ̘̖ > " &  @ " ' ٲ̖  '  '` 2 ` @ ܀ "'  @ " ' ً̖   4  ! ` 2`" `  @  `<`2  `"eD"W: @`"> H= (e-h   X $  b  'ee`> H% ( >  H 薂B: ` ` `$`H׳''ؐ` ! ?`!~ ~```'` 'ǒ `l܀ h  @ "@  ' ̖ۘ > " &  @ " ' ̖ `'  ' ` 2 ` @ ܀ "'  @ " ' ؚ̖    ȒC Ȁ`!`> Hā ( `` 2` " "Vc V^ Td]d[ "     '`X"`< `'d   #` 2 `` 2`Җ 2` Ā@2` Ȁ@2 `> H `B : `!'\` " ǰ  \@=  .kv  "@ "$" @b 堔 $ka h'X $'lX ''p't$>'h?x''`0`@'$@ p@yd #@$@*@%$$@@  p@yd c@ " ` X -       @ &``  `h` ?2* `2 @ Ւ  'd'`` `` d $l   `"  l  " "@@""@`"=``2 d > `\ 2  > H(`B :(  " "h`X "  $ ` "`'L'P'` `#"`> !@;> ` ''Դض`H`B :  D``''  И#Ԙ #Ѐ`  Ԁ 2#  ##  אԘ#  Đ#`L'' ʔ`%܀ !'  @ "  ' ߘ̖ d  Ȗ ׈ YȀ O   @ "  ' ֻ̖ @% %  @ " ' ֣̖ (   @ "@   ' ֋̖       @ "  ' r̖  ?   "`" (`  4@@ "@@" "`"@ &``8 3+ @@2 $,4, ` @&` "@`? "`W @$@@*@@"@@""`"@&`    "    ` 0'   @ "  '   @ "  ' ̖ h̀   "$'$ '$ "     *   @ "  ' ճ̖ 8`?'܀  m`H""@ 4@@ "@@" "`"@ &` Ԓ    P  =P "@0 H0  0` > Ț!X`X`"'L'p`'P't  'l `#"`> !x ` ' ؒ'''h'd>  H`B : \''h+ d  ""`  2"""ख"p"p`"` L''h܀`#'  @ "$ '  !   է    @ " $  ' ݘ %%  @ "@ $  ' ˜  ? Ն@  l "`" (`'l 6@@ "@@" "`"@ &``8 `:+ @@2 't"`l`'l.6.'l` @&` "@?"@@% %Ӝ @$@@*@@"@@""`"@&`    "    ԥ 0p'  @ " $  ' : \` t'"@'"`   @"S Tn T 09'  @ "$ '  %M  @ "$ '   ``@`    "    ' Θ Uഀ2`X@ޔ 2`X_& '|7| |  a`_ 'x''xW |'' > Ғb8*@ x2 .`E'  ` !* @ `*%O  I -  @ "$ ' h ` ` ? "    ө 0t'_<   @ "$ ' 8 Z `^耤   @ "$ '  2=`?܀ `2> l""@  6@@ "@@" "`"@ &``     P  =P "@a\ HW  ` > !^㿐O` ' f $t $@^"$``< ` > ݐ!- 1>  X V !Ѐ $`@8$``@@   `@@  "`^v`s@g h`X> "H $``B  ": '$H''Lְ ?`?''     ```  !  @ " ' ,Ԗ ``@  H` ` ?@ "   ' Ԗ f@   '"  2 Tഀ2`X@  2`X]S 'Вdа [0T  0܀ #'  @ " ' ŘԖ "  ̖ m ̀ @ ( 0 'ȐȒY  `܀`@  ]0'@h X"`$   > H(`B :( D''ؒZ ; $`$@$` '! '/ ܀ [  @ "@` ' H̖ ^> @"    @ "` ' .̖ D``'` '  @ ܀ !'  @ "` '  ̖ #@   ȒѶ ܀ &  @ "`' ̖ b 0`̐@  Ô !1R܁㿘   "   `X 82   @ < 㿘  8`  > S! 8  > 0  8 ֐ 㿘    @ 8`'`X?"?' $'L'P*  !@  '  `X"`$S QH /d * % 8`t 8 23  8 ) L 2L2I 8  $ 8H`H 0 ȑP ba>   *`' 8 > >"  8 2;  8  8$ 8DH 0{Đ0 H 0L `3H /d * % >  a@H 0 1P a >   *`'`t  ^  ?2 㿐   #\  N 㿘 >  "00F, <`2> }ܐ> ="X 㿘 @ 㿘> 0 8   8 2 > "`? 8a & 8H /d * % > 2  "  `0 "`0 `x "`xH 03@`  h x2`*  *`  a0@ ;"@f}C  8 fq Ӎ 2% ӯ  a$ a,a $ 8& 8  4 8@* & 8 `;0ӷfi 8& ?& 8& H /d * % BaH 0 !1 `X  8@ & 8z2  8 & 8B  `0 "`0>u0    X $`"   <    2    x 2    <^  E㿘  a>2> #> H*` €㿘  b>2>  > H*` €0 ` c &> Ґd4 `D` > `X $`> ҤWi !" ' ' ""  ' '  xq> #> H*` €㿘  a>L2> #> H*` €㿘  b>:2>  > H*` €0 ` c 0a" >$  "" >  $4 `D` > `X $`> ҤW !" ' ' ""  ' '  x > #> H*` €㿘|㿘`  =@  0@  \?`%@ @    > " g > ِ"?@ > Ӑ"2 ##@u>   ?`  `@#$ <@ B $@@Y8 @ d@ d ?` \> `Z>     @o) "$8_4 2 $<  2  @  : @ʐ >zb,@Ɛ  8   `h "`h  `   B;    % =@  @o- > > !t|b >   > b# > # W 㿐d'  " 0@ @?` @ 2 \@ 8 :` @  `> 0#H\> #`> #  " `@<@ B @@8 @= d@ d 4 3> `1>   `ഓ-` (  :-` p d> 0#Ȗd> ֐#`h="`h  0?: " D\"@: :  ` @n: 2: @\'@e "-8  `"@B:d $d@  x  | "`@>  \$\> x 8"`D4 2 <8  21< 4\: @@ @ Ȕ ( 2&$ #>z!$<?: @@ @ d 0     $>  X> / >zb,@l  _> ` > 0[ഓ? h -"h@NX $@ \@ ˖\6 T :@: @ E  \ & @   `ؕ? ഒ  ?  B; d `$d@< x\`@\> ؐ "`D8""8P@d"@h2:& > !|b ` > > b# > # ’  ;6'􀕀`@mt  '\'d  $   'X  p@ >GB??P!> X-@d@x 0@ 2t XX.d 'D'@8'<> -@ =`pG `t "S 耥- D@+@  x> - @ :` xE a | a6@ @x<@MD@h <@?D@Bx@]2w  2t d @\t 2j xP Tp@\d 2` t *  ('`?0?dl8G  l:x 0Gl `P'``@Ap  * ?@ `@t$ $ ?*  @2      2 > !@h@#? 08 d @h P'\@>|<`aԐ@?HH `, Hx'8X \8 d@x 0@ 2X> !`8` d@x :  @ d> n!X $@ ":&` (@ 0#`0@#dX=`G8 #h#\@4g&@ =Ghl8;`X   8 #h#\@6l&8 :@ E8  '8` (@> Ā 9l@8l@> Đ ` &`   @ > #Ā 8h 8h ?H d`X $@ XXd@x 0@ X@d< xX d@x 0@ J 2> > Ɛ!#̀`> !ؒI8 @ :EƢ` @69:h` (@ 92l  '\'d ` $ Ѣ   p@ >GB?@?P!> ,`@d@x 0@  2`z!@&d.'D'@8 '<@> ,`@ <``pG `t "`Z"@,`  x@D@ +@> ,` @ :` xE b0 | b0=@`@ @x<@TD@o<? D@Ix@d2Z  2W d @ZȘt 2M xP Tp@Zd 2C t * ` p'`?@0?dl6N  l8 0*l `P'`p  * ? `@t!?* @ @2  @    2 > А"`h@#? 06d h P'\`@  @; >|aԐ@?HH `, H@k @2 \d@x 0@  2> "d@x  d> |" X $@ 3`` p@@@ 0#`0@#d<`G#h #\@2w<@ <`G@hl ;`#h#\@4<8` @ :E @`` p> #Ā 7/l6l`> Đ `&`  @  > #Ā 7h 6h @3H d`X $@ 2 d@x 0@@d< xd@x 0@ e 28> "Т` @ :E@Ҥ 6`7^h`` p 7Vl 㿘> #Ȁ`2   `  㿘& @<@ 2@,: @<@ H @   *@ @ ?*@  >} aP@ `>  X  @ \0  ` ` `  `> "ږ> L#  `2h 2  '  "#  `  `h : " h" d   > #0  `  ഒ :  `" X  `  l`   `l  "`l P`   ``P "`P  `   l * "l P`2   ` * "P `    l`   P` 2 Pl? 0" "l?  ` "P > > !ܒb > > b#X > #h 㿐 ,: @ږ @Ֆ @Ж '  @`? ,@* , L*  @ 6 `& `&  ` 'L@ 6 `& `&  `  @Ȓ ' < @8``: &@`$ : $$ 4   0~@%0 &s@ @8`  @ڒ8 " ,L*  6& &H @?  6L6& &H @% 6 L*  6   L @` 㿘 `\@X .? 2Y`8`t :    @``D .?  @``\ :`@ @B` `,@#c@> @ cL+`  6``@   @ cL @6``@`  $b`8㿘 `\@  .@2f`8`t :    @`` J .@2` @``\ :`@C  : `@;B  `,@c@1> @ cL+`  6``@   @  cL @6 ``@`    ;`@f; `8 :@B: B㿘 @ " ,1  @@6&@  @ . ,`@S   @ ڲ` ,@"   㿐  >@;    Ԓ.  :  @ :`D @  d@wD `     ?1 3 0@ PbU  Ԁ 3Ӑ 㿘` cL- @`T'@` : #?@ `8@ ?`?F @B: >   8    > + 3  DP :< $ `: @`T? @ "U 8D* 2`@ c ` : ҄ `8"@   4@ "U @ 8D* 2` c ` : "`T `T? *`@ ?#@ *`@  #@ `T?- @"U-   8D 2*@  c ` .*@* $$ $dcLB? +`0D :< $ `02`T@ג 2Bβ`8?   4/  `     `@ "  P  T@`  @; `8 -  4@"U  8F 2*@  c `  -@*`8`8 $"$ $dcL 8B @; *` @?6bU -TT@ @?"@ ,  : :`@2 @XB`$ @+,㿘 .`#P Ւ "а `P/ h%$          h? #P.`$"  "  : @>` @ " 8    : @@S ` lF+ 3` F+ 3`@*  *   p *      O> + D  :`& <$@"U#> ` :@ 2ߐc$ < `*@ @"/> ː# >3> : P@" 8c/08  㿐'D .`L   'TD "   P` > +0 K  D :`=`%`: @ .6 `@U b@`\@ : '^.``0` `:"    `@"U@:@`\@ @ `@"U@ b`\@ @ 2 ``0>  > 0 (@"U@% "@`\@- :   .`- F >  H>  X%`0'\U!@.'u6x`x :  F :`  hD f`t.'^6 D : H@:  @v 9`x@ * 1@ :  D :`@ D $`x@y @`* @ : d@ĐD  0  0IP@i0xP#  2  $ Px!`xx %`xD X $@  D@(`@U b@`\@   +  *` <%` T LB?=?"  -`%``LB =".P".: @B㿘 0@> @ 2 8T>   ;` ;  8B2ༀ(  > 0 >  : @N 8 @ > < >   Ȓ>   b  p  > Ԙ 8 0ڐm > +D`P :<$༒: @Z0  @`@U  `@ 2  >  D> !@"U@`@@p .$U`LB < !"\ ~ d@ଖ @ʕ;  @"Ud@ -  P P Xڢ * @ 2@~@>ਖ @;  @;  d@mଖ @ؕ; ਖ @ԕ;  @; ਒@  ; @ʐD@>  @; *`@ @@ 6@bU - T8?-``@"U@:c` ``  " &@  : :@ 4@?T >B.@"U#>  = E 2*@ c`  :@`  =  E `q> !8 = E 2*@ c`  * @ *Ɔ$$$=  LB< `# `@"U@:c` ``8 " &@  : :@ @ `@>@  "U:``@2 p$8" $$8 < L` < ## @; U $aLB<  # \@ "J d@1.@@bUd -  P PX * @ @.@@d@.@ @@@* @@@ 4@bU - TT@ @ "@ ,,㿘 X`$ @ @. 㿘 ``,[@ >  !X`@ml `> +DP :< $ `@ @bU 6` \ `:   > !M`L`Ҁ`2 > ! @"U@6`b \  +@* * 0@*$ 0 - $ d<`cLB  @ " $8> !ؒ  > l"  > $< 8 > "] : @  א 2 O : @ɐ 0`P   @"U@" `#ذ `@W @ڒ, T > @ "U ;`D* 2` c ` : 2 `@  > "8+`?㿘 : @v  `C + 3`  `, &  : &`@:bU "@``@@ 8> ܠ#Й*  ?"? *@ @ *`@"U@ c``@ 8#Й*  ?"? *@ @ސ  > "` " > "" * : &`, > / >> @+ 3` `@U c@``@ @+ 3`  8*`  " #;   :@ a @  +  *`@ * 8 : @>’@> "˖ > =" :`@㿘%$l`h * 2`@:   ` .@ )* 2`@:   ` ..)%$`p@@``8('@  . `. @ `&@ ,?``8('@  .> @ '@%$4. '.  '+ '%$ (#P .`.`& > 0' '|P'T'X@<? 't 0 \> "؀2" 6~ P`@  4 @4#02 @sD  `   `8 20 ` `8  20`8 0L`8@`` @ @0 @ ] `Y`(: 0#\T\#`#d#hۚ `X $@ ,ഐ (  :0\#`#d#h#h#\@$P@D< @K ഗ,``("@ \  %X \(w )%@ 42ഀ` ഓ-`(  :! `P@ؐE ` \` \ I0\'? @\)9@0S`` <D@L @  @ `(\*0\&? \)0\" D: T\#`#d#\#h3 p`X $@ u\#`#d#h#h#\@#wdP@gE ` 2 0` (0DL `(T: #\#`< /\  0 )Ƙ \#@0&"`D\d@,< xX` \P@D\" H`X $@ \#` #d#h#h#\ @#ഗ-```("@   %@J  4> ܐ"'* `X@ :W'x + #`T#\: 0Ƙ T ' 0)Pd'@:xD@jP"H X $@ 0 : #`#h  #d#\@" ''  2഑*  X"'x`% k`' e.` T ɘ : T#`#\0d .`&  0 (d'@Y:xD@P# H`X $@ &ϐ 0ő*   @$Ț'(* x*` & t`&'tX &.`'.`@@  0?%Y   P* @ :`]OT#`#\: 0 q\ &0 (s d'@X`:xP@D" H\"@X $@   \;` #h#h`#\@#`X* `&&5 & '! \"X0?$ޚ '0 ( 'd@< x\#n &&  |x  t\ ` a|x: 0   0  @xt#"  + @@?`0$ "> ,#0 X*`P& %`&`<` <` T @X h""h`%|  `as 'D 'l >'h 0 l'dP\'X'T@l%<  0 ?> #``2&@l= D P`@C` ` # @ɐDD  `   `8ll ` ` ll`ll`0`L l`%8%@`` @ l@`0 ^ Z`pDHl 0T#h#\#`D#d. h`X $@ -`lD`0 #` p#d@#h#h  #\ D@ llDD`P@ZD<  h@D-````p@ :`  #`X`$@%u@D 8-ഐp ! l`P@(E` ```Rl 0h?#X  b Lle<`l eDL   D`30h?#: "@%k@0B%" D`pT#`#h D#\#d艚 ,h`X $@ s`#`#d@#h#hD#\@ϔcDl P@E`  l`( 0leD`L 0D`p]T#\#` D瑚 ꀦ`l 0 h& l`0 'x" Dl d@Xx:xP@.Dx" Hx&@h X $@ `#`#d@#h#hD#\ @mD-` `p@ :` #`h @F|  |D> 2#`'|*` Д ^'pD  Tl#`#\ 0 D al?`0  %h'xl d@x:xD@Px"Hh`X $@ l0 : #`#h  D#d#\@ #xD#r )D ഑*  И; 'p`" gx $N al D   #`Tl#\ 0D沘 - =@l`0 ` h%: l't`d@t:xD@SPt# Hh`X $@ ?# `0ʑ*   x@!D#vt`?*  X*` :"xl#cxl- `0  h?! x P*| cDTl#`#\ 0 D? ~`=@l `0h$Ț l'td@4Xt :xP@Dt" Ht&@h`X $@ |  * `;`@#h#h`Dx#\@ 7|p*` `* :@X"xP "xL #q `+Xl 0h?!.t t#_t#l `0h $il't d@Ԑ< xtP@Dt" Ht&@ #Ax#=x؀@  dp   `h^d`Ԭ`o|l@0  h $0  'x`8 Wl༢: d@`xl` @;  @lx  x d@:l༖ @; l 8  : @ @l ` D l: d @gD x! D`  l`#  'x`8 !֐ ?8 "8"x ?8 "8"x? - h`X $@  ` D  `" @ `lp  :D # h`X $@ !D  @ |/` 0x h L? > #x `  P* ;@!~x|!- l@ 0  h #t 'x 8@" 8"Zx|- ؀ l`0 D l 0 < <TD@T D @b: # d` `h]  㿐 U%\a\ #\0#\㿈 X $`  ?%  0 @-"``8"`5`I"`T"`Q`"` d"`$"F $   `` "`@ ::   ``"`"`D "'  ` "` ::(  `"`"`@``B =` "  `ഖ: :`0  `"`HF ? %e\aT 2 `e, 4 ``r2`v2``:  @Z @p @P`* /`` D@ :`D @@@`x``* @`d@ːD    ?`0찒 " X!70E $@ @5R   ` R   >   R  > #  ` `x@ P* ^! @ P* S   X $`@  g 0'''T'ǰ  '`< `2   `   @     @   ̀ < FX (`   :` 2(   2( @ ( ( h $̀"` > #  p (`     :  @  `    :@R: 2T@>̐  > @> 0> 8& H X`$ CȀ`4 >`̀>@;%  > 0  [2T "- *  `2  `h:    ?@R Ȑ@> 0  T B   `&   d   `   ?  ? 4 e0  RNe0Ȁ@   e4̀ذ    #\`E  T  " ° :  ` : @@}   `&    @e<̦2 `P  ` :  @>Ȩ   #\`E  T  2sX $@ / 4. 2e8` 8) e8`L e@`0 B 88   2 @ ( > 0  ZKT "  C  :   ` :  44`0`` ``P@ҐE    `  `8 2`0 ` `8  2`0`8 `0`L` e8e@   @@ @ @<`Ԓ$P@OԀ " D `0 :  : `0  :Ȫ B`P@G? C??`t? @ :d?`tC?: @ ؠd''?`0P: ? 'Ę   ` - X :`- О  ;@ & ? X " `  Ю=;?ۄ       `  (  :` p @< ;2@8  ( "   `  p =` ؘ  ` &         `   (  :` @ (" p :  `  p@ ; `ބ` `   `   X  :`   X", Ю ;@  `,   8 `ބ  ` : Ȁ   ̀  > 0  T ? ???`t  :`@ c C??`t 'А : В@ b B??  ` - X :`- І<Ȓ@`d@^ Т #d#`#\@ 2'`'  X "  `    О;`0ݔĆ'  ^ ,  `   (  :`  (", p "H  `,  p   ; 40`0`P *  ` :  `8 2 `0 `  `8  2`0`@8 `0`L` e8e@   @@ @ w< '<@8   `  /`(   : /`p   43`0`` ``P@G `    8`L2 `0   8 `L2`0 8`L`0` e8`e@   :   @ @   ` :  45`0`` ``P@\G    `   2 `0    2`0 @8 `0 `L` e8e@   @@ @ ` $ >  ( j:  `h" r"`h `T:@: @ E Ė< ' ; ` > ` - X@: @ - @ @  @ "ې@  > `  @, (@: @    p@ @  @ "P   ` :   ` ` ; B;`?  &   @Ni X'Ԯ'' 'XԺ` X''ذ ''̀@  't ݒ?'क 2 0( 0:@ 0 : ' `8"$ > 0 > G` !H`, #`, 8 HB`B ; H; 8`8`D`@$`8 $<`x> ; `WАB " d" `2`P`P''Ѐ?20";t0 >ܔ '`Pa0t6`X    `̑, ;, "@t & `X $`@  2' <  `''t?H: B? b;,   `̑, @ : %` d@ג`?#d#\#` ?& 2''0lؐ ':` F?< Œ@8 `3 1:@   ̑, Б,  :`d@ `;`#\ 2''䀢 ?В  `8 $`8d#ԁ㿐 `P @h %   @MD  `      2`0      2`0 8 `0 `L`e8e@   @ @ '`0?_ 0 " De< P @ & '㿘 8> ܄Ї/  +-.`> >   '; ) @@2  8&/@/ 8 /`/  8܀ 㿀 D>  x:  @ :E (D T"O  8@2J  E   U 2> `  @ 28  D`"4  x40 :`  |):` :` x@ B 42  @> 8:  D;   x;  BB;` |> #\ x > ^    8    !* * "2@: @ *  (` @*2@: @ *  (` @2@: @ +` @ `? 8    *#+@ *+@ 2@:  @*` * **2@:  @*` *  *2@: @ +*@+@ 8     #+@  +@ *2@:  @* * *2@:  @*  * *2@: @ +@+@ 8 * * `?2@: *   *2@: *  ( @  `?2@: :   tttuu(u@uXudupu|uuuuuuuuv 㿐> 0 > ` !> *$ 3N ఒ  > > `,#> )3Fch  > #` F4> > #c1  ch@  "1=’  44ch0$> H" "ᨀ@  #a "@a"`"  Ԕ Y+ @ 01w @$4  . l c `$ @ @@Z bL Ҁ(% $`$ `` @`$`@$`$  %  @`$* $`$@B % `$@2 %L Ҁ 2%@ $`$%  `$@ L Ҁ  *@$`$ `$@0@q C`$@?I. `P; !R SՔ L р 2%`$@> > # Ѱ # %   `@t  , ;4 $#H   D8[ `0 @&(&&$&&,* < " > `0 H˒ "`$`$ !!`OҐ R Sl u`$@@#`  `  2 3p 3l ( a YΖ Za" @ϐ@ ” Y Z`@@Ò$ a Ya@@$ @ 4at5 l` `0`&@`$@"& L Ҁ,  %  , #H  : @ @( @* @ E @ :`D @@x`* @d@D  0?`  "@20 x@} P* @ 7  ` R %۰ 2lx$ '  `NА   8 Rj  > * (`h ?QV  #耢*B*2 @:   ?eܰ   P@ 2 #L 0w0t$cL#P$cP ,`@ h h#@48 "8t %(%(@#@V0@m  4@ (#L 8 0 4/$$H@  d<@ՐC ?ܰ ܒP> 8ސ% @%$ > ,  #P%$" , ''''2r!%\UFT2  0@g h8   8> ܄Ї(   㿀  '  @?5h 3 > )#h  Mے`  7  Qu $   ?O  `h PX >  < @'쀢?9   쀢" @8  "8 '@ !:` :`  V찒 NF Pe\aT < @"`e > `@?ͨ > `<-  2e- ,`L`ѐ ?`$e`> $@> #V` eL> #P` eL?  ` > D P O 8s!``h 8n %e\F!T@  % `P`h`h#@8 "8!'@JL`р 2`e $e`,``4?@X e$``,*  85  )$cL`8`0`4͐$dH@ `d= @sC 찒 P'`8ݐe$`Ԁ +> `,  $cPe$ "`, &&` " ` " & & &$/e(@&(&$ %%%`t %$`d%(`8%," 6"@"``"`,$cH 7 $cH!Ӗ!Ԑ`Ԓ" @@e0=Xb `0 4 :    @ e0B? 8 %0<  @ %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿈%\U-?  ȸ ̲ $=` (<  ą< Ӛ' 'I Ӗ) !% 0<`8`==9#!#\9$09$89$@9$H= 9#9#9$9$\FT 4" "" ""́㿘6`$` `@ @G AL Ҁ 2` %` `, @V   "#H/, #H8C ` `"`K]` ? 5? L Ҁ`   `M?.`#L8$ 8! 8 $*@$$$㿘`$ b /̔` & , `@H  , / `K `MN 㿘F`!T\@" 4U!@"4> _  &`0&`@>`8 @; @ B >`<: @@ @ d@ d>` ,? >`(>`88,>`0㿘 <  ` 2` t `-  ` `M` 2&@`NQ .h 㿀 L`Ѐ   L`Ҁ " '>  `>  '''`'>c.ڔ$ `` @ P 2䀢 2'耦` Jn` ME 2 N @HL`Ѐ`@A 2㿐@<  &  > "@ + > &!!|> ؒ   /p`l%` -e> " c%`%`%` %`@<%` "- ͐0: @ @ @*  D@ :`D @@x`* @d@rD    ?0 "` -q& `> >  #%`x@`*  P!`@ 0 w %`x@P P* @  X $@ "` @%>  ``R %`> > "<D@Y "` -,_& ` `  l` * "l P`2<\`  `` * "P` `   ` l`  ` P` 2 Pl?  X "l? ` "P X`$2\` %`\F!T@ ,  ``"`p`"t &㿘"`  `,`@  F@I  2@ "`  lP"` 㿘  4?@T 0L804Ր%H@ <d@zC    P`@8 28&8 ?Td@e"    h ښ ,> +`D`D; <0 PyhL? P#%P, 4X%8 %H"@"X ;%0`[0 2㿐>  2)  !> Р#"> > #\!|`    > > #\ `    > > #\#`!   @@I*㿘`f ?``>!*` €> ݐI"L> ݐC"P> ܐ=#> ܐ7#> 1!l> ݐ+"> . > +#8> ("<> %"L> ""H>  >  > "4>  > !> !> "pX > "lY -㿐  '    > a  <`2' X (   @  ( 2 ` 2 ``h :  >  ` 2  > 7! ( > 1! %0  2 %4@(0 i   P@<  %<` 0E $*=@@`   ` 8 ` ` 8` (E?,   ? (`2=(`H$6`P '`PQ  F'    ` @ b  8 P % `X $@   %p '  ' > |!8 2< C > 0C C> 0?`   `  =  `  d`  ) X` !  z  vp " 0j2> ,!H*!h , @  0B " 2<4@O <   2  @ D ` 2  ` L\ 3   `  ? '܀` `޴ P@  <0 @"* $#\  <   ` B   `8 - ` `8 $`8  0@ D : `@ D:  `   @ '@뽐 `H%``  `P@E    `   20     208 0  L`8@ @ @ @ "@&PP5 P@܀`"0   > "P` ` (     e    "  $`2'@(  "  "   `@ 32@@ 䀢  < @ @'@ @ b %=@ ܀  `   㿘 < 2   "   $@"  @#   `?H /d * % t  =# 8 $ 8  t a> G-!+ 8U  8  > !x"  p &I   8     8$ 8+O 8$ 8H 0  0  SH /d * % t  "  *>  .l H 0@# +H /d4t* %t   j< > !*ʒH 0   ด  `?@ 㿘  @7G`  >   `> > #= >  8 > !|4$` 㿘Jאڐ(0<HT`lxhL`ttttt`lX,`x````D*,)*x**)**x*x*x*x*..@.x..// /\///00 0@?" " " " "㿘 `&`2@  _6 ` &@H 0  > 0 ``8 & @H 0  㿘 > > 0  `8 > "p &&a5?& 㿘  " >  "> 6 ` `&"`& > > "@`&" @"& > c"@ "c㿀> 0 H /d> ݐ* %> "> cȠ  > b@d > #DY`""`?""""H 0  0>!+  €> %#H> "!t> "\> "P> !>  > #> "x>  #>  #$>  >  >   0> " H /dcD* %cD$""H 0 > H" >  "!h> `Ѐ  ?"`> c   @' > $ #` > c<   @&c<> $c<#`  r->   c<@& > $ #_ c<  @&|c<> $c<#_  T"@'"'А"@''耢  "?H /d4$"* %$"Ȁ > b@ cDZ"`""`?""""H 0  0> Г+  €> %#H> "!t> "\> "P> !>  > #> "x>  #>  #$>  >  >   0> " H /dcD* %cD$""H 0 耢   @> `ԀQ 2O ? > > ?`Ԙ`Ԁ "Ѐ_ 㿘 H /> * %> > `"" `     "`@3   C 2 2  bH 0 c ?*@4 `"  "` ?"$$ > "@  >  `"#"@@ #"@?b"H 0   "  "    2  " @А0"" @ 0" @0 " @0` > ݐ"T*` > # > > "c㿘`  > ؐ#(H /d4> ݐ* %> "" '?``""`"@" "` "`" &` " "" ""  2H 0 㿘>  Ш` '> #>  Ԑ Ԓ`$ Ԓ cX\s  В $ Ԑ?$&@"  @ &@`A `Cِ D $Ѐ ^x㿐     2? "  㿘> #Ȁ`> ch@ǐ  >  X>  >     * @@ &   @  2  2  $2  2  '  @F D > ?'> ݨ #b > H /d4$b* %$b#H"!$ 4  < $ $ ($ D  @"?H /d4$b* %$b@ $ @ "`&@$ #' 㿘> #Ȁ`> cx@D > ap> > c@*  @  @2  2 &b > ]&> !l8@    %> ݐ @"  %> ٨ %> '> " H /d4"* %""8> `$"8 !t  ??4 $ $ 4 < 0$ $ $ ,$ 8$ @$ <$ D D$ H$ L L$ PH /d4$* %$@ $ @ "`$@$  & 㿘> `ܦ> > c* @  2 2 2 ' 5> 'H >  D $ < $ @ $@" &@$ ːH' 㿐>> G>>>>ʒ p `p!H"`"`"`"` > " > "`> .#>  @W`4, @ 8 > "!l@ >  N Ja > "`> >  #Ԓbh` `4>  OpJR > "c@> >  !bXQ >  Pܔ JC @> "c> > "HbP B > >ɐ#`a0 !> Р#> > #\#Hc H   > > #\!tc X   > > #\ c (   > > #\"\c   u > > #\"PcȒ P  k > > #\!cؒ   a > > #\ c @  W > > #\#c (  M > > #\"x`   C > > #\#`   9 > > #$`(#\   / > >  `8#\   % > >  ؚ`@    #\> > #\ `P    P c 0_@ @, 6S ; @< O,  :  @ :`D @ d@D  /  P $Ж@ ;B ? @ ;B ? ,Ȇ @; B?  @ ; B ?L  "  " " $" 7,& @ 㿐H /!> ݐ* %!> $"`  ֖  bH p@>  `?" ,  @ @N2  "`$ $"`("" ("H 0 㿐 ' > S H /d3> ݐ* %3> &b@" $ "` "` "" bH 0 㿘> #Ȁ`> `@   >   4 2 > "H 0 > "\I  6 6 & & & & & H /d4> ݐ* %> ""  @6  & "  $ & 㿈'XX> `!h"P 7`d '`07` ?`?` ?`('`4'`Ld'`Hd@'`H   >  ȑH /d4> ݐ* %> ""   '`D` 2`$` '`@ 7`  '`@ `" "` ?` `""` "  `'`8 `8"`< # '`<`" "`?`@""`"> ǐ `2` > `   7` ``'@`" $``'` 2 ` ( ";> "H 0 > >!  `  <@  $ L<@  쀢    2 ` "@`"`$`"  L `" '` 4$2'` 8'`  ` '` "@ #   @? H 0 04`  4 @8 2 > "H 0 > ǐ!P'` '`""  @  H 0 㿐> #Ȁ`> ax@8 `( @> `,$@> `40@ > ` > 2(` > "H 0 ` `> #`#\`(!`, y$(>`(4&`4H2`H(,@2L`H&`H&HL$? *@2 `""`?"""L " > O!  2 `L`"`L" `L&`L"@ 㿘8 ` 8T>   ;` @ ;  8B 2> @(> > ! ~Y# 2` ` `? r? * 2 ` "$` X"`  :" " X  ?'@' 'X8   'D` $ 'L 'P+ԥ$ p> #A㿘> !~   6 6 & > >  `0& (㿐'XhX`H /d4> ݐ* %> "" `   <@   "`<@ ` W `   2 ` "@`"`'`" `2 > {"  7 ``'`" '`' bH 0 @2㿘  H /d> ݐ* %> "   2  `" "  & "⌑H 0 @㿐 p  > -"@ +> ݨ?H /d4%b* %%b ` ` 2@`b` `  4`  `$@ " &  $` bH 0   `  > "hH /d* %%b 2$ &8 6  &8` "`   "@" "` &00"`4"&4`"  "` "@" "@> ~   $&,@   /     &   2    @>  $@ > "H 0 > ~"  > (  (&(@# (  &   "`$ &`  `  P$*`"  P*  ;bH 0 `T`$   `H /d * % > cDcD $@cD" "cD$`H 0  3>  |e!  4`4` `  `2$` 4` $`$` x p@2`  | t@2 `    p x t=N `    x | D$` P D|B P0΁㿐 > "> !|("x  55   `  p %, %  `% `X% `    ==   `    h Y" h  ]: %(03> ݨ       `   (  :` ("  p @:  `  p :@`        `   X  :` X"  В @:  `  В :@`   `   :  `   : ม:  @א @ @͐* } D@ :`D @]@x`* @d@HD    ?0 > @j"  ` x@?  P*  z 0 x@5  P*  z!H /d4&b* %&b  H` " bH p@> "   5 `< % <"`"`< <%@U@ D D`2bH 0  H /d4&b* %&b@ # t @G(8 "8bH 0 0H /d4&b* %&b t '@_  2   Ӗ @ b   ` 5 jbH 0 @Z㿘@ `'>!@*` € !"  > "H 0 > S# !` 4  @ `  p  >   xp@>  |t@ > "H 0 > /#HP Pzu D ?*@4 `"  "` ?"$$    4  ` $`"  "`  $  )> *`,   @Y, * D@M D  ("+ ? `"` """  `"` 2 Ð  (  2 `<`"`<" &`<`<" (2  ("/` `< !>   2 2 >  ?*@4 `"  "` ?"$$ @ ` "H 0 > #p?*@4` @`"``"``?@"@$`$@` `"``"``` "@$` $`H /d4#D* %#D#D $@#D" %#D$`H 0 2 @- > "H 0  ` *`> ݐ"T > # > B#> "H 0  ` *`> ݐ"T > # > -# 2 㿘> #Ȁ`> c@걐 ` 2` `8`"`<`<"`<`<?`8"&`8&`<` ``"`& `?` "@&`&` ` `2`H?*@6` @`"``"``@"@&@&``H   2 `H`D`< "`D`H <"`H`D"<`D`H`<"  `L-? *@2 `""`?"""`L >     2 `D`< "`D <"``D"`<`D <"@ H /d * % > cDcD &@cD" "cD&`H 0 㿘> #Ȁ`> `8@  ?  *@ 4  #>  D@ D  ,    ,`@ ",  @( `"  "` ? "$ $ H /d * % cDcD $cD" $cD$ H 0 H /d * % cDcD &cD" $cD& H 0 㿐 >  xP# 6 & 6 &   &   X& H /d5> ݐ* %5> &  ; @( "  bH 0 @0  6 `@ & @"`"`@ @& H 0 㿘> #Ȁ`> `H@R  `2R  8 2N  < 2J  @ 2F  D 2B  L 2>   ` 8 6  $` ("`( (? $"& (& $& ,  @?*@6 `"  "` "@&&  ! O& @   > "H 0 > ~k ``   2J `82F `<2B `@2> `D: `L6`2` "` 0,"`` `?` ""` "`H(> DD"@D  D"`H > 8  8㽰  "'`   : ,"`p8' "  'P'X "'D 'L  :D ` ,"`  ? '@     0/> ( `t : @|x  ?@ B <? `0 : ' 8`d@{ג#\ @{ 2`0u'? - @: 4/`0`P D*   ` :   2`0     2`0@8 `0 `L`e8e@ @@ @ 84<  '?‘-  (@> ~ >  @H /d * % DD &D" %D& H 0 㿀 \'''  #> txH /d4$b* %$b  ^'`[b  >  2>  a2 ?> "H 0 > } ؐ*@2 `""`?"""H /d * % > cDcD "cD" "cD"H 0  ` b> "H 0 > |ǐ H 0  bH p@ 0? " K `  P'  P'0t? 3:` w,  : ,d@z @ >`G #\8 2'02%&@ִ(8 "8㿘> #Ȁ`> a@  2  0`" 4 4"`4 4? 0"& 0& 4  @?*@6 `"  "` ?"&&  `"  "` ? "& &  (`2  0   2 `<`"`<" `<&`<"H /d * % > cDcD &cD" "cD& H 0 㿐'H` P'T@z < > !u&#$ 4T $\4  $ 4`2@` `@  `>  u  55 `  4 H /d4> ݐ* %> ""!>  04  t   4  4$ t  4 4 $ $H /d4> ݐ* %> ""> ` `$`"`$`$   4 ``$`" '``$"H 0 nH /d4H* %H'"   ` $` ?# @4 H /d * % > cDcD $cD" "cD$ H 0 H` $ ` "`$`$    4 `< $ <"`"`< <$ H ՘    2  "@ "` & " $>` @~*   ,` $  @~*   , " @~*  " , @~*  ,@$T ` 2 @ \  4 `< $ <"`"`< <$\  "2@` (@H 0 8 @v`?  "H 0 i  h&HH /d * % > cDcD %cD" "cD%H 0 "H 0 @    2> za!( P` > >  > "H 0 > zI!X` (2` %   @5 L %L" L"L%"H 0  㿐H /d4> ݐ* %> ""  P 8  <:`   Ә [&&  @}đ<*  0 ,`"  "` ? "& & @} *   ,` &  @}*   , " @}*  " , @}*  ,@&   2 >` & @}<@} 2   D  2 & r⌑H 0 㿐> #Ȁ`> a@1  ?*@6 `"  "` ?"@& & ` "`  "& &  2  `  h"`  "`  "  `0 U> >  B#?  8  *@6  @2 `""`"@""`""`"@""H /d4D* %DD "cD" #cD"H 0  `0  > "H 0 > y!H /d * % cDcD &cD" #cD& H 0 㿐@@ `( " `( "`"`( ("> bH 0 0"" (`"  (` ""(`(" > `"H 0 @ 㿐> x!> al!> 2   :  @  > `$  qڒ! 6  @6 6  X& & 'H /d4> ݐ* %> ""` ` P8  <:`   4    2 ` "@`"``$`" >`& @| *   ,2 2  D2 1 2 > "H 0 > x/!@> "H 0 > !x ?' c 2 "  `j6 㿐` > e<#$` @ qD!  4 4 $ $ E   2  $  " $ ?# @4 $  "`   `  <` `4 D $ D "`D&D$    4 `8 $ 8"`"`80 8 @{k*  ,` $  @{b*  , "`@{Z * " ,@{T *  ,$    4 `< $ <"`"`< <$ > "H 0 㿐`  H /d!> ݐ* %!> $"    `   R @    R @  > "H 0 > wG"  ` R"""H 0 㿐 > `0`  > @i"(0& H /d4> ݐ* %> ""   Z 2  bH p@> w"H @X  ` `?2`   $ `    R @    R @  > "H 0 > vݐ"p  ` R" "bH 0 > `?"`H /d * % > cDcD &cD" "cD& H 0 0 ` `?2`   $ `    R @     R @ > v"  ` R" "bH 0   `  @ > @" $> `?"`H /d * % > cDcD &cD" "cD& H 0 0KH /d4$b* %$b 6   &  쀖 bm  bH 0 G0%   6 `@ &`@" "`@ @& bH 0    $   `  0 "P  '`  ' '''蒒 > @*"H /d * % > cDcD &cD" "cD& H 0 㿘 8@> uÐ#H /d4> ݐ* %> ""  ` >!\*` €@ F%\aT @ޒ@+ !" > u#0 Gb ( 8? # 8 *@ 4 `"  "` ?"$$ H /d * % > cDcD $cD" "cD$ H 0 bH 0 ސ H /d4E$b* %>$bH 0  D S $ H /d4$b* %$b ?c  4   Pnp D `P Dnk P> "H 0  ` *`> ݐ"T > # > u #X 2V bH 0 㿘 ""> v#046  *` ,)`?#> > `P@ @@ > "H 0 tԒc "#@  #@   2  2`P`ґ*`㿘  "  > "H 0 > t#" 6  x@w `P*  0@  > "H 0 > t "H 0  O I & H /d4> ݐ* %> "" mX @u: 0` D> 0  > ` `4 H p@> tX P`* `( `$ H 0 > > ` xt=`  * `X@`$  H 0 `> >  Ȓ`tB ` * ` H p@> ` t ?# @ 4` ` `2` D `\` 4X` S`,*`(" `4 H  0 D :@r``4 @ ; B >`` `X*> >  < 2 "bH 0 sɐ!("   > > @ * 2 "@"H 0 saP"@`0:` ,` 0`< @r9B `  2` ``(*   *`"n: >`` `X`?* "@` `2`㿐 ? "?> sd!x"6 `x@v~ `P*  @  O> sS! !& l+!@t !0'` D#> 0  > ` `4⌀ H p@> s+ P`* `p ` ⌀@H 0 #\#`> > `!s `!  * `Д@` ⌀@ H 0 `> > #\#`"`rB ` * ` ⌓H p@> ` rא ?# @ 4` ` `2` D `m` 4i` d`p`(* ;`4 X `0 T :@qL``4 @ ; B >``  $`Б+  > >  @=  ⌑H 0 Pr  <@    >  @*  > "H 0 rk8  ;  0@` /``0`< @pB ` " 2` ` + `p@ @ `  ? @"?m : >`` `И  `?* @<` `2`㿐 8("' 8@6 '?*@4` @`"``"``?@"$@$``` >!*` €@В @  `  4` `$@" '$``'> ?"$ "`"  "`  "@"" `2`? "@ 2 8`"<<"`<<8"@"<"8@ِ `2 ` "`? $ 8 4  0`" 4 4"`4 4 0"@$ 4$ 0@` 2 `?  2 $`"(("`(($"@"("$",`2 H /d4D* %DD $@D" $D$`H 0 ^ @ڒ Y ` `@~4` R ` `@4` K ` !" P> qL"`` j D`  S` ?# @``4` $` %> @`q2 `   4` `$@" '$` 8 > `  "` m `` *`> ݐ"T > # > q " `2` `##?  ` 4` @`"``"``@"@$`$@`  4`  `$@ " & $``2` 㿘> #Ȁ`> b@j  * @ " D> pː"``D 0   2 4  `     `D 2 㿘> #Ȁ`> c(@2  a 8 " ,> p#H ` `"  "` ? "& &  &  "`"?& @" `P  * "  P*  @; `"  "` ? "& &  ( EH /d * % > cDcD &cD" "cD& H 0 㿈 > #Ȁ` > cx@  b2?> p'#! @ 6 \F!T@ x @s9 `P* @ @s2 `P* @ `h  h! r O& `8 > b4 "b4I0    D  6 >   > o#7 `  *  ?(@ (:   ," $ (> #\#` > @# xoÔS#@?* X@ `"  $ > @>  x8o?"@ `$ *   ? p@ (@2  (@  , "  (@;`> #\ > @# xo@:?*  А   @ "  > #\ @>  x8or ;@ ?# @`3 } `"  0`8 2 0> ` "` 0?  4?> oQ P2  2 0  4@? 0  < 2 0  4@? 0 < ??`> 0킐 D " <K  <J  ?*@2 `""`?"""%>!* €`) > o x @y " < @; < ` ` 2   <k  <` *`> ݐ"T > # > n  <2 ` q > nӐ   f 2  D 㿘> #Ȁ`> a@N    ` 6 "    `"  "` ? "& & D & D "`D"D&    6 `8`&`8" `8&`8& 㿘> #Ȁ`> a@  " > n{!0 * 02  2  ` 2 `"  `""`? "" " D "  D "` D# D" `"  "` ? "& & H /d * % > cDcD &cD" "cD& H 0 㿘> #Ȁ`> aP@ص  b2?> n!h! ( @6 ? `"` """  "  (2  (   DU  D   *` , 0`?#>   m`P   "    ` 3  `"  "` ? "# #  D #  D "`& D D# `2 `ˑ*` "  `8 > a "a- (2*  `"  "` ? "& & H /d * % > cDcD &cD" "cD& H 0  㿐  ` R & H /d!> ݐ* %!> $"   㲖  "H 0 0  `" & "H 0 㿐H /d4> ݐ* %> ""   ㇖ 2 "H 0   `  R  > 0 R  > m#! `   R`"  >  R`"  > "H 0 > m!? c 2  `  2` ` "@`"``&`"`@a D " @(#?  2 `""`"@"" @ 2  <`" <"`" <`<" @2  "2 ,"H 0 0 @p"H p@   0 > @Ր" `> l"8㿘> #Ȁ`> bh@  L D< ": ? @4. 2   @( % ` "`& P  "@$ $ $ $  "" 2  L @2 L  D枒 L 2  ? ` "`& P  "@$ $  H $  H"& H L 2 㿈`> 0  H /d4> ݐ* %> "" U  ⌑H 0  `@ > `<  > `D > `L > "H 0 > k"0`8 > "H 0 > ` "> ݐ"T*` > # kǐ    `$   > "H 0 > k"Ȁ`  (" `@!⌑H 0 %Ӓ `"!  ฐ`     (   $  `0 ; %``  ``P@ilD   `     2`0     2`08 `0 `L`e8e@ @ @ $DF !H /d4&⌐* %& \  820⌑H 0  㿘 ؒ > j"H /d4> ݐ* %> "" t B'> > #Ȁ`  @t 8 22 8 2  > "H 0 > jΐ#( "   2H 0 H /d4$* %$ t > Ѐ`@ H 0 㿘`  n 2 X $@   0    $@H /d4> ݐ* %> ""@  H 0  @] t @* 2 `H 0 u ` "` ` >!ؓ*` € 2 @@  H 0  $Ԑ 0'sH /d4%* %0 2 8@ H 0  $ 0LH /d4%* %0 `"` 2 ` `8 @ H 0 $ H /d4%* %%`2`  @  yH 0 0 , @  @ `_ @s WH 0  $> 0ݐH /d4A%* %0# @P 4H 0  $ 0n纐H /d4%* %%> "H 0  ` *`> ݐ"T > # > iO#P 2 ` @H 0 爐H /d * % %ߪ  H 0 H /d4%* %%@ t H 0 . H 0 M$H 0  ђ   `!u    ``  㿐> #Ȁ`> cx@g  '> ݨ⌑H 0 H /d4$⌐* %$⌐  " * DH 0 0#K  H o4G$⌒*@ e0?H /d4$⌐* %$⌀`` 2` `@@M ⌀"` `, LH 0 洐0#  H o4$⌒*@ e$0H /d4$⌐* %$⌀`` 2` `@@  ⌀"` `i⌀f  w   㿈> 0 'D> #Ȁ` > c@ҫ Xb 3> ݀ 2bH 0 D `3>    AH /d4&b* %&b2.   H p@> gߐ# bH 0 ``   !6    !-  @ & ``` 2@`@q bH 0 '0#bH 0 0H /d4&b* %&b  'bH 0  H /d4&b* %&b2 "   H p@> gS#  ݖ  > "H 0 > g@#` 2'b`,  @'bH 0 찒 lH /d4&b* %&b2YbH 0   :`@i @e @i* b_@ E @ :`D @j@ipx`* @d@dD  0? 8찒 -u찒 H /d4&b* %&b2  H p@> f 2 H /d*  > > %> ""㿘> !l * * @hv" > 2: @ > > "8@ >  `  "`㿘> 0 > ahU# 02 > al@hO > c耢C 0Ho  "``  0> "H 0    ސ Ho * "`> `` u"`H /d4> ݐ* %> h"" "  b  `0> > "<> c ` H> #"<#c "D> > #8> c<` L> ##8#c<"D" > > "H 0 > e 8` #> ݑH /d4$b* %$b> > Жc  ` "> "`& >{ b>  (X#7Ŗ #$b` &#ВH 0  㿘> "D!> #В`"9 #Ѐ  > "`& > >O#㿐H />  ` > @ h0S* %> ` > ݘ   ?""> > ` *     +( "H   Ζ    > @ @c 0 2(`   ⌑H 0 㿐H /4> * %> !p> ݖ  "b> #@>  *   : @ ` **  ' "H 0 0u> @_ 0q> H!! $@"  2x @@ ?L D "?D@ ; ;"H 0 ` À@   I > @ 0  = "> @  @ H /d4%"* %%"`@"H 0 㿘 H /d4> ݐ* %> "" W ` 6>"*` € 2 D`F D >`@;  "7`7 `.  ,@ " `( ``2  > "H 0  ` *`> ݐ"T > # > dF  2  > "H 0  㿘 *> #Ȁ`> a@ξ  8 `' #> %> 2  8@& 8b  6 $b 8 ` 8 "  [  㿘`> БH /d4> ݐ* %> ""> #Ȁ`> a(@΂  x `#> %>  L x`& Lb (5̖ $b x 2 L` > "H 0 㿘 8(2 > cǐ!8`X <@ > c!h㿘> !eE㿘> ƀ!  @ H> )#H'`4 .`*  *@2*@ ` > ݐ"T*` > #  > > !a#\ƀ ` >"8*` €>  "  ƀ $cH ,>  0"  #\ ;`ƀ ycH>  $"  ƀ pcH>  ƀ#jcH 0>  4# #` @#d D#h H#l ,#p (#t#\  $ ƀ ScH>  >#x (>  ,##\ 8#` #d#h ƀ @cH $>  ##\   ƀ 4cH >  (  , #\#` #d #h#lƀ #cH>   H  ƀ cH>    p>   ƀ cH>    ƀ cH>  ƀ cH > ?ې ЁZ t @`$@> b N`Ҁ ` @   iN`Ҁ ``$@2\.`_ !  | W!> !?c |?# *`# <@ |  "!> b! . $! N $|" |$  $  8$ $ $ %|b x`Ԕ!Z1x!Ԑ`Ԓ" @c2@`[ Za YZ"xx Za" @c#@at[ t ?$ 㿘"   $`H 0 @’6_H /d4`* %` ?2 ,H 0 ?J?Z  `" 0(@    ͖ "ʦ ` 0(@? *@Ho * $` > "> ”03Ζ  㿘j ``@q  0@ !taD[ t -㿘Ͼ㿘  <`> a!8  㿐> 0    L `D  > a!P ` 8  @0H /d4* %& ,"H 0 5 㿘`|. `D"@ 4&`D`8@ `PY`D&`<`PY`D&`<`< "&`H`8(&`8H /d * % 㝐H 0㿘 $`H 0 5ZH /d4`* %` 2 ,H 0      ` "?> b!h?$`51 㿘  ``" > a!   9 㿘  . i $ 㿘 > `!   bu 㿘> `!㿐 "   ` "        #\ @  P'D X' " 'P\ `> € `> `!@%@c+8? "`"D@N I@ k'  ` (ഓ,` (  :@^  Pഗ,`p @@^ P:@??#:" 7`  ,   ഓ,`(  :ഓ,`p   * p@B   0*(  @; B  `%D  2` ܰ   `2   X*`   :ު0 `Б* @@   ޝ '  8D ߧ `8"2) 2(> _" @^ `8 > G>`x!H&`8 8 HB`B ; H; 8>`0` ,`",   `3 `P* V SQ: @ K`%D $ 4@@?:`P,`,@ B / `P*@  %:": `%D $ 4@@ ,``P ?, @ `? ' D  `V`@S``"((@]oP ;@??;@ 㿘 X'T" ' `  ?>   "P_442r ` n   F?f_`$ @]  2@(ﲦ@ >D@ e`@b>D d "&>& "  @]4 @]-@]k >&:& D@]{@ d 2`$2`$ T> €"T"^Ɣ  2" 㿐 &'> !   ` : `8?2  `  `8?2 `@8?  X`(43 ?> !   ` : `2>  `  `2> `@> > blp$ @?`y @y  "s?  `    `>     `>  ! > > > "bȖ^2 ` 2   @^  ,4: `&` : -`  aB * 2`   - 4-` D-`> :  l> "p  @   2: 4?@ 2?bl!D@&bl    bl?"&bl $@  @ $``͠ 6$`/>  W@,  "@    ?@* "@    $`$`$`$` ` `* &`  ?,   B"@ $a4$a($a,$a0& X `8a` y " #      2u@ P  "" $ e@ 2  @@; *  *` ?"` `    ; *  *` ? ` ; @ $` *` * "   @  <    ` 8`   ` 8 > ۰> bd`a<$a<$a@""` $a8( @ "` 6@%> @, @`" Wh &@@r ` "l i bl& "&bl?㿘 <!8 "!<`"!@!@"a@> ""h!@?!<"$!<$!@!D '>   @ %> ,` `W) @4  1  * *    !D' l& "$l㿐 2< ?+ )44@&#8 2 @> > > "bȖh\!U?"@@<"@$<$@<`$<<"a@> <"bh<"<$@ 240 ?4  $4 ?X"@8'?@,`&= *  *` ?0     ; *  *` ?  2$,    ` <  ` ,>  `  `  ,> ` ,> \#x@ " ڡ =`     2i? P `` !""@$ `ڄ X?2.`@kk 2'` @?2'@k?0?'@, 2 `02 ` $, `   ?@$0 ')&   Jΐ?, 2M$, @  = *  *` ?k?  ,㿐 "? `{? ?`:  C ,  C, @?" ?"f? >  `:` + > > > "bȖ[W! <`    D? `6@ " `  ? "@  !'"#@  @   ?"@  '!@&" @ > [! ٪?0٧@"&㿘 `"!?@ 2`?` ?`?,   2   ?,  @ "? . 㿘 U  * &  > > > Ð"bȖ0Zʔ"`* @,  : @&`07`@j:*  *` :    :*  *` :*  @ * ?  $ @ " ` @Y 㿘 # 2 0* & `> > > Ð"bȖ0Zn"`@@` @1㿘 " 2 u0* 6> € > > > Ð"bȖXZD"``@a: *` * "㿘 % * @ `> > > Ð"bȖZ!"&a>` @`:0 " *(""(㿘 H  * @ a> > > Ð"bȖY"&c  :`  : 6 !(  $!(0# ?#!(    >   `Y &  > Ñ*@ Y֐a B*# 㿘> "``g `c@ Ґ0[: ` > Y!H `+> ð@ ` "$@Yap 2    @  `? "  !$@""`> Y! @* "> Y! & : C8 C *> Ñ, @2  " Yn! C,  ?> Ye"㿘'D! D*@  `` D * @   ``?@\b 㿘`&a >` @>  @ > > > Ð"bȖ8Y#x   ` C C&>@*  @ C C &+  @ *` @ ?  C @ ` C2`@ ? #@@ 4#@ ?"#@ 㿘  @ > > > Ð"bȖhXҔ#~ @  > *  *` ?2 > Ð"XĔ㿘>`* `*?"@   2  `  >`* `*` ?`>`*` `* 3 ` ?>`+``*2 ?+`*"  `?&  ?>`+``*+`  > > > Ð"bȖXX# a" ~    @? 㿘> bl>  p L > "d3> 5> 7> > "d"C? 24bȖX #? "44?<`@"a@%@?<""<"@"8 ,`,` @ " ")> ,  Rj!, u r l"p"@ %l 㿐> А##\!> > Úb!   O$!S"> "d""d"`> #`> "bp> *"a㿘> "d`" > > > > Ð"bȖW$2PĐ!㿘> `4>   V|> > "bx"t>  |>   x(  222㿘> 0 '> %> | @x*` "  @2 2    |0 2  㿘    [ l> b|>  @ x* @` `2 @`@2@ l C  `2`"|@ bx*   & " " &    2   "" 㿘 >  b`  ``D > Ð# e  ` 2  [ "W  R $ `XD  $" ( 4> `X $`29 @H 2 ?@ܔ  @   @?  `   :p  `  2  $ `X`$ " T       `        ` F㿘> "``"   D > Ð#8_ Y?   "  @ A p  ` '`@'`*  ''$`'&   ` ? <@   ` <@  `7 @   X $`@?     ''䀥2 X X`  ?@8k E  `   `z       `    '   ``L쀢   0  P @Ѱ   `   ! >$ 2!$    ` 8 ` 82$  `  ` 8 2$ ` $   '$  8    찒 R> G8`B :8 ' ' `    aB 2` * @ *   `쀢 "    `:   찒 ! `쀍!2 P?' P@   > #Ȁ`@ ` > ÔX@ ! "" @$ J`") * `2   ?"2 ' `2䀥@ ' 䀢2  "'  "  `2  `@d  2 $  z$ '   $      z`  '$ ӈ2M` "I`  D` Β `  `   aB * 2` @ *  $ $  $  $ % $ $  &, ~$ `ܐ(` $`В `@$`R?`@ީF  2  > G0`B :0     ` ? @   `8 / `  `8 &`@8  0    ?   :`> Ôh@  `    ?   :`  $   >$ c ^` $  a$ "@$   2X& 谒  `    b / b)`耢 #` 2p&  `  p@  & @   0&' 0؀`+ (`  }   2Xv  谒 o耢 &`($`g В  `@]$`1В  `@$`X `  А 5` C`*@?$`܀`0 -А $  "`0.*@ $`   2XH& 谒 ܀   В  `@$`&`@d 㿘 > `X#  Tܘ 0`> SK#㿘  ""  @ > Ð ? @ $> T#     > T# @    J@ `@ &J@J   㿘`(2 > S #В&`.``LM  X`($ .  ` 2` .㿈 ` ` `" X> R#! $@  ` #\:`  " "`  X $@ Ő"`:  :` ``"`: :```  $` ``   @"6 Xb`8``P Kߒ@` " X`I`P`@ X $@ ="`D6 `"`P2 "`D&`P` : #\q  a``   @  2;`  `  $  X`$`2`   ```    ` : `  2!` `  2`@8  `` :  8 `` : 8```:      X $@ ׀ ְҰ "   ? ` 6"@4   $%   ? `"` `$ & @ @ O X $@  ׆`J`  : 6> Q 66> Q 4`   `$ @ Jǒ` ` "   X $@ `" : #\na` `` >$`` : `  ` ; `` 8`/ ` `` 8`&` !`  n` "``` `@:   ``㿐`   " :    _   `@ d "  2    ~"@  a# `X $@ ` `&`^ ؒ' 0"`X`?&`` ` ``?2`` &``X $`@  ΰ C  $ 㿐```:  `  7" X`( * `?&` X`$   q{``  ```?2`` &` X`$ @h ` ` $``  `      2C >` ܐ  #\#`#h#d#l   2/ ܀ 2+    `4 M  .`2M  "  M .2    D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ܔ`X 찒 <   #`#\ #d#h#l     2> QI 8܀  " 㿘 X      p  @ X  " \ \ 2   `  t  \@    㿘@)G     X .2`,`@  @r 2,``.  *`,` X    #> Đ 4  `x!,     , @ 4 $ ,`ߐ  㿘  > O% 4?#  * )`*` X $  " ,3> Đ 4  `x      ,  " 8$ ,$ ,$ ,   4 `Ӑ  㿘. X@ , $ %`"$ (  2| E  `   p@"  p E  @2k E > X#̗. `> OԐ Z  ( Z`"Y  , (. > +0`D   $ <  `   p@"  A   @2<  > X# > > Đ `O/ > + D < $)   2% E  `   p@"   E  @2 E > X#̗. `> > Đ!O{0  4  E 㿘@  `    X,2`,`   @h `,``,  *`,` X    #> Đ 4  aX      8 ` 4 $ 8`ߐ  㿘  2?> N #ߒ  * !`*` X   " 8#> Đ 4  aX     8 ?$ 8   4 `ې  㿘. X@ 8 0 %`"$ 4  2| E  `   p@"  p E  @2k E > X#̗. `> NȐ!`Z  4 Z`"Y  8 (. > +8`D   $ @  `   p@"  A   @2<  > X# > > Đ `N/ > + D @ $)   2% E  `   p@"   E  @2 E > X#̗. `> > Đ!No  4  E 㿘    @> ML!И   > !>  " @   X ` M5"㿘 <  H  抒    o ;0 Hbf 2 @> M "'أ.''''ܐ g ]` 5<` `, L @a @  *`$ @ &`$@N &@$b  0@  8 "`  &&@ݘ > < 4& @ 4&@ >c0甔   -@㿘 < @   ` *X @" 欐0 㿐bؐ .> L"8   @1 @> ,@''adS `  $?$ @ ?,@   .`"`$*@&`$㿐" @Y   $DO @g p"D=  @=Ԁ   " ,3> Đ 6  bX     ,' 8'   <' @'܀ " ,@  ( @ > +. 0@  D '耢 " 8@  4 @ ؙ. 8> +@ D '& $& (& ,䀢 & 0& 4& 8& <& @ ?# @6  8 4@? #ߒ @6  4 2  ( 2  0 2   $ 2   6 ?# @6   6 @ΐ  p"C [ @Ԁ R  " (3> Đ 6  bhf   2  (`" 4 ,   > +. 0@  D & < 4` 8  쀢 . 8> +@ D & @& , ( & 8 ?# @6  8 4@:  ?#ߒ @6   6 @j  㿘> 0 <` 䑒    ,  X `"  ` " @m  $ 4 㿘" `@   *`">c  㿘> `4>    > "b> """"`p>. @  0  @ `> ' b<> b *  $> "? 2 2   ` "` "  "@$ $ ' 2 > "#> ` > >  4b*` ؐ "b  ℒ  DN b`0$b > J|"p' D  >   > Jw"x ` "` " ? "@$ $ `"  "` "@$ $ $ @` $" $$  4 $ $ 4 .  .`@  #@  $     $'?''''''' <а  @ @@J @R    0 4 `"  "` ?"$$ @2.' 4 2  ( 2   0 2   $ 2  4   "' < 2  @> + 0D $ < @ 2 ' 8> +@D $ @' 㿘`` ?&`` @`?  &`> &`b``&` `""`p> 0 `> I"` 2`Y > I"`(` %> Đ`6` t `   5 ` `* ` 6`  ?ؚ`$'''''''' ` " ` "`r`?# @6` 㿘   X`"?o&?  㿘  `>`#& `  `  F``B L  < #.%!" 0.&$ 0&" 0#kO ː' 㿐 `   &@㿘"̒`D  `0`4&& 㿘> a  "a 㿐 `` )&  ` ``  ``l  &P"&▰ F& h88hh8hhh``(4@LL֔֔֔$$֔֔֐֔㿘 > b8* @  @ "   ԑ  㿘 > @b8* @`  @ " #" ( "s ` "`L"   ` ::p. " <$`  d2 ``X ``   "㿐 `D ``Ʃ  ` (  V  &  "`    " ``B > `  ?> + D ;"`  "` #"`> + D 0"` 0   &   ` : :`      ` : :`( ``B > `  "    `> +DD ::0  ?&  㿘  ``<`>"(*` €`X $`1  2,   2 Xd @2    @"    p 2t h`<㿐     ` (  V  $  "`    " ``B < `  ?> + D ;"`  "` #"`> + D 0"` 0   $   ` : :`      ` : :`( ``B < `  "    `> +DD ::0  ?$  $` $`  `  /$` $` `   p $`   `  t $`  `  ( t$`L  `   <`   `   $$`,  `   D$`0  `   ,$`4  `   @$`8  `   4$`<  `  $ H$`@  `  d X$`H  `  l P$`D <  ( $`(2 X@$`( 8$`(  `  h :3`+  +`  2`*  *` <`P <$@ `<`X 㿘   @    `?2_ `?2[ `?2W `(?S `L?O`T?K`D?"`HE ?"  X $`=   ` `  p   `   "` '` 2   `     d@     X@ > 3"`   `H9"X `  d X@  `H?# @ " 0#"d d "d `Hcd  "d `? X "X  `? `HcX  "X  $ `H` Ű   `   d`   `  X`  ` 2 X`?"`  X $`  `@ ` ?2 `$?"4`,  `    <   "  X  " X  $`y  @ ` @`$ n` 8  2`,`$(`, `,?2 X`4?"H` X $`2V   ` `  p  `4   "`4 "`4`` <  5`4?"`,  $ `,?   X $@   "  $  ``4`, `   X $`   @  㿘   `   p     " @ "? "  < b" 4 O  `  t  2 d" "  ` @ 02@  ` o 2  $  @`"    ` b2 @ 㿘   `  `` p ` ` 2``t `p` 2``p@ 2``t`   2`  `  `` t`  2``p2``h: " "`_ 0" t" pՐ` ` `" `  ``" > Gh ? 02% > Cϐ"2`` $`  `  ``@ 72@2  .`  ``@ ;&2@ " t" p_` ` `" `  ``"  !@(֐   E㿘 `<  $`  ` d X` 2(    `  d` 2    X` "     :`" ϙ  ϔ ݒ0[Y㾈> )  cH '  $ > C)"< 2X# X@    0`  ` `R c  ` R c k `  `2 Xd @  ` @U ` $`` ` `` 2`` $`X`$ R X`$`2   凜リ `?$`` ` ``?2`` $`X`$ " "  > H< ("ߒ ڒ  ܡH > u"㾀> )#H  '     `' ' $$2`X> B\"X  #  X  N ܚb \;܋܉EcH !@    ` d X` ԰   ` d X` Ű @ + `<   %#U ` @%> A# % cH@i x   `  R c   R c  v  `  dX @`  ` ` d`    X` ے Q   <   0?<  : ` l`    ` c`  )  @J`.@  `      $` "͢    $ ` ` 2` $`X $  `X$ 2`   ^  ` ` S`2+) 퀥 )ѐ`  "`R0@2> @#0 B  2 `@> @ސ#PPO`  ` `R c   `R c  ` $`` ` `` 2`` $`X`$ < X`$`2  `?$`` ` ``?2`` $`X`$ p m x 푘 #\Z`?$`` ` ``?2`` $`X`$  ``   > ̪ w`@> @> @L#P @2` > @D#``   `b  1 ` b* `   `# 2p@2  @"   ` `  p@      @    <   0<    Ұ B`` ɰ Bǰ ʑ    `2 20  2 `?$`X`$ J  ?% `X $ > +X $@ &ࠀ2  `  ```?2`` $`  ` `?2`   %     @` g Ӓ ٠ ˒ ٘ ? %> ?o#o Bٹ䀢 2  > ?]#xٮ i "> ?P#x > R#$  '   % 䐂 `˂ ` L Gy 5cH > <`n ?$  ?$ ` `?2`  ?$`X $ ǂ cHEcH > #`> )#H` ' `$`> >ِ#  ` R c   R c  L/> H` "`p/> H !  ̰ 2:  ` `  ` "``  `   `` t  "t `` t "ڐ 2   # "` > H8ݐ (``  ؓؑH $`` ` `2̔ " <$``  ``2 X $@   $ ` ` 2` $X`$ ̒ X`$/> H2  2X (`> #`"+:> ݆#'' '  '"' '`/> H''`#\  2h`  `ؐ `":``  $` ``  ̒ @K ȐP/> H74  X`$ Ȕ"`D6 ̖"`P 2 Ȕ`D&`P̐`X$ `2`  "Xh  $@ _Ȱ  ꢔ̔Ȑ껖 2 "` `*"@?$ ` `?2` $X`$  $``  ``2 ` $``X $  ט 7א(דH > g#㿘  @  " @׬0us      B`` 2`  B `` d X` t   `   d` j ` X` a `)$` ?$ X`$Ş ś `  ` $` `$ X $@=ņ Ń 7C ǛX $@# `  ```?2`` $` `  `?2` `$ X  $ @ @?` @ s Ր ېِ㿀 (`  @s ?  " @= X (@ 6   `  ( <`: p 5֔  ` <`:  $   #`#\  #d#h#l  š ֍㿘   !} "$" "@   i 2N  "J >  >  ;# x p@25 x | t@20 x  p  t x " x 8$ <($ 8H /d * % H 005?2  x |?2 x P@< D$ H x?2  |?2 H /d * % H 0 >   ` $ L! 8*` €㿘 ? >    2   <  `  R  >  < 0 `   `   p ` 2  t2  > Œ< X <`C l>  `> H`"c"* @㿘 > `> H`"`"* @㿐 `D c`  ` *  "Z> Ґ  $  "`    " ``B < `  "C ?> + D <"`  "` $"`> + D 1"` "2> Ґ   $   ` : :`      ` : :`( ``B < `  "    `> +DD ::0  ?$ > #> H*` €㿘 > `> H`"c"* @㿘 > `> H`"`"* @㿐 `D c`  ` *  "Z> Ґ  $  "`    " ``B < `  "C ?> + D <"`  "` $"`> + D 1"` "2> Ґ   $   ` : :`      ` : :`( ``B < `  "    `> +DD ::0  ?$ > #> H*` €`>L(`  `   ` $` "`     㿐    `h     #\ i 㿐>  !` ` `2 * `$$ <>"l*` €$ 8`  `` ( tg > H b& $ 8$ Ӱ$`$ 8`  @ $ @``<``* *" * *" *<``& 㾀> )#H`$'2<> 9/ &  `   > H3~ (0A` &"`p ` `    ``  t   "t ``  t  "`  ` ` "`B 2  ꋔ "`> H3E (``  H $`` ` `24 > Ґ! `<  " <$``  ``2 X $@ D ` `   `d `d 2t -  `  ``@ ;2@`X$ `2`  2n凘 2@> H2ϐ (ҋ &> H2Ɛ (҂$``  ``2 ` $``X $ "ڒ " <kH > ?  P >  2 > ބ  8> ބ 8, 8 < "  <ࠀ  ` 2``?"`" <`@   3  `  4  ` `   #  ,  #  @ `@" "  2   , `@  " "  @  2  㿘'` > 7  `"0 "  @"( : 2 ` (@:*?& $@:%&&>!@Ӑ   `&: @"` $` '> Ő@> Ő 8$ 㿘& ` N<@ 2@R`(@9?`(2ΐ >#ܐ@ "4 X  @&0/ `"" > Ő! 8Θd> 7@!P@8 > > +D  "D"ര  "`d> Ő@p> Ő!87d 㿘& @9  ?&,    $    㿘` ` ` @ *> ?# ?*  *2` 2   & `.贆<.`  (@9V?26    㿘  "f. @@6&@  , f@:e   ݲ`f@"   㿐 .`f, `[?f (` fҔ f, ` 0j P``$&@8 2  &@9>N:@ `/>&@9s2   2`"  6  N "* &N  6 N "* &N @e >( >N :   > Ő!7d> 6!ؖ * . ` .`f,$` @` ?2` ,f`$1n` 㿐 .`f, `y  ?f (` fC t 0e P`( @8>L:@ `(`5" : 6  @F   @F    > Ő!7Ed> 5""@L *` .`  *``> Ő"@72d> 5"P>  +@, `<f,?$`  ?2 ,ff,@ ` 2``(0 㿐   $@7&@ @ >  6"x>  @ܔ0;&,*`?& (` & 0& P  $@8q&@>`L@ `:  @  > Ő"6ϖ$> 5A"Ȗ * +,@  &,`$   2 ,&3㿐 @` 8 (>  "5"$@7&,,  ?& (` &e  08 `P@8" (6`L@ `: 6` > Ő#6$L&`6`> 4#8 @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,&Ұ 㿘 ``$@7&`$2 `$ `6" @E@   @D   > Ő#Xd65 > 4#x" N@*   *   > Ő"@6#d> 4#㿘> Œc$4֐   ?'X'T''@ b 2 ^ , (?# 3?* *@ 2 @2@ !?f? =0 M T  @*` @+` @2  2 % %  (# `% f  ΐ'f*@ \ :``: xP@4D" H X"@Ę  > 4 #ؐ? ` '*`( ?# 5?* *` 2 2 -?B'   T! |  % 'f{'f*@  :`: x P@4 D" Hd 2' * * @ 2 2 @ + @ X"   ' %  T `7 N.`   Tט .`%@  ` % f -f,  :`' D; x@4G P "`H `'+  ? *`,    2 2*` & \`.`_.`  f? ?? c P+`9? * * 2` 2 @-? H 0 Tf _\ %@**` ?`,  2  2`%  + % `& f f  f,  :`\'`; x P@3 D" H X"{ \ f?; lf x 'f,  :`: x Xd#@WS@  @Af`@  &D!"@* f? "\> 2 ` P*`& /@!.`@@  f ! ' 8`@" 8@.` 4  " " `  "` 㿘 "   ` "      @  P X   > ƀ` > 2> @`'@8@4@?" ">`  ٘  S'ക.` ( ?c ?+  *2  (3  *  >?```  @.`  ?ക.` ( *`*   3`+   ( 2` 2,  3   Ɛ`` '@& ?ഐ * (c ? **`2  2?   > Ɛ h3B > 1  v"9 & ?   8 B `8"2% 2(> 1 ,  `8: <`x$`8$>`0`> G !H`,`#`, 8B; 8 `?`P+`c *`*?  2 2 `, )`($`@#@.` ?, @ @` '@$@ @ .``P ?, @ "@? '  ?    `z``"((, < 0??> 㿘$)?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6` x (  2* 6`x z <  2+  6`z   3 * 6` +`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  '&`p <     l     <@   #`l2 6  `L2`d 2  *f "`d8  2 &   㿐 >  b`  ``D > Ɛ M `4@ 0` ,`  `X $`2 @   @?V "  `$ -     @  艔 "  㿈  X`$ 2} (  "  % ` @"`    "  ``B = `  > + D "`   ?%   2 P ?%  `(? @0f,* @@1@0~f$`?f(  fF찒 " w0+ ?%  f$@1?`L` P`X)? *  2  2  2x  2zD Ű 0Y   `<? ` +`X ( :`ː82`X@  `X (`  `" > -  ( @.J  J 2  @2   `%   @  2<f(9fff @@+D    :  `#\ȚT 2Y@@z T T `%    ;2fb2f@+D    :  #\T 2Gf@b@=T$P@-ĐT " DTf@Tf  : Df@+B??'f2`$ 'f2 (E$'f:` 'L  <`(%X'H? 8 @ 6  (" "@ @$   ,` (@"  `%   o   <H% ( `(% <ݐ  (> > 0   ?'f2`" 'f 2 '?"@'  8 ? ( @ @ *`* 2 2` f@, @tP 2P`   ("ؐL@ $Դ @?# ,` ( ? @ @ *`* 2 2` # f: @4  > Ɣ X 0 H@,"a  (> Ɣ  H @",!8 `p > `t > ,!P< ` ""`"`  % 㿈  ''X'P    &2 'D?P@-&: >`'   k `8"& > 0 > G` !H`, #`, 8 HB`B ; H; 8`8`D`@$`8 > +!h><`x< P*X" `P& S &$o&,2" * @; 2'&2 ?&ސ?)&@?#, ? @ @ *`* 2 2`  &. ??l 2'֒?ݲ@ $P "`@/,  ?c ? + *` 2 3  &. ?> 2'`Ζ  X`8 $`8X"%P%X%%`%%h%%p%%x%%㿘 !@:?c ?*` * 2 2 &@   .`.`@; ``` `6``> )#H  ' < ` & ?   $ ? ???'''''ؒ n    4 .e "@' 㯔 4 ?$c* @ w  @E`"@&@`@@: <`  * 2` 2ݠ < א`   2  @8"@ "@`  '@ ͻ""@"@> )#H > 5!` ? @' `''`''    &''@ `  @ `X $`?  m ' '耦2 `X @"`X  ?'`X`8'  : 8$2 @ ($  '$Ԩ  :    @ژ 1 ''ܘ =; @  B  '@*a@(P '@?#Ԁ@  ". :   @   2 P?'' P@   > #Ȁ`@ > Ɛ %  $U /   2`*  * 2  ?"@`䀢@2'  쀢''䀢@2@ ' "  2  @8  "   2`*  'ܖ$   * 2` '@p  '`$ 2O @"K `"F`X $`"] Ւ V@ =B @)@'{'$ $$$ؐ@&'ؒ@*$1$`$А(` $Ē @$ ?@@ ? ?* +  2` 3  $  @ `2*`@ $$ `   :`82 @ ( > Ɛ*  ?:    "0ِ $ @*$A @<@ $" $ 2`X'@  b "'@" '@ @ "'@L  '@'`0̀+ @( } 2`Xv   o '@($g Ē 6@]$@1Ē *@$`X `  Đs` C*@?$Ѐ`0 @-Đb  "0.*@ $ 2`X'@  Ѐ @ Ē @$'@@@ 㿘? #`  `  * 2` ` > $!Ȁ > !` ? > " > "(@? *` * 2 2 > Ƅ"H?@# ?*  *2` 2 > Ɛ"`(۔> 'M" X> )#H '(&> '>" ?# ?*  *@2@ 2@ '/ L %` ` ""/ < @ 2` ` >#*` €           //` J ?> &"ؔ @ `:2+    ?Ț'''ؒ 7'''''`X`4@  > &ΐ"H@ = B =`@'k@%Z  H $:   @ H?`c 2``*    ?耤@ &" @`   *`@ @6`@   2 *  "@ T@ @ @?> &f## @ `*`2 @76 ?> Ɛ#0'> &T#P#  *2  *`@ @76`@ ` $ H[ :  H@   :  cH > #p㿐  ` :   @ ("" :   @ ?  @ ` *`2@  * 2 3  `$ 㿐 :   @ݘ A`?# ?*  *@2@ 2@ "` `L &`` !<` @ 2` ` >#ē*` €           * * 7 `$ `?# C ܐ  #\#`#h#d#l  Ț 2< ܀ 28  ""  `4, L .2( `" L .2! ?*` * 2 2   *2 @ D j8 @8  `` ` 'G E B ?*# 2< ?  3 ? *  *@2@ 2 @ @`$ 'ܒX  ܰ 2'< ߒ  #`#\ #d#h#l   =  2> &n#> $# p   > > Ɛ#$͒c<X(@ 2  `2 > > Ɛ#$c ( > > Ɛ#$c f  @#D; B?  2 (0  c'@"  ff D%? =`@ @"f8@ (D,f ?'#\#`#d ? (=(`H%6`P `P- ' W@ b 4f`8f "XX  $@  %x ' > > Ɛ#$c 2<  "&  > (> ƀ (> #> 䀊`"= ` "    "  2 > > Ɛ #Вc #͒c , f  : @"]@D B?Ű 2<@ < `@` D  2    ? `` `m f@!  ff @"* $ ` ; #\@ O=  B8 @ C   5`   @ @fH"@@& P4  f ~ 1  "  %`2f@      @ 32@䀊 N'@ @ b % =@    㿐  f@! :`'  f?8 i0 f P @ & '㿀 D>  x:  @ :E (D T"O  8@2J  E    2> `  @ 28  D`"4  x40 :`  |):` :` x@ B 42  @> O 0 D;   x;  BB;` |> #\ x @$> "s x  㿐< > `a 2 @  )$ <  "$$ 8#`$ 8`?`(# ?*  *@2@ 2@ F  > H b& $ 8$ $``  @ $ @```<``* *" * *" *<``& 㿐!> Р#> > ǐ"`#\    > > #\#X`ؒ     R㿐> 0 > ` > *̒`  > > `,!> )Ē#h > ! > > ǐ!a? #h5#h0H@Q  "#D ##h06> H" "ᨀ@  #a "@a" b"d@"z ! `L` `@"m @  ? @y 0 @ `0Zy Ѓ "`$`$ !!`׊ Җ  0\  `$@@2@P  ' "b"0A!"d@!" L  ` ? @"@ @!v Za Ye Za@@!f" N  : .> + D&0> ǐ!("@R  㿐`D 2``4O   I ``   "`>  n!X@ (?@",* @@#@"$`?(  `  "@l0 $@#g?L` PX *  Sx`$ 2b      >  !p`h ?H " (:  @K$ :`  $?Xܰ 4`$ P `@ ,b`" @"l$*@ ? :<` 4 8 ` $$$ $@"W$L` $ X@"PW0:4 ( @"F$$  '$($* :   ?ܰ ܐ`P , ?@є+ &>''''aw㿈   @?  > )#h     `$   ?&  `h ،'  $찒  @MP 2  !`  &0%`'P'` , %` : 2 4:4: ," @!$*@ ? :<` 4 8 ` $$$ $@!$L`$ X@!4 ( @!}$$$( [    ($,$* :   ?6찒 .`P;, ?@[' &` &b&``$ < &`(&`&`$%`%@%` 2 %`$ %`,%`( &" ,  쀢 "4`7  nђ ` `  &b㿘6` `@C >b`L& 2`@;  2 ` : 2` 4 :@ ``< "``" ``L&`   `)?r`&,’   `$*@$`$$b㿘"o  `ʔ `ן  d 㿘"; cS`8 "f> !f(|```L5@`d 1 f  f 0/`    @   +` + *@ " @ 􀢀 񀢀   2݀f f 0`<&`f&``" >``   >``b>` @@  >`(`  >`0 ` Z`! Z `@-ה  㿘 <  ` 2` t ` `   ` `` 2&@ 㿈" Lf   > ǐ! d> ~!>a8''''Z耢 2` ` Ֆ 2 ט Lf  > +,f D$`0@ 2㿐b Ů & >   ; > &!u"> ǔ l  "$ $ $$ $$ŭ$ਰ "(n А0@,* @ ,@$ ?(   T "$_&@ L` PXN *>  "#X $Xg$x* @$z* @$ 2"  > >  S " !&~` d > > +D  "D"# d`X $ $ &㿐"`   2* F (&( " F` & `  d`@ F&&   2@ "`d"` -㿘    $  `P8` ݐ㿘`f   / f`$f* *  :`    f~f, ? PDf`Uf &f  2㿘 8?c  * 2p cS " L\ ? * *` 2 2 ?> ǐ!   *`*   2  2 `> ǐ!X 08 "6  T @*` @* 2 @  2` > "0 ` @*` @* 2 @  2` ?> ǐ"`3 0`2  d @ @*`* @ 2 2` ?  㿘 > b8* @  @ 㿘 > b8* @   @   @` " L???# *  + @2@ ഑3 @"(@y @" <@$@`  `   㿘     `"  < ^㿐      $  "`    " ``B < `  > + D "`   ?$  ?$` #$` ? /$` $` $`  $` ( *+ @ 3`@ 2@ $`L<`   $`0$`,  $`8$`4  $`@$`<  2` $`H ` 2$`H  d$`D<  ( $`(2X@$`( 8$`(    * 2@ * <`P<$@ `<`X 㿘      ?2԰  ?2а  ?2̰  (?Ȱ  L? T? D?" H ?"+`X $` `@"`  `` ?"` ` H` `2 "  " ` $` H`  ` `0  2X ?" X $`}   @ t ?2< $?" ,< "h  " X  "X  $`Y   $ e P ,?2X 4?": X $`2C `@" 4ɚ " 4 ` 5  . 4?" ,` $` ,?  X $@ ` " $` , 4롖     X $`  @㿘  @" U "/ "  < b" $ O  2 d"  o@ 02@  2 `$  @ "   b2 @u̐ 㿘  "  @ @    2   " $  & @& @  & @   @ 72@"   "  @ ;2@ 㿘 <     `02 ` ` "  &  @  2  $ @|0EC㿘 ` $ `> "< 2XN X@ F   ϔ 09 #`(` '  0 2` `$   ꛖ   " > H  2  $ > H`) ( ߐ`` `  ` `'`'`$``$2`X> "X@  " X@ Ҙ؀ ؀ ҅Ր0B  ` 0ް  ` ؀ (  < Ѱ g` ` @%`> T" %@ܔRܐʔ  ٔ #`@ o   0   `  a  <  8     ؀    ܔD p ` `J`.`   `  ܔ' S $`  9ب  ` 2`  $`铖  ܒ q   Ыܒ  2%# ] "  z Y@2> " Kب  2=  `@> # #@( `2 `$   9   *   2   $    |s` @> `@> Q# `@2 > I#b"   `"   @"  ܰ  <@   Ͱ B  `Ȁư ʐ ?      2  $ & `?2`  *`2 > #(   5   %  ` ? %`> "܀   "`> ѐ#H" 0a > Ɛ#HKI   ?2 `$ #`#\  #d#h#l   1  > ?  > ǐhA  ?#?*  .@2@ 6@ '#`#\ #d#h#l   Κ %f 2    2  %   ?%    `0! x v ` ?$`ܔ   ` 2 `$``0܁`` `$`> 1# #@  !  ޟܰ 2܆       $`` `$`$`0# <`3`  3  $纖  @ `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#`/#\ #d#h#l    2" X " @&4 > #:   Ȑ 2 ``$`: "` 2 $ " ``2`` $`"@> HȐ (㿘     v> ` `2 B 2) B ` % ` `0 *  2$M` `?3`  h `ʠ :8㿀 (`  @g 0@@ X ( 6 ` D`(>   / ` $`  #`#\  #d#h#l  / 㿘 ``X  ( 2   `2     մ (  ϔ 㿐  ܐ   #\  h 㿐$`> #!<@& @  > H (0V @ > !$  3`     $ $ 2 " < 2` d     @ ;2@    2  2@> H (f &> H (] 2`  $ "`<T㿘   l`?    `? 㿘> "``   D > ǐ#ْ Ӑ   " [ `"> > b#X> ^"$  㿘֐㿘o 㿘? 6  3 > ǘ  㿘@㿘@Β 㿘?2  . "@> *` $`A @@y ( $ 㿘( $㿘>  $ 4  @`@^$@`<  $?c 4    * @      < 㿘@> 2 (> 4* >x@ ? 0 (  vvwvHwv`wvxwvwvwwwwwwwwwwwv0vwv""  `?   "`"@ "   "`" "㿘?2   .  "@>  $*`@ 4 2  & 4  @& 0Ð  㿘? 2 * "> *`$ `4  ?>  $`4 ` +> ` Z   0$  "``4 "`0`0 ?> $`0? 2` *` *  * " `* `      @Ŕ  㿘?2  . "@> *` $@ `$`8S 2`40 `@& Ӂ !X  : "`0> Ȑ $`4 !b "`4   㿘 ?6 *"@ > *` $@`$ 8`@ 0J `@ 0`@͐@@ 㿘. "> * `$  4 2&@   &` &     p$ $  4  ?& 49b   "㿘. "@> *` $@> 0  4 2 8v    88@> Ȑ 0v h  `> n h`          $`$@ & $ $$   4 $ ?& 4Ր0  4@?` > Ȕ㑖 "& $ &Z fS " _  ֔   㿘``E>"P*` €@@A=@@_7@@1@@+@@ې%@@ @@@@@@ߐ @@`>   㿘. "> * `$   > Ȁ  ` 2  ` &  ] / 㿘. "> * `$   > Ȁ  ` 2  ` &  9    p` `  '`@''''' (㿘> . * * "`* `@ > O!`  `@w @@`"@㿐'> . * * "* ഐ@@`   . @a @P 0` @B@ې0> ! 㿘. * * "> `*  @Q` &`  & x  2 `(> ! x ?& x`( @%  t `X (@l ,`X   `x   `.  H%> . * * "*  @` da@.a  . a؀ @  $ $ D $ ($ `'$ ,Q ' 4> K ` "^$`` $`x`(`@ɔ `t 2@@`(@lV`,@`<  `Xa؀ `X@  `X` 6 `x` 2 `,`a $`pl"> Ȑ"H`g-0> a"> ^" 㿘 . * * "> `*  `@ +`H * `D "  `< "  t $ t " x$  x <$ x`<`2`D@`D  4 㿘. * * "> `*  ` @˒` > Ȑ"㿘`D `H " > 1# > i#8㿘 `. * * "* `>  @/ "Ւ`a``   㿀 '` ''  d""  㿘> %#H㿘@ e``` @:*  * |2  @2   2   䀦 @ |@2 ` @2 ` @2 `  @2 㿘`| e`` ` @ * `䀢``"``& ``"㿘`|` e` ` @ *  &``"``""&`㿘   &`|&` &` &`0 @HT`lx㿘> # }  1 6 @8 @> " @ $`$ |$   $ $   $ t$ x/$ p , $ 5$ 2@>   l &@㿐 " 2 ""`p ,   &    ` @ `H  "<` i$ x`h e & 㿘 X  ba&  ?$ "` ܀ " &  "& i 㿘" 㿘  "+ @  &    $    ` `>  Đ#p` 㿘@~ 0 ?" @ &@ &` ?" @ &@ &` ?2@ $?" @ &@ $&`  ?" @ &@ &` ?" ,@ &@ &` ,?" 4@ &@ ,&` 4?" <@ @&@ 4&`  ! € &`( &`( &`( &`( &`( &`(  &`( &`( &`(>  >#㿘" " &` " &` "  >`P>`  " &`  " &` " &`0&`, @" &`8&`4 " &`@&`<!" $&`"* (?`!*`> ! €&@ &@ &@ &@ &@ &@  &@ &@ &@>  ϐ#&`(&`H>  (  㿘#> a $!$a$ T$! T$!㿘#> aa! 2  @   a!  T@   !T@&? 㿐` `@,  &@&`4?  Ʋ`> ` #&@&`t`` 㿘@ % $@ V&  & & & @&  `2 & && pВ   㿘`0 &`&`㿘  % `@` TZ ` ``ª  T + 0 ` m  ? 㿘  ?  A?2㿘> !@! 㿘   *  * 㿘 "@V@ &@& 㿘 ܀ "@I@ &@& ܁㿘@"  @@Y`R   !  /  㿘 2  ? #*`@㿘Ԑ T    T  * @"@  4 $ $ & 㿘!> "#> ޔ $"b͐ "/#@b c$b$" @!> )#H'$֖ `$$ @$($( $$$,?   &#H >  (p> )#H'@  X ' ' $€؀ 2 ` 8`  #H > ̐ 8㿘  ֐ ʔ㿘 @@6 㿘(8 f  d "V "Z |$(($(,$(0$(4V`>  H> `   A" V  ( 28V  `(8V$ `$ $ $ $$``$  @$  U(8 "  "     V 44(& W  㿐`*  2  (# ? 2@9  > ""|` *   2    `> ސ"|+   㿀'`  7` `ܖ -` ";@ "`4"<":@ @0$0䀢 "*0%㿘@, 㿘@T㿘> 0 @` -㿘 0!   - -㿘  -   㿘 2   F` ` 2& P!> )#H'` ~ , [#H֔ T#H< H F - = -; f 6 2a`# * "C ``H "`H2` 2 > Ґ#`"` "(S &2#H >  ȁ0&$ D&( &&&,4 ^< " U  ߐ Ib ?B  2` +` *  * > " `* `1  "@ " ' " #$"dTq $ " bg$ 8< P$ 4< @< H< `$ 0$ < X @Д Z!@̔ Z> ɐ `@ǔ  㿐$ V   $ O  $D $<  o  㿘"@  > "\`   q  2& & 㿀"   2''А'  < " " @  @ `@ "`@&@  㿘> "! 㿘!>  $. $!> ")" 㿘> "㿘> " 㿘   @ 㿘   @ 㿘   @ 㿘   @+ 㿘   @O  - -㿘   @~ 㿘   @ 㿘   @G 㿘` %  *@ `?* $ `@X`      2?   @h$  ?``@  @     @$ 㿘`> H @> H ֐ (㿘   @  2@ߒ{㿘     @ ͒0ca㿐       #\#`@@| D ?qo㿘   @  2@"㿘     @ tA0 㿘    `@/  9  5  >  > ̐!  @"$ :    ,w  @ # :   " "@㿘  `<   ) X`X@   ` " 0  @  㿘    @&   @ 2sҒn㿘  @L 㿘>0 @c㿘 @$ 㿘 `  > .!`  㿘 `  >  !x  㿘 ` 㿘  $> Hj (  -㿘 @| 㿐   #\(,    - - - h X "  x `''\' |'  0' ' ''` "܀ " xp X" ?  x" ` ` ''' |'  (' ' ' "䀦 " x` X "  x  (  , ," ` p@"  ` ''' |'  8' ' '''S "Ԁ " x㿘 `  b`8 '''#''`|`'`'`''c` ' ` " `t ?&`t㿘 X  "> !  t  㿘 X " <  `  t  㿘  6    @` " > !Ё 㿘  `" @ `    &    ``3`ϒ 0ϒ`, ` + ```t "`t`b 2`< (< X$ <$ @@`$ p` 㿘    >@ >` >` >` (>`  0>`( 8>`0 @>`8 H>`@ P>`H X>`P `>`X h>``@ X `" @2E x`"`  @2= x` 2 (`$?" `  (@21 x`$ ,@2, x` "` @2$ x`"`4 @2 x`4"` <@2 x`"@ @2  x@"X  @2 xR   `t  I"`t'[''#'' |' ' ' ' x @$ < 2`4` ?`$?`$ ' ' ,'`4'ܐ @' @' <' x ?$ x` X "a " `" `@" 㿘       *@2 ϒh> )H`'``X`b&`` W ?`< S ` `J`.&F # @ <, 1?`  ' '''' |' ' '` '``,  !( "܀  @  o  " H > !0> ) XH' " '`|'`'`!'`@'  ?'N''#'' !` "cH > ߫"h> ) X#H' " '|' '''''Ȓ@! (  ?!( "܀ cHcH > s"X> ) XH'"`\ `XX@  "  X@" 2  ' |' ' ' !@A'Ԁ `|'`!'`'`@2'䀢 (  ?''+"8 "̰cH > !"08> ) XH' " '`|'`'`!'`@'  ?L''#'' !X "cH > "Hh> ) X#H' " '|' '''Z''Ȓ@! (  ?t!( "܀ cHאcH > ޮ"`0 2'א` @ *  ``0  ` 2``@  2 ` @8' '` X> ) XH' "` ' |' ' ' !'`|'`'`'`@J'䀢 ( ?'' C!8 "̰cH > 9"x㿘`  Xb)X    ) & |&  & & b&`&P&T @(' @! (   ?)X "r 㿘&`d @   `` ` 㿘 + <    – > T" t $ t x 0 t   U0  t $ t p`X`b x  <`$ x $  ' | '  (' '  ''Lt㿘 >  |"     x`"> > ""> " x`"> > ""> # t> #>  p# 㿐> А#!> #\> ɐ# ,c0  V #Y㿘> "   " > > > ɐ#8cHh- @  6> > > ɐ#8cH! 쀠@?6@#> `jc "% *` ӑ* @  .`$ b$ * $ $ $ $   $ .`@@$ $ cf    @*> ܖ܀ & $ܐ $"`("& (㿘 >    > > > ɐ#8cHД!  "  > > > ɐ#8cHĔ!D b ?"> < b> #'㿘> b b  ? $ P"@   L> > > ʐ#8cH!2 @ 2 > > > ʐ#8cH@!36@  @ ?@ۖ   ` ? 6 " @Ȗ  $@  *  " * ? ""$  ,`* @   ? -` b  -` ɒ b?$ -`*  b   -`  bb     > > > ʐ#8cHh(! %@  *` * $  * *  @@ $  *  * @ #$  * * @  $ " @G  $@2* *  % ?%"$ $ _ b ?X b 㿘> " "  $ "   P> > > ʐ#8cH!2 L` @ .1> `, @ "   #€ &`0 '> `,   L@  @6 ``*`  €` &`㿘 "  > > > ʐ#8cHz! 1 $`" ( ("`( (? $"& $& (  #>  ,  *` `` ?f`؀ "`@Q   & &j& 㿘`P 28"*`$`$> ` b("2   , @’@@@@* `$`$@@В`$` &`L"@֒ &`P`8 > `8 ?&`8`$ `  " ?  > > > ʐ#8cH"} @?29> `;# ".* @t  . $ b* $ $ $ $ $   $ . @@$ $ #9 a`P   `8 &`8&0R@ 5> `L+` @ *`  "  @ `"`` "`  "   *`"   & `@&`L +` "   @ )*`$   ?$   ? b ` `$" `?`L@̕2 `8&`L ?&`8&`P܀ & $ܐ $"`(&& (㿐`P  @j->  -`@ ,`2> ʐ ^ $U `4 2Q `( `(Ho  "`0"-  @   #\   @7  `  `"> @> @Av!8 @<,?$  ("@ H  ?#@ b b ? > > > ʐ#8cHH#W6 2 > !p " " 4 > ! 2 @   &``"&@㿘  b*   & ? &   8"`"@㿘  @@- .`,``  8 @&@ $  $ "& $ $  @@ڑ,`` -`  8 ? @@> r!S,-@,``  8 @$ $  $ "&  $$&  <> B!@ @`8  $$ %8 $ $ "`2@@@@,`㿘 6@:  6   *  -* , @& ! *@"@  @  +`  ?+ "    *`"  ?& ` @̐ˀ8> ܐ  ? ?????'???? k'Ȧ? ('' ("$ ( $ ' $"`($ $ $'  $' # +  *`  @@ $  `@$    $      & 쀢 $`> > > ʐ#8cHf$cߐ쀢`"`("@''`"`("@'' " (㿘> b b ?@  > > > ʐ#8cHH7$x6@  &> <"* @㿘> " " @   > > > ʐ#8cHH$ 6@@   &> ".` .㿘> " " @   > > > ʐ#8cHH$6@ @ @ > ".` @`> #@`"    > # €   .`  > ؐ#   "  *`"   $  "㿘> b b ?@  > > > ʐ#8cHH$6@` @ @ &`> #8.`@ 2"@ > #X`` @  *` ?.`# `@ `* "`?#`㿘 &  &     "  ?    0 㿘? &ː0' 2    ?&  2  2   " { ?   ?0?㿐> А##\!> > ʐ# cx  / > "0`&`#-:`㿘> #[  & & && 㿘 7 4  @m .   " ( 4  ?> > > ʐ#c ~$ 4$   (Ho  "`09> # €@6   > " `p 4 ?> > > ʐ#c "`p@ "  > > > ʐ#c  > > > > ʐ#c # 㿘  @K & 4( (H "4"4 㿘  @`"- ``" > > " c  @Ka  (& Ho  ?"`>  H €> c€ @8㿘 $>` * @ @ >` 2  2 >   c! &" $& > 㿘`  > H  8>  X` @; @   `5 > > > ː `!M* @ "@ $  " ?" `""`?""">  - 0`.`@"@㿘  @0  $ &/>  *@`> " +>  `,  " @J p?$p  , @`  &   c` /> > "  , @ " @J `p?$`p  &   c`ג㿘> "  `  . 6 > P > > b ؠ"?$  $ $  "P` > P> `"> N!  "P> !`  $ $ $ ``'>  6` @ : ! 8  cʖ $ $ > *!@.  c $ >  !h`  ?$ > ߐ ,$ $$ $ > 䀢 $ ( ("`,"$ ,㿐>   "> ""> !> Р#"b> > ː a X   #\> > #\!`a 0   㿘@ " 㿘@㿘 ?A? >&  (`" , ,"`, ,? ("& (& ,  ,> " #>  ( >  (Ho  "`"aɌ  # € @@ @3  2 (ʐ㿘` > b     * : & >  8    +@; 8D ;`  @ `  ` > !b ` * : ` qZ  (Ho  "`> ː"& b  : >f` "  43> ˀ 0>  4,>  4 + 0 '> # €@5  4  0 > # €b  @" @t@3)!@5-b  :F  ( 㿐d@   z /?k@5  I> b  @      @  t  `* `  ,`@ ) #\  @1  (Ho  ?"` (Ho "`  ( >   (Ho  "`& > "  :D'`ʰ Ȱ  ¦  @ 2> > !> "  @a 91> ː@4w 2! (#\  @0  (> @:z"7@Ho "`,@  (Ho  "`"" @Ho  "`&@@ @ S>   "  @   `* ` ,`@`2@5$ (@H>   ( ( ??@G  (Ho  ?"`@1ِ0Ho  ?"`>  0@&@> b  :DC` 㿘r @G 㿘> "䀤`@ "`(0  㿘  @,  $ &?  + @`"? `*6 ` *`@-@ " $&*@`2 ?<  6  , @ 6  @  2  &  㿀> "('.@  :`  #\'  #`#d+ ")  #  @F (Ho  ?"`>  H €> c€ @3㿘 > *`4 * ` @`i>?!@d>?!(@`^ 1> @?T"  :F 5> #> @e3X`T  2  $   > ː &  X"Ø 0 & @eQX X`@e&   " ȩ X @eA& 02@e>X  > $@dX`T >  2   > @e*Xޒ 0  d&`&@&`&`  &`&`&``T`T`&``"` &` $`T@eX " 㿘  ?:&  >    > > > ː"0b@`(!'!> @d X    > & `X␐"P   `"  "`  ? "& &   2@d͐ X  㿘  ( 8'L\  ` P@J N  > *`4 * ` @    0&@ @ B />  <П@   P @'> @8)"( > "  :`@ D @ L> L,ŀ2   P @㿘!> ː@   `8     F   8`@ϒ @7"@ɒ 㿐> "  `"   > 0 aD@  "@> 0 aDD "D> "     4  ̐ ".#\ ( ! ( Ho  "`А $ `  @>  @ > ˔А"$ 0#    @-   @w> ˒`$@7v"0 @l`$@E  @O (  (( (Ho  ?"` ( > # €` @9 ԰  ?$Ԁ  2 > > > ː"c ɔ!&@D̒ ?&@.`@ " >  0@@2`  "  L a" @   ;$> b 'L'Hb  'P" .@ `?''''D '<<@ 0 ` 2> H#8 P`< @ <@  H 'HL H 'HH 2'P8 P<(  <@ <> " ` "`P  (`D<@  D`1T> ߑ* `*  @  > > > > ː"cp"b   @ 2 8 $@ "2  ?.     'D      L% ϖ  T`2P'@ L &% #`, " " ( 2 4 2 0 2 > # €@0&,`> "    .  0%`B :` D . > b `. '@@T X ? > "؟T  ;$ "8$@ X2$#@ ,'@`%> `4 % `( !! @0͐ > b  > ؒ`"   `H   0bВ@8>  > "  ``@````  @#`P#\` <LX " ` 0…`{@`2y'L> " X "`  `0%`8B` 'PP P #\ @ T#`#d PP`P'L L> "  -> ;> `9"8> `( > ːc##)'L@0? `>  $`8`H   08bП@(Ho  ?"`> b   @'L@/-`<-`Y ``> 0> #P 4 `c `2 _ \`#\     @* 2 <@ז> @4ِ <@0R> # €`"`4?"`4" (Ho * "`@/`2 $(&Ho  "`(Ho  ?"``_>   [> b a $a   #\   @*  2) <<@g`p`h@ > > > ̐"c$@2``̰  $`> ̒`$`@4Q @n<@/ʒ(Ho  ?"` Lܖ Ғ# ? $b  `"  HP` `0> "Ж@8@܀ <@> b  h p  > > > ̐"c$> @4 P<L@-(Ho  ?"`<@.<3`L?'L ? P> > > ̐"c`l%  `8 @ L  > 0 aD@ {"@ 0  aD"D<#"D@ > b `  "`'P 0" @8C `P P #\  T#`#dLP ` `> > > ː"c %BѰ > => ̐!  <@<  ܐL " < @\  `L`( ! @.RLL(Ho  ?"`b<` > "  "8`2L4 P`2#\     @); )LL`( L L(Ho  ?"`@.L<@ > " > ̒`"@2 <@.v(Ho  ?"`> # €LL`( Lª L(Ho  ?"`L    @*P @*K'L> k K L#\8@?    @(Ě  DLL<`( i @-LL(Ho  ?"`<@ > b ph@ > > > ̐"c&+@̰  $ > ̒`$@2h   a"a@-ڒ  > # €LL`( L L(Ho  ?"`L@-: > " a  "a  Lܖ Ȓ# HP`  0> "Ж@8@܀ 1L( ((Ho  ?"`<@ > b  h p  > > > ː"c풔&> E @1  <!@+ݐ(@(Ho  ?"`> "  (@ (@,ǐ(( Ho  ?"`< @ 㿘%>    @ 0   㿘 I@a㿐  > > > ̐"c& 0@ >  4 > > > ̐"c' @ y @>  !PC%> '> )> > "ؒ 3!> ` @:`$!'@  > > >   "b $ bД''$@ H`@y@* "" @+{" @@ > 㿘 `"     0 㿘 㿘 $ $ `""       "#> ̐ &   c    2   &    @   2 "  $  " *$  `8 ` `( ` 2$ 3`$   $   `$ 㿘 >  b  ؐ $  W   @  ܐ $ i 㿘  > "$%> ߢ@8 @7 @_L`㿘> "$@ 8 @  $ 㿘> "$@ 8 @  $㿘aD&`$@w" @i $&`$" &`   @r   `"\@㿘@ $> `!D@|& $&!D㿘  `>0  `88  ;8  5>  8( ( >`P> 2̒  $ >  02 J 5 8  4    `8  2 0` > "   ( 8 @㿐> " `2> > m!ؐ("b@"@e@@j@+_@> 㿐` ` ?@@  =#@y (> $ > "  @  8      ^+> `@7  R @ O  4`* @ *E D $@8`$  "!> ̐ & #ܖ   k 2 &`@ @ Y `` `  @    `㿀>' M> "c!> " @> !آ"@$"E#'#`&  #\#d ?@? b> Ꝑ!b> " 㿈\`@> "$c'  . #`#\#d ?@g? "@> {"(&@j  @@ 2 @> j"`@$@@g > Z"㿘 > ߐ ,@  > > > ̐"bЖ9!   9@({ *5> `( `(Ho  "`> ̐" >    :@  d  @7@&>  @ :D̐Ȑ㿐%> !> #> ؐ!ؒ  > @( c@&> "   ؁㿀> !؀@ > > > > ̐"bЖ@Ŕ!a"   0## @ . '#`#\#d?@? e `a > ` 0"@  @@P  #\ @$  (Ho  ?"` `   h p@  > @@ Ė $ > @-ɐ#h > > !l  8  "В 8 @   :@ D @2  㿘> "$@ 8 @ @  㿐 >   "!> ̐ &   #"    2   & > "  @ 8 @  @  8   @ R 㿀> !؀@ > > > > ̐"bЖ@!"  > ct 0@ #'.@ '#`#\#d?@Κ?  > P & @ ' I  ` `0 "9> 0 #\ @#2 (Ho  ?"` > D@> @-#x`"В8 @ "  :@ D&@  `2 @"&㿘 @  㿘 @㿀> !؀@ > > > > ̐"bЖ@d"N"$ 0c'>  #@ '#`.@ #\#d?@H?  㿀> !؀@ > > > > ̐"bЖ@="q"$ 4@  0.@ "@@  #> ct  0c''#`#\#d@  > ̔  ct㿘?Ŗ?㿘>  @X > `  > "  : ($($> "(@:@    &$ * )> '> #>     ` "* $`> b" "$>G  㿘>G> > ̐ 2 㿘1>  -> /> 3> ̀`>   @   c  '> %> ` `   ` 2"   @X!   @%@% @XS%  В  ̀`㿘!> &@@X  !> %> )> 㰐 `     ?$$ > @X,`   @ > 0>    &@㿘!> @Wݐ > >   `&"@X # 㿘`@L "` "L$ `2&$` @ $`@" @`$`` &``@@2"`"@&&@$`@` &`@$ $`  $   $ " @א$` $ @2"`"@&N$  " @ 2@$ $` $ L2&$` ` $@`" @`$`` &``@@2"`"@&&`$`@` &`@$ $`  $  $" @$` $ @2"`"@&$$@y `$ @s$```"` "V`" 㿘 2 ` 2'& &` ` &`" @P`&`` &`@@2"`"@&&&`@? &@9$ `    ` "& `` 2)` 2" &   & " @&` $ @2"`"@&$ &@ $ @&`` & &`  2" ` &`" @`&`` &`@@2"`"@&&`&" &` @ &@" @͐`&`` &`@@2"`"@&&&`@ &@$ @   "&  & Y" 2*`  2$ &  &" @&` $ @2"`"@&$&@{ $ @u&@` & &`  2" @ &@" @c`&`` &`@@2"`"@&&&`@R &@L$  " 2@2& 㿘@2`K` F @ "` 2``` $" &2$$@$`"@$@`$``$`` $` ``" &@2"`"@`@$ @" ` 2" @$    0`` $" &2$$@ڐ$ o㿘@  `  ? @ `  2  &` &`&`  &@`6$ $@$ $@  " `  @ ?@   2    `  @ ?@   2  "  20   " " "     2 0   " "  `㿘` @`  42 ` > > > ̐#Ȓcؖ-!`$"@@`8`  8㿘Ր&`&```㿘ǐ&`&`   ">   ` @ܐ㿘` ` @ ΐ ɒ㿐 >  `J> ߑH /f * ' > #t t (#>  ?  > ǐ '>  %> ߐ*  ` "  b @; `? , * " ֒ > 5 Pb Pct  "t"PH 0 ". X > #Ȁ`> ͒`@N" > !˒  . X#Ȁ`> ͒`@N >  0ܼ . X㿘 X  H /f * ' > tt> & b aP"t?"aPH 0 0> #Ȁ`> ͒`@M > !ݫ0 #Ȁ`> ͒`@MՐ >  0ݟ:@ :` :` :` :`  (:`( 0:`0 8:`8 @:`@ H:`H P:`P㿘`$` &`H㿘>   $"("  L2  P㿘>   $"("  L2  P㿐>  > > ͒" "`"` "`"`> > ͔"⬐ "" ""> > ͒"ℐ "`"` "`"`> > ͔"☐!"" ""> > ͖a"a!"" ""> "> " # a0" " " > ?"> #> c" t#t"`"t``!> Р#> > ͚aH#\  Ȕ  ڲ > ͚aP`0#\ `  ک > > ͐!Ē `aX#\  ڟ `0ޢ㿘T$ $ `(`&`0@ B >`0&`  P  L}`L p`& p`$ `$ #  Y"`8  @  (0 `( €㿘m&`$$ `  (`& 0@ B < 0`P `LA L p & p$ `$ &` "`8  @  (0 `( €㿈` 4 04 d   5  `> #Ȁ`> ͒ah@L  > #Ȁ`> ͒ah@L  " ]      @p `?`   &  &\" B  \  "!> ̐ &   #   G 2   & \#d#`@#\@Ę  >  2 }  ` "`  ?? > > > > ͐#Ȓcؖx#D  `0@" v`$@@q @m`(i"`8` `0"@B^@\`8 W`<S`@O`DK`TG`H C`P  ;>   > # > b -"bv &> b  "b `"`$@`$$`$ t|& t2z $> (఑6@q" `@ @` @> b "b@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8 8 $ 8$ <$ @$ D$ T$ H> "( *@   $ P$ L$ L$ P p`& p$ `$ $` " t & t2  $> (఑6@" 2 `$ @:&  2 o      >   @  "  p$  >  /" p4 `  ,`  "" @*$@   (  @* "#   2$"#  㿐@?\' @ot  ?@ @⺐ۛ'&@ 4@          㿘> " *c#    @≐"%~h㿘 $ % >* > $ .㿀`'X'HXd  > > > ͐#Ȓcؖϔ%@  H> > > ͐#Ȓcؖ%H`0 @ 'H`4H@0@`0@ ``@ $'H @  $'H@H`4@ـ א` @"'`` :'`ڰ #\ H> 2'`` '  H`$ `"``$:`$`:  `"* `$ * `(`@ `"*'􀢠H$@ *'H#\H 2r @:I`n`$'H#\`Hޚ "`\1> `'> > '  :cȒcؖ%{" * '*  $'H#\H * $'H?@nH H?@`A'HH`4@ ` @"'`` *ܰ '`H&2#d#`#\㿐   "!> ̐ &   #   " 2   & @  _  @˒ 㿐 0@* 48@8  > #Ȁ`> ͒b@I  #Ȁ`> ͒b@H ɔ  @Ô 2  &    @   &  '& ~ $ߔ $    "@ ( 2  H $> "(ఓ4@ " " H  8``2: P  `  $ @^Ò, "& ( 2!> !؀  > > > ͐#Ȓcؖ &^ @^O $>  `0 $ "  ("@  8$ ( ?$ 8 @^> $ 2 p &  p& p  #   " t"& t$ '@` * $&㿘 *#> %> '>  H " PcȒؖHݟ&ր  8  @  (  "   ( `" @   2 H㿈> "$ 0@  * ' #` #\#da `?㿐ڔ `  `$2 `( 2{ `P u + > >  @ hQ$@ (Ӗ> E"      > ;"  > 4"耢2 > +#"(`&  @"& ` "" &"` p?$& p``&  @2 p`&  p& p"`"`t 㿈> "  @'L `> > > ͐#ȒcؖƔ' `" 0> > > ͐#ȒcؖPܹ'0'L 3 L°  @ '   `'  "!> ̐ &   #     2   &  ` &@ ` @ &   `p  `'  `'耏` `$ 8``     `8 B`  "$@ @]' "6 $ $ $  $"@ $ $ $ $ (`$ (` "€ 0@B   < 0``8$ 8 @ <$ < @$ @ D$ H$ D P`$ P> b  4@ L $ L  ܐ$ L쀥``' T$ T%``$@: Ϡ  " '`  @a`2%L      @?`?`  &  L @ 4 `  2 o `G " '&  ` *'& ' *  &` @[$ ' p?& p  #   o"$  '` @߀`` "   2 %   ` `2G  L "!> ̐ & #    2 &L@         ې 7`G `L@ E 㿐 2 0  "!> ̐ &   #Ԗ   c 2   &  0@* 48@84 ` @0`$e'`! ` 2 `$2 `( 2 `P 2 `8 2  "`8 "`( @; 0  b 㿐    "!> ̐ &   #h    2   &  0@* 48@8Ȕ  ` @ Đ ' @` `8 2\ `@2W `@ "L ` *`8F ؔ `<&`<&`@&`<`< 8`  H`> `H?&`H>  8`<`  ?X` `$ `H 2` 2` `$`  @֘  2 `@" ` *`$  㿐4X 6 S     "!> ̐ &   #   D 2   &  0@* 48@8   @  A$ D "  * $ 2 [  㿐 2 0  "!> ̐ &   #`    2   &  0@* 48@8   @    4 6 $ T 2    "  * $ 2   㿐  > > > ͐#Ȓcؖ*  2 0  "9> ̐ &   #   } 2   &  0@* 48@8N  `2  2   E @<   ` $  @ ~`` z` " * H􀦀U H  ` * $`2ذ  2԰ g а  ^ Z H 2  8 2 "  <  ( 2     @ה $  H < ` ' H $  @ ` ( ?' H ` $8 H`2  2|  x  "  * H   &  ~   @  H 2  $ < " 9`~A~/ 瀊`& (  @> #А?' H " * H` H? ' Hʒ 2 H`2# ~  瀊`&  ~ }} 瀊`&   㿘  > > > ͐#Ȓcؖצ+`  "!> ̐ &   #   ~" 2   & `` , @ `H i`@2`H `& ~S ð `  & 2  , 2 ~D   @ `< " ``H 2``$` " `@ 2`<> "   2  H@ @ (   2 ~  @% `<`"``H  `8 2`H `2` `( 2 `H` `$ Ԗ `H &`H`@2`<   & }  ,@ `H 2 `` `$`<`@"`H"> }/} 瀊`&   @> #`< "``H?&`H`@ 2`< ,@" `< " ``H? &`H`@2`< }  瀊`& ߐ | 㿐   > > > ΐ#Ȓcؖ֞+| 0@ 48@8 0|Đϰ   8 $  @`  |   *8  '7> P@ (> > ΐ#ȒؖXV, m k>  `"h $&@"` L/> ̐ "S> @ N "6 4D> ΀ A>  4=>  4 <>  0 9b  (@2    /> > ΐȒؖp,T> > ΐȒؖ ,Y# €@> 4 4 0 > @`? $`>  > b  4&@$ $  `@ "`8 2      2 '  [@{㿐( @  @" ` @*  `< 2 `$@ ` 㿘> !ߐ @ 㿘@ @ސ`@Uސ @UE &`& @dĐ $"`$ $ 㿘 $@h 2`  "     "1> ̐ $   #B   {ђ 2   $  `$ |  0 4 @d 2 (  "1> ̐ $   #   { 2   $  ($ 0@$ 4 { 0  g & $@d}@㿐 ? =&  "  2 p  "!> ̐ &   #Җ   {a 2   &  p  0 4 L    @T>  #&㿘  vz @$㿘&   & x> & 0& 4& & `& (& ,& p& t& & { & & | x" x㿘 x?  & x 0 4֖ @Tw 㿘 2 "!> ̐ $ #_   z 2 $ 4 0 : (,@'> `8`" ` > M Ȁ 2`D> G! 84` 2``    K P $ H  (`"  p` " p€  p ( & p$  ($ #  "l`#Β P   (`"  8` " 8€  8$ H` $ 8 p ( & p$  (`$ " "`P "`H  `H     `H  `P )Y&` "`@`8  `@ " `8`<X ` `$`8 $`8 @  < $ X `@2P`8t& t 2zk 㿈 0>  4ƀ!@ p>  t!X x ƀ > `8ƀ!`2  ,@.> Φ!%> `0`P` `$`(#``L#dƀ#\`8  F T  F T  F T`D#\`H#``T #d`<ƀ`@`@2`0㿘>  "  ƀ  2> > Οƀ"P`ƀ"``%> Οƀ"p @ ? #> 3>  ƀb@ݒ  ƀb@ 3  @В  > Οƀ"㿐> Βƀ#( 8> Ά (  ,>  0#\ƀ#8 >  #h 4 ƀ $> Οƀ#`o@ (@8@"  "    > Οƀ## (> Οƀ# (`> ϟƀ `@ (? @   > > ϟƀ 0 (ƀ P (@@ @>  (* ct `@  @>  #>  #@> # `> ϟƀ @ 2 > > ϟƀ 0ƀ u(u utuLwDuhuvvww w xxxwwxxx㿘> +`D@!  2> > @">  > *Б2`@:` o 㿐> 2!̪ '􀢠53> ߖJ5   &    $ 8 8 X " ``" `*`@  "@ 2J5> ߮ Ĭ(  n%,` i4 $> 0  *   "PQ`Ĕ(  *  `" D*` @2 $P2X=#` '\#\ @&` ` >\!*` €>  @ 0>   !T> o#Ę )n> "  X'  a \ ` _Y V*$ X@R d$ LP > "  \' ؘ C X `  _; 8*$ \@4 d$ P2 > "  `'  % X \  _ *$ `@ d$ T >   >   -"""" """"" "$"(",> 2̀`(> `02 `J`5>\,( a$> 2`: `22``2`0> "  ",   l  "  l "  " "(""" "$||| N N㿀` ` ``@@' ` 2+@   G 2` ('    2 $' $ @  @ `S > $@ * ' $ 2 $  "#> ̐ $   ck   v 2   $  $#`#d#\x 2 $`  `   @> $@ * '&  $ w ` `0?"`0`, V`0㿈> "  @`$ `` *  @8   2 ' `v&'z *` 5> 7> 8 " > ϖ!:$> ϐ0! @"h ` b  $@8 " ((`?2`> ϐH!, ` =/ܔ "   3(.P /  L]$  2/O ` `0$ B @ ڔ 2/Ǫ "   פ  ' *8u`x`` @`@` ` '#@2 ```` ذ> "   @`8͢@d  " ` "` '8>@  ΰ  d $ &'@v?N 20  $0T `2 ( <       @D 4 @ 8   @0`  @0, $00>  <2````   ^ ``` O @   E @:     @2$`"$  `` * b2  ( ! #\;` `d$#h@#l ' 0,?`$00㿐`@`` `  "`> "$ 8 @ @ $ `@ "( 8`"  $ tM $ "@t^"  `  `i@㿐`@> "$@ 8 C &@  "Q 8 @8@ >@4 @ *D  $   "#> ̐ $   cږ   ti 2   $     t  H  t     㿘`@  `> "$@ 8 @@ "@ `@ "  8 @@  $  㿘@`> "$@ `8 @@ "@ `@ "  8 @8  $@  㿘@`> "$@ `8 * #@  "$ 8 @>^ * €  $Ք@    $@     $@   㿘`@> b  @ 8  &@  "" 8@b `` 4`H  #|     $@    㿘`@> "$@ 8  &@  " 8@ |w     $@ ̘   㿘@` |Z 2   $d   #㿘 $   㿈\` l Ҭ >   :  а ̐`@ *  &@@@ #@ @@ 2`,#8-`??C B < `?@# ) %`@(!``   ?׉  ` ? ?x `  < m k 2/ @/ -`  @#\#`#d L`"O  2   "7> ̐ $      r 2   $   > " `` 6`H   rА  @@@ ט  " @@7 0   r  `@8> '' @b@   2 `*    #\#`#d????????' c 17> '> 3> 1> ϑ/ 2(xሖa˃ Q` xሖ!{ R@(Ho  ?"` ؒ  @ ` "`" `"'` @> b   @ +@ ;` d ; E  @㿘" @ q 2 `(> > > ϐ!xa  > > > ϐ!xa  @ ɐ > "  @ :`D ߒܐ`"2 2< " "<  2"`" `  "`2  ""`"  "" "  2" ""> " 2 ""3 2"` "`  "`2  ""` "  "" "   2" "" "`"" ݘ  2l` 2 "`` "`  ` `@2" "" "``  n"k 2`2"     "2" """ ` ` "` 2 ` "`  ` `@2" ""m  "`` "` ` `@2" "" "`` "   A" 2` 2"     "2" """ `` "`2 ` "` ` `@2" "" "` "2`2"㿘`2` @` = "   2 " "&  2# # " `"` " `"`"``"&`2"` "``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @v    㿘 @b    "     2 0   "  "  "     2 0    " "  ` `  4? `$ $     $`$ ?㿐> #t'D'H > > > ;> +`` "" ` `$+`""  ##"`  "> "c @8А > Ѐ`> M"  > " "@ b ` b .@ʻ`P. , @ @׼>  К @ 6]b > " +`" *   "( @ > ϒ$ɤ"> "b ,*( > @ " ` @0&  @"`8" <@"`@" D@"`H5   8 b  `% '@ b `@ ڢ`P> `К@+`b > #  >  * D#">  H+ @8:">  Ԓ > #t $ P#`8     $ ($ ,$ `$ \$ T#`<$ X$ L㿘> b b "b b  "> Ǘ"` "    `* 2`# 㿐> " #> `ذ . %> !> @:# $`#8  @ $$##@"> ϐ"> b# @@,$'> %> @ lRP "  㿘>  Є ("* > #>  b b> #`b> 0#x` @x> ` @ 7`  :3  `*& @ `   @ #@  Ѐ 2?>  #! > ߖ` Ж " " """""   @ 27? @ 1 * &@ ? #@ @ i  Ѐ 2?> ѐ#^! > ߖ Ж " " """""M ?䄀z Є? C(> "b* >  b   `   :/*&`@"#" Ѐ 2?> Ƌ#! > ߖ Ж " " """"" ?䄀ˆ 㿘      㿘> " ` > O#> ϐ#I*> > D  Ѐ > Ȑ @> Д    > ǽ 0\ > b ` В `@ "А `? >  ؀@  b䀦 b   `@:("Б* b䀣 + " * ? ?""  "$"(","0"4#@#`#`#` (`?#`#`#`  Ё㿈!>  > А!X  Ь $> " 1>   @ ;`   !P7#\`Ь  `> .!x> +!㿘@㿘   > > > > А"b w#> "  8  :  @ @ " > > > > А"b a#@5#> G!Ğ> G!H   <  :`  ` ;  ;`2 @  @d4I> 2b D> b   @ Đ!H  :` ` ;  ;`2 @  @d)  & b  D:!H ( b;`  82 `@   @ D4>   > $#   b ?2` b ``,4`(`(> > 0 ct`D> H"      `> 4`43> \#t*+  @@ *@  &@  `  0  ct> > > А"b Ģ#W+   *   `z ̀`> А"0ğ` "`" ?"&& b ?" (a $?"$ (!  "  "@52 , I > & (& ,& &  (&Ho  "` " (Ho  "` `  "`  (Ho  ?"` > #@0@4 㿘 `'` (  `> > > ϐ"b `  (Ho  ?"`  ?"  ,& `& ,`' ,>  ( & ,` & > > > ϐ"b @ܔ ` (Ho  "` `  "` 㿘 ( < 4` (Ho  ?"` ( ( 2  > > > ϐ"b `â " Ho  ?"` ` ?"  ,& `& ,0` (  Ho * "` "& `"  (> > > А"b Xb$@&#> `"  "`> "# ?"&& Ho * "`> b  ?" (@- @ `2   >  "#`"  "`> "# ?"&& Ho * "`b `?"` 0 b & 0` ?"`   2"Ho  >"`> @3~#&@!> #t*  @& *  @"@* "  (?Ho * "` (@Ho  "`b ``$ "`>  > ct"`<> @3w#㿘 M> " , C?"B (  Ő ( * ( `> # € (@ @ !Ho  ?"`m Ho  ?"`,㿘)> #> Ԥ" @2$@&%`<@30T  Ԑ`` @ ` 2`,@2%`<0?` "`$` ?"$$ ?$@2#> #@ (Ho !"`@2#` $`" $` `$`$ $` $$$@2Ő#> 0!d`> И  > `28@*  (@ 2` #  "@ 282?㿐> b(Ց6?* > "@*`+   *  H ?0a('> " > ?"""(H@("@>   " (-  2 >  " > ?"""(H@("@    0"0`0#"`0> "@# "`  " >  `( H ">  㿘 (@'`"  "`> "# ?"&&  (Ho * "`> b `?"` (@L 0   > > > А"b p%@"> > &#&# &  ""  (Ho  "`> b `> H "` (  (> !p@ Ho  ?"`(.  2 >  " > ?"""(H@("@>   03( (>  > # ?"""H ">  >  "c"" 㿘 (H` "> c€㿘`(H #> 㿘> (  82 > > > > А"b %*b" * `@㿘> @"p> "d@0t > #"#"` > ߢ ܑ, @@` @ , 㿘 "  > > > А"bǔ " > > > > А"b `@&㿘> "p2 > > > А"b 2  > > > А"b  > > > > А"b ` K&㿘> @0"d#> bp .?#>> `0#t  "!  bp bp ` D @ 4   :@ "   :@ 2 > Ж bpd  Ǡbp*@$ @0d. @0d 㿘> bp > %> bp @8 @: 2 > > > А"b0 &6   > > > А"bP  @/d :@ 2  > > > А"bp **@$ %  9@/d㿘  > "  @.@ @  > > > А"bӔ!H `1 /%> '> +> /> -> @``⨖!!`( > ⨖!"`8!bА@ 0  @?k  @ڴ㿘> "(> .@  @>!X㿈'X X` @$ > 4 ??耢4 ?> 쀢(?>   @@b :  2  @ ( & & @@{b*`&   & `  <` B s`(~ }`(@2/`( v`2*`( ` `(> !p@ Ho  ?"``(Ho  "``( I`(Ho  "` `(Ho  "`> # €`2?&* & &D` 4 ``耢4}`m`㿈'XX`` ;`#\`  &'@ &   `@  2 N L `E@B 0> `9@6! `  `(@> ` " "(@w`  `<  ``@H`@C`  '@&@-㿘 o)> "   @b ` 2@ (!"@  " " @`@7    @`( "@( @( (Ho  ?"`> # €@@`)Ho  ?"` >  H€@> `0€@@(Ho  "``㿘> #Ȁ`> Вc@'J >r!h& !> @-2#& > #  & $ "@" Đ?@-_#ā㿘> "(@: * 2  2  @* :@ : #@  `> > > А"by#G> #Ȁ`> Вc@'  8(  <"  8 2  @ > "  P,@@@,``@$  P (@ @Sy @r /> 3> Ѐ` ( @@ "  > ѐ☒b)#l(Ho  "`?`"  (`@"> ѐ☒b(#}`( @2> ) '>  H€ > `0€(Ho  "`(Ho  ?"``@* > G 8  > G "> G\3> G!2㿐> "ؒ> !؟  > > > ѐ"bX#  > > > ѐ"b`#㿘> >ct 0  D@ > - p> ` : @, , @> "0 ,"㿘> " ` @c `: @ $`< `, @$`<$`<`< @Q, $`@ $`@` @I $`H㿘> 0 > "cH > "  ͤ+> > G3> /> Gc!H@+֐ "`w    $  @@ $D`$DĚ: @@   c:  :2 `   ` $Ā@ : (D@   b ;`  ; 2 `   @ @  6?@@+xc" ,@  @+c0㿘> 0 > ct`P"`L+> 1> /> @+\, c%> ѐ`  `4 "c" %c@+?Ԑ" &  8@"   @: "@$ H /* d %  @H 0@+㠒" `,4`> #@+L0p> "  @:@ .6 :@ 2 * *`#2`p`'D2`'*`# p'  '   % > G> G !X;`@ b  2 `8    @" *`  `  ' $ a >  $a b€ " (a, $a,@ 2   7` ` > > > ѐ `!2 ( 4  ?> > > ѐ `!ǔ ($ 4Ho  "` (  a0 "a0a$  "a$a0 y$a0a( $a( ( !  `p "`p> # €  a` _"a` 2[%@> > > ѐ `! @ * @4Lhp@   > > > ѐ `0"  @  `5  h l@ $  (> > > ѐ `X"3 @ 2 ("  (   " (@   "  (@"  (  @    ( @@  (Ho  "`> # € ` "`A (`" ``  @ X %`@u ǐ.`  @:@ '@ ؒ  2 Ho  ?"`.``& %`  @J `  @&''@  "@@  6' ' 4 $4   ;`   #\<  ` 8 `$8m$ (@fDgd`2 (> ؐ!  ( (Ho  ?"` (  (`2 %@> > > ѐ `#:$ > # €ؐ' ` `> >  H@ >  H€> `0€Ho  "`   (@D     㿘> G!> > G!X b  a ; `  "a2 8` `"  @" 6!! ̣$!!  ! d > #`> # " " a 2 `d > #"  @@ D"" lh@ > p > "# > #  2   2, (   `> > > ѐ `#2 ( 4  ?> > > ѐ `# ($ 4Ho  "` (`2O=@" (   " (@ ђ   (" Ho  ?"` (@"  @    `@   (Ho  ?"`` > # €m" a< "a< `4x (4u (㿘!> "  > 6 #@' ( ,  g >  в > _"   7 S6  O *  8 @E> $@* @*`t  (@@"5`/ (2  ` "**`  "  ?"$$  ?" (a" ,$?"$ ,$  $ ,$ $$ "@?&  `@Ǡ P`Ш     < @  >  @@  D  > #@'c@>㿐 ?> > > ѐ!ВaԔ ɀ > > > ѐ!Вa(ɔ ```  "> > р 2 > > > > ѐ!ВaP " "  # .@@7> b @/\@   ' >  > @'#> " ( ,' @8>  Ъ > @ "  6@M6 @I*@**@8?@В7> "> "  63"  $, *  (@@ >  b  8@  @   P( (> `Ъ`@ B>  6=', * > ct#@?`(2 @ ``"**` `"  "@& &> " ?" (a" ,$?"$ ,&  & ,& &`& `"@'`?а P'> b < @  > @@ > D > > #> @&c 2@`" ``" &`(`(!2&`(y&`(@``㿘> @&3# \?8> > ct" -@'> )> +>  (@"В!b!` "`&  ?"$$  (Ho  "` (Ho "`$W*  Q$ *  K"@* " $ @$>  $`< 2 (@& c㿘>  耤 #>     b  2 㿐> џ"!> " > Ѡ"    " >  #    \>  P#X#\ T X L ` 0>  4# 8 <>  @# D H >     !L!P>   @   > ҟ  >  ̐  П  >  ܐ     >  !   > !!P!!! > ҟ!!$> !!!! !(!<> !0!!!,!4> !8"  t d>  x"H |  h>  l"  p> ҟ"> > "Ё㿐> "#> > * >  "℀ "c> ` Mq "> > ">  # #\ \  >  "c> #(> > Ґ"cP#\    > > Ґ#cX#\   y @㿘> #` ``> " $ 2$D  :2`*  @Ǔ*` @ $D2$` `2`㿘`:  \ V* `>`.`@&$*` \U &%㿐#> @$c> "   ,"    @$c 2     #\    ,  &  @ 㿘 ,  . ,  $("@ ;  $* @(@ $* @(@ ("@   ( ": ( *@ @  㿘> #1@(> " d "dD` :2`*   @$*` `2`*` *e@   "e@e ?dD@2d 2㿘> # #>   4 "$ $  $  $   "` " $ 㜔㜀 $ 㜐 "`"$ VҒ \&  &$D &$H 2 $ "$D$ b `d "`d> -> "$ ?b $@2$D`$D $H" H$H $D" D"$D"$H`d #`d 2$@ 2 㿘> #?@ "$  "@""  Vt \ 2㿀> c #`#d#\    "> #`&$,&$(> ```"` $(&$D$, $D 2$(` `2` @> )#H> ` 'X@  > " &6> # -`$`!> " $  :@`* 2`  $ $ `$$ ݨ $Dd` 2&ϰ a ``2@> )#h KҔ  @ ) > Ґ#p$Z "@> Y#    $    D'''''Cz @ ~   ( 0 2 `< "`~ >  z"0` \ S Ԓ    d0O`’ \  \ SŐ% \ S  $ $$@`<`` ?$`<  a@$$T \  S$$$$$ז "> ֐#@4 # `< 2$ad$$U6 \U3 \0r 2     @K͐WH > #(> )d@ ch @`` jU <  2ǰ 4  > * <"@*` `" @ ?* ``ja hX + 3`    0 hX> `8&dL8   &dP&dP> <  2* &`"   @* <  ?   > s `d4 "`> Ғ  #\ ? \ w ` &d0 |  "h> #h8> H `X02  @  :` `3`+ @+` 8;@ < `@f  &d0> #J  "> >  k @$> Ӑ `fJ>  `Ԑ` ? &`&d`h  "`hh``i 㿘`d( d,&`1   d(d,Ӓ "d  d$@4  "d@` 2&` <``/dJd@> )d@#h   `iW > "  h d" " h0d@ > u [ > c d(d,>d0Sڒ \㿘 x> 2* b  @͓*   u 2d( 8 (& <& 8H /d * % 2H 002$ @I< d@* 2` < "> Ӑ ) H /d * % d@R<> xH 0j0@㿀H /d * % > "9 H 0 %%% %%>`D4,  ,  `P `&`H$L$@: '@   j䔒  耢? ?>  "$LH /d * % %< @, ` "@4H /d * % > #Ӓ H 0`8 @=  $ 8$ D$ @$ <$ P= @ B < x`4>!P Ēc!$ 4$ $ $ $ ` > $ $ `D`""@$ `D`""@@8$ ` 2`D$ $ `""@$ `D`""@@8$  |$ $ HH /d4* % !   % P$X@=H 0 <`D@IH /d  { * %  ?`%`"> `8&`<(&`8> "a1GH 0㿘  & $$P & $" !,&$&$8`x "`xip $$P6 $2,  ?& 㿘 > #Ȁ` > Ӓ`@R  D H`H" "@$`H ?$  < 2$  > Pm> #   "`H`8($`8 $`<  2' 2#> "0ڐ 2 "  > > > Ӑ a(p%  2 > "ڒ0~$㿀> "`$^ > #`Q``H> "   ">$D$ $ 48$D$0   #`#d #\ E 2)$D$D@$H$`"dH$H@$D$`"dD?$$H$$D`$$H`@2`$`"$D$`$  $$  l % l$( ` `2``` & 㿘& d$"d$㿘?c> "  d` `> > > Ӑ a@ܔ&u2 d > > > Ӑ aXҔ&v6 d(> > > Ӑ ahǔ&wd0&   > Ӑ!Wd > ߐ"$d  l"@ ($ l  ܒ "d($: * @e*` `*` 2@  㿘@?@+ 㿘> "  t'D` $ t> > > Ӑ an&2 p ?$ pD @    p $ p㿈> b `@: * 2  2 * 'H#`<'P'66@b'D`2` `*  @? 2  'DH ' `>  ` '> a 耢`EH`v耢s    l    a @F3> H(" : * @*`   2  F a &a  4 ,` (Ho  "`> "   *@ @ޘ>  ` * :  @ :E @ D'  ~ 'H /d * %   > 0>  㸒@ ` > G֐!ТH 0`/`P耢M@  H(" :`*` * 2(":* *  ` @pHZ PP 'PP   `> *!P! $`8$`4$`<`x$`P$`H /d * % > * $`N1H 0> " ``.$`@%$`D$``> .`$`H"H /d * % > *`x "xH 0 > >c 0 `8 2`@ @@>r $`8$`f q -`8> 2` 8 ``8@4`8(0> `P"    -@ @ -@:  :  D H "($: * @*` ` 2 `8@耢`H /d4`* %`  MT` > G` "> GK> G!H 0㿐>  4> !0FDD  \> !0= M'%  \M"  $ $$@ $  \ M$$ $$> $"H ">> G" 0`  $EY$@$N \N \0` ei㿐`*  >    -0 -03> `'r|    &`!> !r㿘@> a&  && & & "a㿈> a  "a@s > 8 8''7` ''4i t耧`@ &` &` t &` 4S& ` 㿈> !`> "0@8 > 8 87`'''' t4. 耧`"@&`&``t&` 4& ` @&&&& 㿘>  @ `>  t``>  t3Ɣ $  t3ϔ $ 㿘!>   >  t @Ԕ!$ 㿀> "   $@ @ .@ @ /&@     ( 2b  $"b    *  * @ +'@ &@ ##`#\#d ?? > &@ "X  &@ 2  @"@ " 2 "@$  㿘 $@ > "(>* "@@"@  2@ 0 @O>`2$@ ($p`$   (  , o> "  8 " <> " 2 ( a@@2Z  ( "   > ߐ d@"P  =#I $>@ 8     * "* * 5 *` #* @#@ aH ''' #\#`#d#h#l^ɚ    D#`#\#d#h#l^    D&  2 8㿀 $`,`Q> ߨ d=> c" ' <'' 8 " <> >" 2 ( !@@25  ( "  "-  ' $' $$'> 8'` `* #* *'쀢@  'ƀ "  `2' 㿘 > " > "$@ 8 @ 3 㿘> ""l> > Ӑ"\O^bȁ(   !> Ӑ & ""z     < 2  > <*`" * `"  " <  `Bz ` u&  "q> ll & (l ("`,"l& , "c&  `%&  > a<*" * ` @> 0 `h@  `  @  ( B@  > 0 `a] "  >   "& ||& $ ! & & &    & & > `& > ll & (l ("`,"l& , "& B |W " 㿘 ? X&  @  ?` & @    @ Bq0G`&     @   ` & ` !> Ӑ &  ""y  `     #""  (`" , ,"`, ,? ("& (& ,  "  > > > Ӑ"c Δ! & {B*㿘  A  ?&  `H&     @6  `" !>   &  ""y  `2     & > #8"&  (`" , ,"`, ,? ("& (& ,&  {p> " @: * '2  2 * #p''䀏`  8   ; ;``  @ C  8   ;`; `  @ C E @ @  @ 2@     `0` `#> > > Ӑ"ch-"ےy `(Ho  ?"`> b  :DP'U D``(` ` ? ` <` 9' ` @> # €`( `(> !p@ Ho  ?"``(Ho  "``(2 ` ``@`(``(@> `0 b > # €叐> `> `( `(Ho  "`> Ӑ"x > b  : Ƥd> # €⻐> Ho  "`> #€ ` `(Ho  "`;`2`'#\'蠘`   `"`> O#`Ho  ?"``j>  f> . @ X ,` (  (z@ (Ho  ?"` (Ho  "```>  0@``(@%`0 2!€ Ő`   `> ` k#> h  € > b  :D䀢 ` `!> Ԑ %``" Xw ```!"`yɐ`` >%`㿘> @4 >  $@>  h@  > B? 8 : :` @ B   @      8 ;  @ 8C  @ ?㿘@ 㿈d @@    2 ?#㈒ '( " ( >  Ho  "``&>   @ :D Ҷ'      @ >   )%> ( (Ho  "`"vޖ @Ho  "`&@@  '#\  8 '>  @@ 9>   @@ `( xҐ (Ho  ?"`0"(Ho  ?"`>  0€&@>   @ :D q` p@6  `%> Ԁ%" !&  vW  ` 4 2  $ @? ^ 2 2   & N> "  'г. @ D 4  $   $ $&@ >? 0''''''   @'`Z`<  `]  `]&   @ `> 0  ^2`耦`&@`   M@    . "@i 1  ?`&  w `  㿘   "   `& = !> &  0 ]  Z@`  㿘   4  2>  $( >   $ > 㿘!> I"\> bd" "bd> "l`#  "``X2`(` 2`(`  =6` $`"d"d $`0`0"`$d`(`〦 d`$ ?   ƚ 1```"`(``,"`,`,`("$`,$`(` =$` `0` Ir\㿘> ""p> 7!0㿘" D  2 D > Ԕ ؐ 0> `?>>>aD % $ l4 \$!x$!t$!p, h$!! $!$T D N H /f * ' > pp`$"""b$""pH 0  㿘H /f * ' "`""""b"?""$"$"H 0 "` ""dF) "d $"`F# $"dF  㿘\ $ 'D``d  `  H /f  Dp $a€ * ' DaĀ aa 2aa    "a"aD$ a?"aH 0 j @ #> Ԑ @  D@̔  D ᘒ`Ȕ"!  @ F  D0A  K ?` @ 4  2@? ` D H` c 4  D D  D B: ` `  D0 D@0j@o0f֐0c㿘 \ "`` "d  `  J 2H /f4!* '!   !! !!@&&`  7! 2" &!!&! &! "`! &!" `H 0  ;  B> PH 0  " 2 `B >  2㿘 !F@] % a2@a1@La@"a a@ a@"aI@"("` a@" 0H@"A"d !J@. !F@( {G@""`t 0H!G@ ""`!H@"f"g @0!K@"1"`^ Z2X /W !F@, !F@  J  !J@C  `    " @0 / @  2*  `  " " /     !F@"   !F@> >   /> "p`"c"`@"\bbd "Xbb`"Tb  2Pb 2Kb  `@2Fb @@2Ab @6 2 b`@/ @ ڤ 1     `bd `ͤ 1`2$b  2 b 2b  2b  2bbd` 2b` 2 b` 2b`  1b`@"` " @C @ B0  "d &"`Cؒ  B!  &"dH /f * '  \`@6 \H 0n ""dC &"`"d "eC `&"d \0!G@0H!G@S 1  4L ."d D0!H@0H!H@; 1  44 `". 1"d ) @ C"d @;#@8 & l 8 ?W 2 &"& 1㿘`2> ̐  .@     `.@ `.@㿘` > ! "@  @      .    㿐`2> !H2`/@* * @&@㿐`2@> u!p22` //    * *@ & H> )"` "dcH'7 5  1 ->(!(@ (> 0> !(!ÒА@" @  //<'// `'' 7```& / '    ; 22"  &(    j cH > {!㿐 'P'T'L'X@'H ?Đ*@H6 > "p`. b` "'bbd`"#b  2b ` 2b>b> (2b`\ "bb`  2 bbd   "b`2b`& (& (B> ਚ 8B >]0<@> )"` "d"lcH'31  -  )А@;" @7  //<'c `''/'/' '''' 7```.[ / '    r 2H`2 `B >ΐ %&"h @ `@  @   -`-@%` %` %`%`"h`" "h`8 ݐ?"`8&"h"h  "h>"h   3#\   @M H > z!㿐 ` , B'> "p (`"`"!""d`""  2" ` 2" \  @D  2 ""d  @<  "" 2"``!"`` B<```;@C<`m@0/ !㿐 @>   a   t  > 2  , 2  0 2  4 2  8 2    `  `` `|`` `` ` /@ "`u &`  `` 2 ``?#@"g 1` 2`  2)"(,` 26`` 2 6`` 26`` ",`6`&` @  "A 1 " ,` ,`8 1,`2  #L 2+> bt4 #\z " ` @R  2` 0`& ,` & 0`& 4`& 8`2 6 >@  , 0|Y 㿐`@ ``   `  `2`h `h > > "b  LH q #"X> > "b*`, 2 2` 1 7> )$4@7>  $@?* 2`@4@5 :` 4@` @ vߐ #\t `,z ߐ16`>2 1@7> 4@7>  @ * 2`@ 4@5 (` 4@` @ v #\t `,zR ߐ6`>{ǐ `` > )`#H`''?'` "` / " 1` 2 ,` 2  ,`?#@2 , 1 2 @ 0 2 @ 4?#@" @'`'`'` '`'`'`'@Œ "&`{  ,    H@Ƞ 2  HȀ lȐ 1'hȀ`" `4 "`<'@. s ,` ` 0   4 2 > 8  >  y#\ " ,? 0 2!` 0 2` 4 2` 8 2` > 2 > 0  & , & 0 & 4 & 8`> & ` ?& `& $` l& (! `6 < & l@2T l?*  & l{ H > x"p> )`#H '` ` > )` "` 2 `` 2`` 2`ϰ `  `?#@> " > ''' '''##`'`''`` '`'`''Ԁ `> > "`"``  `'`'''` > #> " .6h!v`!/ , / 0 / 4 / 8 / H " /  4  / T`@m  L/   `@ ?l*@ ,@T  4`@M  23@ "/4 `> 2'؀ ,܀  , ,䀢 ,@+  26`< 2  2h> )#H > w"P㿘`  @K&`  , ,`>4 `,`,$ `0 $ `4 $ `8@$ 㿘`  @/&`  , ,`<4 ``$ `  $ `$ $ `(@i$ > )#H''d@ @ > > "p"p` ` '` h' ' D//'''''/@/@$' 'l'p't d<   > > #`: ` #h@ (`0> Ԗc  S dd  @@ ` ?"` ` d &` "`@dG  d`8 4 H "`8:{dH`8?"`8H > vϐ#p㿘 9   4  < \` i   8?$ 8㿘> !   0 @'  2 ``$ ` 9 4  < \`8?"88 ` "@     "     : 2   8   ?2?  * +   > ) cH0 @ !k '@0!j@@ Ԓc3 i -!@ " !@ 0Ha"0!@0H a" "T @ʖM@a!@. H! @ - a@'aF@!@ !8 ! !aI@ aG@a%@ aM@  aT@aO@   %  "0H? ?  `"XX@" 2 `"X@ "@ C0Ha"@a!@= Ha@   !@'a @0HNa%a@אa@0HEa%aI@"" a%@0H:a%aQ@aR@0H1a%  1?   / #0H  0H 1   > + D D @   > + D D @  0Ha%@"N | H!@.0 !@0ra!@a"@'0jaR@" aI@>aQ@W0]aS@9aT@C0U (& ,& 0& 4& 8&  <&$ @R&(\ O  `& d& h& l& p&  t&$ x?&(& & & & &  &$ 1&( .&,@j 0 "  @^!0t!  & & & &   #" @ &&  #"  $ ' ' ' ' > +`D ' '  > +`D ' ' d lװ H /` * ! @ҒH 0 cH@  @ `P ' `/ ''' '$'('P'T'X'\ ''Ė ? @"  d 2 * t* p@'?@s ', @s, rcH, 2  > Ԓc1 g  ,' ,`\ "`\@uJ$@ `  '0F `  2/ ('< ,D'@ 0 'D 4 'H 8'L <'P @'T 'X '\ '` 'd ? @" @sM    \? & \ @ "$@s$X    -x cH > sr#x> )H'' > #Ȁ` > Ւ`@  '`"  \ "  ``-  2 / ` "`H / 2 `  `   H@ `P 4  \   \`, `0'p`4't`8'x`<'|`@'`D''q 2`-x 2`-y 2`-z`" X X@"`-b 7z`- `h \   `> #`> Ւ`H N  > #`> Ւ`h= C `h`` 8= > #` !> ՠ @`& 2D`H) 2@`H Ȓ 7    7&Ĕ( .) .(> + D&&& \  `&&> |&` & `` 2`"`"`&(`&,`&0`&4` &8`$&<`(T&@`H (q|  > #` !> ՠ @0ʐ  '`H&|`L&`P&`T&`X&`\&``&q 22`hxh@  "+`h  :+  > #`!> ՠ!8@k0 p ?&p&`t&dx&h|&l&p&t&x`h&`l&`p&`t&> +`D &&> +`D &&@k d'`d&`d`> + D&& ? &@  &U V \@7@ `$< X 'c 7'/  7//'@~ 2> #`0!> ՠ!@ܒ 0" 0%5nD "Đ"`&Ġ"@ > ""`` '`'' '/@y/> "/А"' /   X''7'' 4  `@    8 ?$ 8 2 8(@M D(!'@'X'0','4   7 ' 5؀ ?$ 8ؔܢ @ > Ā "Đ"`&"> 3"> 3c@  &ܐ@ 2> #`!> ՠ!@^ܒ  04Ր2 "Đ"`&"@ > " " '    X//7'''' 43  `@{    8 А?$ 8 2 8@ƒ D(!'''''   6y B' 4܀ ?$ 8ܐ@z 2> #`,!> ՠ!@ܒ 0 0! "Đ"`&""@M `d H@i  ܀@L@ H > p!㿘 @i   `  8e  "  @ 0> ՔaИ Ֆ`00 ?& ѐ Ā ? `"`"""@!  Ā`2 Đ@㿘H o *@ g 4> a@2 `"a 2  > `& ΐ"(` "`@` @"` ``2 `\> ՒbX {0 40?"`\`&` &`@r ` ?&` H 0㿘   `h 2@ 5p> )#H'2 > "!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ \!@"  -0!@P - @ @g " 1@ڤ ` Ԣ ` xܰ  x@W xٔ Ւ' '  ǒ ' ' /@| *@' a@)  @$0@h А А Ԕ '  ''@'܀ 2  !@  @A  |  `u Т @  '   ''@'쀢   ` 2۠0F 1!@ ((E\ ` `>@!c & *&@ x*  ((&\  , ``, @ || H'dao#H > n"㿘  H /f * ' ``@ "`  "``2@$ax `h ax a   H 00*H 0`p`&`$ `a   66  ` &`>#&`T`\ @@c㿘   ,>  "   2  !>  J  ` 2  ?"`   $ &  & " $ & `2 0.!     2  > "Ѐ   ` 1ݐ & ?"` &  & " $ & `2 >   2 ` "` @"  "@ " "`2"`" 2㿘> ! ` `@`2` 6 2| "` "`! ! "@! " $! "`㿘> !  ? 2 @ `"  "` "@$$ 4 60 2 p> )cH'H /` * ! &`` @ "`  2`` `   @ݔ  2  ,  &  62  2 @H 0% 7 & `& `& ` & & & `   "   2  2& 3 6H 0 1&T  `$  & " $  & А@ג ax `  @`/`/`''''  0ؐ0 a1@& `"  "` ?"&& 3X 6 ?$ H 0  @OH 0#H > lĐ"p> )cH'H /`   0 %А* !  ? 2& @O`"  "` ?"&&  `` ݐ?"` А@U      / /  ''''!xa22 6H 0H > li#㿘  61%   7 &֔ &2ɒ 6 㿘 "2 6  ?? " 2  2  2 㿘  `"  ` 2 `@  2  , "$2 @02`42`82 ` <2 2 > \> (@ *` > ߒ@ "\H   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ !\c(* *㿘      0%>    "    0 0  "p@  2   ``   㿘̐    X 㿘> ! "  0 @Ô  2  "    0    @ `  (0  㿘> Ւca   : . "@     @ "@: :   㿈> )#H'        ///////` /> ՒcP& #H@ ``: * @ &@ . `@ &.  ?. #H > j#㿘$ ? > 5#0> I 0`{/> EA2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   > !`"?  ";  ") # " *  4&  4  $ 42 `  0  2`` 2 蒂`B &:耥,),*p B; p `B ;  `B ;㿐i? ' 5' ` 2-  2)  2&  2#  > !`2' G`2  2 0 $   2 ' > ! `2  2  2   2  2'  2  " 㿐@a   ' `2   @aʒ  2 \2  hAA`? > I0`4 b0,`\2)` `l   8 ` (`    :```2b0> 㿘  -   - $  -ސ!$ @N$ $ $ 㿘@N`@/ `/ /} `x㿘> !x> f"㿘İ x& &  ܒ'T'X& ('P'H'L` Ⱀ  :   @. :`2 2  2 "_> ߒa|"`  "` "`"`3 ( 2  > `"X 1> !x& H /f * ' `` @``k&`` >  > & ` 2" &@`&` &`> l@Ho  "`> @bH 0>  "  H 2#\  @:{ > b`  "` p> > )b H '"b b '  Ւ (   l$ ޾  Д`"`#H@   //Ѐ`,>   `C@  2`' '''`"<#H`+@  2`' '''`@2``@Lp ܔ`@X L`@    ℀@2`> #H`"#H > g#Ё㿘``   c ``2t `n.`># € i ` e H /` * ! > bdH 0 M > > !`d  D ``h ?"`hH /` * ! ̔ H 0' # r%@# r Ԓ   - -> :#  㿘H o*@ af H 0㿐6 @      0""`0 > ߒ Qe!` > ߒ Q\!d  > " RT   *> #\!hQ(%> )H' X@m> 3"> 3cw`  `   .`H@> f# 㿘 `"?@  2 `"` 2 h``2@o?   ` `G` 8  `G" ``" `%` Q? M?"K?`` D?2B?  2=?> ߢ a@ '> ߒa@ٔ   ` `2`  .`  .` .` .` .` .` .` .``   ?  .`` a@  ? 㿀x `> #`N> ֒` g 0Hce  > I> #`;> `0> I 0`!> ր@O 2`  > #`" X`0 ; 0c``耦@ > ֒ 0l "?> #`> ֒`   0c > `#l  0   #\ #`#h#d   㾸> )#Hx'@x x 0 @֐ \< X  b//77' ''n  > #`B> ֒a ِ ?> Ԑbܞ?bД      //'''''''H /` * ! $ H 0/ > #`> ֒a8 0 \? > H!ΐ  \   h " ?ߐ $ @ ` '> Ȇb/p'@'D'H'L'$','4,'('0'8'<   @"d   ?'d'T'P@d    @d   H > d!> )#Hx'@ x 0 @> "p"p> bb ''  ܢ?  ''//''''''ܐ////'''''A  > #`> ֒aД ? cH > d"(> )#H'`"Z?N@  ." "J  ."&" ?H?? /G@G,H<`#  ` * 2  X@G G)@    ..6 X .6   H > d-"@㿀> ) h cH'"M#H4 lF#H l$> #`=> bPG h 5 V \@  \> #`,> ֒b 0N '#H> "p"p'` `'`''Œ >  #H> !`  #H"#H > cА"ȁ> )#H'@+:3> @K `@ `` 2@ `v@ `l``? ? 2f`Ā +> ?``"`"""F `Ā`2``  `(&  D@K4`|' v''''   ( N`  ?$` a@ 2 ``%a'?a` 2``  > `"`'.#`> ֒bؐ  0` ?$` `2@@K!@ bb  '    X//7''' &C H<@@ D4'p  'D0 'H 'L( v&H > c#㿐 @ > ֐#@  ?/'?   ? ? ?@"```?`` `  `  ?` `   ?? ?@"``` `` ` ``       8 &   " `&  * 2`3 ?# 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"5* 2`3 ?# 4# `@`` * 2 3 ? 4# +   @     ? @ * @ ?    @  ` *`&  * 2 3 4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"3* 2 3 4# `@`` * 2`3 ?# 4#+   @     ? @ * @ 2i > p#@ ?#  * 2`3 ?# 4#* 㿘  `'@`           2  2  2  " ` >  *` k00? ?  ? ? ?@2 >  @ >  *   `  р``*`>   ǀ```   @I/ `<# "`@0$l $@`P 1@ ` 4 ` @>  " @@`8 ?"`8$@@ ` < 2"@`@p  .` ,`&` &`  &` &`&` ` # $@  @   @  0@ @0 A 1'@ 㿘   ` ``" ``>  *` `\ 耤``値`  `0  ```ۀA`o`k " ` Ǥ /#ې $#א $ `  4  2 `@  "`" `8 ?"`8$$ $ $  $ $ $ $  2#`" A`4 ` A`8 Ð?"`8$# |$@H< 2 `8 ?"`8m$l<# "&#| L&c`  4 " 2   @J  " `8 ?"`8& ` @&  $   $  $  $  $ $ `"` )``" `<`2 `8 ?"`8& " A`` ` ` ``\ ``X` A`A" AA > `B : 2'`2'@㿐#\ `  `2b0> h`#`  # `# `# `"? ? ? ??@= '`` `> (`$3 ` ` `` X3 > > +`23  2" @# `?# `?# ` # # @ @  ? @??@  `> > *`"# X "#  3  ? @? ? @?@?@@2 㿐@  ޙ   @:> #h   2 X!   ,  t   @:> q#h   4? +>  @  $  `  ` `B =  `  " `   $@ @ ?" ! $ ۢ@&@ !>  8 <㿐'D'H@'      @:> #    >  !! > !(? %>  4   @u   $?`8 ?"`8> "!$$ $@   , , $  $  $  $$   1 $ "  @ 2  * @2  @e !0`B:` "@   @Q !0`B:`>  `B:`0`xB:`x H /f * ' > aD   H 0    'aDH 0    > > ֐#c > i#> !x> #@ ;> " 8"$"  *  *`@*   28@Ô  2 8 (@  ""8"2 "2= > !t5>  `'  H`& !  @$ $  x *  * *`@  $,, ?$ $ $  $$ $( $, $0 $$@$4$D ? *@ #@2 ?$@ , ? * @@&@ # 5? @} H /f4'aD* ''aDH 0 İ!# ? @a H /f4'aD* ''aDH 0 !1 $,?#@  @ #      $ ( , 0 4@! $2@ $ !5  N *  * *`@  $@  *` 4`  ,` ,`  4` $`$`$`$`F 2 2  ` ` 4  #2`+" ` 4  "  $ @ ```@" " `` " $ " ꀦ @T> #D`"# $D> "H /f4"D* '"DH 0 !  `"H /f4'aD* ''aDH 0 ɰ!5> ``@$"`@ 2$"% 2`" ?ؑ* 2 2 - - % %  % $% (% ,% 0% 4% $   wԔ  %% ٷ  @D " !%?I&״ ׆@*@D " !%?` &   @%>  h`B :h0`B:`D"H"H /f4'aD* ''aDH 0 %" > 0`B:`>   `B : H /f4'aD* ''aDH 0 !㿘> !D` > > ֐#c"p> }  '> @*)> `@J``           $  (  ,  0  4@v $Ԭ!> @2`@P D " !1$#?%#㿘> !D` > > ֒c#:"> } & `& `"` &`㿘> !D` > > ֒c#$"> }   "`  " 㿘> !D` > > ֒c#"> } & <`8& 8`8"`<&`8㿘> !D` > > ֒c#~"> }j  8 <"`8 < 8" <㿘H /` * ! H /f * ' > aD   H 0    %aDH 0    > > ֒c#~"> }*#> "`8)> '> >   ?,  8 < ` `(`B <`(  <2 #t@`< >   `0 <B<`0#t@ < 2`0H /f4%aD* '%aDH 0 H 0㿘H /f * ' > aD   H 0    $DH 0   $> "8@ >   `  8B<`  82` H /f4$D* '$DH 0 ̸̤Ր՘ָ<(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((hDp㿘@;> !a> "a> !> "a`6 `` `"+(\`;`"SXV`R>*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`㿘> !䀢` `@`2`  /  2"`> {j !!䀢 "@!" $!"`㿐> c B:c> #Ph ' (   #    2  ``̀  2  2   2     ?' ) @  5 :23  @      @:> { 8   `2 J@c `B :    @`2  c`B z:  @" c`B m: $$В"@ 0.    0c 0 2  > #`R> ג`P {!x0L? ?#  #  #  #  #  #  #  $# $  @  ? @? ?@2 , ,  ? ?  ? ? ?@2+ (, , + ( (6* 6* 6c* * * .`&  `B ;@ 9 (0M㿈@'`"`  "0 @B:@쀦  >  `B : F@  @  >   @:> z; 8  '쀤2 >  !`B :  :$ "> #` #> `p5`za > #((B:((` ""0 `B:` h`>  >   `A` > #(@*` B; " " "U  +> #W k> |#4M쀢  "l  "؀  ?> f#" D 4_> \> @   "0 `B:` p>!ȓ,  €`   [ "0 `BT:`R P   L "0 `0BE:`0   "0 ` B:`  >1 /    "0 `(B:`( "!   %"    "0 `8B:`8 沔     2T  :I T D  2 @'' ` 4 ` @4 `$ `?$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4`8$ 8` 4` ` <$  rB ( (r=   0 ("$ $ 1$ (   Ԗ   @:> xѐ 8    , ,(8$ B`B ;$ ;(8@쀢 @   "0 `@B:`@    ""0 `pB :`p  " "0 `xB:`x沔 =  @8f'@8^@   "0 `B:` LO@> aԀ I   =  沔    6@8 / # dR "'@$ $ > 3b?̀@ 4  q ( ( q 0@x > 3# 4qw `4@$ $  . (, (8$xB`B ;$x;(8@֒ (@ ߔ@   "0 `HB:`H Д 沔 Ϧ  @ON'@OI@   "0 `PB:`P  沔 ς  @Oܔ'@Oה@   "0 `XB:`X  沔 _  @E'@E~@   "0 ``B:`` e h沔 ;  @I@c'@I;Z@   "0 `hB:`h A 'D沔   @ @'@ 8@* /2@#`> פ d`a` `" `Xw L  @ !0`B :0`B :0@@!!> )#H'/ >  `B :   `0@ 0   0@:> v 8   2c>  Ҵ )> א 33<+"< ,"  "   2  `@ Ӹ   @:v 8   `'3 ` *  * @ @  <`@ ӏ|  | @:v 8   >   *,  2' @@הkx  x @:vi 8   `> ` 2 2  * ?@t@ `@ At  t @:v? 8   ?  * @@ 2 LB 0p  p 0@:> v 8   @vՒ   / /`'`'` ' `$''' 'Ġ 癒'Ȑ  2> А@v   //`'` '`'`'| '   > #`K> ג`v 0F@?`* `*`*`@  * 'Ԭ`''''/'a'> l** *  @'l'> # > ߑ* * a * `@  >  ?`B : ]?cH > Rr p> )cH  '   * *`@ *   $> a耦` > !쀢 @zH> ! `> ! @oHА@v    //?' ?' ' ' ` X7@ v D>  4 8  X 4  \ .  <"0` l  00 `` l@ 0 >  >  @`B ;@# \ >  8 ?# 8> !䀦  H @ 2 H > QА!`> )H '  8'Į  `   ѷ̔   @:> t 8   ` @uj  ؐ  /Ѭ /m t  ؀ ?ِ  ;  *  @ " ?-     z-  ` "@> 3     j ` ֖؀``ِ ``ِ   `ِ        " X7ڐ@  <0 `*@" > 3@# @ ` А  @@`Ȕ   @:> t 8   `` @ ܐ - 2   2 > !`> !Ԁ`2 "  <  "V     <@ʔē* @*` 8h4(V  <V   ʟu | h` hd  Ŗ(``\$`$`   (l```(l  "     A, - ;,, , 5, , , , '`8lД , , `> 3, , * 8 8* * * > 3#@4 $@@ ` ` $`,  8$`$` Đ@ 8$`$`  ,4 0` + #H > P@!(㿘(` )   `   E( `  $ $ * `ll $ Ͼ `@  J ." *J  lh   JK  .2   e >c .    А S   ) %А C0 ?   А `-3  ` *.4  J ."*    .  &$  ] 㿘@ @ c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @ &&&& &  㿘   * @ `    B ?> I 0: .  `2& `  0`@c  " S " `  ` `   "   `@"    22&˨㿐2 > I 0   * @  f` dx [ `2R    `"GF ` 0 2@  0 "    3  / "-   @"' (6` `> +? 'D@$'D"@'j `j  0? ? "4```  2 2 2 `* @`*`2`2`.`.`h> )H ' 'Ȓ`   ̔   @:> q 8   H@qɒ   //ђ    > bh bh } h!"t  r :2p  ,  , 0   , 4  , 8  , @U  2Z        $   (  @?  2D  Ԁ   2`*  `* "7 2沔 ]  *0?h@@ Ȓ@Ȑ L! 2 @pȀ "'j ' L@ "'  'Ȥ h2 h+0?h@@ lȒɴ@Ȑ L 2 @?Ȁ H9Hϒ L@ H   H)> PB?:PH > M9!P!> )#H' ''P> #`> > גah!  (pq'0(آȐ  (Ȓ` 0ɭ 0 #H iV (  ` 0ɚ 0 #H  : `(.` x`?`('` '`  '`$ '` ``&``&` `&`@p&`$/y/x`'`'` '`$'   큒X@p /Y/X'd'h'l'` Ȑ i > a``0@'  2`` 2```? ? `  @2`2'@@pR    ,T``8 w?"`8`2@> #`!> נ!To 0 `&`` :&` `&`` .@&`.`.`.`.`  "> "0  `.` !k.` : (-J-* 2 2 -- ? @6 #\    @^P  P #H"0 `B:`P #H"0 `B:``>!ܓ*` €P  "0 `B:`P #H"0 `B:`P #H"0 `B:`P #H"0 `B}:`P z#H"0 `Br:`P o#H"0 `Bg:`P d#H"0 `ȖB\:`P Y#H"0 `BQ:`P N#H"0 aBF:aP C#H"0 aB;:aP 8#H"0 `ЖB0:`P -#H"0 `ؖB%:`P "#H"0 `B:`P #H"0 `薂B:`P  #H"0 `B:`O#H > Ke" 㿘@/㿘yvs1> > א!H0p $!H㾈> )#H'  ` `*  `'@` 'D`'H`'L> !X`> !`@ @   @:> n 8   `2 `>  `B ~:  ?'0` '4`?'8` '<`' `'$` '(`$',X72 @X7"@  > #`J!> נ"H@ ` > #`=!> נ"@ `n 4> В @n   //Вئg    ֔ >> 0`"# ` > #` !> נ"Ȓ0G@m 8 !?`@@}  '> #`!> נ# ާ0(mϐ 8 ?$8#`!> נ#h04@  8 ?$8  0> #`!> נ#0? ? 0`?@|ϔ `? `> #`!> נ#m > `(?@0@0= > #`!> ؠ 0Őmm 0|   . i ?> #`t!> ؠ h$ imI c> @7 `@P)> !'> ! @B@m @m p@m   //q///p/f f xf #\    !>bp OP @mu  /Q/PXe  Á#H :>  6>  `B ;n#H > I h> )#H'> #P  > !X`T Q`P``4 L``< G @m+   //``'` '`'`''@29 -` ` ( @ #` \    O(` %`%` ؐ8% i ? 0   ``0  0`4 ? ?  ` :  `,, , ,,eS,`eO  ,((,,,,,`4  Ӑ0e> `@e:   `0e3 @e/  @12 %( i&@ ?&@`4 $$&@`0  &@"%`    ,(< .` *  ie@&@%` ,%`% ? ? ``$  ` ?@   @l_ <  .@.``&@%`%`   %`ĩ "`d`?`? 2`,` ,` ` 2,`,` 2, ,  2`,,` :?ؑ* 2 2 ,,,,  ( * T* 2 2 ,,#\    @o  "0 `B:`  "0 `B:`  > "0 `B:`> ``B  :``  HH > H Ё㿘`:  D `A=  $ 282 *`" (` "` ( "   Ԁ` d0 ``2 * Ԁ    ' &`  Ԕ d`㿘> !> > !HCa`?H  ͔ "-  4 > @kl D '' 0' v  !  P:`P X:`X ` ,:``> !>Ēa   P 2 4> j|  2 X@k8 D 4  ' 0' ' v '  0 "& \P 2 4> jY!  @k D 4  ' 0' ' v ' Ȑ 㿐( @  >  2   * @76    *#\> !1㿘   %   ``  @h@j , 4`@4   @h @j 㿘 W !& 4?$ 4 & 8 $ 4 & < $@ 4  & D$@ 4    & @+> +& D D @l֐  *    ,``"@lŐ 2` 2  @l    `D& H & , 0@& L ?*@ & 0㿘 , @> + D L |  ,    4 , @` D  4d@ly?$ 4` , < 4$ ,  H>  8 0 㿘> Đ"P1?*888999999999998<9998\9999999999999999999999998|㿘    > > i!H#@ *"@ *`" *  *  * " * "> c: `*@@ 6*@> !$  @2> ߘ!+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > # ``2 `4S```"`44`4:+ `4@ > "> ax@(8"` @+|@ 㿘!>  @ij!>a!A7 !A 㿘H /f * ' > x` x` "x""`?"H 0 `@ 0܁p> )#H' (?'''D     > Ȯ `B 3:Ȕ `B ,: !@> I!> `X  * X  >  *  @ `B ;@>  `B  :>  `B :D  " "0@B:@`B =D` '`  ( 'D``B }<`"0`Bv:`D` ``B :` e"0`B^:`` h`2   :    (  N *` `B : "`    ? ? $ 2 ?``B ;`D? ?@ 2 D` @2  `B :`     ?#@    ? #@@ D   B: D` " D"0`8B:`8D  " D"0`B:`D    ' D'  ' $D'` D ˔  @v̒  @ 2  2    2   D    D D $ DD``\  i `B :6`D `\/ ? ?  ? ? ?@ ?  * @? ?  ? ? ?@?  * @`B a:? ?  ? ? ?@2  D`X* 2 2 . .  ? ?  ? ? ?@ DD`X* 2 2 . . D`\   ? ? 2 `: ׂ  D  K cH   `: " `ߨ  J> ` " D"0`B:`D `` @ "`  2`` `    @u  2 >  !\`> #`Dఒ`B : ? ? "D@`B :@D D !`(!%> 4 `  @u  ap`B *:pΐ $aa x`B :x8 ?"8$a> !@f a  **  "  "  " $$j"a'D4  2#< h`2@ `2 `2>  8 #`f!> ؠ!X  f1 0Y h`>   : >    #  I> !X`2  @B: @D` ;"0`8B4:`8  * @'  dܒؔD@Ԁ &cHD   *` 2*` ܀ 2&` `B :` " D"0`8B:`8D  " D"0`B:`D  % cH` ( )А  (n    @:> ek!  'D`ؔ`B :? @> !X`2 DD`ܘ؀  `(`B :` ( ` "@ #` D ("`~    > !\`> #`D@   `@DB:`@cH  DDcHD@cH  `2   2   ?#@    2 P ?#@2 P B: D` ]"0` BV:`  P`B ; P0`@B:`@!I > > ߦ#a > ! D`@45 ` `B >  ,"0`0B%:`0 2  '   G cH * @*`@*` DԠ!>  cH`B :hDcH > A~!㿈   *`   (   ( ` 3) 3 < +" 43  `. `* 2+ `  Ȗ   * @` 耤 3 *  * @耥 Ð ` 㿐` )  (   @:> d!   2 &> ` (` ( ,  (`  (   @:> c!     > ?`B :?@  && ?㿐Q?# @ "  06 01: w> `5 q> ` 4`\  '&c> ` .   *` . `\  4(?>  'H֔$@ @O?H &@C Ր$@   ;?$@   4?>   ֚`C : $@    &?>   Ԛ`C : $@   ?  Ԛ`C : $@    ?> `B :?㿘 @/ "- 0( > 0#> `B : Ŕ ?`B :`   ` #  簔 ??h> )#H @' `@<? Δ  & h@@4ؒ`\0 ؀``ِ ``ِ   ` `ِ  `7ڀ` ` 2 X h'耊@ .  З ) & h `' / ̒ Є ) & h@ = ` @* *` 2  'ȐȒ o ) & h@3` `2- h (@ ">    * 0P> `B i: h@ 1   = ) &9 h@T (` + 3  <  +H0FEH@J π 3 `,` `,` @ 3")  < # +"  h0 h@@  2  @@ 3  ) & H  3H > >!㿐3 <+> ؐ!cx ^3.. ˒     ( ` h " & j 7& V `(   (   ,3 ((    X> )#H' 2 > a! "i? d3"< <,$ Z2) (+B Q?> M?: HlF;@ C (ՖȀ&@ 7 ɖ?#@.?&(@ $ & *  @cH?@  "& * ?cH > >!㿐?'t ?㿐`R ?`+@>Ő"*` €> ؐ ):?> #d(m 7> "(e /`, >   )9,#`  >   )- h> #(E  1$#\  -> "(QEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE`> )#H'  # 'D'̨  ` > ` 2/ `` 2+ `` 2' `` 2# `> !|> @> > +`DB  :@D`F ᰠC`D`> `b`0`k 0  D 他 #H?,`7> H |DH /f * ' D Q D `$" > ؐ"P_ $ h ( D?'D  #\  (̘  DH 0̀ ?> "N'0LH 03 _ V$Z!  D  @  !@ D @o(  DA 2 X  !H 0D$   (  > >  `$a?  '>  4 ᘀ%> > !` `8 ?"`8$`ǔ$8 $? '>  4  ` @nՔ  > ᘀ6%> > !``8 ?"`8$@`   .. `& ``& ` & `$& $ᘀ D> `B :  Ŗ D#HD`м<и;>   @ B`B ; ; @< " > "0`8B:`8> !|> > +!D  D #!`D> <b0 `#\`0_+    | 0 PH /f * ' > Ic D$  DH 0 A  H 0  а DH 0 ADz' ? @2D b '̑H 0e> <b0 D  ` l  94"0 ``  l@  ,4(  "0`B:` ;<"0@ l "0 `" l l  l  0420`2 \`2 \> !d`0 \ @$     Ö D> <  \ D  `? ?  ? ? ?@2`,` ,` `? ?  ? ? ?@2<,`,`< DM DDG D : `! !` `*:Ʋ  `*:<D@) '<  > "0`XB:`X> @`B :@>  8`B ; 8<  `"0`HB:`H`  H`B ; H ̀`A>ΐ!X*` €` >   -  >   $_> !``> ! 4@ #H8 ?"8$#H > :a# FGGG@GlGGGFН㿘 l> #@ ?V ?`Q>ѐ"`*` €"J  ?@@@!<9  5@1.  *@k&#  [@  [@^    @ -㿘> #@    ߒ  k& -@㿘0 !k 0!j  @ @\㿘H /` * !  >  >     $  ( ,  0 `  *` B ;`     @l"  2  $ $@l  2  2 ` `B :H 0`2``  < 8`h< @`p< H> 㔀* >  @*`  (: 0: 8 : :  >  p "@ >  p  㿘V 2. - R `:`' -> # * >  0"c> " @\$>  @\!> "!p1> >ْ`d!t4 >  `&`!t4:` p> )cH'H /` * ! >  '> <`)> -> +> 3> ;> #5> .7> 㔀@* > "`"` ,`2 * @*`@  ` `   / '''' !x a2А`* 㔓2`@ ޢ@\ 4㔐at5|%p>   *````   T* 8 2 `# 8`2``*``@\k$7c&&㌑H 0> )#H > 8#0 㿐> #`7 >  *2 * @*`@`@ * c2`@ 7> >  ` @ *@ " ""22 $ @ p> )#H?' * > * `  `z 0 >  r >  * 2 i  ?%> #@!> > > ؒcH @k!!\ 2\2X4.!T\ @K -H /` * ! > "`"`` `/` ''''x a1аH 0 %#HH /` * !   <`8,@$`<` <`(<`0H 0>  `2 #H > 7#Xp> )#H'> > *  #* `     C H /`4* !  > "`"`` /''` ` '' !xa2А@[C `c?* @  *`2    ?* @*`@ ` 4cH 0 H > 7T#h㿐>  >  `    $  ( ,  0  `*B ;      @i  2  $ $@i  2  2 ` `B :`'H /` * !  84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X$`XH 0E H /` * !  `     $  ( ,  0  ,`} >   7> 5> ؐ`@iH  2n` $`$@i@  2f`` "b``*`2   ΐː` 8#\ xY $@  $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x ?-` "$` ` @BԒ 82 $````-` ,` `Q >    ` @hŔ  2B``$ $@h  2;`$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X`x$`X`<``<`h<`p ?,$`x````H  8  2 H 0A 7 $@  $` `$` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x$`$`#H 0 P #> ) '؂  @ $@ (@ ,@  0@  4@ '`cH' ' ' ' '''''''''đH /`* ! > (` @ ؒ @g  2  $@g  2  2 2  H 0  1&Ȓ 8H 0 H > 5B#㿘  LŖ  ®     ?p> ) cH'H'3?  ?@@ -?@* `..  *  &  "> !|> @> > +`DB   :@D  ᰠ  > ؖ cȔ`0X4  H /` * ! >  >  `        # '   *` B ;      @g7  2  $ @g0  2  2 ` `B :` H 0H@`B :  8M   沑H 0 7 0     X ' (2  ֒ 8H 0p 7` *` *  *  * +` @  +  ( *`   @  *   ,   (  *  -  * @  !+`@  ,+ "  *` *  $  %,  +  &(* #@* '@      ,` `@fx  2` `$@fq  2`` "``2`  8  S 8H 0 7  (  2 ? 8: 8H 0԰ 7  ? > ?  ?   //''''' d l0  ++ , ,  8s 8H 0 > > #`  > H " `*`2  `H 2`dl+4 ㈒  > ْ`V  ``B :`Œ 8. 8H 0Z 7`B :@W   ,`,@  $` > $`  $` <,`,`$`# `$`$ ,$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8H 0   `4  ` "H&@&`&`H 0 > )#H > 2 0㿘H /` * ! >   5> 7>  @ 1 - ,>   `"!x ? $x@`& 8 2@@ @B=@?-@$ 82 ˒H 0>ْ`dt.% >  `&`t.":`p> c> )8#H '  (> *  `" >   0B: 0p`C  >p(> *    > !p`"   @2   (        X   ' Ғ ( >  7# d l" 0   ( ( (( ڰ > #>   `#> Ѐ  *`2  `   ㌐  ?Д  ?//?؀`d'耣`l"  (' '' 0' '''  cB<    ` 7`B < ` 08( @< B`:C :h` B#> c`C > >`>h ^ >  <  .`2 2 * @  * E* * >   ` =`8* @*` 2$8 2 8`2 ਐ`" 8਒`B >਒@ߔ`( B`C <(<8 @`> * 㔓2`@ `  #> )cH > 15 @㿀`H /` * ! 沔 ז       X ' ( 2  H 00"4 `>   //> 'P#\  @ H 00i!T`` @ "`  2`` ``` ` @cP  2@`  ,, $ $  !T$ $@$b0` `l *    `@ *   >   ,, $ $  !T$ $$ap 0 !` 0 0gH 0p> 0> )`B H :0'   > G < ( $  $ 沐   $<F 7 Ē"@@4 >  &@* * `($ *      ? *??ؐ  //'''''   : > *`*@ 2` > cB> ޔЀ 6  ``B > `H > 0  H㿐>  `B @: @" '`!`B ;`Ԑ 0 /  0 @@ޖ   @:> Rې X  ' 2 !`B ~:2`  !`B:`0q2`    g̴  `!B:`0\  T '> > 㖔B# 48 ?#/ @2@/4 !(`C B8(b804 ` ( ; `  !(BP8(0" `0  D!0`> *@  *`@`> b '@5Z!㿘`    *   >    8\dpp|ddddddddd dddddddddddd dddddddddddddddddddddHdT00000000440444p00000000000,,d,,,,,,,,,,,,,,,,,,,,,,T,,,,,,,P|,4,,,(,,,,,,,,,,((((((((``(```l(((((((((((000(0((H\ \L08 8 > )\'X#H ''`'X'd '@   h!`> PƐ p`h``'` '` '`$@Q|'`1> `,`" `0 `l@?* %'d`0`" `4 `p@3* 'd`4` t `@(* 'd`X` x `@* 'd> "H`ylH /f * ' ` ” ` `$" > ِ Pf $  ( `?'d`| #\  (d  `H 0d ?; "'d0H 00 Ϣ!  `  @  !@ ` @_  ` 2 I]  '<!H 0l   p "t t "x x  (   `  ``@ 'dh '``?c? " ` @ߒ 'dG'`h '```@y <'d,`,`, 2 2 ,`,`x` ` 2@> O  <"x#@x ``*,`l  2 > O *@+@l"@`l#@lp  2 > O  < *@+@p"@`p#@pt  2 > Ot  + *@+t@"t#@t $    'd  $`  $` $`  $`$ H* * "?"?"?"?2 `` 2 `` 2 `` 2 `` > `  > >    -B: 'dX`B :X`А@Oޒ `'@`4 2`8`%`\   @ `* `*`@ *  `     "`` * 2 2 2 ,@,`,`,``" `@?" `` ,`  >  ,` !o,`LH /f * ' > Ic `&  `H 0 A   ``B :\ "0`XB:`XX X%@%`%`%` %`%`%`XP`B @:P \  `"0`PB:`P`X` X `  `"`4` "`4` 2`0 `? ` p2 `?b "2\  \"0`B:`\ S \ 2 >  `B :"0`XB:`X 3n'd` @ "`  2`` `   `@]Q  2  \  \@ ` `> !\`> #` 2 `\` 6 ` 2\ \`.?` ?@ (X`\"@\@T@ښP 'dT%%`" ```  % `  \`%`` %'T\ \`-`? @?   ? @? ?@ 2` ` >  ` @ @   `> `*` * ? ` ? @?  ? @? ?@2`,` ,` `? ?  ? ? ?@l,`,`l`L`H @2```\" ``*B ` p'd?# @2`" \ `e  A`'d]`Y : `! !` `*:` '`'` '`$' `*:``  `d @ P  (\"0@` l@ @ "0 `` l@@ 0@ (9'd \P  T@  \`@o'dd ( ` `* @ (@ T?#@8'TT"?? ` ('d\  "0`hB:`ht` `  ,$*p 2 l " `  , *>  >  ``B :`> ` ` 7B: `'d ,,`` e  '`" '`# @2`> G%`<   ( # `E` ("` `@8D 'd& ?* D2 2 *@* '@D  *`  * 2 2 **?* 2 2 .`.`  `@4 44 @@ 2@"@` "``> " D* D*`*`*`*`D*x`B :x\ "0`pB:`p \ " "0``B:``'`&`d``"`d  \`@|'d`'`d  > `p`B :pЀ Ѐ` @`80 d@ dЀ`> )`8 ?"`8al_p]t[xY`ې> )H > (l 㿘4 7 V    q( ``  7`$  D& 㿐   2  $ `$` ,8& ܐ 4(` ` (4= 7      ;( `  ( 7$  Da @& ` @$`  ,,` ` *` , ,`'DF `  "`㿘( ؒ (  * 7&@ 2   ~      & `& `  &`  2 7 " && 㿘  ,    4  @Z+  " `8 +?"`8& 2@Kb   .`.@&`&` &` &` -"<0 @` l@:  \ &   *\ $  "%(!'X  "\" A0 @`l@:      *''`2'@@> )`>cH 0'  ` ) @ R ` '  2 :>ݐ!* € @K  "  2 7@'>ݐ! * €`!8Т $  h@2ɢ  @ڐ*@ h@   /  h@2  Ő*@ h@2  *@ h@2  *@ h@2  x*@ h@2  m h`} h  h > t  , q 0 m 4 i 8 d> #d` 2] `Z  2WT  h@2O  <`*@ 8 Y hA  <@ 'b "3  2. ('>ݐ . € h $ h @/*@ h $ h %*@  h $ h *@ 2 h   $ h   *@ h $ h *@$ h h@ "   ݀    @uѢ @ ˢ"ɢ  2Ģ `' `" h "  h  ?$ h h ?ߐ $ h ? $ h"  $2 H o *@ a  5  | H 0"  2z  'r 6> 75`0> <,`09> #    2. +, #   2! , > #   2 , > #    , `+ <*@ * !$ @@@@@ h h   @ h @@@@$ h * Ő :>ݐ * €   '" 76>ܐ#(* € h,2  h)2  h&2 % " h h2  h2  h2  h2 > #d @  h       ' h2  h2  '` ː ' & ` ' H 9     ?#@8'А@H  ' ' & @ 퀢`8Β >ܐ#*` €  h h2  h2  h2  ' h @ ' @g @aH /`4 * !  !   '  !'! '!'!'!'!'! ' L/ȴ' $& @ $H 0+ 9 ' 6& 75"  <"  ' "@  *  H > $ 㿘`)  = : 6 2, *  2( "$  2  2 ` R `:2"Ѐ  ` R` : В ѐ ' " "@ o 㿘> 0  @Ւ?$ h {联 $`` `( { 0 "  R`@ $ @?  {㿘@GY h?& `&& \㿐 2  { hE &#`#\@ h> )#Hݐ?''Т  `U'>ݐ"ؓ.` €   @G E  = \ 69 \<  :( , 5(  4 0( 0 +( X '(  !,  (  ( @   ` " ' d  ''̢ > F!( (   &  ( &` `?J H > "!0㿘`.   "& [ {& `/?&`=?& \`0 `"  `8 ?e & "`8&   "& 3 {& `1  , "& ,' {& ,`#  0 "& 0 {& 0`3 4 " 8 { 8` & 4`8 ?- & 8"`8& 8`2  X "& X {& X㿘@&`\& \`d& d``  {2 & k`""" " "`  {  & S`> `,  {  *  & ,@`,>`0  {  *  & 0-`0>v`X  {  *  & X`X>c`4  {  * Δ & 4`4>P ? 7㿘 ?h {`> )#H>' 0 @`'  5棔 2&@m 7$@> !o ,`,`$`?`I>ݐ#H*` €B  > > ̀>   @ >  * ( V \ @2$$@! 1 $@   = Ȑ`! > !o ,`,`   =ϔ Ā  ,`    2 2 2 2   ' ѐ > ՠԐ @E'А /Ԓ , $ $ $  K$ Ѐ  1 <  @ >  *    V \@2 1? ?  ? ? ?@2` X6` `2 `@S  2  x 0 "s@` $ ` "`$``g$ c  _  2 2 2 2 U  G' C >   @ >  * 1 ? ? 2`6`  `2 `@S   2  2  1`"  "` ? "$ $ =@ -'@ > !l `@ H `  ` @ 5&@H >  g!@㿘 T   &&   -0! ``"` @`2`X" `` "`  ` ``"` > !l"`"  -㿘   ? `"`"""ѐ  `2 排 5㿐 `": {   "- " '  (# (  ?8  )2 #\#`@ 2   ?ߴ 㿘\` ` `> DZ!P   ` ` 6 *`  ?݀`>ސ *` €?퀢`+v>ݐ#\*` €2q  . ` @ ` `  `  .Q > Հ . `"`@ 2E ` A ` =` 9>  `   >  * 2*  2   {  &;  /` * @`! & @`!&\ ~> 0  @ ` < 2 /`` ` 2 `` 2`` ` ?? ?  ? ? ?@2`>  `@  >  * `6`  0 / 0@ {㡔  &;&  ߒ 1  ` * Ӓ 1 {ご  a&,b  ~ v (t ` / 2n  #"0 2 0  0 4 X0X {M  -'@:ҔL  3D B ``* <` 8 ` 5 32 ` /t 3 {"  &4$ 7:  @` &` "d@ d ?&d &d * 㿘沔   =   '  ( 0 '8 0(? ?   ? ? ?@2 + +  ? ?  ? ? ?@ + +  o 㿘 (C    2 Ð; 7' ` 3   @3  #  ?#  #  #  $# $ (# ( ,# , 0# 0 4# 4 8# 8  6  ` <#   ( #   ؒ`(& & #  & 9 (&@  2,   (0"4(4"X(X(㿘> @!㿘> -!㿐@ !   b   @:> @_!p   2 > !`B : >   ?`C : "    ! @ * @&@ 㿐> !> !""   , , , 7, ,  9m > "!ā㿘H /` * !  >  Xc2` @O  "& $  & $ & ( @z s 2  & (& $> ""H 0㿘 >  Xc3  > X#4  $   @OW     @M 㿐 `       @:> ?!   `2  >  `B : ?? @@ "@{0ɀ  " 0`\ ` ` 2 `` 2`` ?` ? @? 2 ``X* 2 2 .` .` `   "   2  ``* @A7``*@2 > `X#2  `p `#@NŔ  1 `  (-@` ``  `` `` `@N  2@2 `( @ $`( $`$ ( @ $`(> ""@`Ƞ`4` @9` 5?` ? 2 ``X* 2 2 .` .` `` @ "`  2`` ``` ``@Nd  2@`"`$`$$`(`? ? .` .` 㿐> b H H /` * ! $> !'' ` `` '' #  (  ? $ ( @ $ $$ 2 ` `` '' 2 (H 0㿀  : ऀ 2     _  20 @ ($$ $$$*+`+`+`  :  `* +`0#`4#` 8#`< #`> "`"`` #``#``#` #`"  #`#`#`  #` #` #`  #`$  ........ ?& &  ?&  &. .  (  :* 2 2 ..@>Β > > #.`  @ `B 8 //'耤`b0 `B:``"```$>  > `b0 `B:`b0 aB :a` b0 aB:a> a`?#\  4̬̬͐͐̔(㿘> `<  > ْa= 0>  * * > !>  +  (+a"a"  #`<>b" ".㿘  |> 8a0 @ , $ ,  #2 * * @?$ # $ $ @㿘Ғ |㿘"0@㿘 h  ` l!v@8&` l&` > `> ْaД 0= > `! 㿘@= (&`& & &㿘 2 > ="2 > ="0`"  2 `   `*  @ & @=ƒ ( 2  & &  㿘  > <"X  2 > <"x e >  `B ;@= (W?   뀢0> `!>!*` € *  > #`> ْb< > & * `"& & $> #`> ْb< > #  > #@ `B :>   > ْc<Ԑ    㿘H /``* !`  $&  & 0>  @>@> +`D@ & &@ &  $0 $& H 0㿘H /`* !  # " "  0 "  H 00`2`<> <%# 2"0> <#8`H `` @ > <#X2 > ِ#<  * : `q>!*` €> #  6  > &  7Z@=˒#sQ & `<$     2& @ 0@  =>    7@ 03 >   &  6 >  >  >  76 50> #  6 > &  7 @={## @  0@В H 0㿘H /` * ! !> >!a > #Ԑ!> !`> #> +`" @`D:@@@ `2`> !$> #> + `D" ( " `D"   ?"2>  4#> +8" `DH" (@ 28H 0㿘> !`#> `$ @` 2@ `2`$`> `$ @` 2@ `2`$>  4` > @` @Z"`\ 2@> "( X > @$ > !X` c> !p`c@c`!c@`@0` `  ` X@ @  c2` > )#H'@;l     / /''''ڱ '`4$ ` `8 ?"`8' 1` : S  '@;4 D`> $ >''@b?   2:  "6  H`?2` 8" 84 $$`0 ``H  "@ @"`> #`> ٠#J0> ٖ#В:r  H > #؁㿘 ? ? >  `X@>>  4+> 2#P " ( 2 , 2 0 2   4 " 2> !X` > !`  > "(`X    @ 8> )H#H> ' ' ''X R'H /` * !  <@  "*V  `"&V V  2"V `"V %> +!> D4 @  D4$@ 0> 4H 0' 2< <@[ @U6 @H 0@:% D  ' v 'ۖ #H > J#㿘   4  / 4 $$* H`& 0 "  V` 2 ``> c  &`` ` 6` <> b0  4{ x> )#H`< '`0"`H`4  !> `  "`@H{  2`4``"`4 @ `"`@Hm  2 `4 @W 2" $`4 cH@  `4 v  @ " `4`   `4 ;e&`4"` cH0]""\ZcH`4!2` $`2\` > @ `0` h- X5 ' `4!2=cH\  `  > 8 hc08ې *cH- X5 `$cH < C  &`H> ڒ` 8Ȑ cH>  !> "`"  <@94$">b$``$  ?4` $`: k 4`ޒ `4> $&`4> $@a"@$``." " &+` &    "`"#"&#""` " R ? 2   4`  2 ` `<` ")`4@ ? 4`  $` ` i1S i- > #䀢`> I!`@ &`< ?"   $ &`@@o? 4`$`T\ @<` #'  ' ''7X7'/'G܀ f> #`b!> ڠ @ݐܔ08  XcHU`4@7!> T\ @2<` #` '`  '`'`7'X'7/'` @ "`  2`` `   @G  2 ""`@$""`?@"$``4&`H ;&`4` "Gْ cH > Z h㿀> )#H0l' , 0 !L "` 0aUaVH!NW3H0HaPm aM,aO/H0J!J1!KNH@7ޒ!(H /`4> * !> ! 2 /,"*  #>  ?&` &` ?&`  &`6`  78`x .`  6`" &`$ `X6`( ` $ H 0}@7'H /`4> * !>  4` ],* +@ "` "`(" `,"L`0# X *$8 <#@ `X24@ T +` 4$ ,`-  @ 8  <  @ ? D8?  0:(@ > ڔ`6  ڢ`* * @2 6* %` ,H 0@7 80 @`" l@* $ 0 ` l  $ 0 `$ 0 `$ 0 ` $ 0 `$ 0 `$ $0 `$ (0  `, ,0 &`&`&` &`&` &`$&`(&`, &`0$&`4(&`8,&`<0&`@4&`D0`$ "`@"@.HH /`4> * !>  4 !  ? ?  > !`` @``25 `2`@?`2 H 0qH /`* !@ݦ > ! @: @H 0R`?` @`?` ''''? @? • X7H /` * ! ђ "  H2 R H 0&`(&` R&`$&`,H 0 > "(&`@`H > K 㿘  > 5G!`2@> 5A!( `  ` `   2  4 y (2  "  4 $$" HN   0`` `@   `` i@Dx@ @    i`.`` i.8@ `2 2  `    ?`% 4 >  > 0/J `$  @    $ 2 2  "` `0 ```4 ``4  `  24 ` 4 `T   > !X`> !p`@㿘H /` * ! !> >b"  " .> I 0`b0  `"` 1 $ >  8yY$  #2 * * @6ǐ$ ``2b0H 0㿘 Ǡ @ € C 4   >  8 <?@' 8 4 & 0 ` " h \   A "  0 4  Ԗ 0  ' h " A  4$2 Hϒ   4   H  2  \ k "0 `e > ڒaP4 | "` "> cc$"c$ "  \`T   >  >  /4 )T  2T >  > ؔ 4 .$ T  ) ?"4  " h  $   2?  $ "0> ` .@5P# @Ș *    \  `"!pa$  !p " !p!$ 2!p`  # hG" " 5 0 0   0  㿘"` h* 3/ // / / /   `0` > 4!0`` ,C@  > ڒ 04{ː 㿘`9 3  `  ԕ  %     *@@g  `*ʐ  㿘   H /` * !  @> ! +  `(@3O (  ,`,@ `$` $`  $` $` ,` 4` $`   X4`$`(`( ڀ &@ &@H 0㿘   H /` * !  @>  4` 5> ڀ k<h@2 <` $`$`$`$ `$` $`$$4@ " `L8 2f`L$ `X, `8$$`<$(@ X48`8 $,`H#" @ $,$,`\$4`P,!$0`T % ,2 * "@*`  * -    " "  " " ` ` , 4:`T   ,2`*`" *  <@  `` @&@ &@H 0> )H> '    ' ''''' '$X''`@   d  d @:> 1}"   `2  >  `B :  `'` '`'`' > #`}!> ڠ"(qn 01 n 'Ā #Ȁ ̀ ?#@>   >  >  > #`G> ^b`   > #`:> Qb  > #`.> Eb? ?  ??  " X?@h X7h`Ô  l> #`> ڒb12 0 "  -`     > #`> ڒc 1   h`?  #` "   `z`1`А@1b   //'''' Ш  4@  0 ` 9    0 '` ``@' '''`   " i ?> #`w!> ڠ#`k i0 l@?   Y> ڔc0 0V QĀ NȀ K̀ H@E0D +Ā (Ȁ %̀ !> ""` '`'`'' X` 7€`". `@0  ` `".0`@/> )  !> ڠ#0!   !> ڠ#0   !> ڠ#ݐ0  >  `B ;> )#H >   > )#H'@0e  Q> G i `< ?  @g$   > ې 1(> / `  9``<    (` &`$@  `< "4/'/`< @$@ $ $*@ ,,, @  :  `*@  , @0,@0   ///р` /` @'`'`' ' < Xc'Ē 77'/' $$$ D$$   ` (`  @'`'`'` *'(N    | 2> #`!> ۠  |/8 ''' '@/ ؖ $ܲ($ ?$?$,(.`.`.`.`.`&` &`  &`  &`? ? ?@ .` .` , @ ` i  ?@$$ @/h .`< ,` i '`, 2 2 ,, :.`.` (* 2 2 .`.`@ #\ ݦ > "0 `B:`  > "0 `B:`> P`B :P8 ?"8 H 0 ``8 ?"`8+H >  A ȁ0> )#H'    ' ' ' ' ' ' ' $'  > #`!> ۠ 9 6 0.a >   @@   @@:> -"  `2 `>  `B : ?'` '`?'`'``* `**``@  2 2 2   `? ? ?@X7 > #`T!> ۠!֐. L> Ѐ  `> #`@> ےa@- <> `r  > #`)> ےap- 0$   . _ ` `@Ґ 0 > ۔a-Đ 0_  > #`> ےa- >  i ?> #`!> ۠!s i- >   H`0 T` 8 i  , ` i &|> ` 4``$`<> b0  (   >  ({4` 4`@ 4$ ?$42    ` i@  >  (L4`g0s` `2.T`  i , ` i&  `4``$`0>   (& AT` ` >  >  (4`1T` % 2$4`  H o *@ a @< "> @!X`<@v H 04`4 ?$4` $`$`  B` P$` McH> Ș `B ;@cH >  V"8> )#H'@-  i> G `< ?  @g   > ې"H-ʖ(> ,<" R  3H`<    ?(`  H$@` `<"4/'/`< @$ $ $* ,,,   `*  :,,@,ƒ @,’ `  ` `/@/`//''''Ā < Xc 77'Ķ. ''$$ $ %$$|  l 2@> #`!> ۠"Ր|,  '`('`?'` '$?$ $,($.`&` &`  &`  &`? ? ?@ .` .` `2`@   ` i@ ` @  ` i  ?@$$ @,* .`< ,` i $`, ., 2 2 ,,666.`.`.`.` :.`.`C (* 2 2 .`.`#\  ^ > "0 `B:`  > "0 `薂B:`> X`B :X8 ?"8˰ Hˬ 0 ``8 ?"`8H > " hG""`""`5"` "` " "`"` 2 "`> ,"  22 㿘 > `(XZ㿘l 㿘> \ 2  > ","","` "\ `` 0 ``0> ۖ#@> ےc* 0x '> ᄀ 2 o& 2 \> *#H f a 8 |=    0 ``0> ۖ#@> ےcp* 0K@+. $> ", $"@" > `"> #` #>  c 0n 0*  `$ & $ $$$$@H > b0  %@,#n0@ > o`  ` 2  o: @@&@[㿘>  \`(@ #X`"  "`> ""0 ?"$$ s | ?Ӑ> & > b?"b㿘H /` * !  >  c 2 > ےc*# 0 0 ``0> ۖ#@> ` > ܐ 0 ``0> ۖ#@> ܒ`X* 0e X@ > #`>  `0) `2>> @6@ > b0  $@+h#ǐ0<@ `2   @:00W*> & > c  #>  ` 0 0) `""`> ""0?"$$͒ | ؐ?& > b?"bH 0㿐o   0> ܒ`) 0C=> R#\ > a 0)y   `m&  = 0> ܒah)i  > ܒa0)c `""`> ""0?"$$x | Ő?& > b?"b㿘 `  & \  @   `& `0  @ 㿘  0> (ߐ!>  T` > #`!> ܠ! 0) 0"     s0 "㿘 > (" Ӑ ` "`[P> )#H' >    ' ''ap '> !X` > #`}!> ܠ"@ 0( o>  &`2  2  2 [ @@P   @@:> (M"x   >  `B H:   C  > #`+> ܒb(y 0& `  ,`` i ?> #`!> ܠ"0 i(\ >   ~H> И `B ;~֐H > #> )#H' >  b0 'X '\'`p 'd   > #`!> ܠ#`0(  > ? ? > #`!> ܠ#HːX' >   @@,  , @@:> '"x  ` 0>  `B t: `Rꋐ 6 `> #`W> ܒcp' 0R` *` * ` *`@  @(, (X> +'\ `'d''` /``*D@  '7' "8`  "` lQ%  #2 * * @)> `8% % ` ` *`*`@ * ` 2% ` 2- @<`T D%> 5> 3> 2   ~>  c ` v> ܒc'P q   ?  ?   "b    '9@Z  2h`@ "Q   ''`pH h@' `  /u/t  '| ' ' ' 'h 2`* *` ' * 2` `*` ' /  +  *  * @ '  +  *  * D@ '@M' 2 @[ T*  (u DB4  >4  * *`@ *   d> #`,!> ݠ & #4  `l  @ > %4#` !> ݠ j& 4   ,` `i ?> #`!> ݠ!HLX `i&x > X  ڐ@ |H> ؘ `B ;|H > !P@&ʒ D`<` `0'`''`@''`<`4 ` )> )#H''D@& @& @& H@& D       //'''''x'L?P////'H /* !   D8 D` D`8?"`8  & $H 0#H > !㿘> ! "  2  @5  2 2  㿘 > aX  0> !p` @V  $ "@8`"  "`> "! ?"&& >  4  @Ȓ " @  @-"`@p`? $` > ݒa0% ȥ |> )#H' 'D> %&!ئH@% DА@% @%ޒ @%ڒ        //'''////''x'L?P'  D D`"& $ D`8 4& $ "`8ņD& $#H > ސ!㿘> !  㿘H /` * ! > !X  > !p`> > #`> !p> ݒb$ H 00e!  H 00Y)> ݀2 $   "  $ H " $R  4 $ `` `` $ǒ"X ݀ ` a@ a`` 麒 @ H @R   @@@$@` aH 0 㿘 "0H /` * !    =  0. .  6   $`& IՐ2 H 00`'>  "`>  "   ?"&& GH 0h  > H 0] !` (    (H 0M  |Ŕ  2 H 0? '> $@ $` $` $`  $` $` $` $` $`  $$`$ "$@kh " $@ $@$` "&  $` ""   % H 0 T   2㿘 | ;   "` T "@"  T"`@V& T㿘`"  "` ?"&& ϒ |㿘>  4 @2  X X2  +  " 㿘>  4 6.  ? ? "( P 2  T 2  " \ `  @" 2t 2 \ 2@z 2㿘!> !`02`@ : @! ! 6]  ` |ĭ  T Ŕ `2&$`T`( `X> `   ? @" H /` * ! `4`4 $``"`#`4$`H 0 `L `@q > #` !> ݠ"  X 0" `   $ 㿘 P"0`& 8& <@ > #` !> ݠ"  X 0"Đ  \ 9H /` * !  `"  "` ? "& &  T "  ɒ | 2 ? $ > ݒc 0" H 0Ų |@%x H /` * !    *@`?ʐ "I 8 L 2 L  &L L2  L &L L )` 8&8 <&< D&D @&@ H&H L `P `@ > #` !> ݠ#HX 0"1 `:X 26 L\1 L ' L0@ɔ䤒 > 䀢`2`L> #`ِ > c X 0#\ "0| "`8" <@] L2  o` [ `2R  2N     X2F  0q  ?" @":  ' ' ' '?#> +> + D "@ @  `D" " 8 @  " <'' <'@,$ $ $ `D$ $   2 8  @W " 1\ &\@ "`H 0㿘 T    y  " H "R  $㿘>  4)>     L 6 ܐ  `4> !`- "A`4 ? ? "  L 6  P    P $ P P "   "  P ?$ P  2 `4"`4??  "   L 6  P  ?$ P  2 `4 ?'> %>  ? ? "4  L 60  P  2 P@   "  P  X   P 2  L 6 @P   "    X  Β  2 ! "*! @"  " @  ! $ @"  "  .   ? $  2 0   @ ?$  2 > ) P'#H'> #` !> ޠ (J  X w  >  4 "  P "  X X2     2|   퀤ƒ   `@ `2``> #`@!> ޠ X  X 0 : V  @  (  ,/ 0' 4'''`원  ! @  D ''@''  K > `" P  P & P! #`ː @ǐ`Đ X> #\#`` 0#d ``8?"`8cH > ! > ) P'd#H'> #` !> ޠ!8  X  @ 6  ؠ  //Д @ ( / (/ h@  D'l't  d֘ @>  Pd ?`& P> >  4 Bd)> ހ"*  P 2&  2#  X X2   "  > #`" 9 X`0#\ !hb`0  Հd#` !> ޠ!# X`0 Nd` `8 4H "`8dH > " > )hX#H'   M  > #` > ޘ# b `0 l x@ x`0@.   //  hl @ pt  @'''' 0* @ ' 4*' 8*' <*@'//< @8'''ܑH /* !  H 0`> #`!> ޠ"X  /H > N"㿘 < 8  > #`> ޒb  > +& D`D & D 8> +& @`D & @ `?> +"@D"@` ?> +"`D"`㿘 Ґ H /` * ! ? ? " `XH 00>6   `<H 0P 0`"( ` 2$ `@-\  2  4(2 @ D  4 ' ' 0 '' I   >  ` > *`>  > (  ` (> *`>  4>  4  Q, Q Q Q S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S R R8 Rd R R R S S@ Sl S U W| W Z X Z W0 Y Z Y Wt Z Z Z Z Z Z Z㿘> "h' h> )#H> ' 0 `B ':0   2 ?#@    ?#@sH@   //ђ  А> bh bh@ `h!"` `r 2}``, `,`0  `,`4 `,`8 `,@,  2g`` ``  ``$ ``( `@,  2Q``Ѐ?"0 `B < @ r"  `B :< 6沔 t  .0?h@W@u@̐ L۔ 2@s*̀ "0s$"0(`B  :( L@ "'  '̤`h@2z`h/0?h@"@uj@̐ L 2@r̀ "0r"0(`B ;:( L@ 5H  0H"0`B : ; `B : ;2@rː> 2  "  "0`(B:`( #  | > PB?:PH > Ɛ"!㿐`> `C#@ ? =?     > " `/>  #  ? )> 2#\"h`    r `?#\#`"h  > )#H'T'X' 'H'L'P @ 'h'l R K f'h R `: t    7    (r  2  7H'h@`&``&``l&` ` &`$$ H H $,̚h 2 h '  1$'h&`&` &` &`H`" l`4 "l`<'ll<*2 2  ```2 .`.`.`.@ r.`l.` R `:"  Ѐ?`: А`@ 'h`( wۖd 2  7'h d4@`Ҕ (4@h#\2  l 'hR` :> l "> "0 `B:`?`>!*` €l  "0 `B:`l "> "0 `B:`l "> "0 `B:`l "> "0 `Bz:`l "w> "0 `Bo:`l "l> "0 `Bd:`l "a> "0 `ȖBY:`l "V> "0 `BN:`l "K> "0 aBC:al "@> "0 aB8:al "5> "0 `ЖB-:`l "*> "0 `ؖB":`l "> "0 `B:`l "> "0 `薂B :`l " > "0 `B:`> #-   B ;00`B :0 pԐ?p͐H h> #㿘):- 00i le 0k  n "pZ 0  ” )ҝ q :   p<h > )  @ cH '`  '̐=S`G.`># €`> ~# ;'̑H /` * ! > > !  '̑H 0 > bhŐ  '̑H 0H 0 ?$`,`r    $` '̒  * ``(* 򀦠  > "`"`$``` $` `$`($`$  ?6 i`2> > #(# 2``Ԁ } $`АȀ  > I 0`T 1 P 1    ?#@B 1    [ . 1"ऀ ' 1$`, $`0$`4$`8 Q> I 0` 1 ^ /``H``,W̖ 2 ̀ m 1i'̐$`,$`0$`4 $`8$` $` $`$$`(WÐS   8J'̠А@I   //А`ǔ #2  97'̀ " 1'̠''' '''' ` /'̐ؖ'   -'̐} }Ւ> A#8oH > .#H㿘`    -   > "0  8> )#H @'> `0`@ `  'd   'd "T   Ő  2 /  1   8  8 $  8 (  8p'h'l'p  't'x'|h'|    H ,ad 2 >d  1'd zȒ {'d 2 < 2  < $ 2 < ( 2 <g 9 ,  0n  `\ 7`? > (2 (c 4`4`4`L4`N l<+2 `2  ```2  ..... H 4 2<.& &   &  (&&&&  G&$* `4`<c4`>  < , h`" ,2 #\ HY 'd /'dn 6?nH d> #X㿘@` +>  `*`   0@-$ 2@ * $㿘@! 2>  `*`"  㿘 沔 n  2 H /` * !  L> `p^  mH 0 7H 07    㿘 & ` 2` `@ (  Jc  2`  o` > R``* @ ``mg㿘  A  $ 7 H /f * '    H 0 2  >  p"` a > `@ 4 R`* @ 2   㿘` > R``* @@H /f * '    s H 0 " 㿘  *`2`  >  `:` `' +` 0  z  H /f * ' 6H p@㿘>  `  . `2  . -* *  *  J  *>  `)>   @    4@ 4 @ $ 0 4?`>  ` "$` J$`$` 4 Ja  >    4>    "$  J$ $  㿘 > E > `" @"` u u0 u u u u u\ u ux   (  4 t t @ @ @ @ t t t w x` |t  P P T X 㿘  q &   㿘  J   > >"" 0  `8""  㿘>  耢 " @@@ "@ 2@@"@> `?"`> `?"` { J 㿐  ,   *  !,   J   5 5 4`     2 &*@* @  !| `"6> ``0s0 ɐ@~   5,,4$[ m>  耦`` " @` @`2`p0B 耦``  `  @`*  `@`2`kT@8   5,,4$ ' 耦``  2@` e@`2`k0>  耦` ` T@`2`k@ Jh> )#H'@  "  "  $  $  //  h  // H JԔ  ' &&`T&`Xр  0 ( 2' 7 ( ,' 0' 4' J'7Ґ@O &`D&`Hр  0 X b' 7 X \' `' d' z'7Ґ@0 &`X&`Tр  0 , 4' 7 8 <' @' D' L'7Ґ@ &`H&`Dр  0 \ d' 7 h l' p' t' |'7Ғ@̐ &`P 2@р  "  x  ` " $ 0*` $ *` " $ H*` $* H > i#㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"    䀒@2 !% "! !$  ?! "!A!  ?!A "!x!@  ?!x "!|R   ?!| "!pR   ?!p "!tR   ?!t "!R   ?! "!R   ?! "!\R   ?!\ "!`   ?!` "!   ?!   Ұ `! 2! 2H2&’ J }  ' &&`@Q&`@s    @   Ԁ@  @&`@[    @   ܀@  @&` @C   䀒@&`@9 &`@͒!$&`@Ȓ!!@ &`@!@!x &`(@ !| &`,@ !p &`h@O !t &`l@F ! &`p@e ! &`t@\ !\ &` @ !` &`$@ !  !!@! &`|@ϒ! &`@ڐ @ `p! 2" p @@'pl p" `   אlJ J  㿘@`! \ ?6>(> ,, 3+*@ ("> (! 2 *@ " *@ "> 0 l*@  " *@ " - 㻈> )#H'H''''@> >   ' `> `2@`` @  J   ' @   4>- -5  0 `8H%  ` '`耤      C  2 mT h  @ J'H@  ' ?`>"\*` €@Ւ"  / H ',@L@H  W '  J  ' '''@ } ` ̀ Ѐ ؀  Ā Ȁ \̀ YЀ V؀ SĀ PȀ M  > #``G   C H /`4 * !        l  2 3`X x `$ s[:p'@C  ! ,! '`@ ʐ@!$@!@!@@  @  @ ~ @ٔ @Ք @# @ @ @ @ @ А!#`#\Ԓ!@ I@@''' $ [ '`Zc$ Y0'            @ T @  @  @  @@H 0x ` ̀ Ѐ ؀  Ā Ȁ Ẁ TЀ Q؀ NĀ KȀ H  > #``B   > H /`4 * !        l  2 3`V s  ` o Z5`'@=  ! ,! '[@ Ő@ !$@ !@ !@@  @ } @ y @Ԕ @Д @ @ @  @  @  @  А!#`#\Ē!@ D@@''' $ Z  ' 'Y'XH 0' H /`4 * !        l  2 3`V[ А Y*H 0qbS` g  c' `' H /`4 * !        l  2 3`V 5 ' 'H 0+`  H>  $``"  H JC  '  2> ޒ#p @ 8' J0  ' H ` * @$` 2> ޒ`# 0 ' J  '  2> ސ# '' ` >"4*` €H /`4> ِ* !> "X`  ` `]ʐ 2 `H 0H /` * ! > W H 0'X'\H /` * ! >#VX'H 0 ΀  7 ~' H /`4 * !        l  2 3`U:  `܀     l  2 3`U   "    `" ` ""`  `"$ ` ""`$ " H 0  ?    -       ̠ЦX#\#`Đؒ@ {Ȥ(@! 0@ 4 0H `0  * I  0 8 ?"8@ 0 2  `0@ 0 2  `` ` `   `H 0` \'H 0H 0 7> c  !>  "c> ߚ`"P#\ ؔ   "P) 2 H 0u @  ؐ $`$``$` 0  /(/)7* 0',`0 0 `>"*` €",` ,` ,` ,` ,` ,``> "P0\EH 02    ` ,``|ٔ `|@ N ``Δ  ``@ C         l  2 3` ,`X$`` X$` "- n.  $``"> [0"PH 0ؐ 7  2@` n2`` "`"``R`|`  + n.  $``"> [0"P}H 0 7  2@` n2`` "`"``R`O` `R @ ’ D('@'''  8 w +'`"``Ā``"`"`Ȓ?`"$`$`` "`X2` "> X,> "P0H 0`> "X"X`$`X`"`А`""XX$`> bH "bH <`,`H 0@"HM 6'`耤 " `" ` @2   bc  `2`@  `$`  $ $`?$ '  F D 7B ,   !"@ & /-     , `  @ Z   !,  `> b* @   @> "@ @        ' "H JH J  'H 0> )#H >  > $>  `"'lް @  ?`  ? P h଀ "R    ?ఀ "R    ?ഀ "R    ?฀ "R    ? J{  p @ y 'l'p  7 *2*"ࢀ 2* 3 ll +l -`"@'2 2@   В`@'2 2@   `଀ 'R   ? 2 3ଠ3  R`ఀ 'R   ? 2 3ఠ3  R`ഀ 'R   ? 2 2ഠ   ഐ 2ؐ Rz`฀ 'R   ? 2 2ภ  22 R``''hh  *2 'd5> [ > P 6` 6`ࢀ 2] l> ["> ߒ` @T   > ߐ ! .`6` d6``(@F  > ߐ ! .`6` W6``0@9  > ߒ # `8@/  > ߒ @ `@@%  > ߐ  (!.`6`56` `P@ > ߒ P .`6` (6```@   2"> ߐ  ( .`6`6` > !> [> ߒ`h!@@  >   !@`p@  2> ߐ .`6`6` > ߒx@ >   `@ڔ  > ߐ .@6`/6``@Δ > ߖ  .@6`"6``@  > ߒ! `@  > ߒ!  `Ȑ@  > ؒ" .@6`6`> #d> +> \> c`> ch> #pl;= > T=`+> cX> ==&`&`>`>` >`(>`0>`8>`@h`Hd `@ 'dlp    l@ Ӑ l~ J! 3  26 !  0 l"!O -! J!$  ?` p @  'l> p@  l 'l'p ,,!> ,4`l$4 "'t@klll'x@ .`2 l *  $`?@lll'@!$l!'@l    @ k J` `'\ @^ @ Hp@ U \"X J\X` @ C `@ C X  2  /a7d@/`/c  /\@``?&@&` *` 22 ``!*`\@oX \X@` "@ &`&@  ߖX  X`  &`\  J㿐      p a " `  "  } `(  } " `  "   `(  " R `  ?@ R `  ?@2& f  J  '^ & a &`@G ` } &`@? |  0@̘>`0`V 2@  &`(  R  ? @'R  ? 2 2 @2 `( R`2   " &`,  R  ? @'R  ? 2 2 @2 `, R` 㿘> "X    ̀ 2 ` '\n @ Wp@9 \8X Y`X@ T `@(  `  2/`/c 3 l    X /cX  2 /a7d@\  0\@``?&@&` *` 22 `` *`\@DX \X@` "@ &`&@  X \`X  &`\  J㿈  Z `2 U '/'''  '0C>`0`l <H /` * ! >&!hOݒH 0 &H /` * ! >'!-H 0"&&㿘!>  @l"8 >>>>'"8$"8Ж(!Ԛc" " " ~" 㿘> "8    X X H p         㿈> )#H'@+  `  & * 2     > 0  `8 2r   `l j  f>  * `<`(^ * @ !   @9@ ߑ, `۔ @- ? Ӯ >(!* €24  80 ".  8*  8&   뀤  2  `` ? 2  `  "(6 `- 2    4` ` 2 @ `@@  }`2 ` w- 2    4` 6` 2а   (ʰ `\`?: *  2  (  8 } (  8 s (  8  4oJ?`.@g  ? [(   *  Q(  @u H @Ғ H @ F 8o   8k  `@ * 6(_  - 2    ,`2 ? 6" @ 4I ` ۔ `2=  @" 4 ǀH8/ &@* &`ɦ`2%  > !*`   @2      cH `   cH `   cH > ΐ ؁  ( H P X X X X X X X 0 8 @  $`?"7 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$ * * al2`` " ` ` * `"`>*(           * `"`$>*(           * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "㿐`"N`"`0"`0 &  $  $ ?& $` >  $  $ ?& $` >  $ :` B   & $2 (#  ' (5` $ ?& $` >  $ P& $ $ ?L& $ &  $" $ =& $` >  $! $ >& $` >  $ :` B  & $2 (#  ' X` $ ?& $` >  $$ & $ $ ; & $& `> `> `> ȁ@  &2"  $F@5; @@" $ " $" $ : $" $ : $ "+@'  $ " $" $ : $" $ : $"@  " : : Ȓ :": :@ #@㿘\` ` @ 0@ 02   `@~@z`@v .`.  0.@.   '0ifb 6   .  & `. &  6 `6 6`.`&``&` 6``H6`F.` J   E 95 6   .  &  &  &  & `& ` & `& `. (& $ 6 *`6 ,6`.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`( "` 06 +  3 *2` `"`"`2!+  3 *2 ``"` " `"`" `*"`" ` "`$"`,2 "㿘`' P `2>*!<*` € * *  *  * * **  2*  &' L2  "(*`&' T~ ' Dx ' Xr ' Hl 㿘```  `` 0 .㿘@  ? 2 2@`&@`*@  ?@&㿘`(!!@ n*  = &@`*`2 22 n & "` n"`R`` 㿘`.!p!t@ n*   &@`*`2 "   2@ 2@ n & "` n"`R`y` 㿘`/!|!x@ n*  ߐ?&@`*` 2 022{ n & "` n"`R`F` 㿘apatR ` `2`2  "  2`&R % R`  ?@&㿘aaR ` `2`2  22`&R  R`  ?@&㿘a|axR ` `2`2 "2  " 2 22`&R Ґ R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a````  ? 2 2`*`2`&a\``  ?@&``2!a 000"㿘`s`6!㿘a`s@   24@$` &㿘`&a`&a `&a` ` &a`&a$` 2a` a`H  `@ j >  )a``@*`vQ``>* "@` &`*`X" ` $ a$ a $ a%>   $ $ $ ``@*`v/``* "@` &`*`" ` $ a$ a $ a `  $ $ $ ``@*`v``>* "` &`*8"@ ` @ "``a "`"`"`"` "`w㿘`&a`&a `c 2 * &a` `@&a`&a$``@*`uڐ``>* "@` &`*`$" ` $ a$ a $ (a  $ $ $ ``@*`u``* "@` &`*`" ` $ a$ a $  a`  $ $ $ a> "$`a  , $@```@ >u``>*`" ``&`*8"  " " " " " " v㿘`&a&a &a  &a&a$``@*`ub``>* "@` &`*`$"   $ a$ a $ a  $ $ $ a> "  a  , $@`" ``@ >u0``>*`" ``&`*8"  " " " " " " " a *  , &av0  b$'*`  , `*` ,@$@$` " ? zL@ /u `@?L /2? @ ''', '' _ /5, @ ''''' P''l'h''h C 7 8 .x /@ `@`$ `'@ $@=  ' ?0 ' d` _x0\xZv    @ 2  *@  22" =#` = 8 "`@ 'd'\'`° `(<  > 0` h @8@*  u `D  >`0''''''`\''耢`?   '\`ؖd`q\ o%@`k \R` N 4I`@D`$@`;'``7  42`2@뀤`0+2=    D  "!  ` ` ? '` D$@` ` `@̀ ` d "x  ">@\ "> > 0  M 㿈@ '''J@㿈` ''@#\  Ӛ 㿈o   ` '@#\  h@``` 0& 0#``'`'` '' c` `'`''! ` `'`''"4`@``` 0-`  0(` `'`''% ` `'`''%`'$ ` `'`''&ӔX@``` 05`$ 00` `'`'';&``''Β``'`'` ''``'`'` '`''l㿘`  6`&6 &&& &$&,&4& `&$&  _ l&(D<&,T U&0LQ ZM ZH> )#H@ @'''''') 2@ X``0` 2 `!H > ː!㾈> )#H'T@ 2'#H`( X``0``0?"`0`,  ɐ`0 #Ho`!#H > ؐ!0㾐> )#H`> H`aa'@ 2  5   `'!6  0 ` ,q! aᨀѐ` $ &&H& H > 5!H"@ "` 2` 2`  "`  "` "` "` $"` ("`  ,"`$ 0"`( 4"`, 8:`0 @:`8 H"`@ L"`D P"`H㾀@ D''''' >ఒ  y 2'ؠ(` `㾀@ ''''' ఒ ǔ Q 2'ؠ(`ܔ `Ȣ`zP@ 2 0%  $ 0 ` 0 ,?`$ 0Ő 0 " 2'ؠ(e` `㾘> )#H'  -H@  %H  2  F` ذ H`[  H-`u `H > Q!`㿘`$&& && &$&,&4& `&$&   l&(DD&,T &0pu&4Tq Zm ZDi 㽠> )#H@ @'('''$'',E 2\ X``0` 2 H` !H > !x> )#HD'p@ 2'#HD`( X``0`D`0?"`0D`,  `0 #HHl`Д!#H > ֬!> )#H`> H`aa'@ 2  5 HВ  `'!6  0 ` А)! aᨀѐ` $ &&H& H > Q!> )#H'̒ 25(@T  2-̐ 2`& F` $0 2$N X``0` 2`$>* H$`0`-!H >  !ȁ㿀 !8'?''' '   >  <8" > 4 "㿈` ''@#\   p` ݔ  @?# @"?`"` + -0% -0"4`, -07!? -0 ``2`  ''''#\' ܘ LW s` ` `` ?'#\  `  '#\ ܘ & V` '#\ ܘ J J%> @) `> "@$ P `P& > b$@@J@N  `& $> b$@@?@C $ `$> $@a@3@7 `$` `' ܀8'ܐC ܀ ````9?  &``. 㿘 @> 4"  㿈   ` '@#\ ֖ 㿐@(  *`  '#' @* @` '#'` 㿀`ݔ    : :`?@?H/ /!?"@! "!H  H/ /!?"@"!H  㿐 (! '!(` `'  @    !  $!$!$$! !( @$!(㿈@` (` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " 0  $  0 "   $  * `$ E 2` 6 "  `$  㿘`` @E  (> )#H t'@ ݔ )c@ "O |  b@ ":  @"? O?@ "" hJ?@ .!>  |@ ??@ :? ` @` @5 `@"  )`@&`}@*&? `@y`u@"?  1!?" . 1!?" .`.`@ .6  ' ' ' ' ' ' ' ' ' N'䀢'耢> ߐ"x* 'N4 '耢> ߐ"x* '/@/V?c?  & t@@  @     . . . . . . ** * * . *N  * * * **** . . . . . z. ' ' ' ' ' ' ' ' ' '@n'  ~@ "8  }@ @ ?# *` * * *& t@9 `#@B: &> #`0> ߐ"W ,  %& '`& `b%Q &     2 8cH&? cH > ғ"؁㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0>  c > ߐ" t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` 㿀> )#H'bƒ ` F  " `7B   #H > "㿀> )#H'g `  2 `7   #H > #㿀> )#H'g `  2 `7   #H > ː#0p` ` `'''@''Ԙ'''e 㿘`  "` e8` 붔  7#3 (`*` X ` @'*뛒 `@eF'쀢`   ``는  p`` ` ''@''Ԙ''''d؁8` `  (#$ (`*`  I*  ` '@c'  2@ "` 2` 2`  2`  2` 2` 8? <"`"` "` ("`  0"`( H"`0 D"`4 L"`8 P"`<㾠@ D'(''$'',+ ܔ  f 2'ؠH` @㾠@ '(''$'',  > 2'ؠH`ɔ @`r=@ 2 0%  $ 0 ` 0 ,?`$ 0Ʋ 0  2'ؠHe`Ꚕ @㿈`@: '?㿈`@: '?ϒx``@: '?'&㿈`&@'''4 N8`   @ ` 2`(v < r `` ''`'''''' ?X`( 'ؐ  =: `%@8؄????'''  '  ̚  : Ȕ$  *   ŔذA   ` ڔ `"@& 0" 0`, Ґ`0>  "x`> ߐ#P `J `@'` ''''`  '`   '` ! '` ( '``: '?!؁㿘 '>     &&@"  @ @X.$> ؐ#`?٤!> ѐ#`?0Р @> ߀ > > Ð#h0Ő#p. > 0  p㿘> 0p#|c@c@א* *,"@ **`@# + " *`" & 4$p#$p J(8  J  J  (8 " J   & 4 & 4 * 8 * 8"  `  ?2  " @ ` ?  2  2J  J@ `2J   $*0 ` + +    "* 2"*J@   J@J`  㿘  `"@ J@  "@ 2N@@  @ *@`N &*@   (+  2 2 " 2+J " ?2J@ "J`  2J@  @(*`  *02 @@@ @  "`"     " + @ @ ` ``z  @Z( 2 "" 2 @ 㿘`>  # 㿘> #` ``?@``H> > "c< "@> ݐ#0>@> >A>A>A>A>B>B!> #> %>B'> >B&`Hc#,c<"l 4`D$ `4 ` ` ` ` ` ` ` ` `$ `( `, `0 40@]& &`0> ߒc@L&`D>"`"&`D`D> !> " "#8> ߒc@L`0&`4@ 2 *@&`8 <.''  @#\#` ?8  > `_@ > # 8 &`@%>  8l` b  @>a  b à    Ңb @J`@* @ `8@C* ? 5 >#?`@`0$b :  0$ Є$`@ :`@>a à  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0> @ `82`4 `23 > b&`4  > cx 2'4 ''@K_ %> #>?H@K2@G 'b @KR H>  > 8> 2@ <* <b #@0 @("@ 0 p > <`>  < "0@("0 4@㿈#\@\Қ `?"`0 "   "`  "`  \"㿀> " @   +  >  "Ķ `H/ /`   ` `#`#d #\ޯH p@\'@"㿀> " `,`@U #\ " DH >"l`2`,>"€`,*@ *``0" `,`4* * "`,`8*` * "`, `&`, $ > ! 1> "ؐ쀢 "@'`' 㿘&`(&`, @Y㿘&`( &`,  ~ " @:㿘>  P㿈> " &`,#\( "&&&`0&`8&`4 1>  28 x"@? &`(&`, 㿘`,`0 '> "   @ H/ /  H p@ >  ??ߦ&`,&`(㿘> " " `> 점  D@? > ߶.` 2&` '` `" 9> 5> 2`8샐 l@ @`& 㿘> "$@"> m!.@m> @  㿘> ]! 㿘> #   ``?㿘  > !h& " 4>  ɐ!x 4> Ő!> c  > ! 㿘`>  !x P> #`` 4> > !>E ,@# ` > > 폐!0판!4  > aH 2'4 '''> @Hɒ @j &`8   &`4> "ݒ@H@H> !N`%!)> @Eb " PÐ@Ek  @ >B'] N 4'> )> @H"HaS 2@E? > CbP 2 $@ɒ >B'' @H Ґ㿘` > > #`2>  >  a` > > !0!1> #H  >E$   &#H> M"X>E0 L@(㿘` > > #`2>  >  a` > > 칐!0춐!1> #H  >E$   &#H> ">E l@P> #`` $`> 쑐!0P0`4 @Y &`0`@< @X &`45> @GВ $`0@q &`<   &`8> "@G`0> > "D"c `a4  > a` 2'a4 ''> !X#>B'c< 'j> aP'c<'a 㿘 < 2`4> ꬐"? ? -   =" @ <  8@  &`0  * * @ 2 &`0P> # ` q>"`<2| >"`<@"s `  '''#  >  $#. '䀢  ?@> " @XH  ` '`'?'` '8` !'> aX  8> גaP  2'8> ΒaH 2'8 ''@'   "'耢`">B@'>Bϖ⼰ 㿘l 㿘d 㿘\ 㿘> #. > c* 8@X  > > #D`4 齐" > > B#  `B < #H*` `" 0@  @ 0 2㿘> #H`?> 鑐#(2. > 錐#`@ "@> .`1>E0> .`1>E00 20"0  >E  02 8 $  2 > _#" "@Qݖ 㿘> #`+> " @ %" ?    2 #+`? ҃@ @ 2  @ 2   @W& 㿘> " ?@> !@it 㿘> #h`P> "`)Ho o > #`> l?8` **lH 0 02> #l?8`**#l> #l?8`**#lHo o > #`> l?8` **lH 0 > b>  +(2 > #P] 㿘> # "  >  > g#`?a#   > Z#  㿘> #`!> > #b0  25> > @# > > #p#L 2/>  ,  @V} '&5> h #> ?8 , @Vq c`?8 > `  > `*l&h> >E#Pc > "`"> ? > ې#ȁ㿘> #h`> E#ЕH > l*#h*l*@H 0 > #l > L> p" H  * *H 㿘> #` >b? > `   ਒ 8@ 㿘 > " d   @U0>  H > *`* @ *#ct@ @ > 4"  1 > "!t *  t *   ㇐#  t`* a> ဢ` a>  >  (@< 0 ` > `&2 0㿘> #` V` >b? > `I   9 8@ 㿘>  `  0@U%> > "`"㿘> #`2>b? > `  "    8@ > #耠`?㿘> #  >   h? 8> > @D*`p> ː x> `  , @U8!> #> #aؔ  #&aؔ @ , @U"(> c> !ؒ   >"> `H> >  "`" > 4 *  *`  *  > # "c㿘> #  >b? > #   ߍ 8@  >  " >  `?㿐!> #   ?* *   @T ?   @T0? ?> > "#|"" `#  ?0 @T ?` ` > > "cx"!'>  $!'$@Q d@`> 成 > :` @ d@!!㿘H/` /  > bL    "bL > bL?"bL`?H 0 `> " > >  # > !ؔ  > > ㄀g> H `* `*  `*  `*  `*  `* 㿘>  d`!!>  `d> 糐 ؔ d> *"cВ d$ @"@!> > "`$#t *n #t *`g #t h*`%>  "@@Œ  > 獐! d$ @Ր> "`$#> *c c $cc@鮒 > v!8 d$cc> *"#@绐> 3  ``:  d@!>  :`@4:`"`#  >  $> c|> #* "+ "@#  >  $?`*`  "* " ``> : ##"c#  㿐H/` /> `d  > #t  ' 0> #> #|@'? 'H 0b 㿐>  d`> > m!pc  > #> cx ' #> #| ""  "`0"# ? 'c>  `'> ## @ > #* "# * ?"`  㿐> Y`?!c  > 汐! ư!@ >  d`@G> +  ' `@,' '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`  7 ' `,'`P~> +"` `  > "` $!@-! ` , `""` 6> > !"Ta@成 > 7!> `( > "/> ,"㿐>  d` > + g> #t`c @vx> +` [> #`W` Px  g  ,g@ , @甒 ,g@ , @犒 ,g@ , @瀒 ,g@ݒ , @v ,g@Ӓ , @l ,g@ɒ , @b ,g @8P* xP@ ,g g `,g㿈@*/g////O7㿈P /// P///@&/> tH> t  *  @( `#t (H > tH> t  * *@ `#t (H 㿘>  d`Z0=H > +  & & H 0 > "P  "P   > 4> PP & "? & ?/a `&& P P "㿘> #` >  : %"@8@r /1>   ! % `   , 7   @   @^㿘>   5 , >  ` !!> @N* :   .@> ` @ 2`  #@N* :  ڴ`  ~ 㿘>  ` #>  %> $` !Ζ $` 2$` % 㿘> >  `" " 㿘> #`  > v"0   㿘  0@P > "c>  > *L7"8㿘> J!L` > # В`"@*^㿘  > G"H`?  `>  > # `?㿘>L&`0bt`< > #` > 80 @Pp &`4> "> •"a@> "P㿘 H  8@w > `& 8& 8> c  H  8> !x ?c 4  2H 0 c Ho o>  8!x ֪@H 0   > b>  |(2  <㿘``?> )#H' &a> bh@>  &ađX:   @2a &aa  >3 0>/"> #  0 > "p> "x> "a@ka> ဢ`"b`@@\>  D`aa (@bb@;`a>  dl> 7"> > >  #0_> Jc c> "% > ""b`"a@7a &`0>Ӕ"H/ /b@aH 0cH > k"㾐'pzp:   &">  "`D㿘> b> " ߐ" `   > "> Ӑ" $ >  ,"ʕ: > c <->  D# ⿕: %> ဢ  "`&c>  :` Ⲑ#8> ဢ`&c l :` > #> #   s h>  ⛐#h> c T>  \#: ␒`> ⋐#㿘> !#!!!""""`l0= . 08"">&"`"`"` "`"` """"""""+""̄ "`l""  "` "`"`"` "("`l""  "` "`"`"` "("`""""`l""  "` "`"`"` "("`㿘!>  Hْ  H  "" 6y # !?00 $}0+!@  d !&"&"&"&!!&!ܐ!0  "_^ @ !,! &"&"&"&!&!Ԓb@ !$ @! &!&"&"&!&!&!&"㿘@9> `@=X &!&!> ` @=Q&!> `(@=K &"㿘`?"> `8@@=>$`&"> `H@=8 > `X@=2 > `h $`@=+$` `  * & * "@> % x * $`l$`$`> $``@=  " &"㿘"  > c @n > > #ῒ (㿘` "> `@=u& > `ؐ@<  2&  & !> & @=e >  @=^` {>  v @<˔ & 4> a @<Ő& , `> !> %>  )> ․`   * `2 * `"& 0> !߳& 0 @<a0 4& 8  8& $@< & L !H@<& D`  `   *@ `2 * `"& H> !`߃& H @ a@ a @  )> ․`   * `2 * `"& >  x?&  @<-a ښژ&@<!Ȁ 3!@< & d> aؔ @<& \ ` > ․`   * `2 * `"& `> !& ` @;b& h dca h& T > " 㿘@ Ā Ģ㿘@@㿘 ւ> "  @ &!&"> S"H !̐ &"> "lbt&"&"!̀   &"㿘 >à  #@2 > 3"`@, 㿘 &"  Ң @|㿘! H: ! @&"&!&!&"&"&"&"&"&"&"&"&"&"@Z&"Ё&ƀƠ㿘! @> H` > c@;P?`4 ` > c@;D?> <  > #` ` > cȐ@;0?`4 ` > ?c@;$)> < % ?"?c@;?> >!c@; ?> >!cȐ@;?> ?c@:)> >  #@2  ?2  ?2  ?2   ?2 &!&!&!&! `! 2! &!!Ԁ 2"  &!" 2" &"" 2   &" ` €`""" 2"# #> `(@: &"@7-`(@: &"" 2"  &"" 2"  &"" 2"  &"" 2"  &"" 2"  $&"" 2"  (&""Ā 2"  ,&""Ȁ 2"  0&""̀ 2"  4&""Ѐ 2"  8&""Ԁ 2"  <&""؀ 2"  @&""܀ 2"  D&""쀢   H&"㿘> #@`#@`2``?2`` 2` `@ 2`> ې㿘> a  "aHo o>    `  O"` H 0 > "#㿘> #`2    `>  `?㿘> #` >  h 2"> Ӑ `2 >  0 @J͖ > " h> O 㿘 > !(> !0> > 8>!> > !x7> `h`> > @!-> ܟ"㿘> &"> > 8" > > "p`> 『܅"㿐>"€` `> "2`> a0> !4 " > ?"8#a0#!4㿘 + #`!> א#8> a8 "a8> #̒> 8 + > a0 "8"a0Ђ$ Т@  㿐>"€ ''|㿘 4 >  t. @  `@7ʐ$ ` " 㿘`` "$ > #`2  > > #` >  > c@8Ҕ?V`  `?"   ԁ& 48@ 㿈`> , t@`@7$@ 2 !0@ @"!0> ۸#`> >#0 > #7 `4>  `d`T,> cЀ '耤  > #'2> > #'> > ''0,&&&& n&` &`  > @ؐ&!H&> a@  &.G.J.H .K @E >TX 2   @ H /k * , @* H 0 \`\ \ > bX 2>  > > "X> "\a @C` >Tb\">T> #a0@D &`0Ho o> ` @  @ H 0> #`>  `@7  >U >U``4 " T" P" X? \㿘`" > j  > d ( 㿘>     ,`@ @ 2L L ܀ @D 0 `@ 㿘H o*@ f@ H 0㿘@j @f   * 2 :@a 㿘`2  > | 8.`@P 4 @I: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3> c " c `" ߐ  㿘*3> c "Ґ *c`ʐ 㿘>  `" վ  㿘> *@#`ձ 㿘 >  `" ե  㿘 > *@#`՘ 㿘 X !> !Ѐ    !В $!& X 㿘 X  > a& X "aА   㿘>  l%>  @  g  >  `@rf@7㿘H/` /#> c  I  c  @ H 0㿘H/` /#> c  (  c. " H 0> p> ? G @( `(  " " 㿘> `l㿘> `lǒ`>   " " 㿐> "0` Ho o   b0    b0H 0% H/` /1> #`>  `$ *b0`P#`>  `$*H 0 " 㿐`/Ho o> "0  `   0 T@H 0> )cH> "0 '> ``"`@23'>  € ??`> , -%> p @ " > `@ 2 >  %> > c؟€ >   `@5`> .cЀ Op%> '> 7>  %> '> 7> `J@ 2`J@ :J` ` z$?@1 € > ې K@p @ " > @ 2%> > !Ò0ݒ@5> a( > ""(& @5 > ےcЀ ?Op `J@ 2`J@ :?J` ` z$ ? @`L'> `H7> JJ@@`> ً!0`  `$ > ـ!`@5   > > "`p Ԣ -`pတ͒ ,`> g!H,  >   " > "l@&bb @H > !㿘` 5 % ` % `. 5. % % 㿘 {  p  0`` 㿘 0  0  S 0&  4 <& $ 8& ,& (  b ^  Z  U   P  L  H   C  ? ; 7 3  / M J  %  !   㿘`4  8  . 8   @  `€   @ ` 8   @  `€ "  @ 㿘 4  N L " ? . L `@? \ * L * L * L㿘    !t!}!u!y!zx!y!v!z!zP!z!zx!|!|!zx!}!}d!zx!}㿘> #   "     2> > !!O@ "    ; ?  㿘`>  " 㿘@0  22?@ 2-? " d@!  2#?@ 2? c@ 2?@ 2? T  @ 2?@א ? 㿈 2&`480 @D@ &`4`T&`P &`T&`t&`x&`H`H&`L>  ׸"`h> " > /c&` @?- `> ר"(0> =X``Ą >\ct@? `4&`0&`p&`h&`l    7 *`p @ " 27*`T &`T`4&`p`&`l&`h X&``p > "Ps0j`T "> @ @h "> > c"h> 4 _"8 7'> #`> > !!{ *>\  " #b 04    >\  <@ >\@  >\'>\b`,>\`c '> "h'5>X'1 ``' @- 㿘$ TN   *@ p*, &   & @ @ c 4 # h @ Ѐ 2a"@  2  @ϐ 2      `? T   p*@ ޒ 㿘>[aa>[ aa$ " > >  0"  ֚?֖"?&` 8&`&`ȓ,`" @  @ @`> c`&`L&`Q`02&> А"$ &`㿘 L> L `:  6O L* @I  x D `  * D@؈   x3`+ +` @B< @  8@* g! &#:`  x:` @ $ C *@@* :  2 x@ ( x  $*@ @p*  |  C& H*  ;& <& D x̓2* @   * *  :@Ҽ& HH /d * %  L 2$@*0  P > "@H 00 8(& 8H /d * % VH 0㿘 $  H&!L&  L &! L"# L@ 㿘 ` $!  &!&!!"a!? "& &!`,   &  L&! L"@$ L&!L ؐ&`H& `,VN&!4!\ $ P㿘 T " h p *@ h *@ϴ  h* T`  p*@㿘 T "  8 H    p  8 *` " ` 쀊 + * ``*`*0z 0 *` ` 쀊  `*` i 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& H P @ H 0㿘a " '>  h `Ѐ``$  Ӯ ? l ,  2 h>  Ӟc?$ ?㿘a"? h @  l *0  ??㿘> L  :  6M L* @  p2``  ` *` *  > * b4  Ȗ2 /  "  ̀ " & ?  $ $ $  @  `  *@"     $  $     $ > L2 @  ( "쀢"" ( "( " "ࠝ㿘>Z>ה T  y㿘>Z>ה T  y 㿘 P > +#(0@㿈 H   > !>  P#@ ">   > % p> ! p> #X0>  #` x0 >  0 >  >  >  ##\#`#d#hx#0㿘H /d4 H* % H   >  P  xҒ  & P!4 "& P P & P@EH 0㿘H o*@ e@0 H 0㿘 x !   >  PӞ 0>  Pә H /d * % @ H 0㿘 x    P    & P& x& t H`2a4& Ps $a``a"a& La?`"$`$a$aL8@2P P`J>X ē*` €& X$`D `$` x( 3`+ +` @8<``a`쀊   & P7 # 8` * @ " ` 쀊 "`I! ?$ ``$` T `& P` ?$`a$  T " `8@2`H8$`H@4?$` & P& `h`0B<`h А   `     ܐ & t   ` `H̥(  $``̬  `Ж@ϵ<  -  `@$8> b  @8$`D` |- $`@t%@ p`m`Е:` `Ԁ"P> `҆!P`ܘ 8 & | @ ` & /`0 h*@& P& t&  А> # M f, `@ ` ^  X  R y L   m @, `@ `e 8 `_ 2 Z -` `T ' N ! H  B  9  T `& P   `0 ;   ` ( HH+$`  & t& P &  dѰ 0> a80  8D H`0" 0 DH`08"    2   % 2  ` @2  X   ` `4  \` ? ` & `& \ \  & \ .& P X  ` `@* > >  a@?> ы#X& X \?? & \ `  ? ` & `q& \``В ;  B`<``䀥`ؘ " $` $`؀  `  @; T$H Hˌ d  & t& P & 4!ÐO n <   & P& t&   b  5 `\ /4 S  T ` & P> `  @n /#  >?  " $`@ H`쀊 " T > aP  (@ & P㿘 H!4& \ 9  X   6!  " - " ) 2 T 6  2 T> !xԒ 1    2& P0& P    ? > !п  !& P     @* > > a? Ք> Ч#X> a`8$`<($`8 X & X?? 㿘> cL4  bA@ ̔$"@@"`  s@ "@ 8" p@ 0e e@ "M` r ">@ 0@; 0 !@"pV  q@   m@? 0  h@0 0 )"=@"`  e`g@`f@ 0- pm! @`!r u @ n t!i ` &`*`` &] [ *`d S e g@O? 2  @?`4# @ `* * `>Z@0`T: 7 @3 2/ n, @+'`̰ &&& & &&&& & $&$(&(,&,0 &0 & $` 㿘> #L6  `  ̒ oޔ  * 7 $4$L$8@`vs``o̖  @i* &!; ` ;  a > aؔ   aW6r6J&&̐? 2`  ?6   .  *6 >Z`T@/㿘> #   $ P \  K 0   T  ? p*@M  p *@ `p2```   *` ( > (4 ȁ㿘`>  " > @*LbJ@ > " 3> c @*N !<: c> ސ"0!@> !<ِ"8 㿘> #`2 2 ` 8 2   & 8 `?P`   "`> α"P0g`> _^@b`@*@&d&`0> ΢p> b@* ?&`< 2 a4 < &`8 @&`4)& 8  > ܶa耢 2'a4 ''#> @)ϒb @p &`8 n  &`4> "b@)@) 5> #>a@)@&|  @ 'b(o @)Ր 㿘 8 21`0`4=#  ?*@2`&a@Q&a<> #`"`0> ̣">* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  8    `4  4@  @ ` @  #@  4@ `# `ޑ+ 㿘>  a@)G a<: 2` > Ր" 㿘>d a ה H >c!>c & 4>ݖ & l㿐 /@Ϊ @ @H /e4 L* & L   P  T`2  L@'H 00 >  _@z#貒 $  & P& L 0  TH 0㿐H /e * &  0 /& P & LH 0  "@"  "@"㿘  - &  8> )#H l' pH p L Hp ' > #p @l 4`hh    ,@ ,@l `,@ x** 2@H /e * &  l@EH 0&& t’!"HH /e * &  l 4h` ll@h2@H 0H > "#0㿘 # @ " c@" Hc @(?#@ #@?    @y Y&   0  ` `?& p 㿘 @  ` & H(. @`   `0  `. @  . @ ` @     . @> #@H 0& <㿘H /e * &  l x@ tH 0  d㿐 < `    / 0  㿐.` & 8` `2``2` 0 // !,!!!!㿐>    & 0& L>e Xa4I, P> '`' & p @? " 㿘 L"@ $d "!{ P t€ & 0& L X& 4㿈 p x 0 t 2! <b P T"'" 'Вb@ ??  Ð!?@W ?& 0& < < 6 <` L& < <`4>d"$*` €`  & 8`& @ & @`` @ & @2 < @ & @ < X`& <H d < D.` <: ` & D H.` <: `& H& < < 8@o X?& < p  @ #\ D@ H& D& HH4?(?" L`   ` @@  " 㿘> * * " *  4c& & &`xH /k * ,  @ O  4  1  . 1a. 4֐ȐH 0>f"> &`t`㿘 xH /k * , 1 `*1H 0㿘 xH /k4 * , 1 `*1H 0 㿘     !ݒ  `p   0 0  *  `@,5  2 | $ |$  . L㿘 ( 1 `N. 1㿘 ֐ߒ `2 F`` 0 ` 4  $ 4 |$ 0 $ | . L`2 F D@ F  . D E  . E |`$ |. L㿘 H /e * & H /k* ,|$|H 0 `" D H 0`,  2  ``I, `> a ȳ`$. EH 0㿘 xH /k  * , aF  Lc &  & H 0` 8`? `> )#H` >m'``8> ,* "* ` 4`& & &`4 > &``?&`\ G# ,` @ *  @> ! Ɇ `\  > !0`  >  "  b`" `"b" `\  > !8` >  b "` b"   2>  !P > O!@> vaX > pah 2> > >!p> ;!x0!> #>j>j>la̔Ж&&&&l  * i\&`0#&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 8 @ G# ' ''ȑH /k * ,  1 . 1H 0&@bH /k * , @& H 0 HH @ H /k * , & @ H 0H > (!㿘>    &>  !.  0㿘 4 0H /k * ,  `. @sF . `@`p" @Ē >  > єݒ  \ 2  T 1 ` , 1, !͒  T`  X > ې!@ 4H 0`> # > )cH ` ' \ #*@20UH 4 p $ $ v2 G H /e4 p* & p  $ l`P`"'@ "'H 0> !# `'`'`  @'` @ '`  'ȑH /k * , `1 ,`1,H 0$ @T\`2 $  # %$ $ $ $ $ N` p  ?$ pH /k * , x> $pАp$l$t  `,@H 0 `  p   H 0 ,`M`  L`M`  `L`Ms "$ p' L`M 2$ H /k * , @  H p@ 2 p` "  p $ p  @2L`M p > L`M G> і !+  L`M  `M  ) "& `M p H /k * , @o H 0 p }$ p2,`M p =$ p`2 p  @ p "H 0 2 p h> ђa@* @€ 2 p HQH > ]!Ё㿘> # . @ 0 p % 4 h> ђa@* `@€H /e * & ,`M+H 0 p  㿘> # . @> 0@ h*` 㿘> # . @> 0@ h *` 㿘> # . > `0a@ h`* @`4@ l d H /k * ,  ]@ "4```y@8`x@6@ `z@`{@7  `\@ " j@(+ `m@&`k@*$  0 0&t& $``@j 0 @g 0 @0@& H 0㿘 l> c*  4H /e4 p* & pA =V  H 4 P & p H>  H , P H H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!&  \    $ $ H 0`l> (H4`p(`p " " `p"`pH 㿘 l> c* `( 4``$`@" `  `   \  @,@   " X 2s H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> $ d $ h   , , ,L    `, @> #c$ d$ h@^ H 0@@  , ΐ@  4 `G `H*`F " `F `I*`F `F `? "߆ *`?㿘 4 J`` 5 * *5@     & & "@뉐 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@X  4 5 `` `  D`2 @` 2 㿘 l> c* 4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %f 㿘 `p`|`t E 脐 p q 0,,  :`x\ ?$`p$`t `  ,`. L `  `d ``,`   ``,` 1   . 1!. !㿘 @  Ꞑ& @ $ $    G    $ $  1  . 1. !  ,  , . L㿘 `0  `\  > #Ā``G`2 F D D ` `  .  F@. D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0  > !P> "`2> > !P"#\> a 㿘> Ь  l> `h!@ t*` "  4 |    T X `& T`& X 8 <`p  , Б* $ ;  `p  ` `@ P X `& P`& X 8Ē <`@@`?2  , Б* $    .  : x2 6& lH /k * ,  t& & t t h     `. `1  -`1-`!   `. H 0㿘`p `&`p &`p `H`Pv" > `h!@ *` €㿘 4H /k4 E* , E D, EH 0  G > `h!@*`  €  H  . > `h!@ *` €0. 㿘  0H /e * &  .  .  . H 0㿘㿘> =b   ` @@  " 㿈>p!` &`0>c`d`T>qcLaahih&ip&il&ih&a\> ,`* "* ` 4`T& & &a > &a<?&a8 G# ,   *   > "(˒ a8 "!>   >  >">"aĐ """ " !>  (  a*  (&aLaL*&aH &aX&aP&aT&a@&aD P 2a8 & Xa8  @ А#0` @ H /k * ,  H 0@  1`. 1 !ђ H /k * , @ H 0> H /k * , @ђ H 00K#`&`D> b> @b8  > fbH 2`D &`D`D `H`  '> ,"P`H> #`<> $"p`<`> `H"`H> #`a '> #4*` 2"> c> '" '􀤠>  H@ݒ/㿘!$ >  " c > " 0H o+*@l@B `4 `3 ` `5`@ ``,`3,`5 ,`4)u  !`&!d&!`$`@禐)t&!@ &!D)t  .)t.)y,`L)t   )t `.)t@K@ْ H 0)w .)w@@ɐH/` / ?& H& 8@_ ##? @ `  @  7#?#? @ `  @  "! < 2& H@* ##? @ `  H? ?> 9"ؑH 0㿘H/` /! @ @  *@TH 0㿘H /k4!`* ,!`( ? &!`@ )p*)p)l`@&)p)h&)p*@ H 0 @ 㿘!H /e * & )w 3!` /H /k * ,  .)u 1 2 !\ , 1, ! !\K !`!\)l  &!`&!\)h&!\H 0H 0! `G `H*`F )z" `F `I*`F `F `? "߆ *`?㿘! J`` 5 * *5@  )u  !`&!d&!`"@I 㿘! K)t  58 %  @ % @ *5*% %㩒 㿘 aLaXaP ㈒ ǐ p 㴒 0,,  :aT㟐 ?$aL$aP it  ,iy. L it  a@ it`,it   it`,it 1   . 1d. !㿘 @  & @!d$!d$!`!` !\ !`!\)l  $!`$!\)h$!\ 1  . 1. !:  )u ,)u ,)v. L㿘 @I `2 F D F@ . D E  `@ . E$a`$ad ,ix. L㿐H /k4!,* ,!,&!4!0&!,&!0H 0  > #> # `2> > ## #\> bJ P> )#H'!H> (!P!"@!X  !0!4 `&!0`&!4!= < /  `p  ` `@!,!4 `&!,`&!4!& <`@@`,$ @2 @:!T?2 $  7H&!HH /k * , !P&@ &!P!P!D )t  )t `.)t 1  -1m-!)t )t `.)tH 0H > h#(!H( `E `D*`EH  `H  *)w0*)w㿘 H /e * & )y .)y:)x .)xǐ)v .)vH 0`>  㿘H/` /! @ @  @H p@  6㿀 ?> #8  ` @&`$ &` R'`$䀢 `48 " 028  8?@4@1?2- `4 ' `4` >s `@ ''>s''S " `$ "0`$0"`4&`$`$"4"H`( &`(  '㿘" > #` / $ +#> !> 뀦 82 0` H2 0``  0ac " 0# X  ۀ㿘" > J# , $ (? 0" 0 8@2" 0 H2 0`" 4 4"`4 4 0"@& 4& 0  ݀㿘`"  >  : *` @ #2  >   㿘`  "@ @`㿘 $ & 0 & , P@  " 0 2 P 㿘 $   P@  0 2 P㿘 $ & 0  & , P@  0 2 P㿘 $   P@  0 2 P㿘 T` 2`  8 4 $  X$=@= 09` (*`>  > ( * @ > @r `@ T 8  $ 8 T 8  $ 8 X @ T 8  8 $㿘 X R`   `  `   @!`2 T* 82 $  8. T \?" : ! `2d `@2 T* 82 $  8 X @" T `2` "@  T  8 8 $ T 8 $  8`  T  4 8 $ 2* # !$ T"  X`>  `& X> : Xɒ @?`2?` l& X>u`Аd=!?㿘 ( "H /f * '  X  ? T& X`4 $ 8 P@  TH 0㿘 T \`/ 2, 4 8  $ T`4  $ 8 2  h 2 d & h d h  & d P& d @" ?? ?㿘 X !!< T  8 $  8% !`c#``c   T 4 8 $ L   X $ T 8  8 $㿘 X  ?& X l㿘 P@㿘 T `0@ ` `,@`!@!`<@ $`0 & `,& H /f * ' H 0㿘 T,   0@    0 `k ,`k `x2<`x`|<`x 㿘 X   T L*``" 荖  \( L*``# 胖  \'  L* `#  v  \) L*``& k  \#  L* `&  ^  \%  L*``( S  `<@F@   X L *`& h& X`+ A  ` X L + *`@& h& X 0  `  X @& X& ha$ L *``0  `  X`@& X& h!$ L0*`@     \  L*``   㿘 L T 㿘 X א l `"   (8 : @2` `2`  `2@ 㿘 X!/  T 4 8 $ T`4  8 $ X` $, *  $ 1$ ( ,, 2,` 1  (1" 1"  (""4# # & 0&  0 ! A !㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,| `0 $`0q 2 T`0m   4 8 $ T`4  $ 8  X @  `@  T 4 8 $ T`4  $ 8  "`0% !`0 `0 `0  `00 @`0 `0 @$`0`0 $`0`0@ ``0@$`0`0 `  a$`0$`0㿘> `   㿘> ْ` >  0}  (> &`L&`P&`8&`T &`X&`h€`T  4`8`$? b &`\㿘 ( `S "`"6`0C<0>` L2  9 0= L2    T 4  8 $ T$`8  8 $0*` \`   T 4 8 $ T%b`8  $ 80 L2   ? 0 K QV 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,Y `0 $`0N 2 T`0J   4 8 $ 0  T 4 8 $ T`4  8 $ !`0 "`0   `00 @`0 "`0`0 @$`0  T  4 8 $ @`0  $`0`0 $`0㿘 T  4 8 $ T`4  8 $?b  T: 8 8  $㿘> aX   㿘> aX >  K  (> &`LL&`8&`P&`T&`X@`T  4`8`$? b &`\א㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`ʐ0 L2   Đ? 0 ' -2 㿘 T  $`,$`0 T `4 $ 8` T`4  8 $ T  4 8 $ " T`, $`, T  4 8 $"`0$`," `0 $`0  `0 `0   $`0`0 `0 $`0㿘 4 ?c !2  4  @2 0 @`  㿘 >  `f! (> &`L&`P&`8&`T &`X&`h€`T  4`8`$? a ! &`\`T  4`8`$&```\?"@<``@ސ㿘`"+ 08103  L2  . 02  L2    T 4  8 $ T$`8  8 $0` \`֐0 L2   А? 0 3 9> 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,) `0 $`0 `0   $`0 T`4 $ 8 ` @  `0@ @$`0$`0!`!!!!!!!!!!!!!!!!p!!!!㿘> Ӓb4   㿘> ǒb4 >  hk  (> &`L(&`8&`P&`T&`X@`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`0 L2   ? 0 G MR 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,B `0 $`07 2 T`03   4 8 $ T`4  8 $ ?`*`>z# €`0 `0  `0  `0 `0 @$`0`0 $`0㿘 T  8  8 $㿘> גb   㿘 : *  2> "&`P * :  $ > > "&`Pb >  S  (&`L&`T&`8`P&`X@`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`Ԑ0 L2   ΐ? 0 1 7< 㿘 T  $`,$`0 T `4` $ 8" T`, $`, T  4 8 $"`0$`,1 `0 $`0&  T 4 8 $ T`4  8 $ `0 `0  $`0`0 `0  $`0㿘 T  8 4 $ ? 8  8 $㿘> Ӓc   㿘> ǒc >  Hk  (> &`L&`8&`P&`T`&`X€`T  4`8`$? b &`\㿘`" 0)#0$  L2  0"  L2  ` \`0 L2  ?0 Z0af 㿘> dcl   㿘> Xcl >    (> &`L`&`8&`P&`T`&`X€`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`z0 L2   t? 0 א ݐ 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,) `0 $`0 2 T`0   4 8 $d`0  h$`0`0 `0 $`0 㿘 >  `2# >  : *`@ 2(# (> &`L&`8&`P&`T`&`X€`T  4`8`$ ! &`\`T  4`8`$&```\?"@ <``@>  `0㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`0 L2   ? 0   㿘> `D   㿘> `D >  x  > c:`&`@ (8&`L &`P&`8&`T&`h&`X@`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \` 0 L2   ? 0 f lq 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,- `0 $`0" 2 T`0   4 8 $``0  ` $`0F`0@ @$`0`0 $`0㿘А @ =  T 4 8 $ T `8* 2  $  8 T  4 8 $ T `8* 2  $  8 T  4 8 $ T `8* 2  $  8 T  4 8 $*  T2 8  8  $"","p"p"P"<","X"P"$""""" "4"p""4"0"0""4""L""L"L"ԝ㿐> a̐  "a!> > a#\    Β   !> > !\ a#\   !\ 㿘> !\  " " >Ȑ  ޚ   㿘> !\ܒ " " " >   ǚ   㿘`@ _`> @ `> !\ܒ㿘``@ `> `@ `> !\ɒ> ̄ ̝㿘@ސ | 2 #> 퀎`1Ho  $` | aj  `逎`  |?4 @`!!> q  @ `@4 0 @ߐ |  #  Y& & & & & 㿘 > s  |@   `6 Ho  ?&` @   ( `@ ,8> )#H' 2'@ @  %" h/#\#`#d  @  >  * *` *   * *` *  ' 2a`2^`@h А@d    ///#\#d///#`  @   ? Ш ѕ.ґ+`ӡ(Ԗ Ւ  ֱ5`-    5- @  -`4,-,״       ّ* ړ*` ە*  '`F cH > >!㿀@  ##\#d/#`  @^ 㿘ʐ ' $ *`*@*` (&&& &$@ے :`  `  `   `$  @0 㿀@   6/////@ $(? #( #\#d#` @  㿀 &@2 @ c /#\/#d#`   @ 㿀@~  /`//!0 ##\#d#`   @Ԛ 㿀@c@_  // / \h#\#d/#` @ x@E@A ?# Z//逧/\h7 /#\#d/#` @      ( (     㿐\&` dh'`  ?@`2$@ 2$ $" <  " #\     i&$ " #\  "Y*   Q  $& *  A 2@  <   '`    *  *`  $@`(   *  *  '`    *  *`  $@` * *   *   ?@ 㿀@l  / //#\#d.#` @Ě x,  @M  U4 ///#\#d/..#` @ x@2 @/666 (/////#\#d/#` @ 㿘 $& , & (. X`0@  & ,H /d * % @ H 0㿘> #Ȁ`> a@  ` €& 㿈 %'쀢`''> ! " > ! "> & > P& & @  !>  "}  `@@h?"㿘 > " @_  & ~ @㿘``d`> ɐ"Hh 2 ; \$ $ $ $ $$ #)` " $`<`8$`<`D($`8$`H ($`HH /d * % ,H 0 ( t㿘 @  +  ,` *`>  €  #@L@  ?@ >  ,"p   ?`$ 㿘    .`  "   "@*`" * * ? !> =1> !!"|  ?㿘 `(`4@? ?      > <+  €($@"$(  @    *  d  @} @y #`$d_dq dn 0W  *   ` V]bZ bW `$?# @4`$O UK VG  C VC !G  *  c > 3   *   4`$`$`?# @4`$ `$  0  ?    *  b   V   @㿘 8 ,` $`> ">  " ߔ㿘 4 4  ``q> > !p! >  @!@ ɔ ``  |  >  *`* @ @ !0p@q> !  `` > ! ` > !  ,  @> ! ,  "> > !> "    * *`  *  "  "> > "P"X> t"(  ,   * *`  *  > b"` @@ʰ > "xW `> Q" @ @ > "F㿘> "`@w  ` *     ``b`0"O b`> !Е* b` b` b` M  p @> #> #̀> ^> Y > T > #  `    @ `D`` > ( Eb` A "@b``;> t*` € @> "> "*> 3 b` # !b` > "@  b`*> 2b`ޒ b`   b`*> 2b`ϒ b`㿘@&`, 0`,&`0 0"@@& 0㿘@ , " , ,$ , ,  ,$ 0@㿘@m ,&`,& ,`, `,& 0@㿘8"<("8H /* d % * H 0Ð  "<"T"""""t㿘`  z N 2 r ```$ `  I\ $ ` $ $@   ($ @ " ` "  ` 2F`   $  ` $ `$ [$ .`[ X.`Z ,`$> *` € $ (" &`$.`[ .`Y 4`(  >  0 .`Y 4`(     .`[` " ` @ "`  Y``  J #㿘 !&! " `$#`00!"> `0 *  && ` &`&`C& #0 `  8   /- ! 0!">  : `$?# @3`$ 3`$`$ 3`$`$ @3`$  `$ 3`$ @ϒ".x"."."."."."."."."."/"/"/"."."/"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/"/㿘`> 2 x  㿘>  `> ""H&8`.&`0" 2`0 6"`0"6`8 `2`8 *`8>  `0`8` @>  `0@> @" > >  >  `8 , H  &`4> Z `0 `8 , #>   H `4."@ `4 `2`8Da >b k > !(`@㿘?@? 㿘 @ @@'㿘 8  @  8 㿘 0   @  0  `㿘 4.`.@,,> "!HHo  ?"`9 0Ho  "`A 0F 㿘k@ " 8 @6 4 4.`@ " 8I  8`@& 4 4I  4 㿘` @2 `  "@@"@ `㿘0a@a@"8 ?2 ?2@0,") @5!@?2 ?2@ 2  @ @ 㿘 0 `" @ `"   㿘 0@l 2 4e .`@`2`$]  * N  `>> `p  @F( FÔ ?> "H !c ( He 0   * *`  *   2   @ 2  "   4"@@ 4@" `H8    @ 2  㿘 0`"@6  @&    @㿘0 `" @  2`" 㿘 0` `"@6' ` @.` 4    `  4,  ` @  2 ` & 4㿘` 0`"@6< ` @&6  `62  4.`@`.@ % 2 , $ " ,  "`0 `" x@ x "@bG  4@ "9 @ " "  " "` @ " " """    􀠠"A @  \    @"*   @2 @  *   *  \_ \* @ 00* @ 800* @ 0*  @Ò`*> )#H < <  ` `'@2  `  > >  >  > >  #h>  #> n#l#> #h`(3 `.> -` €> ( 8> % @> " P>  X>  h>  p>  x>  >  >   >   >  > 7 >  Ȑ #   h   >  ! $b" > !  >  p > !(> !@> !P> !0cH > !X㿘`> |!p^ @> )#H 4.`'.`    D  2 0  > b$ ( | 4 @E4  0 < 0`` @ "  & 4 &+> bHo bH ~ "ɦ  0 @ `@" 0```` 0 0  " 0@6.` 4 0  $(->  x`" 4x$ " 4 ">  @2>   `2> ` 2>  4@ :Ē`< > u > a` ! @ `>  p ` ( & ` ? &# @4 & ` ? &# @4 & `  ? &# @4 &!4 & " ` & 4 & `  $ 4 $> '!'   > !x* x.` $( 4`.   bH 4  ʒ4  4."@ bH >  x " 0@' 0 0` `@ED H > ~Đ!㿘 2 '5 `@2-`2)@`` * 2` @ `   2`@@`   @@'в@h> )#H x ' .cH >> `p  @%> "HȐ $u cH    " ` @  `̀ cH@ cH > ~G!㿀'> H E f    BH5 T  +$ G@ @    ` $ @ ///:/ 0   4뀢  & ////@ 뀤ט"  "    "     6 @% x  DL 㿘I㿘` B    , ,, ,   (㿘 ? . D! "C"D\"D"D"D"Dl"D\"D"D"D"^$"`"^"^"a"b"b"_h"`("a"a"b"h"h"h"h"hܝ㿐> a  Ř㿘a@ a@ &`>  "x$ (`$ , 4 > "t`&``0 &`L $"> >  `p  @2> `Ȑ &`> " >ax`> bt &a> "(Ւ 㿘 d!>    0*` )> > >#ؤa<`0`< `0    0> >#ؤ`4 `<   0! bH 㿘? 2  @ 2` `?> |"`  0   z  `$ >I`  4`$!!    ! "K .  ! 2B `$ 4`$!!@ ?`$# @4`$/  @:  `6" ,@ `"      *@$  *@$    $ `$`4`$   !`$?# @4`$㿘?2  @> "`2`   0@ r 07"      **@$  **@$    $  ̒ _!` #?$c 2$ `$!   m  ̒b$ 2$xՐ!?ǐ 㿘 L? @2  `@> "`2` ( ` $`2`!  D(@" 2  `Ȑ @ G a@s`@@%0& < 8(& 8 D& HH /d * % !H 0`r㿘 ̠!@D!   &!@w0˔0@p Ȫ >& Ȁ 8 D($<$8$HH /d * %  H 0d 0  "Ӑ `(4  x@Ŕ L *D@@@8 $ ?,@2 ` 2  *4`*4`*`*`*  * (+4`+  4`4`*`*`*`3`+ +  $h@$!0$P>$ D#$ 0$$$ސ Ȁ!  !' 2v $@!? &! &!@Ԑ @А㿘  ,> cȀ  > bX@  ,` 5*`>!< €$ < (3$ H ( D`0 8"@  `a֐`Ȑaa$`v 0+ ?   ?2&  ??& 0 8  D($ <$ 8$ H ( D`0 8"@   類㿘 L? @2  `@> "`72`  Ȁ "    ( D*`" 4& D `0€@㿘>>#!  D㿘>>#!  D P> )cH?  2  @> '"`2`    ``$ _ ! @"R $c@"L  !@"F  Fc@Cc @ p@":  c@6c@ 3 0/ #  `q@")  !@"#  # # @`m @0 @"  !@ $0!@2@2$  $   @3Qc@#)c@ c @!@U h c @c@ _ c@"=$ c@;c@ Q c@"`c@"` 1c@c@ > c@"`  `p@`s@q .  #@2 #@ "# e e@ "m` r @  @a #@  @ "# @n   `m@\`q@Ԑ   e`g@`f@L  h@"@` #@t 䀢  !@ ݀ 0#@"q 0#@0#@ ̀ 0 @2@ €  >!@ϖ `!`!0 &`*`` &`0 9 `Ȕ$`` `Ȱ $`00@  @m@ #\@~@ x@4s? ,C@͚ eÑ*   8Y   @ٚ O` &d ?# @ `*`2 @7  09#$ =l #? , `@  '   "@` !?#?*`  $ ``&$   * 2` 2`*`` &d ?# @ `*`2 @4?8r> ް   =#$   @Y @ ,``&$ ?#   * 2` 2` &d ?# @ `*`2 @4  ` 8`&> 0 @@X @     @      @ }    @ t    @ l    @ c@ _@ Z  U`̒   O`̒  IV  "$A $!=2$ ٔ 8`̒ Ӕ 2 `˒@ * 0'2$$?#ϒ @!2$@u@u@@    `̒G~ H > wk"h㿘@.!  <%#$`В d &(&8&0&,`ؔ @ d`&4``$"> bpv  > bo  6> bh `ؒ 6p&<!, !W &&6r&6J&6H~>6@\  "   "   @  `= `2 ?2  @?6 `# @ `* * >c@ߖ㿀'  ;  2`5  #`#h#\#d  휚  "  * *` * *`  `̖"  4 `̖"  =+ 㿀'  ;p  2 #  #` #d#\#h ]  " `  .@ .` .` .`<  x'  ;A  2`_  #`#\#d#h N . 쀢 "  I  /  / / `̖/#`#h#\#d  쀢 "  *@ * ` @* ` * ` @*耢  `̖"  훔 `̖"  y< x @ݐ Ô@ /#\//#`#d   8 㿀` $b'C   :  2`:  #`#h#\#d  쥚  "  # ` *`  * `   `̖"  8 `̖"     :N#$@  0  4 @ &.  `  `  J  ? `  ;  .` #\ `@;ɒ x\ @   G/#\//////#`#d   j x @ ̒ K'/#\/#`#d   U 㿈'В"#d#\#` ̒    F x@Ԓ  B`/ / 7` @( //#\#d///#` $ x@ @ C`/ / c7 )/#\#d///#`  㿘   ך 2`` "   +   Ś 㿘 b ̠(> & &( 鼔  Ѐ> ؀" &  ؀   ܀ c b> ؁ ?? X> )#H'@D Ȓ @@@` :>!d*` € a0  (//#\#d/#`  쐚  ! ϰ 2 .`` ̓*``0  (///#\#d#`  s   `I ` ̓*``0  (///#\#d#`  W   `-``* ̛2`!0 2`2` ////#\(///#d#`  4  Ű ̒`2 2  2  .` .` .`͔ > H` ̓*``0  (///#\#d#`      ϰ .`` *    ///ɒ/`  a0#\#d#`    z $ ` *    ///ɒ/`  a0#\#d#`  ɚ   .@W  .@S ` ̓*``?0 //#\#`#d :  a0  (//#\#d/#`  뜚  - ̰ ͓2 Β ` 2 .`.@.`.`.` `a0   ///#\#d//̖#`  t     H > s2"> )#H'@  T@@`a0 ̔  T(///#\#d//#`  TA  M` @͒ ?**  * +`*`+ @ 4 +(( ` @4 2 2`  4@5` `   .........& &&.  cH > r"h%> )H'@v ؒ @r` ̒a0@  (///#\#d//#`  ǚ  ܰ .`.`H > r"ȁx( 7@  '  @=` ̓*`0@ ( (////#\/#d#` (ꐚ  ``(8ɒ 㾰> )#H'@   @  @a0  (///#\#d/#`  c   !*  &` `n$ H > r"x( 6Ӕ  ,  @А a0@  ((//#\#d//#` '   @ `*&``5` 8W 㿘@` >!*` €H t 㿘  `  `ٔ!㿘  4 $ ` 4  ? 2?  @"  *  $2 ? `& < ?㿐> b  㿘> &`0b > "(2 #(",@㿈?> ✑2 `  6C ✑. @ 2 0; `$ 7  2`$ 0 ! 2) 0 H  @ "@ `> "H@c 2 0 @  8   @$ 4 ? $c 2 $? 0> ✐* @?0`$ 2`$㿘? 2`> ✐ * cF  #D #H  \  cC2#F">8#D"*8F0 #E"'H?0 #AcH130 #B",0@/ +@} '@ #4" "?@$8   44" "H"L"P" T "@/ ^x@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @&@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   o x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d    x@ * 0  H `  '  :` @y  4, `4  +24 ////쀋 / / 0ab#\#`#d   ǚ  J@ @ "**4 *J@ @ "*** `" `#(2 "㿘` .ݒ` @*ؒ`0㿘* `H   `Z   4$`8 $@O A *   5   3@5 '  *   , *  3ߔ   `@? P$5z `5u x@  6`67 7 ///////`/ / 0ab(#\#d#`   㿀  3  20r  #`#\#d#h  做  "  ?    *  $8  *$H  *  $<  +`@$L  ($@ * $P  ($D  (0$T#`#d#\C#h`  4 0X@< \@8     ,@ , $ 0$ 42$ 㿐> b& d   `& d㿘  4 $ 4`    `2?  @"  *  $2 ? `& ؒ ?"T"" " """" " "d㿐> c4  M㿘> "H`a`@ `@ > #&`$ ($ ,`> c&`L`0{T&` $" " C &!4 & C 2 $ & 4 & $"> >  `p  @2> `Ȑ &`> ]#>baic` $h2 $  $  `̒ z  `@ $ ђ `>  0#>   @ @Ԓ >   #Ȗ0> #0 #> >"T R6 &a>  0㿘` `  Ȑ @& 舐! 㿘!肒 >    0*` )> > >#`a<`0`,̖ `0    0> >#``4 `,   0!`> R"z 㿘? 2  @ 2` `?> s"젒 2   @ 0s  { } "  `$ >I]  $h2 `$!!* `$  4`$ ! ⛔! "A ' `$, 4`$@ Ѐ 2  `$?# @4`$- @ ɀ `6 ,@ `" "      *@$  *@$    $    $` Ⲕ!`$?# @4`$zs*㿘?2  @> "2`r  2 Q  @ 0sJ z s 0A"      **@$  **@$    %$  Ȁ @}  `$   b!` #?$c 2$ `$!   p  ̒b$ 2$hؐ!zBrʐ 㿘 L? @2  `@> "r2` 2`-  @* ` $ 2 D "    "" D`@( 2  `@ xC `@ora@@r0& < 8(& 8 D& HH /d * % H 0`rn``  +@ 0+``0* * +`  ``` * (+@ 0+``* 00* * 3 +`+`  ```  +@ 0+``0* 0* * 3 +``3 (3 ((  `㿘``  (@-55-5-5(``55(((((((1 (` ` 1 (1 (( %`㿘 Ȁ @ ̐ @ͮ!   &!@0ǒT0@ Ȑ ?& Ȁ  8  D(% <% 8% HH /d * % lH 0 ߺ  Ԑ  (4`   x@O  L *    B D@ B @~ 8$  c  @   ,`  ?# `  $`8` h@%`:"`%` P>%`  D"%` 0%`$xT%` 8@ Ȑ & G Ȁ  ! 吒 2U$@ !? &! &!@= @9㿘  ,> cȀ  > ``@  ,` 5*`>#` €$ < (3$ H ( D`0 8"@ x aj`?`Ȑa`$`e 0+) ?   ?2&  ??& 0 8  D($ <$ 8$ H ( D`0 8"@ w qҐ㿘 L? @2  `@> "p2`  Ȁ "    ( D*`" 4& D `0€p㿘>>#t#h 4 㿘>>#t#h 3 㿘? 2  @> "2`pd    `Ȁ @px ``$ )  !@"  p@ !   q@ "  m@  $0!@2$   $ ɰ ǰ  `m@"P t@"` `p@`s@$ 0e`e@6`r@- 0 !@"V `q@r  h@) 0 e`g@`f@ 0'  .'!@ `!/͒ 0~@ 0x`/!0s` &`*`` k&2`0wZ d`Ȕ$``u 2` e g@2`? 2  @?`4# @ `* * >`@ict`Ȑ w5$`0:27 2$`Ȑ /$` `+@ ' "$" $ !2$佖 @ "`  䪚oh> )#H'@!@ ̐`D翔  ̐`@`L纔  ̐``\絔  ̒Ȕ $  > a稔 #Ha`p #H > h  P> )#H'@a!`&(`&0`&,`&4 &8 d&8 6` `<  2 > > ` `̒` `̠`D@V `̤ @P`L>  $ S@W` 6p&<` !W &&6H6r&6J&&XoW? 2`  ?6  +  *6 >ct@H > h$ 㿘 Ȁ @Z dА!㿘  4 $ ,` 4 ? 8&?   2!?  8 ? *  $$ ?॒   ̒ 3! "?㿘? @2  `@> "nf6` 2 Ȱ?<? @6?`  *@2  ̐  '?  $`.`  ࠀ`"??( 2 @  B @I    & ??nE㿘> "`? 2`>   "2  %耢 = "*@`7` (@ T @4, @ , @= ,  @ C B  >D41 2 @* ( & D$!%`   #& & & & $~ ڐ , 2 %  _(*``  @*h ̒' >` ̶  $ h'  7` 4΀ ` Ȁ  +  Ő <   2I$  #d#\#` #h  ݓ 쀢 ? ``@# ` 2` `*   `0( *` 4,( @ `,   >` y  *`@ r'@ '  #\#`#d #h  G 耣 "# ? 2 ̔   *  *`@ @ * 7ސՒ AА`@ 9'  #\#`#d #h  䀣`) @ ? $ ` `*` `*  ` @ 7޸ `'  ` ` `*  '``@  >`, ``@$ 2&`  ""&` ` @"`d"`b h@"` @@@"`9 ` ``^@?c ! &@&` `&@ &@ &` ?&`ޒ .&`&` 2 &``<@`@ &``  ` &`&@&`㿘 &!a  5`*@` ab&`&`&`ݓ  Ȑ ?& ړ" " " "|"|""""""""""|"|"|"|" """L"L","""L"L""h""""""""""@" "x""""`"`""`"0"0"0"0"`"0"0"0"0"`㿐> aD  柘㿘> &`D#<$ ,$ (@> ߐ!Xa@@͒ aL@ʒ >`Ȑa(`ߔ?`&`&`l&`&`&`h $?# @4 $㿘` `!@ 0 @& 0R  㿘 L!@ ?> 2  `0  6 #%> > >!pa<@ 0$  $  $  $  0 ` "> >!p`4@$l  $g  $b  $]  `0 㿐> `А  $  `& P`& p`@& 4㿘 P t@|  .   p@` $`  .  ,`  . 㿘? 2  @> #(k2` 2`03  @. `D $ )  4 $ C! $` @֔  2  $`0(`@^ ` $?# @4 $ `0 $`0k㿘?2  > #(jܓ6   :  0 @ !1   D @<  `"`$ ``" `$ @ `$  2 `$ @ `$ @| `$?# @4`$`ː!(j㿘?2  > 6 j#(  _  0 @(W U D p t  $ 4@K J ٰ  4`"`$@~ @`$"@ 5@C 0 " g |, < 0   $ 0 x  $ 8`$ 0@D @_  > !`? 0 ה!@ 0h$ 0`$ 4`$jP㿐 0? D& lh& h @Ζ @ @ @ ٶ!@` @ߔ @ 0? 7& 0 $ @ 4 $D$" H0`"0"" <L2 <0"82>T(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 㿘 L? @2  `@> #(i2` J 0`@/ D +`"  H@ 8 >  8 !  &>  L`  >  L }!  & < ݔ!@@!i0 8(& 8i D& HH /d * % H 0㿘 0 @  D!L@C!X   &!X@v0ʔ0@o 0*@& 0( $`"?# @5 $`8 `Dh$`8$`H$`$ `D!\$$$$q 0@  !@ܹ 2  0@5!X? &!X &!X@f 0@b㿘  ,> cȀ  > a@,  ,` .*`>! €$ < (,$ H`ܛa@p`0 $`0a(] 0#Y ?  # ?2&  ??& 0 8  D($ <$ 8$ HH㿘 L? @2  `@> #(gؓ2`   D`0€g㿘?2  @> 2`g#( " `0 @ >>#h" +?gΐ  㿘?2  @> 2`g#( " `0 @ >>#h" + g  㿐? @2  `@> #(g2`    0 @ ! 8@ < a@a@* D0 !@"/V D@; ΐ@  6 8& <& x& |& 0`" 0 6 0(" > 6 >6 @6 h& l& 4 >4 @`v>!ȓ*` €@   @˖ &@ /   @ #  @ { Ք 0u @ʔ o @Ĕ j @ b  @ؖ \*3$ 0/$ 0@ N`2 H `@  L @ @  L@<$ 0 0$ 8 $ 0`( , <0  D'@ʒ > !` , <$ 8 0 $ 0 0 ?$ 0V  " 0  8 $ x < , |, f㿀2 @  0 `/ 8 `/@: 22///66/// Dc #\#d#`  x`D $ % @ a0h /#\#d#`  ܚ   * *` *  $`L$`Hp`D ' $Q  ` /  #\#`#d#h ;ఒ % 0 "   `0 ?$`0 <`X$``$`d$ %4$xD ' $     $   24%   $" % %  @ 0 <`/82 2 ///`  #`#d#h#\  ؚ l耢` 2    $` z *  *    "`zڔ쀢 2%00  ,@ ,` ,`,`,`,`D,` ,` !0,`,`  +,`& 2@,@,` ,` ,`,` ,` ,`D,`,`!0,` ,`  ,`  ,`% % 㿀@g  `/ 6/b /c  D #\#d#`  ֻ 㿀"! 0 6`0@ 0"0<`2 =7`     2f  0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0?  ?& 0`7  @ D66`6` ///#\#d//#`   V 2??& l l? & l? & l h?& h& l& l& h 㿀`4 `  0!"! ?& 0 0 =ϐ =& 0 @ D6`6` ///#\#d/#`     ?& l& h h?& h& l 㿘 0 %$"  %  & &` 2  ' x?& l` & h ֖ 2" 4  `2 @  @R D6 /#\/#d#`   ծ x  ! 0 =& 0@1  /`/!06"#\ D#d#`   Ո  & l& h㿘 4 4   $ ` ,  0 Ӑ ` Ъ>"-` €  @" Ű *  $2? `& Ւ     * *`  *    $ 0 "T $ 8{q& (  @ ` 0 $ 0 ($`H    0 h $ 0`$ h$ l`"  ($`H   ` 0 $ 0 ($`H "  4  2 4> !d  4 "  ( $ 2 ( 8>$ 8 ( $@ B` 0 2X  :`2$`HQ & (  @2L    h? $ h$ l`@ `D=$`H    5 > "" ( .  `  ( > "@ ! Z& (X$`H`2? 4 "  0 $ 2 0 8> $ 8&2 ?"$ 0 $`@& (>$`H?㿘$ !&  6 Ȓ '$$`8(`82`0`0    ?$`0 A   " 0 2`8"   "t"Ƹ" " """Ƹ" " "Ƅ㿐> b  S㿘> &`4c "(2 ",>  `X  2@p d>  `@u  2@ d@! d $ .`O.`L6`@6`B&`<a<&`8.`N&`D&`H.`M@Z aH@W >a$`Wl`&`&`&`㿐> bh  @ > `&! $ 2&!!> ` `. ^@@ 0  < p!> #L@q ,#L . ^&!㿘?2 >  #  2 6' #*@`2`4  $  >  `  !!B  ? $# @4 $ $  4 $㿘?2  > c6 *  !`" 0@   0$ P ?$ 0 4? $c 2 $ 㿘 L? 2`  > 2 * @ 4`0€!€㿀? 2`  > 2 * @`0 #>a`@ "`00 @~ߒ #  //#\#`#d`4   : `0 $`0>>#" %㿘 L? 2`  > 2 * @ D P 8& D D  `ה!<@0& HH /d * % H 0㿘 4!H@H!T  &!T@{0J@x 0 ?& 0a>"#b   0` #` (* D2*2+ +  P `#`  Dh#`$#`#`#`#`A#` 0   `Ս!< )  2!@!T? &!T &!T@5a@1㿘  ,> cȀ  > `@  ,` -*`>#H €$ < (+$ H``ja<?`0a$`$`0U 0!) ?   ?2&  ??& 0  8  D($ <$ 8$ Hy㿘? 2`  > 2 * @# : #( 5  # # * ! ` 8@ ( 8vD (0#!€ @0!` -@  0 ? $ 0  -   4դ(> )#H 4'@}  $ 0///@}/!` `2`// (// 2 2 2 2 2!2`55`22222`2`////////////////////`   "` /!`   8 ` " ` /!` @  " `/ i4/ɀ g //!%/ "! / /! a  '!`" ` * * @* @ '!$" 2`//   (c#\#d#` @ > )#H > Y 㿈0  4 "0c#\#d#`  4# 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  8 h 4@| a" 4( /#\#d//#`ؘ  >  }9 + *` `D +    &`D"("ՠ""""հ"ՠ"""l㿘>  . ^} `>  ` 2` > . ^}  `>  a  >  > . ^|!0> 㰖&!&!&!  &!&!&!&!@B&! 㿘 0 " ` @N "`  @~j`$&`  @~d@$@&` @~^`$&@@~X $@ [&` #؀@U`S!@8Y `!,  @~>* 2 $` 6`!,  @~3* 2 $`* 2 "U06` *`2 26 ` @~?$? H!.`` @~?$? .`` @~ $? P .``   i4  g6 ^   ^.`& 8t (@ 㿘 \v/ X`D2 @}$&`DP 4@ؐ@{   //ܐ@{w  D @}0/Ȣ H@},  8@}( @ <@}$ c4`4 42 ///#\#d//В///#`  Ϲ  2 @{G  / /@{>/ @ a,/ @| /@~* d / M @|>? N/@|9 / O @|/㈐? p//#\#d/#`  {  2B@{   @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   C  2  <@   㿀 P  4@z’ # /#\/#`#d      㿘` &` , \uD X2 D@|] 2 , 2  , , P>`&` D(`&`&`$&`&`w㿘  ,> cȀ  > ap@N  ,` :*`>! € \u X2 @|-`D T"@$ T P`D" $ P$`< (+$`H `Ѱ!<˅ 0!$`$ 0R0 0!o ?  9 ?2&  ??& .0 `8 `D($`<$`8$`H^x 4@z0   #//)>'> (#d#\#`  ·  29耢  ` >   "(K4(#* *` * T@  > !t P  t P> !z 0 `  㿘 L "  i   6 \4 @ g 6 \ @tk 8@{$ \ & X` ?` ?& X Bt[ <@{v$ \& TtT X2 tQ& P"L"ް"""""ް"""|㿘>  . ^ze!`>  aP  2` > . ^zW"`>  bB  2` > . ^zI"`>  b(4  2` > . ^z;"0`>  b@&  2` > . ^z-"H`>  bX  2` > . ^z"``>  bx   2` > . ^z"`>  b  2` > . ^z"`>  b  2` > . ^y"`>  b  2` > . ^y"`>  bҔ  2` > . ^yِ"`>  cĔ  2` > . ^yː#`>  c(  >  > . ^y#0> #И#&! &!  &!  &! &! &! &! @(&! > y#H0 @~  > > y#`0y#x㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 8q  (@ޒ >  #@5 >  #xԒ 㿘@ǒ > #@ > #!> @x##@{ >  #x`㿘  "  +D 2+ 2+`+`Pa"  >Dh⠔" $" " " ."  㿘  ,> cȀ  > c@  ,` 5*`> H €`D P@ " $ P$ P$`< (+$`H `l!<A 0!$`$ 0O 0!+ ?   ?2&  ??& 0 `8 `D($`<$`8$`H{㿀@w  4a66 ///#\#d/#` C 㿀 @wѐ 4a66 ///#\#d/#` ( > ) H  8p <0 D>  @cH' B2#d#\#`3 3`x  L ">    0  0> 6 \ `(6 \`8 > 6 \`H 0> 6 \`X @w M  N$>  \h?xh @ wH > S x`8> )`<`H  `L ' ? $`8 $`<    !> @wt  !> @wn  E  > ?cؠ  S 5> ^ d : ?А  1> J+  @ *`В@  `L $`X+ $`X@w7   >  c   > cw;`*H& d 2 > cw/` ?А  J,  @*`В@ `\$`Tqj`X2 qg$`P H > R!  㿘> &`0`4 > 2 "(",wt!@?>  0  6  * 20  $ 0$ ? 0> * @?0`$ 2`$㿘? @2  `>  * 0u""8""T"8> )cH ' \     > `p  @ L  I > `p  @2BcH   2=cH   5. :8 :  ' 6 7//???????ؒ   /7> ` (( c#\#d#` x  >    aP @? cH > R0!X㿘`&`0`4"`,> v!h&`@&`D&`@z  > !pv0@`D $>`,  &`> v!`H&`&`Dx ``D@ `L `H+@`D`@P+n`  >`<:: > !vr`&```"`@@0N &`@㿘 4 $ D:3 D  L+ ,M  D6  H  H+Ӓ@ D `P H&  @    07  ?> ?> )+   cH@  <' '//'/( (# 0a0#\#d#`  @ɯ       0& < & @    @ @ * * & D  & H @Ȓ & D& @}   T@  @  H %> $ H @ @$ L$ 8 u`@  P @  '> $ H @ @@$ L$ 8 u`@  P @  & `&  $ H @ $ L$ 8>  b  P  $ H @ $ L$ 8>  b  P`   2 & & @ &  $ H @$ L$ 8`@ P  @ & H > Pʐ" x 4  ?7 >?* * * 2  > @ ` !T*` € L       D` ]  D   E  L "   "  P DC L DI!"  DD D 8  <$ <2  D     L    * D" D& D      $ D< 0$ < L    D     $ << 0 L @@ < 0 D`@y,`  * @      :` " <" < `@P+㿘0"$@@ x`  2_    4   ` @    @2    @=  t  `.@`.`7  ??> * ` .`  ;//''`  0a0#\#d#`  @Ƕ      㿘  @0(@(b2*@ *@ b 2`* @ *`B2*@ *` ? ?@0( ( @ @p  3`0 @"""""""#d#p###########,#,#,#` @   `> p     `> p`  h> )#H&`0`4'"`,``0Ȓ`D > b8S ! 2&`< &`<> sz"@@ϐ > "Hsr`mcH`P 5>`d)O !&`> `sa"x`P`"'`H?`P P` T"`T&`T T P"$ T$ P3 `P 2`P`H`P  `X(\ P ((`H "&`P>a6 > `s+"`H`"`P?`H`"`&`L"""  `H 2`H`P  cH`H `@ &`@cH > Nn"㿘 4 H " P6̐ H " P? H`"`& L""" Œ  H 2 H P # 4 X(:(  P " @? P(T P` T"`T& T T P"$ T$ P  P 2 P @  ^ 㿀( ڔ  e '   ///7>  ?*`'' ( (# 0+#\#d#` (#  > @9  * @h2 @      @ `  @*`` & D   & @@= ,  (  @%  㿀'   ///7 F?* * * >  2  @''`( (# D+ 0 #\ @#d#`ŷ @ 㿘Ӑ 2  ` l & P P& T& H H& L @ W` @ ` 6L   "@  @ ">     5  > /     4"" L" L"@ & L" > " "  X    @, H$ 8$ L  $ P T P$ T T"& T  &`5  H " P? H`"`& L""" u  H 2 H P " ? P P` T"`T& T T P"$ T$ P\  P 2 P 㿘 4/  0@ P 5 L @ ?`>"ؓ*` €    $ < H "     @  P@ P@֒ P P 2 Lڐ> "q# 㿘0"$@@0 㿀' `//7 F?* * * >   2 @''`  D+ 0 #\ @#d#`Ē @ 㿘 4y ? H.  `@ $  @ 2 *@  * ` <*````"0  `  *` ` *``  W S `L 2 :`0 <"`L00`L+>( "   5A j>(      5A ja :`0㿘`L G?7`/ /`f6..`0((F6..70 @>`0㿘`"!@>  p1#!@> p-#( 㿘``~P  > ~J#8 "   > "  `g2&`48)@ P "8, 2  80 @r &  > &`8 ~c 2#> > c@@D> ~cP > ~ cX 2 `8`8* "`8 "j" > c   < " > c`@(??&`D&`D`D &`D> o#p`8<@ @ %&`@ `> @"> ,> (@ > $@"> !> ,@"> > o#x> o#> > o#> o#> o# > o|#> `@ow#> ot#@O B> 8 > }c8  > 8}c 8} 2'8 ''@Ґ %> #>@ʥ@h   'a8N[ @ 0> }\c  > `@#Ȁ &`0"% > >>>„  >Ä`"\"h>>>>†x `"p"`"d"l㿘 8@$"! 8@耊d! ?i-  8d ?   >  8@#> cn!V> n  8 |` " 8 @!,@2 8"@ 8"i  8  "h 8  @@ `2 @ @(@" D@" D 8,@2 8 D` *`2  8 `   8," @@ 2& < 8" & t& <㿘~ 㿘``| 2 @ 㿘i  8  8 㿘 8@#> ǀ$ %> @耊d! ?h  8d ?   >  8@#> cn=!> l  8 |` "& T& Xa  >  @@ n(  T?@@*" 8 & P'a >  Pn 8 @,@  t 8 "@ t 8" 8"  2 T P`  T @& L & H> lh X 8"  @ T 8"` @@2 8 T> $ P @" 8* 8"  8  @,@""  8  " <㿘`8`0> !` > >   `mB> > `!(m`8? ="`8@  ``< 2`8> l !@@$"!`@@耊d! ?g `8d ?   > `8@#> cmu";> k `@,@ @`2`8`8@ @@ "@`8`  耊` ! ?g `8`  ?   `8> > #ВcmA";> k!` ="`P`($`<a "%>   p€ Р@€  А * @  € Т @€  m   А@€  a > !l 倊 2,`P В € Р@€   ݠ * `@  А@€  * 2 `P`P@@2`P ݀ @" `P,a  >  @! € Ф @€   ݀ @ @€   l>`T"> #`2 `X`H "`X`L@L`P`X ""`T@"@㿘 8 >  }" 8> ࠒ` " !(ly  \@ 㿘`"!@>  ll"!@> lh" 㿘``z 2 x@ P "8, 2  80 @ &  &`<8&`@ < " > b(@ǣ??&`8&`8`8`@ `&`8c> :` l,"8&`48  ''@Ǡ %> #>ĒH@s@6  ʒ '`LK) @Ǐ H㿘`"!@>  k"X!@> k"h 㿘``z 2 @ P 0 @W &`0D&`<4&`P4 2&`@&`4@e < " > bx@.?&`D> k"0Q > k"0J> b@??&`8&`8`8`< `&`8c`D :` > "> "> `Dk"&`48 "' '> k#@@  #> !>Ēc@ݐ@à  @X '"J @ c㿘 4#> @Ʒc    & L> # k[05 @lM& H Lc 4@{ H (`8 * *    L`4  @2 `   " `4 L@ ` "   H&`8㿘 0"!<.` L(   P &@("!@ 0.`( H @` 4   L   & L @` @ޅ.`㿘`0 $`  e ?   2`D> #8jђ`0@k`<$  `D$`T`<@k*`$ `D *``<@k $`X$ $ `8 @ 2  < $㿘 ` ` `bf@`㿐 (  2$ B  0=$   Ē  ( `2( ? $ '􀦠(  ْ        ( `2(8  b$ $@&@ܢ㿘`xy`?㿘4``h> jB#X0> cx@ţ?&c>ȐcDA@bА0  @֨ 4&c<  @֢#`&c H @֜ &c &b 0@+&c> c@Ł??&c&c> c@x??&c 8&c 8>cc `&c&`0`0&`4 @b'@pb>>˔Pᤐ& @ ?@}h # ! ! #   #&b@ ! #   #&b@ &  ! &   &&b@ ! &   &&b @ (   (&b䀌`    &bb`aY >>>?&`h pc|L" $t$x$4\$ $dLutؐ> c#i|8 > cPw `@"&㿘c4 $ \@/ \ $@ @ic<#c4!Ā !6/  ! !!€ ! E!Ā !6 ! !!€ ! "  D  &!&!$ !?&! D " Zє  c$* @ jc,8  ," c ""  2! \$6 \ c$c "`c4 6 Z$c4$c<㿘#X 6 A#D#"" #b " # c #" `?"# #c   c  ## `?㿘H /f * ' ː@~H 0㿘>   gmc!B #> #> >  hX#>  @hT㿘 @  > #> #> >  `h> P>  h: @n#4 h"#8#,*`#`` `@a:  *`#,#`` "$2Z#4  ##8##4\2\#4?### #㿘 h 㿘#@#,, @ # % @@  #,*  "@!`  #,@ &#@ 㿘 h#H /f * ' @DH L`@ C 8`#@#D#H#LJH 0#D?y 㿘 H /f * '  ! "# \! :0!5.0 !6*/ \ 6 \ ` @:4 h$`4@  2 \x \ ?6 \  @m@  `4 "o h`4  \ @ @ H 0㿘# h#"H /f4#,* '#,  #, @  �#$   #$ @ &#( #D@ #,* #( + @" #, ("    #( #,*`   + " #,"  "   $#(&#<@g&#@@"̖("͑*  $c"ʐ"˕* $c""ɓ*`@ $c $c @Ha   $b  $bP $@#0$ #0($ T`#$ $ $>$  $_X? $ , , $ ($a$ $ &# $ $ $b,$ 0b  $b c `$c \ @ ;4\H 0>n 4#     ?#d ?#d#㿐# #`>   f~0# $   '$   '`   &#?$'0  ?&#$'0>  f[ 㿘#      > fL!M1? @ @ @ݒ @ڒ ` < `@Ԑ?< >@ `@̐?>@# @W@U @R *?@@K@I@G@@ @ *?@@ @@㿐c c  $   '$   '`"  6  >  $   '$   '`  6 !eҒ` 㿐c c  $   '_  $   '6  >  $   '_  $   '6 !e`㿘#     > !e 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?> ` *`` *``  `#d  #d#㿘%  h> ! eA  B< #$`*`   2  `B <  D`B <  VԔ n 㿘 a !"  0 2  & & #&`  `   ?&`㿘" X  F B  # _ ?    >  ;!Hu ` ``*  #b " b ="b ?*   ^ې ? G $ >   !`d 㿐# h \!c  @$c 0Sc ?$c  \b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL \="7777"h& rW  ?;n #       @2?2 $ 22*  * @0  2  ؐ$c@$cD$cH$cL \ =6 \㿘`rX`?㿘 @`h> d!!0n> a@?&b0  @Ѝ 8&b<  @Ї &b&b 0@&b> a@l?&b 8>͐"`&b&`0`0&`4@ b|!`[ >>&`h#X`>?c!`"$t$x>>$4\p<   # #4 $ $^oWo> b!c’8 > aq `@"&㿘 \ $@ @\!Ā !0~  ! !!€ ! "F$!Ā !0i ! !!€ ! "  D  &!&!$ !?&! D " `U   `*   8 ' ,`"  `"a"    $  \$6 \$㿘" ",   ]{ ?    $@@`  ]k ? @ 㿘ڐ@2㿘> a aܔ !`B >!H /f * ' H 0㿘"" *`2 2" `#߀@r?"  @  " @> 㿐#  h %##*( ' 2#   `B ;  # ?  &# #*( ' " # "3 Z#  &# \$ ;3 \  㿘# #,`@ 2&# #  @ @K` #* `"@a   #@&# 㿘`h@   > "bt`  B< @  `B < @ > " b_`  B<  @ > "@bR`  B<  @@ > "`bE`  B<   @> "xb8` @> "b0` @    BaB < < @> "b`  @ > "b`  B<  @ > "b`  B<  @@ > #a`  B<  @ h   BaB < < hd  aB < db  aB < b > # aϒ`  B< a> `aĐ#8   B`B < < ``@  aB < `@`  aB < ` > #Pa`  B< ` > #ha`  B<  ` > #a`  B<  ` > #a`  B<  ` > #av`  B<   > #ah`> `ab 8?㿘 H /f * '  ! "# \! :0!5.0 !6*/ \ 6 \ ` @:.W h$`4@  2 \Ӑ \ ?6 \  @Ȑ@  `4 #hƒ h`4  \ @ @  H 0㿘" h""H /f * ' # # @ &##@`" "@ @ &#"@`@  #* #,  @ "   # # #*`   , " 4 #"   $##$`#($` &# &#&#&#$`$`$`$`$`0$`4 TZn"$`$`$ `$` `$ \ X  $`,`, "$`(` , ,,,, , ,@ ,    dZ ? $"  "Ȑ,",",",",",@B,\ `@  {a4\ , H 0㿘%  h>  `@  B< "`*`   2  `B <  D`B <  QӔ i 㿐" h \" , `  dZD `    ,0R \"6 \7777"h   -  mڔ  ;n # ? `   @2?2 `$ 22*  * @5   ڐ , `  dY `$   @`,`$ @ #"` @ ` "` "`    㿘> m H`?㿘0 #&@4@" > 8c@" &c&c4 4> _n P0O` > _g `0H&c 80 @ؔ &c  2> D< @˔ &c   > _I 0*b> `@k  4cwic`cYl dcc` @" c>!c&@ &@ @  @` 㿘> mC `?㿘<#c`&@ @@ "`> #@D"`&b&b4 4> ^ 0S`4D> ^ 0L< @k &b  "8> ^ 0<0 @[   > ^ڐ ,b> c(&@ c,&@ @  @ǖ`b`6  $  ?$ b@ $$ 8@ .b+O b@D㿘``l > lʐ!  > lĐ!  @ 㿘4``> ^!00`> ^}!P08  @0&c@D  @<&cDP  @H&cH\  @ݐT&cLh  @א`&cP> &`hap@? &cX &cXcX  `!&c\> ax@??&cT <&cT <cT @ @&cT>Ր#&`0&`4``0 @) c(> a@R  vPiwcX> ^!>>֐ c@>װ`l"&`&`>>&`4X&`?<??? `   " 9 X "T  0U >>>?#Pb"  $!t$!x$!4 \$!$$!$! $!Xid8>`@>> !k > ak > ak >&>Ӓa|4`㿘 \ $@ @Gt#!Ā !*~ ! !!€ ! "/$t  &!&!$ !?&! "#$t D O3 @ `8  ,`" D `"` " x  $x \$6 \$t㿘 5  \4 Z ;4 \ l#@ "@#@    W #@`   > !]B 㿘H /f * ' ΐ@ΐH 0㿘H /f * '  lH 0 4 㿘>   [Ȓa!`B !\ $!$ % , @ % ` %@V9@"> "[ $c @V+ b  $$b #\`2"$@b  l`$b c $c i 3 \ @ ;5\㿘#\  #P?#"`` Ȕ "`#\ U&#\㿘#L $b0U ? b  > "0[ 㿘#L $c0U ? c  > "H[ 㿘>  ["` 㿐#L "H"L"D "@ `B<`#"H#"L#"D#"@#p `\`B 4`\ <` #x?&#x#x  , #`(@S'  6`&#p#x "4`Z 㿈 k f6 a6 `<`\`WT?`P`  `0H` E 8 @@<8 ?`.0 6? "7/` /` ('`0'. 6?668($3$㿐#| @`B <@#`, ! 'R   " #`, @R `ݕ2 &#| 㿘@!P`B >!P.@  @ !``B >!`.@ ?"@ > > ⠐"Z _ 㿘c@?a" Ԓ @@㿘.`* * #h* @   `2p Ri2 㿘%  > #HZI  B#< #h.`     v 2  `B < B<  D Kה c 㿈#L  \ =6 \ w''''6 \*`@"p  ?c6 \'h'''h"h   " e 2 *2  ,@ $   $L$H$D$@$ #P ` #P  #P 㿘#P"T ``#P  a2#P#P  b   &@ 㿘#\  ##P*? .`c   $` ` @@ SՐ ` ?  3> #pY 0. $`       >@ `>@ > `> > `>$`㿘#\ #P % *`@ .` $` ` @@ S ` ?  >  Y>#B ` 1?#=  $` W ?R O L I  >@ `D?>@ > `<?>$`? ;*? 30-㿘 \  㿘 l &` &` #Lb "b !$b "b !$2!$㿘 > f# > f# 2` ``f "  > "   O$ 48Ȓ@ 㿘4`"> X#0r>  &eX#&e [ > c@ &e8e> c@?&e4" &e8&e4e4 6`$ 0&e4e4@XÒb@&e4 2S > f# 2L `> Xe 08 x   `> XZ (0- f`&e80 @ǔ $`8> XI H0<> # $`@$`0 < " > `h@??$`D$`D`D $`D D< @Ġ *&e> X" x0 2&e80 @đ &e !>   f= 2`&e& 0`@ &e" 0`> X > Vr  2 > > f # 2> > "4" &`e;  `В .`.`.`   `А@€ _ "`8&e< .``  `.`   `А .``  `А@€  `.``А @.``  `А &e<@€  P2e4 &e<e4#@We<`&eD`` >c` >c@&eH &eD@&eH@W͐$&eD@&eH>ce&eP&eTeP@n  !8 3> `e 2.e< <@   2"e< `@2e< @ e< > `ev 2e< ?2 e< `@2e< @ΐ e< > e@ &e@> a @ %*` %*`( % %( 㿘% d@㿘% \@㿘% h@㿘% l@㿘% p@%8"%<#l#l#l#l#l#l#mT#m`#m`#ml#mx#m#m#n #nT#n#n#o4#o#o#o#p 㿘> #`> d#`? 㿘!0`> #V0G >  #0V   N 0 @#  N .`d.`g &`.`f.`i@0.`h> 0>ܒb &`@ 2 >> `""> =X``Co` >ܐ T`&`&`` @{`>ܔ`@А &`> "Z@V !* *  E** *  C*  *  02   " 0" " 4" l" p" t" x"  㿘@Ȑ@& 0?    @" 㿘@   > cH`d   &`&`&`   f> څ(@82 h(@2& g(((0 > ڇ(a2$2"(@> 2"2$ i -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `4 @ ` !* *  #`4@ #`#`t#`x#` `4 @ ` !* *  #`4@ #`#`l#`p#`   !*@ *`" 4   !*@ *`" 4 㿘> bLє 0 @``& `" @>لx( ` *f ` *g ` *h`    `  ` *i @`` ` @>ل( f *` g *` h*` "` i"`  㿘@` >ِ"*` €  ?&`&`> cP &`$&` cq` > &`<`(cX  ?&`&`> c` &`$&` c_` > &`<`(ycX  ?&`&`> ch &`$&` cM` > &`<`(gcX  ?&`&`> cp &` &`$c;` > &`<`(UcX? &`&`$&`  > cx&``c) > &`(cP`,c# G&`@? &`&`$&`  > c&``c  > c`&`(`,c > &`@ch`Dc ,&`X? > &`&` &`$`c? > &`&` &`$`c? > &`&` &`$` c? > &`&` &`$`cp&`b    㿘    8  *  & @ P     ,   & @ P?㿘 H /l * -   @(  l " H 0  l@ pH /l * -    t  H 0  t@ x0H 0 㿘 @ A >ܒ`T $ $    @ #{$#{@#{\#{|#{#{#{#{#|$#|#|#|#|#}#|#}#}<#}h#}#|##D###x##D#l#### #4## ####<###L#p#####$#l## #l####P#######|##t##(#p#L㿘``a > aҐ#   㿘4`> S#0; > #S028  @0&`h> &`l`@??&`p <&`p <>`p`ؐ &`0&`p&`4`0 @k`> Sm > W#    .`.`.`.`.`.`ǁ h( h( h( h㿘`h@  $ >  SB`  " " 2 $    ,    ϔ  ˔   Ŕ   ,  $ `x` ` `` "` ` 8    "` $ 8$ <@ €`   `` ` `` "` ` (    "` $ ($ ,@ €`  #" >  @?  p8      ?"?   &" *`@  #`#`   @㿘 t  hB  & t& & & & x& |& $`L  $`L` ` $`L`W ?$` @` L ? @  2 >  8Rg   @  @      㿘    @  ǐ 2``?   Ȑ 2``? N    ` "N     `N 2  N 2 ` 2 ࿐ `        "       @   ͖ `0 Γ2`2  0  `  ~ 㿘 h@f@T ,  , & t㿘@`S >ܐ"@*` €> `X``  A > ```` : > `h``  3 > `x``  + > ```  $ > ` _`  > ` _` > ` _`   &`&`&`> ``_   &`&`&` 㿘? `  >ܐ"d*` € X A  R ;    "5 G  C ,     7 >/"  퀢 , >/#   • ! >/#8     ? 8 E 2 &' $  $ $$؁` ?㿘 ܀  h  ב*  ` H /l * -   @,@ I,@ ,` H,@,` `W `cK ? @   \>  Pʒ  \,@,` `W `cJ ? @  >  P ,@ @W` #J ? @   > !P  ,@ `W`  #J̐ ? `  > ! P H 0& ܁ h?`"` *@ ` *@*`"h?ۄ"` *@ ` *`"㿘> cG 0 㿘@` >ܐ"*` €`2`   h *(` 2 h*@`  h * h*@` ` 2`   h *` 2ڰ h *`   h `*  h*`  h *`ɠ ` ư` " 0` 2`   h *`   h `* 2 h *`   h `*  h *`  h *`` 2` 2 h *`   h*`* ` 2`  ` . ` 2|` . ` ^. ` 2s`? (` l Q. ` 2e` @ ^. ` 2[` @ T. ` 2Q` @ J. ` 2G` @ @. ` 2=` @ 6. ` 23` @ . ` 2)`  ` . ` 2` . ` . ΐ ` 2`    2` .    >܄̇(  h *h9* h(h* h(h **  h *h*  h(h  * h(h  *   h (h *  h(h   * h(h y* uq h(h 0i* e * \ * * SJ M@ JJ D@ AJ ;@ 8J 2@ /J )@ &J  @  {*  * t*     " 㿘@`; >ܐ#*` €  ? &`&`> aP &`$&` \` > &`<`(aX  ? &`&`> a` &`$&` \` > &`<`( aX  ? &`&`> ah &`$&` \` > &`<`(aX  ? &`&`> ap &`$&` \s` > &`<`(aX  ? &`&`> ax &`$&` \`` > &`<`(ӒaX  ? &`> a&`&`$&` \N` > &`<`(aX  ?&`&`$&` &`  ?&`&`&` &`$              ?&`&`&`$&` > a`\  &`(> a`,\ > a&`@`D\  &`X  ? &`&`> a &`$&` \` > &`<`(uaX  ?&`&`$ > &` &``a[  &`(> `,aP[  &`@> ah`D[  &`X> ap`\[ڔ > a`&`p`t[Ԕ  N&`  ?&`&`> &`$&` `a[Ŕ  &`(> a`,[  &`@> ah [`D &`X> a`\[  *&`p? > &`&` &`$`a? > &`&` &`$`aȔ? > &`&` &`$` ax? > &`&` &`$`a&`[ 0 㿘 J  @ $ ` $ $$` 㿘 䀤   2 @ @ $@Ւ0 @ 2 > !L  㿘 x  h> Lא!=  "& x" 䀦   2 & > LÐ" ) ""@""   "8"<  ?# @"D " * * ** * * * 㿘   >  L"HU  $ & $  ` 2@`& >  L|"pC $ $ @$ $ ` h" ( h"`, h `D ! `@@"         h $"    `  $   (    $  h" ( h"`, # #### #㿘> "$> b   㿐```l>  4> # d & 0& 4W& 8`2U 0>  L`1  P'2  E" 2  E" 2  E2  ` 2  ``0>!@*` €$"#$$%$"! " 0J  "$   $ 0  %  0#&@%& 0& 4%& 4& 0 0E 8 & : 2& <> @b& 8> @b& 0> @ b 0& 4 8@K@Es 8Eq 8 & : > b@& < 0Ed 8 &  <: @&& < 4EY <& @J   J* (J А 㿘> b Yː!,!   &!D &!P&!@&!< `D"`H `H $ 㿈 T `$`( $`( 8>  <& T$` 0 $` 4? $` !> "> @b ""> @b P# ?>    " Q P "# P P#? >`<@耢   ''쀢 DӐ 4"@ 4'耤  Dǐ 0"@ ''쀢 2``( `$`(`  2`( 0# `( P`( @$`(@-`(`@2 8D``@@$`D`L`D `: @$`$``$`d 8 ?$`h$``$`㿐> #` T D@ H " H& D& H H " ($ $ ( `& H& D `6 $  D " @$ ?$   @ $  $ D $ $ Ԁ 2   H > D > $  ̀    Đ  @0 Đ  @`$!,` @㿘 8 6`4> # @ ` `@  `> #"Р @ ` `@  `   @    @    @    @ 㿀2` `> > "b$" `  !,>>>"c0@&`&` &`!, !\&!\&!T&!X!T>''' ''( 㿘!` T  &'&`̀   `Ē  @ !``Ē  @ !`  $!`!`"!` @#``#dd"@@d`?"@0 d0E" Ed0 # P`#dd2 #㾸> )> #H b0'` `  @((> > ( Ȗ$I 8> ' '$@e$`  "3 @ "/  2&) @&@&&b0` `  @> p ȖIs '@:' "&  & H > $#㿐 4 S  <`> "0`  #\`    0   >  $&` &@@% &` `#\`\  &`&`&&  & `̒ ɒ  㿐  "    ` 곒 값 㿘@` `> > > #cG!V"`N@  `  `, @ W,  @&` 㿘>  0 H> @H @.` < >   HH㿀` R .` < L  8 2 0E   4耢 "8#\#`6 2 & 0  € 40#H /e4 p* & p    0    ` 4$ l$ pH 0@Ő 㿘@ 6 @ p "@ l&@@` *`  <  `V `  V 0 㿘` > h!@*`   € >      <>  4>b   4  0 2  @  *@ 2 (> FE h@   – 㿘` .`L  <  D > "0@">  6 H /e4 p* & p & p@Ȓ $H 0 "` 0 € 42 >   Gz `       㿐`  #\@f  '> "> ` !>   `>  4>b   4  0 2?c.`  * "`㿘@㿘" `$   <, @`R` 2  , 7 t"`"  `\   @"ђ  㿘`> F  㿐\ @Y>  @!Ő  > EX &">  Fݒ`<&"> ",` %> > > > #cE2"D " #\> > > #cE&"#`     a& <> 0>  !8F$D"@ " <> !XF` <& l& p > F!h \`2& 0@"b& 0& 4`& 8>  7>  t9>5> 瀦@   "`@&@  * @*`" * &  : & !& t & @(    > >"4   &㿘#> b, "  > > > #cpD#`4  > > > #cD#  > > > #cD# > > > #cD#&  > > > #cD#> b0"b0> $ $ @"!$  @> `>  $ "$b,㿘?> 2  \`26a  \*@  U * < 2L  E> p>2!a$`$ $ Т` $ lƒ " p4 y  a# %$ $ $ $ $ $ @} 2 p> h $ p*`@  `"   `4  `4    $ 㿐 ?> `\6 ] *`< 2 U  "'   " H /e * & @ H 0 > h!@*`  €o  ?&   $€> "(`   $    '@  ?& b "b@Dnbb ?$b㿘 ?> `\6  * <     >  ha@* `@ 㿘 ?> `\6  * <     >  ha@* ` @ 㿘 ?> `\6 > CO!* <   㿘 ?> `\6  @2 / *`< 2 '  > ha@* `@@ 6r 6 @? 㿘 0 4 @ 㿘# #2b 8` `?&`@7` @ 1&   0`@ % cV"  cEcL  L #Q #P    L"<#K "*` #D"~``0#RE"x`0 #Q"V"`0 #PL0 #UƐ`0` ` =& :&8& ǰ ` ?&`  `` &` @ Ӑ@   $€` "`@` "`0`t `0` `@@ `0`4@ `0 `&8`0@ `4  @  $0|`?p&`(`0t  2`4n -``?^$``> *`"  *  @Cݑ* &`*" *  @Cԑ* &` O&?    $`` "`t> `  =G @Db#`  $`$`` 2`@#'> `  =0 @DK#` $`$`` @  0@O  `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0@{f sH 0nid@ ^ `Z  V(<$<@K  89; "&8䗒 0< 0   4 䋒 00*" *  9 <0& #* "@*` `9 < ?2 " 2"@&" 2 0  ` @ 㿘 > ?\6 @ + `< `?`  `0 `4?㿘> ? \ 2`   * < "    t_ 㿘> ?  \2`   * < "     t㿘> \  l \* @H /e4 p* & p  H 00 H 2 o " p o<* @2 H 00  & pH 00}& pH 0 H k ` P@ p2 0 @ϐ@   @ D    P   @ zH /e * &  p H ?`& p>  & p 蒒&`:` }V  H   p  ?& p HT H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `   㿐  > > > #c?~&" p C  ?}* 2  o!<@ 8@>@  > ?#@` 2> ѐ!@ h *` ` * 2 €0+` 2`   ?> Ѳ!T hJ*@ ' ?㿐H /e * & ` `p@ H 0! @  'H 0 0  c  @ "$H 0㿘" <* @`" ?&"`  㿘 > @u"4  , > "@>< ` > "h@b  "$l ?> @W" $$p$$@  $pv 㿘" > @6"@ " ? $"$ p03*> ">  < ` > #@   """ ?$"@  0> "L` > $  4@ #} 㿘 ` .`w  <@p H /e * &  p` l@`2 "2 "H 0 P   H 0 E &"&"H 0  p 2 l?1&"&" `2 .` < ` 2 @v 2  .` < ` " @g@p  .` < ` @; 㿘 2  p> > > #c=Δ'g``` 0 @   $0S ` *`   <2  (p?l㿘' H /e4 p* & p  3> !c8  p`!H 04 ` .` <  `) H /e4 p* & p@ ` >  &` 8!R @@  ` ?&` H 0 㿘` &  &   㿘 p  㿘!> "D " & \"@ "D& \& \㿐> ",`/> "D  >  < 0  > 0     㿘> "D> ` ""L`0 $> `4€> "H€> >  H > >>  ""H㿘> "D``<`  `0  @ `4`㿘 p `2 ` `  0   p 4㿘 @` 0 `  `" = t 2& 㿘 0 ' 4  H /e4 * &     t &   &  `?& H 0㿘㿈 #X @'''*'?    ? p @ ? p   @+  @'   @Y ?㿘``0`  0 @ 0 @ 0@1㿘`",``0.)0+ ?&   0  0@ː0 @(0@L0@@0  @0@E㿘`  `  0A` 0="$" ?8$" $""5>  (@  " + 0' 0 `# @א" < ?$"$" .`@ "` 7 2 @:`& & 0& & & $& (& ,``.` 㿘 `@>@> @?@`  `?  6 &  0 @P0 @  0  @0& 0㿀` @=Ӓ@>m0`4` @ $   ''쀊 2 䀢 `@耢 '@=@>8`@㿘 6m @`@㿐  $`@>$?@`  `4@=a0@=`  倥` ? ?㿐@ ` ` @=`%  ? @``4@=,0@=Ɛ`  倥 2?㿐  ` @=$ @@=@=`0``4> *`P   P* @@ ` ` 4@<0@=z`  2?㿐  ` @=c &@@<@=Z`0``4> *`P   cP* @@   ` 4@<0@=3`  2?㿐 ` @<@=`0``4 2" > P *`  @& 0㿐 0  @B 0 "  @ & $&  ` @<@<0`4     $ *w $ "  &   & & $& (R& , 0 F ?N& 0㿘  @;  0  @ 0 "   4&  ?` & & ( & $&& , 0 ?& 0㿘 0 ` & 0 $  @" $ǐ $ & 㿘 0  @@ 0 @" 0@{ 0 @㿘 0 2K  &   (@   & & $& ( 0 ( & (& & $ 0 ?& 0  ( :  $ *  @q (& $&   ( :  0  *  0@b (& $&  0 & 0  (*  $   & $ ?  & 㿘 0 2'  $  @" /  ( :   $  ,n` ,& $  ,@(    (@ ` (&   (@*'  $@   ̐   %& $S`   $ A& $7 0 $  @@.& $` @    ?" & ( 0 +    &  0   "@&   0   & 㿘 0 & $  @"   ( :   $  ,` ,& $  ,@(    (@ ڔ (&   (@*   $ @"&    @:V @:R $31?@& $  @:?@:; 3@&  0? 0   H& 㿘 0 - & 0@,   "@ #  $ @ "" @  & (& & (&  0  @y 0 @" 0 0 d@ 㿘 0    0 ?& 0㿘 0  ?& 0 H $ 0 ?& 0㿐 ` 2  $ 8?@5` 4@90@:Q`  b*` ` `  @::?   "*@@* "*@㿘 "`"  @7  > Ѥ!T h*L@ `?2 h㿘`  0 㿘 8" H /e * & "   2)2$  ` "@7x"#  l  &"> #P81  &"H 0㿘 0 8)㿐" F >  `A3  * >  *`4@ >   `? 2  @"@` ` 4"*` * > bl " ?" @2  `@ `  . @  #\    @  㿘" " \&"㿘 > 7#x0 &  &  & 㿘 > 7#0ّ & 㿘` f (H /e * & @`@ %> ;$`! ;@`@󀎠`@ !`" H 0` 4 4@.` * ̔@@ ``$#$@  `0H 0 #H 00 4` .$@㿘 H /e`A* &`A   @ J[ H 0$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$D$D$D$$$$$$$$@$\$$x$$$$$$$$$$$$$`  " 㿘`> 6ɐ#؁ `       㿘>  ` &`|&`0  `? > #6 > " &`l  ͐ $&`l"@>` bX`l " ?&`p ``l&`t&`&`x&`@ W`Ȁ "`l> 4#> `> &`Ԛ &`&`&` &` &``&``&` )> > "` > > > >  `84!b " > > > >  `P4!"b6C p~`\`"> >  69`> 66  @@% >  6)`㿘#> b  !> > > >  `4~!$""?>>> $ $ a $b㿘!> "  > > > >  `84^!""""`"`$"㿘H /e * &  `2  đH 00' "  \  6  l,     \ & l @  `  H 0`"* ؁ 㿘 ` " @ " |&  Ɛ  | > b" "b> > >  `3": X F>   B> H /e * &  Ԑ? +&   $  `8$ H   " $   >   < >  > *`" *  >  5N H 0>    >  4>`Ā   4  0 2  $  㿘 " &  J  Ā 3`2  l \ " lے  l@3 4 \< l c€    @6   l.`  ` \@& l `&  ֐ 0@`  ` & & &  Ő 㿘 X`3` > 4ѐ!0+`,    ?@$ 2" > a8 3} 0`#``$`H` "`$`A`  `<  㿘 \    @ \u &@㿘 \ ` x  ? x p € t& x㿘 \ "  " p&    p€ t㿘 ؀    X 2 @=㿘?> ଑2 `  6, ଑. @ 2 $  `  2 ` " X@ X  4 f&`@  "& Xn㿘& X&  㿘?> 2  . @X   "Đ  "XN 㿘 & Đ& X  㿘?2 >  . @ ؀   X 2 > 3ސ!X  $ 3 4 Ԓ`$ d 㿘?2  > `. @㿘 Ԓ & Ԕ@  Ԑ? & =㿘 "}@ 8"~"|@01@   v@0) X  @ '" X #  !<  @ "  8   X 2  a< @ @? 㿐 c@  #@"# #@ #c @"   c@ c@   K  #@"$@ "  #@E#@"  p#@ v # @">  p@"|>  p #@ "/# #@ "p  #  #@" p@"|  p@ "V #@1  p0# @" p p  c t "  &  &   & & p`  tc@Ѱ " &  " &  "   &&    & & &&   > ۰   "`"` "` "@"` ` &`&& n >   @@C*` *   Ҝ(  @  ̔) Д  l |$ А5 0a Ȁ 8&*  ̕*(U R&?# a2 l А !G ? ߀" l@ @ ̔ '@' 5 lG$ /  @ t ' #@# H /e * &  l? # @"    $ H 0㿘?2 >  . @ X  >  6?ଆ* @" \ * ?㿘> " $ \@  㿘 | 2) ` \  !   @ & \ & \& \`> !p 1` > ! 1  㿘  >   6 . @`2``     `X @ \㿐> "` > " %>  Ā '> = '> #> ?`'$b * =* 2  o$b< 8@">  ?#`   * 6   @;$$b㿘> "`> " >  Ā  㿘> "` > " `  㿘 ` @ b2 d2 h2   xp €t " x`     ( " x \0',cY @'䀦  '܀ 60"''0 \cZ㿘.2 <!@ " l4!! @"  l@@" l@ @  @@ @@ 2 .2 =`,`- l  l `"  \ z  v  `"   \ n  j 2= 2a =2 @2 \ | > #Ā` @s &@M  I"@ `+F>!*` €2? \ , :  \  \  01=2 $ ? % `? =2 ' ? ( `? =2 * ? + `? ) 0 㿈 `'H "    $  ?Ð" @y& &߰  Ȁ6۰ . ̑* @@  =!H?Ð"@`a>"d*` €H ϖ k H Ȗ d H  ] H  V H  O H  H H  @A H  : H !3 H  , H "% "H (  h  H H`` 2P `  "I  H "$ $ O $ H π`  !@ 0" `* 2  o< 8@> @ 2 $# b    `?   @@~ @ .@=* 2  o<< 8@7>  24.`$#  -.`, 2 Ҁ">FӐр .` 2 .`2 >Fx   x  ? O  .`>Fx    F ° .`2  o4!< 8@ >  `?# > > <c"24 >ab(.`)=``!.`, 2 a .`  $ &   2   $ & 6 .`=2`!@2 ii # 2  @2  .@@ 2&    "@*` 2  ? & @R   a$A}* 2  o;<@ 8@6>@ 2  ?#@` 2,6  0* 2  :.`2 ` `2`  * 2  `8" " 6    6 6  `6  $ $ 8$ \$ x$ 㿐> =>   .(@77 7.. (.`0@2&`7   @`6``6`6` ((7@00 " >      68(( @ @ @ @@ 6868261=!-(0 @#* =(0o< 8>   * ? 2 ** 0>  *2 㿘`0> "x.` €4a666$666666 6666 6 6  66 6 6 6㿘4a66666   2  +@@ ?#8>@}* 2  o <  8 `8`8`* >2` @s+<    +d`+`@* 2  o<  2@ =@"6@<    26` * @@ ) ?# 381> (@ }* 2  o< @  @ 28 @`8`8`* 2    > "*@0 `@*n@`2S㿘 . @4 . * & z &@ 4! @ 2@ @ 2 @@ 2`@ 2 @@ 2` p ? >   `  2  2  *"Ѐ * "  ` T *@  *  G?# 8>}* 2  o <   8 `8`8`* >2` @2  <   < <    * 2  * *`X Г*   * ?#'8%>}* 2  o< @  @ 28 @`8`8`* >2`@"> #)< @  @  o " `  * 2  o<   2 =@*< a   aa **@ * 2@ *   * @ )@?# 85>,` }* 2  o< @  @ 28 @`8`8`* 2   ``@ > #)* ’ ,` * @ *g Vа @"` 㿘`> *#0  㿘&`l>  @` &`p&`0 @> @>@ɒ "> > *͐#@> #X*Ȓ> *Ő#``"*  㿘 ` " X@ X F>   B> H /e * &  ? +&   $  `8$ =   " $ "  >   < >  > *`" h*ݒ  > #p*v H 0>    >  4> bl   4  0 2  L  㿘@@\@k  X`[`  > *@#0R& t |& |  &  &  & ``` .` x @@  3```` ?&@ "@ $ r ` `  &   | ```` ?&@ "@  |$ W ` `   & |`"  2``` ?&@ΐ $$ ; ` `  &   ``` ?&@ $ $ ! ` `   & "  2``` ?&@ $$  ` `  &   ``` ?&@ $ $  ` `   & "  "2 t``` ?&@b $$ ϐ ` `  &   " t``` ?&@I $ $  ` `   &  t- 9> ;> +> ``` ?&@"6"?`$ #cȖc'! *   $ ` `  ۖ  ``` ?&@  $$ m `4  `& x$` 2 `  6& . @ 2   `  2 X  4 &`@' "& X 㿘?2 >  . @``  X    l" X@ p0 㿘# l& & & & & X@ p㿘?2 >  . @   X 2 > (y  `$ Β `$  㿘?2  > `. @㿘  & @  ? & ؐ㿘  V  |@ }@  v@  E  "}@ " X8"~"|@" X0 l@   v@" X' l   @ '" 2 " !<  @ "  8  "  a<  @  @ p? 㿘?2 >  . @ X  㿘 X + 㿘`l"`X  €`p㿘  >   6 . @`2``     `X @㿘>  p )+> `t*  Ǿ  `>  '*  p*: p@6 % p*``@ $% p`%`tQ `t,  >  H@< 2`t> '[ P`t"㿘? 2  `  2 ` " X@ X 2   4u$ & |@ 㿘 X > '* p   ` > @  '  㿘 p p& X%> #>  X " `'  d`' d 0`€ d p2 X㿘?2  > `t.  X @ & X2 㿘@& X 㿘 p p%>  `&В d 0@$ X d2 `㿘?2 >  `t.  X  > &! 㿘?2  > `t. @㿘 cb@ ca@  #@    v #`@   v@" X b|@" X #@" Xb}@b~@"   X #b@ "{ p#a@"\ X #`@0A#c@" p X X  H /e * &   .    ?&  H 0Ͱ 4 # "" u"  $ 9k  " $     <n H 0 "  " "  =q@ pI 0@ 2 d @P d 2 0v  p   0"  "  d$ 0&(& | X   @ U$  R  !<  @ "J  8F D 2 ? a< 8@  X 2  p \ 2 p. @*  p  )>  `! %z d 0` @ "  d2 ` #@ & x㿘?2 >  `t.  X > %G!@ 㿘 2``   `X `     `  @ 㿘  V   p$ t$ p>  X %G> `X$ $ 0$ x 㿘 2``[  > %!`T &`` p&`d t&`h p@& p t" d& t \`$ `0 "  X€ " 2 X`0%   | @  x` `0  x @  X` `0 € "&```d@`h& t"`h`h@`d& p"`d?&`d&`h㿘 ` 2 \> !x$ 0) "  X 0  €   d " d 0@ d p@ h$ t h"`h h@  d$ p"`d?& d& h& `㿘 #@$`|`p`p? )>  `!$a d 0 ` @ "  d2 `2 㿘` \      @㿘`  p p& \ & )>  `!$" d 0 ` `\€ 2  d 0  c  | @  d2 `2 㿘 > L >   x x`2u  2 $7$7$7$7$7$7$7$6D$6P$6p$7$7$7$$6h$7$7$7$7$7$7$7$7$7$7$7$7$7$7$A($AD$A$A$AL$A$A$AT$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A$A\$A\$A\$A\$A\$A\$A\$A\$A$A$A$A$A$A$A$A$A$A$9D$:D$:$;0$;$:$B$B$<$B$<$=`$=$>$B$B$?$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$<$B$B$B$B$B$B$@$B$B$A$B $B$B`" "`$" `" `" (" $" ," 0" "  0  " D" L" \" 4" H" T" X㿘#> bPޚ $  bP`   @ P `   @ P 2$ P $ `$ ѐ㿘 > "P ``"& > > > "b(P!{ А d F  \  & `& 㿘``t > "x*` € 0j , g?e& ,c& , ,  $"" @ 8 `V  ?&    ( P L@   & : ,6& ,  ?&        L   & & ,& ( ( ?& (> ""h0  & 4 (  @"& (@ D㿘  ?$  `  ( , P H`@   $  , $  $ , (  @2 $ ( D@ "$ , ,?$ ,$ , 㿘``[2& 4 8& @@!  & 4㿐``3Z > #*` € @ ?  *` 8  & *   , $#8@   ?&      # @ (2$  & 2  2?   @ ?  *` 8  & *   (  "& (& , @ ?  *` 8  & *   ( "@ 8 & ( @ ?  *` 8  & *   , $"@ 8 & , @ ?  *` 8  & *   ,  "& , @ ?  *` 8  & *   8  @?`& (  *  8`  &  *   $ 8 ?h& , (      ? & "   L 2S  & 2N  Ő?  , $ ǖ"  @ ?  *` 8  & *   ( "8@    ? &  "  2  & 2  ?   L @ ?  *` 8  & *   ( "8@@    ? & "  2Ӱ  & 2ΰ  E?  @  "@ LG @ ?  *` 8  & *   , $# 8@   ?&    #  @ (2  & 2  ?&     $ " (@ L2w  r&  @  T X4 \* 8  `/%> "*` €?L   ``` * 8@  ?• * 8@ؠ?ؖ  @K 2/& \& H& L& T&& X       @ ?, *` 8   8  & D 0 & \& L& H& T& X 㿘` 0 9 ;" @ @ @   8 <  & @&` @*@ *` * ?А&@  & @ @  & @ & @`t "& 4& @ 㿘    ` 2 > "     (  ,   ` & & _      4   (  @   D @d`  & $ @ =& $  (?& (& "`@`P  4   >  4   U"؀`  &  `"` &  $ $   (  ,  & 2& & `,8 / @ "  `$ "  `$2 `$:      2`    ` @? ΄ 㿘  `  @` `; `  `  `` `   `  ```  "`"  2  `  @  }(0o < @ 8> @ 2- @2 -`2-> (-(0 * ?,(0 * ? -o(0 * ?Æo0>  ( ",v(0  * ?Äv2`> ఑* 2i"<➑2`\> &㄄♀a> ⛄▀^> ╀R> ☀U 0\"F> A> ✀8> ❀1 0N<> ㇄぀(> や⟀< 0>%> ダ# 06,>  ㈄ㅀ > ㆀ 0( > ㉀ 0 >   > > "  > > " > " 㿘 (> &@ ,bP & 㿘`"`0`"090    L & (& ,@    0  ,  (㿘`  ?$        L   $ <$ (9  @   ?$   "      $   ?$      "@ L   $  (  "$ (㿘  *@ D #    @ h    @ a > #?  @   4& > #0 ?@  2?@ 㿘H/` / ` ? (> M#X   ("`  \& $ $   & 4 $ @ & 8& 4 8 4& 8<9> 5> /> ;> 3> 7> & 4 4  @ & D $@ 8& @r : $@& H& L& <& $&  g2 & T $b& X (^ $ (` & P W *{  ( & (  (`@%& \ H <: "  :  ?@ 8&   "::  \ " @& & d  \ @"@* & `& d& ` ( +  \   " <  $*9 8   8   \@@$*! > "!> "ᐘclb < t& & & & & & & & Ѐ&  ( > > # #< & &     (@ (@א  ( =& (H 0 ?"& (H 0 㿘 2> F# @ @    @ &@   &  &       2`>  2 2**` #      (* # 㿘  $S <:`:`  XI @ XD  @= $7 1 @,@ * ?""" " """"    ?" ږ 㿘 T X `$ @ ?Ɣ ?@? 㿘 ( "   П@ 2 ( ?& ( & `& $@`"   П@ " ( & ( " h (  h" h ?*``` 0 h *`*`@*`*```"2`2`" " `#㿘> h< @2  (    :  \:     <$:j: Xf   H@` "@"`"`"` "`"`"`"`` ""@`@  㿘 $ X>   T8   " $$@"@:`??C  ?8" ?2 00??-    8*  82?8"  8* 82?2  㿘 Tے Xא Ґ?   < h@@ B$``??x> ?"?2 0g??c> ?2?2 0R?P ?*?2 0?` "@ `& @&>>??2 ` ` `*2? """" """"  " *22?2  ` "> > > ("``  > > > "D"`"`"`㿘  # X <  @  $  l h" h l@ 2 ?     P& 8 (@ Y- > , `@8  B @ @ &@@9 `2   *  *` * @82 @ @&@@    *`  * *@ 2 @ @&@@ ~ @  * &@@ @v@ >  4* > 㰓, 88 @  @U @` @ @&@&`@H  `$"?   *  *` * @8`*  @ 2@ &@&`@"    *  * *` @*`  @ 2@ &@&`@ -@  * &@@-@` @ @  &`&@ 㿘 X% @ T   @ `$ l h" h l 2  + ,@@%   P& 8 (@  @8,@@ @    @,@@ @  * $@* 㿘 XҐ @ T͐  @ `$ l h" h l 2  0 4@@*   P& 8 (@  8,@ 8 ,` @    ,@ ,` @  * $@2 㿘 ` xt?  h <@ Xl > `$  + .> @   ? ?=8 ?  #? 01> `4+ @ > #*  >?/ ?/   # ?#?  `   #?2  㿘 `   $ X  < `$  *,>  `??-@@?  #@?@ 0">  4* `> *` ?8 ?8 @@ #@`?@ #@?2  㿐'D  ȒĒD X $` XD> < ? ?@@ ? >   *.>  # . @: $``* ?  > @ *  @* @ @ 4@@ @ @*@ @+ @`$ ` `@:  `D?`?@Ų@0j> .`4@  '> #-   "'  ?@=`? D ` <>    "@ @  ??6;>   **`> `4   .D @( : %`*  > @ *   #@* 4 @`  @ #@#``?   : #`4#@* #@ 9 : %`* ? , @ *  #@* @#@`4 @ #@*@#@*`%  #`> #: #`?~D0>` < ?@ @ ? > *> . 4   - D`@  B :  '`* ? > @@* !#@* @#@ 4.@ #@*@#@*`'  #`> #: #``࢕`?   : #`4#@* #@``% : '`?* ? > @@ *   #@* 4@` @@ #`#@?vD   ">  >  > "> > " 㿐 Xא @ TҐ?  h?  < @ <@  ` `$` //=  + 2 - ` P&  `(`8 @ ` `*  ` @*`*   @ 2*+ 2 `   * 񀦿$,  㿘>` h<>`<7> ;> &`/ ./ c   "&&c  c @.&@c @./ &@ 㿘> #d` "#d$cdTP> #` " X X  @ T  $* >  $$     P&8 (@> # 2  < $ *  <  $   >  c\* $$$ cd ?$cd㿘> #d` "#d$cdW> #` " XR X  @ T  @  $0 >  &@&`&` @ %   P & 8  (@> # 2  < &@ *  < &` 2  <  &` @  >  c\* &@&@&`&`cd ?$cd㿘> #d` "#d$cd\> #` " X X W @ T R @  $4 > c &@&` &`&`*   P 9& 8  (@> # 2  < &@ *  < &` 2  < &` *  <  &`  @  >  c\* &@&@&` &`&`cd ?$cd㿘 8   (  $  >  ,  * 㿘 (  $ 8  ? ( ?   , ,  &  ( 㿘H/` /> cl     $ ( 2 H 0> ch>   "ch>  #l  "@   `##l> l"  22 㿘H/` /> cl .`  $@2#`  @2   (@2    2 H 0   ׀H 0?㿘H/` /  $ (   H 0:?  > > 4`cl  "$@`4` 4`$` $`4`  k <$`  <   $  ( ] `"`8` 8 v84`$lH 0 㿘Ho oT 9 `,  H 0-?ʐ  " ,"  `0"   H 0?ǐ  " 0   * 4 &@2`?H 0㿘Ho o &@ &H 0 ?㿘Ho o  ? ?> !* 2 2`H 0 @@(> (㬄:` 6 `62?" (+?&'?6"? "`0 `0   **` ? ?㿘@``!"  . ,:) *`   @  `@  ` @  `@  ܦ`   㿘@``!"  , *:' *`   @  `s  ` l  `e  ަ`     23`2(+`@ #@( ` ("@ @"`("`("`("``0 "@ @"``㿘*@ * \ *@  * Ŗ 㿘> a`?㿘> a@k> > 0b(&ad4&ah8> &al`?b@kې: >ap> 0@kҐat @|ݐ&d|> b(B@kǐ @|Ґ&ax> b@ @k&`8> bP$@k&`0> #b`@k&`4`8`0@ `8 `8 & `4: &`< &`@`0> `8-"pd|&`X&`p> c`?> c㿘#A@". 4c_@"4 <c@@ cD@#FE@ cB@"& 8 #E@<?0; #J@"7?2cC@"  80? $,&& 0& 8& 8 @? a & & 2 !|@T   2 @n!| 2  @! ? > $  8  &?`@8 2?@ (?> at ah ad( ad ?㿘!|* "|#|* * @N 㿘@ `!"@(`  2!`  2 "`  㿘@ `!"@(` Д 2!`  Ȕ 2 "`   @ax(""ax0@ ( a|b|@c| `ax(  ax*  ax( @ 㿘``/ 2'  "#   ?"  ">    #`2 4  E"  4 ?   㿘> Ր"> c   0 ? 0`L &`L  @{6  &`P0 @{. &ad &ax   6 `0`0# > `L  > " &ax > b@i` #L@ > "# 2#>  `L`*  J`@`# #? 80> b(`?0&ah4 &al8 &ap@&at# 5$`0> `4S"> b$`@  ax@z–* &`X&`pá?> `03A@"' 4_@"( <@@D@F@ C@ B@ E@?0 J@  "" 0" 8" ""? > $  8  &?`@8 2?@ (?> ax al ah( ah ?㿘> #`!t  L 10*`Њ@@ Ъ@@0#Њ@@ ?Ъ@@0H/` /`!d `  `!d ` *`!d ` *`H 0 㿘`` 2 > #`2  2    ?"   E`?㿘`L  &`L 0@y > c  &`P>  " J  0 0  ?@yӐ&ap0&ad4 &ah8 ü&alap " s" " " # $!> &`p" `@   *@y&at`@  * @y &`X@ `0> `4 #"ג|?> `㼘`!p> "$  @!t  *  ///  * * *``> "$  @!t *   * * * `` ! 㿘 E@"> #F@ "8? c@@!cD@.?0-#H@'#A@" 4$? cC@ cB@L@"? #J@ "& & 0&&&  ? > $  8`  %&#?`@(((8 ?@ > ah ad(@ ad@ ?㿘`` 2 > #`2  2   p ?" —  @`?㿘>  A"`L `&`L 0@x > c  &`P>  " J  20 0&ad4 &ah8 ‹&alap"""?" $# > "$ `@0 * @x~&`X`0> `4&`p "> %`t T?> `㿘#A@". 4c_@"0 <c@@ cD@#F<@ cB@"!t #E@3?02 #J@".?)cC@!t'? !#&!& 0& 8& &&i   2 !p  ? > $  8  &?`@8 ?@ > ah ad(@ ad@ ?㿐!p #\ !t㿘`` 2 ` >  0@  > #`    㿘> # :8?#4> # 0@044> #@ ( 0`>  "#`0> c@fvJ@ "> >  #> "(  8 0`?@w  <    "0&e&e&ex&e|&e&e&e&e > 2&eD :`  #<&ad@&ahD &al$#`@<D*` `?&e &e @wJ &`X`0> `4 ̐#> 'b4&ee `@q&e &`8@אeap  @ "@ ` @ e&`p> 'ag` ?> > &" ϖ> a 㿘#A@"/ 4cD@"s c@@!?0lc\@.c_@"1%d? #L@ "M#E@Y?0X cB@'cC@"0%O? K&& 0&%   &% @? !<& % 6 @6&  <* 0&.&% 2+ !p@ % # 2  !p@˒ 2@ 2%@>   @7  ? > $  8 " ?e`@* :  2? (?> ah ad( ad ?㿘 8#`2 X% %x @ A*@> 'a& 8@  @% %x p q*@%!*(%"& 8&%t㿘 8 ђ > !> "b% A @`%x ( (㿘@``!"  + )% *`     `@  2` @   2`@  ߠ `   㿘@``!"  , *& *`     `Ԕ  ` ͔  `Ɣ   .`   %t2%p"%p "%t@  * @8 "%t"%p%x(%*`ap  @%` 㿘*`!s* !r* !q* !p*  㿘%x  "    *%x `*%p%t  `%x ``"  `㿘`  " > c 2#   > #`2  > "   ,@u(?@Β ?"  `  㿘> #00&ad4 &ah8&al @u&ap   @u&at  *@t&ax @t&a| @t &a  " L@`L>  &`Lc > c@cL@ > #[> c  >  `L   `" J` ㄤ ㄐ? 8at> b(`?at> )@!&dd`&d < @o+ @ @ $# > "$ `@0 * @t &`X`0> `4&`p#Œ> )`ǐ > )"> )> *> *> +cĖ\ @&a&a&a&a &a$@S?> ap㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"! #E@0?0/ #J@"+?&cC@!$?  &!& 0& 8& &&h   2 @d ? x?? `"" "  t`@"p" " > $  8  &?`@8 ?@ >  ah ad(@ ad@ ?㿐!p #\ !H!x`!x H 㿘!x `0 02 ?#ߒ @`"!p! !A  !|`?""`㿘 [!|` @ @ 4"@  4"@F `$$`$`$`$`$`$` *`3$` ̔$`$a `$` d($` 4 `@$` d?$` `$` d$` 4 `@$` d?$`` `  㿘 k!|`h @@d D  4"@  4"@ P ` UQM`$I$$$$$$ *`3$ ̔$$ `$ d(@$ `?$  d`$ ?$ `@$ d$ `?$  d`$ ?$   㿐 `U!| @@Q D  4"@F ` `$ Ȓ@ $$$$$$ *`??$ $$ h* ($ d$ `@$  d $@@ $ `?$   㿐 `!|  @@ 4"O Ȕ@ $`$`$`$`$`$` *`??$` $`$a h* $a @2  ( "  $i$i ?$i $i(q$ d@$i `$i  d$e?$i 4 ` ?$i(` `  㿘  !| $I  E $$$$$$$ *`$ U$$ d($ `@$  d$@@ $  ` @@ $   !xh( "h㿘``[ > U    `?㿘>  !> A     > ` @`f` > J@ >  (> "( @ 0`? @qodx`&ap> ,%> +> -> ,*/> ` 2'0 > "  > @`" p     +@  $  (0 ` 0&ad4&ah8&al&dx&d|@k  @ ap " s" " "$#    `@ * @q &`X`0&`p`4`0GJ ?|㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"!t #E@0?0/ #J@"+?&cC@!t$?  &!& 0& 8& &&  2 2 @x ? > $  8  &?`@8 ?@ >  ah ad(@ ad@ ?㿐!p #\V!tH`!p `!p(!p(H 㿘!p  "    !t `*!p !  !p(㿘``?㿘> `P@_> H> `X@^J@ "> >  `>  h> "(00 &ad4 &ah8!&al`? ! @o&ap "!@o&at# $@o&ax$ #N`0 &`8:`4 >&`<`0&`@e `?&a`8> "  `8   @oŐa&a|`0 "  `8   @o&a&`8@~ a|&`p&`X" `0?> > ." T`0> `4` p> `@^sJ@ >  `h> b8㿘#A@". 4cD@"C c@@ ?0<c\@%c_@"% <4? #L@ "!#E@)?0( cC@!cB@  0 && & 0&&&  @&* & @    @   ? 㿘 8`?!' !t."`\!t " X!p "`p!p?"T!p"`X! !| !' !t."`\!t " X!p "`p!p"T!p "X@!x?#"c !x"#(!x]& 8' !t."`\!t " X!p "`p!p?"T!p "`X!@!|!' !t."`\!t " X!p!"`p!p"T!p" X!`2!|@} !% !t*"`\!t %"`X!p?"p!p#"`T!p" X!`2!+ @Q  **!x "*& 8> $ 8 (&&?`@(8 ?@ > ahad(a @   0@  ?㿘 8 & > !> "b!x ` !x2` `"㿘``  > #` > "  0@n.?@Ւ 8@ 㿘> #`  >  " J  20 0 &ad40&ah8 &al&ad $ @n &ap  ( @n&at&  @@m&axat<2@ @  $#R > "$ `@ad * @m&`X`0> `4&`pe > 0b\`?> bL㿘#A@". 4c_@"0 <c@@ cD@#F1@ cB@" #E@(?0' #J@"#?cC@? &!& 0& 8& &&@T @ 0? > $  8  &?`@8 ?@ > ah ad(@ ad@ ?H`!p!p(H 㼐> )@ `cH!x'!" *!pO * ` !p `2   !p ` *` b*@  b  *@  d  *@  !p `*` 2`   `  #H > ̐ 㼐> )@ ``cH!x'!" Q ` ʔ 2J`  ” 2B`  "!p8,`c !p `2   !p ` *` b @ 2 b   @ 2 d   @ 2 !p `  *`H > b Ё㿘!p" !p `2  .`!p  *!x2@ !x 2"!x 2!p ` *`㿘>  `耢   >  `   㿘> a@[>  > b(`?> > !` 0l" ` @l &dp l@l$&dt@c!,2` $@2&dt @ؔ  #_$> a0@Z " `@ $> !8r`08 &adad&ah &al `@ @kۖ* &`X`0> `4&`p\!ap@#> 1c,2` $> !`G@R`?> b2` ` `* " 㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!p#C #E@'?0&@!p"? '&!& 0& 8& &&@x  @ 2 @T  > $  8 &?`@8 2?@ (?> ah ad( ad ?㿘$p #$pu#ŀ`  ߔ $p s#Ł㿘*`!p * * * @ 㿘$p#]`.`!p.@  #$pQ 2 㿘@ `!", % # @`@   ` @   `@ޔ   `@*` 㿘@ `!", % # @`   `    `   `@*` 㿘 # $tؒ! 2?㿘 #!Ӕ ?  $tĒ! *$t㿘 $@V֐ Q  L 8  6 0@?0&$x 0$"$x%"# "$x01"$x&@$" $x0)"$x0&$x @ @ &$x> 2> 3c> 3> 3> 4ᴘ"Ě`$t&!&! 0 &! &!p&!$$t Gl 㿘   jf `a$]x d` @ `@ mt FB tB @.`t= Pt9 T  X $ *t1C㿘  $ )% d x`@ @  1t F t @ `.` t P `. t T 4. t X 㿐  Ȕdx @ h* @  '   ِ `  $Ӑ d`   dt F  `dtdt @.`dt T  X $dt*㿐  Ȕdx @ h* ` ' dt F  `dtdt @ @2  ( " dt  T  X *dtx 0`$vr d T  `.`dtg  4. dta Xs 㿘` `` X $`d `$S ``x`   jt F? 3t? @,t P9t5 T` X $ *t- ?㿘>  x! 2 >  "(@ `?㿘> !<4> > !4 0s ` "dx 0&dxdx 2`> !0^0&add &ahh &al@h8&atD< @h &ap> "(  `?"!ݒ > `@ "$ * ad@ho at&`X&`p> &d"`0 ``4at > 5&d" #<&dd&d `@bא> 5b`  `@@ @ '?> c(㿘 cL@"E##F@"?#D@ " 8#_#@@0?0{@"C <w?#A@"4 4mcE@l?0k #J@"g?  #B@ "-!x\#C@/!xZ?0#Z@ "EP#Y@.?0N (K& 2I   `"D @ݐ@ !& 0& 8& 7&5& 1 /L 2*@j$   ? &@&&& &@E& &   ?@   @   ? > $  8 &?`@8 2?@ (?> ah ad( ad ?㿘*` !x* !y!z* * @  $x (* az@ $x ( $x( @$x`(* 㿘H/` /ta`"a8" ߖ !t"a8@ۯH 0㿘!t `   !!t "` !t " p 0 p2 㿘 :> 6> 6> 6> 7> 7!p ؒb \h!&!&! &!&!&!$b &$#b !p "!p""!p"b!p"  0 4? /!p o*  "$!p@&$"a!p"!!p"a 0 4? /*  o!p "㿘 `   !? ``$ d p3 $"p $o*  "  $ o@?p /*`@ X" p @ * $ #@  $ @? /p, "@ p_$㿘  $ ѐ?͒ dȐJp3 $"p@ o$ `  /*  #@  4@ ` @ op*`@  X"p @$ ` /*  #@  4 `  ? /p*  " p` $㿐``Ȕ @` z ` u``` $o`d p?#$"p""p@ o*`$@#@ `$ /@ /p, "@ p$㿐  Ȑ@ ap?#$d"ap""ap $d @ 2  (  #   /*  o `$ d ` oapo*`@"  4@ ` o /* ap " ap` $d㿘` ` $` `d  `$`` lp!$"`hp#""p /@ *`$@##@ ` $  /p,  " p`H$!t "$ 㿘> "8`?㿘8  @eJ0&`0*`0  > *`0"@ 㿘> "h`?㿘> `T"p`쀢 > "x 00&dԒad&dАb $`4 @e &a`@ <@e &aa> ` "(`&d` `?# d"X`0 `4&d&d@ d d&d`0&d܀&d`8"> dԐ &d> "$ `L`D *  &a@d۔ $$d> d ["a > :&d"  t&d&dd @_G` "> <@Ր> <@Z!> 9bP`  ``0# @ @  ?> > ="$ S> c㿘 cL@"F##F@"ǰ?#D@ " 8#_#@@1?0@"p$?#A@"Q$cE@?0 #J@"?  #B@ "c!#C@e!?0#Z@ "#Y@"d? &`&$`4 $Ԁ }$@$y $Ԁ $@ה > 9bPs  ` 0# 2e @ja "$$&$&$&$ @? aP&  &$!& &H& " <$$c2`?&=&? 9 7r 22@,  '? &@M& & &&$Ԁ "& @g &  ?@%   $Ԁ   @>  ? > $ 8 2J?$Ѐ'B? !d`8 ,?@ (> ??B !p`8 ?@ > ??B !|! 4 > 2? > ?> ` @( @ 㿘*` !* !!* * @ !*`#$"!!#$!#$*`*  !b#$ ("b!!#$!#$! `("$"!"$"$2` `*`"!a"$a"$b2 ! `("$"!!"$!"$2` `*`#"!"$"$*"!a"$a"$㿘H/` /a`"a8" ߒ` !"!8$Ԁ`@aH 0㿘! `   }!! "` ! "  0 2 㿘 H> :> :> ;> ;> ;!"HcĖ#X&!&! &!&!&!$b &$#b !?"!""!"b!"  0 4? /! o*  "$!b&$"b 0 4? /! o*  "!@&$"a!"!!"a 0 4? /*  o! "㿘 `   Œ? `0`$︐ d  b$"b o$*` @" $ o@? /*`@ X"  @ * $ #@  $ @? /, "@ R$㿘  $ v?r dm= b$"bo $ `@ /* #  4  `X@ o*`@ " $ ` /*  #  4 `  ? /* " ` $㿐``Ȕ @`h* @ `' ` ``` $`d ߐ b$"b#** * "b o*`$@#" `$ /@ /, "@ $㿐  Ȓ@  h* @'a $d"c*`*`@ *`a "a $d @ 2  (  c"   /*  o `$ d ` oao*`@"  4@ ` o /* a " a` _$d㿘` ` $` `d  }`$`` L Zb$"b`h#** * "b / *`$@#" ` $  /,  " `#$㾰> )cH>  "0'` W T`  @Q$(#\>  Ȗ  D'$'' @PP' ;8$`5`"3H "/H*,@: #4"H!> #$ $ $@$ (@T$ 8 H>    v#($` h   $$`H > }#8㿘H/` /` B  ?U $  8  K $Ԑ ?&$ԑH 0㿘 c d$ c " d >  4 ' b > > #'<> #' G > > #'>  ' #>  0Ho o! ?&$"!&$&$"!&$&$  >  cP+>  >cP`  "-  " @& @ s2" @      2      2       ɢ`!!` &$"`!+&$"8!"a@|!2 }&$"t+!cha&$ch`" ! !"@  2!#a &$"a! s&$" a t s$耦@ $Ԓ @&$$$Ԑ `@&$$Ԑ `H 0㿘$Ԁ $Ѐ $ > 9bP  ` 0# ! "$ 㿘N> N , 2 N  `hK 2 > `x@ 㿀> J@ , 2`J@ ``> >  `0m"(#> ` `?@M`" `>  ($#''' 7@M >  0  @^&d  @^&d0 &ad4&ah8&al&`8 &`0&`4&`<< &`@`0> `4] > b$`@  * @^&`X&`p@?a@#> >c? @ > `H-㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!#C #E@'?0&@!"? )&!& 0& 8& &&@e  @ 2 @  > $  8  &?`@8 ?@ > ah ad(@ ad@ ?` $@ @$ @" @0 @ @$@ @㿘!* "#* * @j 㿘@ `!"@(`  2!`   2 "`  㼐> )@ ``cH'!") ` 2"` ۔ 2`Ӓ a b  #H > ̣!d:`(dabc*@@@ d ( d( @d`(2 㿘`!d @]  2/` ? @ ? @ *`+` 2 3` @ * @ +`@ 3 @ 3`@` ? +@?@ ` 2$*@  @` $"@ ̈́2`㿘> a8`?㿘> !H> b(`? > > !X 0ax@LJ@ > !0&ad4 &ah8 &al< &ap@&atD@] &ax&a| @?  @]*&a$#] > "$ `@0 * @\ &a> @Lca 2 a`@h* @&ad&aa   `0> `4]!@@  @Ӓ a&`X&`p> Aa@> A!&d&dd @W7`` ?> > @" b> `$㿘#A@"/ 4cD@"o c@@!?0hc\@*c_@"-!`? #L@ "I#E@U?0T cB@#cC@",!K? #G&& 0& 8&! @? !<& ! 6 @6&  <1&* .&! 2+ !ޒ % # 2  ! 2@D 2!@   @   ? 㿘!??#"h!|" " 8@"& 8! @`2& 8> AaO& 8㿘 8 ے > !> "bH!`(! H > $ 8 26?&3? 8 @8 @  " ? @(8 2?@ (? ((> ah ad( ad 㿐!| #\ t!㿘!h  ?   "h!|! !3 ! "(` T! $ @Ġ$І?(*  Ը@ 0Ġ㿘 > a@J;  &$А &$$Ѐ4!&$ 8 * `&$  *` *  8 @@ *   4 &$!   *` *  @*`  4&$ȁ㿘$Ȁ  T> B> B#c,&! &!`> @Ja > C &!$  `> C!0&!$̀  > B!> Ba  8&!&!&$ԁ㿘 6  Ԑ@) ` <84`$/ d0+ ` @ @G0? 㿘  $         d0 ` @  4@ 0$&@@2 4 $Г*`$̄?   (  ĺD"* @ ?㿘/    0  綐$Ȳ&@* ?2@  #, +@  @  к# " ?㿐  Ȕ @*`   `k'   ~ ` @$x  d`$`    㿐  Ȑ@ *  @ k  ' (      `$H `C d 4@ u   㿘  ` + $ ``$  % d      X ?` 㿀   Ȗ@ h**  `''  `@$ d @$   쀢 ! ?`0 Pِ&  "@8&0' ΐȑ* $@ j7  *'  ""@-`''   @@: (`@ " * +       Ի .   Ի. 3   Ի 6   Ի  +    .  Ի    Ի?  ! 㿘> a > b   㿘> b @G> b> b(@GJ@ > W"8 ?4  &4&8> "( 0`? $@X&ax> bH@GJ  g?Ϡ$$  > + !>   > bX@G> @Gb`$# &`8&`0&`4$&`< &`@`0> `4 "h0!> &ad4" &ah8 &al `@ @Xq* &ap`@ * *  @Xg&at @ ap&`X&`p> Eap<?> `Δ㿘#A@"4 4c\@5 @c@@&cD@#F@"<?7c_@"& <5? cC@cB@, #L@ "$#E@#?0" #J@ %& & 0&&& &* & @I   @E  ? > $  8 !&?`@(8 ?@ > ah ad(@ ad@ ?`15!x 㿘` @ > Eap!x     !x2` `   㿘> B" > <" > 6"   㿘> "4> "` 0`> b@FKL "> "> b( @> `?bd&exPH @WP &apD< @WJ &atT> G&adXa&ah\&al&ee`&e@Q  @ $# > "$ `@T * @W& &`X`0> `4&`p꧐"[> Fa]?> a$㿘#A@"- 4c_@"/ <c@@ cD@#F:@ cB@"!%x #E@1?00 #J@",?'cC@"%x%?"&!& 0& 8& &&@\!x  !x@ 2 @< ? > $  8 &?`@8 2?@ (?> ah ad( ad ?㿘%x  !{.`* !z*@ !y* .`* !z*@ !y* !x* @ 㿘@`!"P ! ; ,   `@m  2?`@e    `  / ,   `@N  2 `@F    ` , @` @4  ״   㿘@`!"Q   9 ,   `   `    ` 1 ,   `  `    ` , @ ` Ӕ  ״,`   *`%x!x!t!t$  `"!p!p 0  㿘!p` " `  "` ϔ! !p  㿘> .c`?㿘00`T&ad4 &ah8&al $@Uh&dp .@Ub&dx P.@U\&d|  @UV&dt  @UP&d> c@D-J@ "> ː#> b( &`8> `?c $@D'&`0> #c(@D!`0&`<* > &`@&`4 讐#0> b$ `@  * @U$ $ W 4  * "@ $ H $ <$ L *" 8: \   +`" $ T$ `:   \ " @$ $ d  \ @꬐" &> J> J> J> J> J> J8aȖ̘ a d$ $ `$ $ $ $  $  > > K" ?&d@  @` > atA㿘#A@". 4cD@"; c@@ ?04c\@%c_@"% <,? #L@ " #E@!?0  cC@cB@  0 2& & 0&& &  @ &&@< ? > $  8  &?`@8 ?@ >  ah ad(@ ad@ ?!p( "p( #p* 㿘$@y`$x\$p  @"  @ 0  @    0@}$|?n?"n$.#$.$. 4? 0*`? $.$.  $. P$.$.  4  0?*`  $`$` $` !p"p#p$` @> # @+@` @`+` @ *`> H,b@Y&$ $.?$. c?$.#$. 4 0?*`  $`$` @  $`#$.&$㿘dt$ ` #| ?    > #@8`㿘$t`& ` ` @"?&& `& &  㿘$t$Ð  #p!p$"p  * @@ * @$ `  $  $ $t `" 㿐 $x$p  Ȑ@   `  $ਐ d   ࢐ ?$?  h\$n/ *  *`. $n @  $ $ 㿘  $x$p \| `$v dqmi?e?  .` . / @   P@ %@ %` %`%`㿐`P#\ $     㿐 `P#\t  㿈 @% ( ! xp  ȟ@ h@   P& *` * &   ?*`  &`&` 0   P#\  D@  㿐#\ D l  㿐 #\`  㿀  Ȓ@ h*`*  ''` `$ɐ*  ,  '  P#\  쀢 Y`$*    P$ *`$ ?* $$` " * $< $x$p` Pߖ&`8`(@   P$ *`$ ?* $$` " * $` `$` * $  쀢` * $  쀢 ??$ 㿘$  > !> "b㿘#l8 >  "axߐ 0> !Ā`   ߕ  ?#l 8@ ֐> #h2 23f##h0㿘 #%#l 8@"j#l 8@?2#l㿘?# %##l 8 @"R#l 8@?2#l㿘"ؐ `  `1  " >  > (  > # #`2 -#l " - #`2 -#l    -#`2  #l "  #l> #p 2  %8 # %"`㿘> #`!#l``8 `\@ #l?#t8 "` #l `@#l 8@ @" "㿘> #`#l "  `` ` 0 `Z0A0>㿘#l  8@ "ؐ  > #`f =0  > #Z 㿘``{ " "`f 8^@ 㿘 >  ca ``?> Yc ``?> Qc耠4`? "> #0>  &b&cp0  @P &ch`  b7>9> K;> KbԬc0$`b7>9> K;> KbԬc0`>   @      *@``D    <&b @> &b&b# D`@?; &6b > c   b   b @x?* @ @* > * 0&b&b 6b&cl& 4&ct 8 &> "lΐ   <@    ` > "l ` @& > >ٚb >> K! H ؖc&b&b&b&b&b&bȀ&b&b> L 8&b> Kc&b> K> K!ؖb `  #   #0$>  cl   #  %    {  0  % r  %> #>ؐ ` &c0cl "> K H&c0&c4@J X㿘``; 2 4 6  2  ! ? 0 ?  㿘 t 4(@% d4(@ th@?Ȅ2h@h@(2h@ th@2h@㿘 t d,  , t ( ( t(㿐`x􀠠"r> M> > M> M> M>("b> /"@&b&b&b&b &c&c&`p0 @O `p&`t!?'> ؒ L > "">   `p  &`l>  #> b `p  @o2 b `l  @ "`p>  &`hc`l> "ؒ&c &c؟ 2 > Ґ > 8 "В ؔ @ ?&cb b`l &cb `p" K&c > M> M> U"Lbp$> T0#@&b&b&b&b  &c&`p&c(H@N&`th@?4  @ * " `p@N &`h&`lhD?! 4hDbؓ* 4@ * 4gc`l€`p`l`p$|# &c&c&c&c &c 0X)@ `>  0M0 ٮ> P"> T> N?a"$t$x$4\$ܦk2c> aܕ*@ > !Ғ  > N#&`0&`4`0@H 8 4 8> N#&`0&`4`0 8  > `ڐ ` @"$ 㿘>   ^a !B@ (D (F!8႖ (Da4(D# ` @ @ `P``@``@` > !hf !B@>!# ``ߔ ` 㿘##"@【`#$,` @ ? > b`B > 0 b  2 +  2 (  2`(@**2 +22*`2` *  2 ! @  B >!4  $4  4  4  b@ @ n'" *#$*2 3 #&  n #@+`3 +` 4 @㿘 ( Ԕ {6 6 җ*    > Ԑ!  4 !! B`C >!>! 2 ! 2 ! 2! !`B  >!" #!!`B B>!>!#     (  * @&# (  ` 2`@ ?"@& & & @ x㿀#$.`!''2## 2?*`  2b @➐ &`@♒ &@  !`B  >!䀢 !> #p "5$#p   "  $#p x髒㿘# ?b#'' +> *@`@a  @0  `2 * @2@@E &*`@  2@:  &㿐 \`@%   9 d6 \ (ༀ` *  2*` @ *2Q * <# 2*` 2 $* h "@ '  $ M   $$$ ?$ A *  e `   @  *  2  %(  > !ߌ4ܐ,2  ; <"@@޻ <,* 2,2`2`@ ?"@$$%  `i e(ༀ` *  2*` @ *2Ö * <# 2*` 2 $* h "@ ' +  ( ( +  3`+  3`+  3@( n#+ + 3`@ 0+  n#@+`3 +` 0@  $4ҁ㿐H /f * ' # #€# #€# #€, h$@' ,  * *,@ n`$ , 2 , 4` h l"@ ' `,` `* `*"@"€ d @ #  @W `H 0  H 0 㿘H /f * '  > ގ! Ԣ x ;6 '  @c` @& > !y ` @ > "m Ԑ`6 Ԓ@D H 0 "x#`' 4 !"􀦠@> R`S> `  @ޏ* P ]0@   㿘<%6`6`6@ n&@ *#*2`@ 26`  23@@ 2`3@#   ``!@@> "8 0`@` ?> @ "P`> @ " 0> " 㿐## # #€b#  3@!#< &> D"؀!,!,& *@ b &  #$'ԑ, "    " 6  , "    ? " 6 ,  @ː*   n" *2 * 4` ,  " *`@    2 , "     " 6  , "    ? " 6 ,  @߉*   n" *2 * 4` ,  " *`   2 , "    " `  & `(`$& ` & & !  2` h $' `* `* `*   n #&"" "#ccc&  ?&*&*2& 0 n'֒"@ *`2 *`#$ 2㿘6@#6`<#! 6`" *` " ,`** ** 2`@ 6` n &@ **2# 3 c > @ 2 >  ܱ" 㿘#< n#$ *`#*`2  4`4"4 4 #  ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  * >  2 n>  x# 0J!$ *`*`2  4`44 4 ""ؒ     >  >  X#@0*,#   `k n#& Ԗ" * @*#2 6 3`  # `۔ "`@ 㿘  ͖ 㿘 H /f * '  a a, \ 6 \ `  U+ x!`4 \@ #$#  \ @ @2 \Ɛ \ ?6 \  @7`4㝒 x`4  \ @ @  H 0㿘 "& "   *  ,  4  Ԑ 駔  "   "6 Ԓa x  *@ *`@ `  `&  2 &#` * ( 22$  *@ `   `" *`0*@2@  `  *@㿐c   " *@@@> + @  2*` @i ` ?a ?#a* @   "" #!"0"@ &`є  ؀@ @  @  @   @  @  @   "& & ؀@ @  @  @   @      "  2 &q "  6q < ,   @  @  @  @   @  @   "  2A&E ה?    "& &`2  ؀@ @  @  @   @  @       &   @ &  ?B?<- &@   ?/o?0x &`&` &`'  -n   &`   .(``(8&` `  2 &` > G < @ 8&` ` &`&` ` $&Ѡ# U 4! b/ ,`@  2 *` ` !"" `@@@& 1 @`@& `@@@& `2@ `2@#$*` ?c 2@ۻ $,` %p%%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%P%%%%%%P%P%P%%H%H%P%L%%%%%%%%%%%%%%%%X%d%p%|%%%%%%%%%%%% %%%%%%%%%%%%%%%%%$%0%<%H%%%%%%%%%%%%%T%`%l%x%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%,%%8%D%P%\%h%t%%%%%%%%%%%%%%%%%%%%%%%@㿘 D""> > Ð#ct"  P 8"& 8㿘!@x"$`(a6"@ a a$`8a  @> 4`p$`<$`8?*   * >  "t> X`Ĕ@8q $a6"@a4> #`F> `6# *24`6 4`F4 `3, `/,`:4ځ㿘`` 2# 2   ` ?  .` ` Ѐ` "@  ? $  `    x  0@D7 & &`h> #*` &`|> #ײ&` `x"??`  @l#&`&`@ے#` &`&L wΔ  &`>  #a0 ` = `+ ` "@ ( `  `4 *` @ *``` * $` .an&`.ao.ap.as.ar.aq&`&` 0#\#`    @y  2`> \ 0̓,  S,, * `* @` " > @ L> E (> B 0aq ` .aq͐aqan`.an `, `" an`an0>  X $aq ` .aqaqan, .an , * `* @"`an 2#`an#`#\    @  2aq ? `.aqaq, @*``@*`an .an , ` " an``pan` `@ ې>  Ӓ0C> ^"&`0&`4`0 류`  "@k 8 0 ?耦'?2 '`@2' @-A 'at ǖ ``'@k" @-- > dc>  *@ `    㿐`0@շ > "h`&`&`L  6`6`&` l&` * "`2$`БH /d4`ΐ* %`΀  !> `Β   `΀ ``>  E``А 6`#\#`   @P   ! !q? `.!q!q, @*` @*`!n .!n!0 +   " !n``B!n`B`>  6`" @ >  6`> !`А#\#`   @   2!q  ? `.!q{!q, @*` @*`!n .!n!0 +   " !n``d!n``@ ϐ> !`А#\#`   @՚  ,    2!q  ? `.!q?!q, @*` @*`!n .!n!0 +   " !n``(!n``@ > !@ 6`6`6`.`.`ݐ<#6`֖``  }2 2 ? `А#\#`   @  2!q  ? `.!q!q, @*` @*`!n .!n!0 +   " !n``!n``@ K> 8!h #``Д #\ @P  2!q  ? `.!q!q, @*` @*`!n .!n!0 +   " !n``!n` `@ > ! 6`ΐ`0.`  `> `ؘ !```ܒː &`Ԓ"`> `ݕ: #\!`А#\#`   @  2!q  ? `.!qb!q, @*` @*`!n .!n!0 +   " !n``K!n`"`@ > I" `ݐ`֒`΀ ?|x`И#\#`  @  2!q  ? `.!q!q, @*` @*`!n .!n!0 +   " !n``!n`" @ n> "@fK6`?#`    2 " `Ԁ@ ~`ܑ2  `݀  ~  } ~> "`=H 00&`"  @*  > #xO 26`` @"$ 6`  `ΑH 0? 0 > T2 * " ` `` ( ("` ( ("`` `"`㿘?2 >  "T` 2   "T*  > "`Ԕa 㿘? 2 > T`2   T* @  e g@ f@U  m@"Be e@- 0  h@- 0y  n@0 e@g 0om H /d4 * %  I"H 0V  =!P  & *`` &E  "  ̐ 4 ?# @4 ̀2 3  - ΀ @ 4 % @?`4# @  `*  * > ^ `H@3$   @ $ * @>㿀?2 >  "T` 2  6M "T* @"G ΀  Т'  @g" ?'Ȕ@h "΀  )  `6! . @ ` "   *@$ *@$  $㿘> ^>ה H  xR㿘> ^>ה H  xF 㿘?2 >  T` 2  65?T* @`.  `*@2 ` r 2!?`, @ `?    `(@ 2  B @Ϙ  `  s ??< 㿀 L? @2 > `@"T2` "T*@   x &   (@ D  t& <΀  Т'  @g*" ?'Ȕ@gG"΀  "  D L  " D N& < N  $H DH /d * %  !n   @ " !n !n Ȗ ,& ,0& 00"@"0H 00-@  H 00 H 00 8(& 8 D& HH /d * % RH 0㿘@@ !n    @F "!n 㿘@ .@@@* `@ .@@  .@.``.`.`   ` `  ` .`a"/ 0"@ 0` .`  ``0   ` `  .` `.` P.`  .`  .` > c >"` .` 0t.` 0r 02 .`  .`  `ݐ?.``.` .`  `ؐ?6`   `ܐ?.` 0Y 02 .`  .` .` .`  .`  .` "6` .` .`0B` .`  ``0   ` `  .` &6`   2 6` .` ` .`  (@ң.`  @ @қ.`  @ ܴ6`  (@`  &` $@`*   = .`㿘` \ 02p !n ; @o  2e !n / `!n  ` 2!q!> !n "' 2P !n !n!q (!n!> !q " 2? !q !q!n  `ِ ` ` > ".!n `!0J , *  * @@. l     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!n 2?> ".!n!0 J@  ,`*  * @@ 2,> ʐ"0"0& 0?"L l 2`  2 * L  x`( @ @P @e D 2#D>  *#!n,`.!n - *  * @"`!n  !n &,0,&00 "@%"0&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 08@   A`0@  㿘.` h*   * `0P2!si !O* !s @ !p.!s`  .!p0<> 0M> 0 `@2O #>  c   @ @ B ##( * h2 *` h2 * h2 *` h =*  h * !o  .!o0> 0P>   `@2 #>  c   @ @   @ #@㿘!p @ h B B  aɘ ?  B   `  ? @ ? ``?  @ 2!p- @!o 8!p" @R !p !o .`*  * @`!n "    "!nx  Ţ  @<   @@  *@  =  `Ӑ ` *  h*  h2`* h2`*  h2`* h*  h*`   h ? $   h `  @ "$ h `@Р > Ȑ#h h *`  h ` "@ ?  h ` 4 > ## *`  g 㿘!n` > #Ν  h *`  h ` "@ɐ ` h `` ? v   ` ``0` `2m !o?.!o"Y!r&` /   + 2`*`  +    `` ;`0`"`0J "5!qF  "`<`08("8`$`0*` " H`0`,D@cP @`0`8 0D Hf# N`0!n!0`.!n `*  " !n`2 !n !q .!q` `@ &` ?  .!r!O*@ !p .!p   4@( `2 !p!n "!p!n!p!o!n@!q@ @ ` > #   > !(> !> # > !ސ 㿘`)!p % h ` #> !!r!OJ@ @ !p.!r.!p۔ P "1` !p  h `"!r㿘 h ` @ `  @> !` ͟ ? > ! @͓> ! X `  *`       ǐ @ĕ-  @ !o?.!o 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @y 4`   @t  @W ,`  ` a >"@,`  (@$`!r ?  `.!r!O*@!p.!p/ M   ` "9 ?`0`A 9 ?=   0`8 ($`<$`8 $*` $`H$`H ,`P@b`D `D 0`H`8"  !n!0`.!n `*  " !n`b!nM  @$ !q`W.!q  @$ !q`.!q 4 2`4 㿘     > !̫  0  L> ! ` ̡`a@  @  @  2> !> !  ` > !`  ` ̇@̂`"  @ > !y  > ! 2> !> ! p > !m 㿘` ``?` ?`@&`!q .!q`?&`!q?.!q? X` V `$ + ` `("  @ &`$&` &`(``   @̆ ݦ@́@e ܠ@a@.?- ` &`  `.2 *  `@.2  .6```Ԑ ?6 ` ܠ" @S. `@4 . !r 0?. `  `` < `&`@2( ``4$ `&` .2`*`  .2  .&`!r ? .!r !O* !p`.!p  (> )cH ' H /d4 * % !p!O!o!n g!q!0c H 0@ ZВ #\> ! ˍ @’ > !ˆ!8`!t7> ?)> !  {!@ - ?> !r!H`)> !  @j!@ @- @͗ ? > !^   %> !  2  ,  @@ @2   3 #\0P#`D  `40 !t7> > #ؔ6 H /d * %     `  @" ?` ?"`  @ ` " ?4` > ! ! ? d H 0 * @ #H > !e!㿈 ` {'> W *` €     Q Ѱ  ͑* R  ư     `ް 6?`!?> W *` € ` @7 `݀   * @ %6   @ `݀ 2   0 ~ @ `݀ x  2r   @_M ``   @_d0X `ȑH /d * %  #``АW#\`,`0 *  * @ `.  . !q? `,!q!q !n!0`,!n `*  "  !n`2!n   H 0 @_  > Wć* > !!> !!> !!> !"> !"(> !"@> !"P> !"h> !"> !"> !"> !"> !"> !|"> !y#> !v#0> !s#P> !p#x> !m#> !j#> !g#> !d#> "a > "^ > "[ 0> "X H> "U X> "R p> "O > "L > "I > "F > "C > "@ > "= > ":!> "7!(> "4!@> "1!P> ".!h> "+!x> "(!> "%!> ""!> ""> ""0> ""`> ""> ""> ""> " "> " #> "#> "#@> "#P㿘\ `& & 0& & & & & $& (& & & & ,%(%4%`%@%L%X%d%p%`%`%|%`%`%͈%͔%`%`%`%͠%ͬ%͸%%%%%%% %%`%$%0%<%H%`%`%`%T%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%%㿘 D""> > "Ƭ#pcx" P 8"& 8㿘!@a"$`(a6"@ aa$`8a  @' 4`p$`<$`8?*   * >  "x> ha @(Z "6a"@a4> "#`F> "`6# *24`64`F4 `3, `/,`:4ށ㿘`` 2 2    ? А@Pb@ @  p  0@40 & &`h> #*` &`t> "#ǫ&`x&` `p"??ܔ  H@\ #?ܒ H @  'ؒܔ  @\s H H@\ؐ H  @> "#ǂ`0@Ʒ H&`&`  g  &`|> #  `  +  ` `|@ " ``4  * ` @  *@ `  * `@ ` *``  @*`@ `  *`ڑ+ `|&```h 0&`&` 0 #\#`   @К ` ``2  ` " ` ` > #@ ֐> # > # 0i> # H``"> #> #  `> #  p`" `h`@ > # x0P ` > m> #` > # > # 0A"&`0&`4`0 Ø` " @[Ö 8''쀦'?2 '`@2' @` '`  ``'@[Ȓ" @L > raА>  *@ `    㿐`0@֒ > "`&`&`L  a&a6`6`&`&a,&a* *  | * @&` l&` * "`# H /d4`ΐ* %`΀  !> #`Β !Ɩ =`΀ ``> #! X``Т 6`#\#`   @    "   > #>!076`"@> #;!H> #1!`<#aa6`6`6`6`.`.`  }2 2  &`Ԑ &``Ԁ  `#` #\ @  2`  "  2`Ԁ " `Ԑ@`> #!x6`> #!`0.`  `> #`ܨ !``` &`"`> #`: #\!В> # +``܀``ဢ"``Ԁ@2` ဣ ܀@   `ů> #!"0``$ݑ+` |??,`2us`Ц#\#`  @.   "  "`@:> #-"H ``ڒ`P LH`И#\#`  @   "` ` " @> #"pRK6`?#`    2 "``؀@`~`2  `ဢ `~``}`~> #")H 00&a۔"  @  > "#h; 26`` @"$ 6`  `ΑH 0? 0 > 2 * " ` `` ( ("` ( ("`` `"`㿘?2 >  "` 2   "*  > #"`a 㿘? 2 > `2   ⨑* @  e g@ f@U  m@"Be e@- 0  h@- 0y  n@0 e@g 0om H /d4 * % !5"H 0V  )!P  & *`` &E  "  ̐ 4 ?# @4 ̀2 3  - ΀ @ 4 % @?`4# @  `*  * > m `@$$   @ $ r @I㿀?2 >  "` 2  6M "* @"G ΀  Т'  @Xې" ?'ȔR@X"΀  )  `6! . @ ` "   *@$ *@$  $㿘> m>ה   i>㿘> m>ה   i2 㿘?2 >  ` 2  65?⨑* @`.  `*@2 ` r 2!?`, @ `?    `(@ 2  B @  `  s ??< 㿀 L? @2 > `@"2` "*@   x &   (@ D  J& <΀  Т'  @X" ?'Ȕ@X3"΀  "  D L  " D $& < $ؔ  $ DH /d * % *@ H 00 8(& 8 D& HH /d * % CH 0㿘@@  㿘   0`@ *  `@.`` .`.`` `.`` .`   ` `  .` ` `א ?* .`  ` .`` `?.`   2 6`.``.` &@+.` @È @#.` @À 6` &6`  (`@ 6` 6`02 6` 6`.`㿘    `  㿘`  \`    > #  ` *  "@> #"$ D . l   $ $ $ $ $$ ($ $ ,$ $ $ $ W$ 0@G 㿘`䀦> ##L  x`( @ P @VD 2D> # #! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 08@    `0 㿘 h  4P t " @0S> #0%> #0" `2e`1> # #8$ @ `  X` А Bb@ > #> #&#@#` #x@E 2  h#P"; > ##@* h2 *` h2 * h2 *@ h * "@0> #0P> # `2`1> # #8Ֆ @ `   `@dې#㿘 @ ` |x 0 ` 3`"h`"  & @ ` *`>@ @u &   ?, *@ |*`  !  *  ,` "@ `  *" @@ ` *2    ` @D Ѡ` @㿘@ `4  hBa     ? @ '   ?  @ 2@ @@ ` 2@@@ `" h`@ 㿀     @ *  2`  *   `*` ߐ * ` *`   * `   `@*  h *` h2 * h2 *` h2 * h*`  h ? $   h `  ` " h `@0 > #t h b@ 2 > #ސ# *` " 㿘` > $ Y  h ߒb@  ?      |` ``0` `2M4"H4&`   *  2`  *` `` 0`0`"`004"*`,4 "`<`08("8`$`0*` " H`0`,D@UP`0`,`"! |@`0`8 0D H1# @`0&`` ? @&`4`? 4@ 㿘`  l, @" "   `2    ,  P㿘 h `  > $  ? X > $ 0> $# H ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @` 4 ` @` `@s , ` ` a >"@, `(2 `4 4 < ` ` ". ?`0`0 + ?,  `0 8 ($ <$ 8`$*` $ H$ H`, P@T D` ,"a` D 0 H 8" 8 $`?   @$`  @$`  - @`2S` 㿘     > $ p 0  L> $ ` xג`a`  `  `  2> $> $  `> $` `@r`p"  @j > $  > # 2> #> $  > # p㿘`@``` ?`@&`` ?0&` R` P  `$ + ` `("  @ &`$&` &`(`` ! @ @@ @@!9?' ` &`  `. 2  `@. .6 ```ؐ ?6` " @.`@o .0'`  ``` F ``&``@ `` `&` .2 `@ . .&`㿘 H /d * %     | `  @" ` ?"`  |@ ` " 4  > $   ?  H 0>  *@ 㿈  ' 6  0z&  u q  i  0c a  ]*  Y  S   @R{ `   @R0= ȑH /d * %  #`#\ 2    . . "    H 0@RX [> g * > $U > $R!> $O! > $L!8> $I!P> $F!`> $C!x> $@!> $=!> $:!> $7!> $4!> $1"> $."8> $+"X> $("p> $%"> $""> $"> $"> $"> $"> $"> $#> $ #> $ #8> $#H> $#`> $#p "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘``ʵ 2E > #`2@  ?2 &   24 > $ʝc 2- >"`2 & > $ʏc 2 >"`2   y ?2` > $zc 2    i(?  㿐`     &f    (@(0> > >P>Pf "Ēbؔ   ```````6`P&``&`X6`:&`&`&`&`&`&`&`&`&`܀ &`d &`> u> u> u"c<&`&`&```(> $f &> v> v> v x`ؔL&`&`쀊&`> v> v 4`Xf  > w> w> w `L&`&`&`> w> w ``&`&`M#f &a &af   a &a &a &e!@&f [  &f> $0#`0  f" &e> u &f&e&e  " eؔ @"` e u` !@&f> $#@d 4 ɪ  ?  `@ @ @ >'<  @ 㿘 D8 4& Db㿘& %Ѐ  `` "> $ D# > %@ = ` #!  &!! # А㿘&`%Ѐ`2" Ԑ 4 V 4 R 4 4 4 4 4 &4 4  Ԑ $ D$ $  $ >  $  㿘! > %l & ;!`7! 4 4&> % @[   @  `> %L X &  $ $ $ /@   &   @O  $  > %  x&$ 㿘!` 2!> %$ "> % Ȁ " $`   @PV $$ $` 㿘!! %0#cP'> %Ɛ d&    ` `$㿘@%  4 %? 0%?`#2``#2``2`` 2`2`2` 2` 2`2` 2`㿘!` ` %> %! !? &&  @3   3 @`    3   3 2 ?#ߒ @3 23 3 :3 3 3 3 @   *@  *@  *  Đ *  @*  * *@  3 !`&!㿘!!` ~%А ?&! ?# @4  "! > %ݐ!8@ ",!`&!! V `&  & "4!E&! $!> %/!X"@  &!&! 7  2   '?   @0 ? 2 * *  2 * ?c 2 * * ?# @2`*4 4 4 4 4 4  `* *㿘@ %  $ % %   㿘!`  `%> %!! ?&& ` ` ?$`<@ `"$`#$` `  *Ԓ > %!x#  Ԗ  @ *  *  Đ *@  > %!   *@  * *@` $`!`&!㿘!!` `r%В &!  ?$  @ "! > %ߐ!@ ",!`&!! P "@ 4 !> %ʐ!!`C&!$!> %5!X" @ &!&! 5 `   "> )cD&>  ?2 +@  2( > @ 2`(8 "8 > 2`+@  2 (<` "< > 2 +@ @`"@cD "cD$ $  `* *㿘`` Ɵ &> ƙ"@  > Ɠ"P > ƍ"X > Ƈ"h > Ɓ"x > {" ` `2  > "   `& 48@  㿘4` > 0"0)> ,"> &cxHH&c|&c&c &c&c&c&c&c &c$&c(&c 2&cp80 @$ &cp> &ct @ib ! А@Eb@6c> b@Z &al8 *>  <@%>  @@ > > "  " > "x " > " "  > "P 2>  > "@ " &c> "P 2a&ca @c|bh &a&a .a @&a "$6c6c6c6c6c> ɐ"h > Ð" ,> {a>  * ct &a&a.a 8 W  &a> "`0y!!!6c6c6c6c6cD  @#<! 2!!2!> {acx&c8c8 `@]&c<a? 0 &a` c  &a@&aah`&ahb 2   'a  a` 0 _ a` 0a   Pb 2   `(0 > "ڔ  @  b 2   `` @   㿐V#> #p` ?` 7  7 !  ` `7 7`  &@*` 6#* #p: * 6 㿐V#?#p ? @ `2 *`@ 7   2*  7> z!  ` `7 7`  &@*`6#?* #p: *  @ `*`2@ 6 2` #R ` #p2` #P ` #p 0 2` #R ` #p@?#(2 2` ?#R  `  #p*0 ?0 㿘"` 2 ! , * "* Vn &"T@o! ,  Vd@e&#! ` !@ 8! VR  &"X>  N#0@J &"`>  D#X! ` ! 8! V3  &"\>  /#x@JΔ &"d>  %#! #!  V!#`0" ! >  #@J !`4"@ ! `2  >  #ɰ 0 㿘"`$* `"X ` k6> #  `  @J &`,m e` #* @"`>    $ ! "X*  @  #&>   8㄀` ` @K/`$ &`,; f#* "@`(   @`6   @6&$@&  ,`,@`$ `$` `$`,`,`,@,``$ &$& 6..  g. ... @㿘`(>"`$`(` " |#* @>  X p#* @k#* "@> #``$@J` 㿐!ؐB! {"X*` €>  <`2> >  # > c*'@  o(`` % >  >  !' 8>  `> 8>  ' ? nN&`> !l > ސ!( @B'> > #ئc,``@2`> 2` ??̀ > ǐ!8'@- " `  > 0> 0 ?*  ' n `'  n `!H``@Ǒ,`&`㿈@> 6` a!X `J6`6` 8 ? ` <` &  `4& > {"p,` €, ,  , * ,%  %  @@ِ @ ,@ @ ,@ 0`& 0@i @ ,@ݔ@\ @Ք ,@Д@vO @Ȕ ,@Ö@   @ ,@@      p. % W "S% O  @@ ,@ 6` 6` 6`  @ `@i  >  `  > #J p. @ %  *% , %*   %* %*`%  㿘  ,@,``2   @@_ ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @n``9$`?  @    @  b #   `?$`$@  @> ` `" !`$`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@p   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @z&  㿘?.@6`2 `*  ?  & & & & @c&  `2  2&  & & &  ?& & & & &  㿘?.@*26`6.g<  & & & & @2&  g 2&  & & &  ?|& & & & &  㿘?#@#@66/ *6`..7  @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` > 0 > 0=Ks  2!h2 &@` 2&@  &`& ?&@㿘/ /` (`67`7 @20`0+#" "   &  &2&  @@@&&&& &&&&  0    `?㿘@ ` "`` 4` r"@@ڐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2> Z!x8 @`@"` ` & u "11 #`,`1?*@㿘@`* @Z >M'@2`&J  ="@@E  `@2 @ 5&  @& ! @* <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ 㿘 > > & &&x&J!㿐   ,@ ,   @ 2`@`  " 2` $`  ` ` ` `'``  (`) , 30`1  @ 4 @D    (`) , 30`1  @ 4 @D `  (`) , 30`1  @ 4 @D   (`) , 30`1  @ 4 @D( # (`) , 30`1  @  4 @ $`$`$` $`$`$`$`㿘 `   `@Q       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! 㿘`  &> ʐ!`r   > !# ####1 `_      `?    `$`   ` "(+@+(03@3  @ 0##### 㿘` ?    ?`8#  ?@ 7`@  6`@  .//@67@/`@ .`@  670@./@(@!#####?   LL        9F (fɀ  ( 4("@`> c ) !> "@!>  "(> $ H,"0$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`> А"d"@>@"!> $!e !!@&!@C v > @ !Ȕ  !> @?@Ӓ!ؔ 2> !@Y!؀ 2> "  > "P$?> " )> '> #?P,  p҂@` ` @;`? @ ,  p҂@` ` `> v#@'?p ?p "> @ΐ#P  @@#` 2> _#h@ #` 2> W#> ?* > "#|"c  > !l=@`?P ?P*㿘!> #@!> "0` #`@ @"0 @ L -}#> )[ `AL @` '>  L` @ / 2*@*@L @%? `L , : ޒ`L :, L?$`L  / , L  /2 ,$`, $, ",@L / ,@"0 @ ` (L - #> ) L c"c@ d  a c@  sc@  $c@$$c@@Bw L $c@x> )#H> c ' 2N`> "##H' (''ؒp`J@ ,#`hܒJ@ ,#``# N@ x>@N` d2> > cؒc] > ,?& & & `",  N`>  H ؒ?,& & &  $,N`> N@   4& ,& & $  i l'`sN` e#`s>  c!> ",?& & &  $",N`> N@  א  ",& & `& $",2#HN` d t r2#H>" ">   >F"& A>> c !> ",?& & &   $",> #`> cҔ !> ",?& & &   $",> `> c !> ",?& & &   $",> ` ",& ؒ`& & $", ">  >  `LJ 1ܤ :  : N`> N@ [ ,& & & ~  f@N` d`l> `@ z> ",ؐ & & & h#",`l!`sN` e`s> `Hc !> ",?& & &   $",> `PU ",& ؒ`& & F$",2E#HN` d t r=#H> `H> !> ",?& & &   $",> `0 ",& ؒ`& & $",N` r  >  X N@>  ߐܐ ,& &  & $,#H >   `㿘>  pN`> %> #> !>  2   ` ``az  N 2 > r >   、㿘> #`,> "0`'> b@ "> @  >  O `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘#> ` !> >  # $`#. @@S > )#@d> > #+> `)> -> /> [1> >  ` `=> !!<`/`$` *>" @$ @`$``$R > >  cX*: * @*` " R    2`2 > 8 ' > b ' '> "`h> '!㄀  @> @a8> ϒaH > !P b0@b0  xx"@'' 2> ! M ㄀ E H o@H/ /@(@6FH 0& 㿘> Ȑ#> ",`> *`#@ ` ``@㿘> !㿘@#@#1> '>  g#@e#耢 "##@##@ "@V .,@#㿘`>  ! 4  0 "> > !ؒ!>  4 !ȁ 㿘> #؀ 2 &#@ 2&#> m!㿘 " !> "@H @o " 㾐> )#H'@!> b@!?#> @a8  a8@> b " @O  > > "0   > > "X & &@ &  ,Z> b @ ? &   > > " <  & (>  b@ @?" 9 %> @Ƞ 0 G  +@4  > #> > ` x  *@ 4 " * @" # , I)    > > "ؔ6 <  &!0> >  , # 2? " ? @ c #H > #0㿘`7`?P> #` >"!> > `"0+  > > @Nb!> "0, >  p"0㄀ 7 @!D> !H'#> a @!D> > #Ēc'''a  > 9 x> #8 #8''ؖ  2'0> >  #L㄀ )@% 9> -> 1> 77> > !H)> '> !8@  @ʒ!D'''' @ !80 9> -> 1> 7> @!D> !H> '''' 0` `LJ`> > ""(`@” > "b(@Ր_# &>  #'L &)> '> L  :'T  L 2L `Q㄀ > > !8@  @k> 9aH 9> b@a * 2 '  > `> ` > ` "``  > H 0+> ' @Z ㄁`> #`& "<  "<@ > "8>  ''' %> "  ' 'ɐ耢 "#;#? 3> @#` > c >  @ #> a@? > b@ ( @~`Р >  !ߒ㿘> #`> 0 >  $>  $$ N!8t > "0  " & 4%> !`0$" >  !PO Q>  $$  B > !``> ! Ȳ @> c > }!> 0> !> "p!P 5> )`@ @   Ȕ >  $ $   > Q!ڐ"㿘> #`> "8Β > "0` €>  0"` 㿘> "0`€㿘!> #˖ ?" #.㿀!> )#H'  #H > "㿘> "0`€㿘> "0@€㿘i > a8> "  ސ > > ΐ""'> %> | #> !8@; n  g ǒ 2 ے 㿘!> "0` > !" `@ "0@ 㿘> "0`€8@ 㿘> "0  8 |@h |€0@(> )cH>  "0'` `  @ >  d  >   d&@&  @ cH cH > -#X㿘> c? > 0 x"@0 t@㿘> c? > 0 x"@0`d€> #㿘> "0`l€㿘 " B>  `#  >  ` X 2> # $`  N  s# 4@ #@ `#  # 2 @N  s2@( @` `"$ p> )cH> =!0' >  n@@ > #  d ```K 2`H > ~#Ё㿘> #<x> ""T@>" "$>  "bP Т@ Њ@@ Ъ@@ >">  㿘!>"P@1"<"h@-"T*> "$* > ""T> "P Ԃ Ң  Ң Ң> `> "" "X㿘!>"P@"<"h@"T*> "$* > ""T> "P ւ   Ң  Ԣ   Ң  Ԣ Ң>̐ "`"Xl  pК@ `к@>␒  "p"> t 㿘>" "$@> "$?*@ > > > ""T"P"bĀ!#>  @   ֢A@ ֢AЂA   @O :>"`!$ >b  "b>    :`㿘!>"P@"<"h@{"T*> "$* > ""T> "P ԂԢ>b<bD >  @ 6>ТA@ @ >"T"\ @   آA@ آAЂA    >"b㿘>"> "$> *@ > ""T"P ւ "$ >  @6 آA@ آAЂA    ֢ >"bʐ㿘%><P@T@ h*> "$* > ""T> "P ԂD !>  @ 6>ТA@ @>"T"\ @   ֢A@ ֢AЂA    Ģ&҂@@" >  X >"b} > X >   > b : b  Т0 (8 $ Т> bX`> "`* * :`>(8 $ Ģ@@ > X> ㄄"* *`* *`:> > b : b  Т0 (8 $ Т> X>  X` Ģ0 > (:? $ Ƣ?㿘%> <)> " > X@`4 "@*"   .? #"  Ҧ?0(" ,? $ Ҧ?0#@4  6 6 | `?0:> >"X(  $:@  "  Ģ` > bX`> "`* * :`>(8 $ ĢB@@ > X> ㄄"* *`* *`:>(8 $ Ģ  >  > >b(X:b$? "X Ģ? 㿘㿘> b >  X %> b @ @"46(.$,? "$ ԢB?@0#@4  ?6 6  `?0#@4  x6 0a  Ơ  Ơ Р㿘P>$>(8   > 2> 7 o ??  Ģ> 2`  ? @0 `( > 2`  ? @0 ` `?>  *  㿘8 X X> c@ &X J+ E (+$ L  < x( $ 8$ D@ " P- <6"@2p @R"@ < @ C  @    ;   8 $ 8D㿘( P$ L@P    < x( $ 8$ D@  8 $ 8!㿘" @`@ *  " !W &`&`X&@"&` &` &`  &`(&`$!&`,!&`0!&`4!!`p `< @ B  &`8! <@ 6`p&`< 6`r!6`B! &`D!> 6`H!6`J6`&`&`  !` 4 $    4 *0  @ B $ , @ ,  , 4 ``ݠ a 2 " 2 "*   gG#ꀢ@  Ȓ  @  @`@  > gG#뀣@2T !  @  @`@  2F > "   aG 4 $    4 *0  @ B $ , ` @ `,  , 4 ``ܠ  gG#뀢@2K6`  Ȣ  ؖ` ,`* * @ `2`96` 5 " ,`,`` `*@      "``  ` ``6* ` `" *  * "* * * * 2`ް?6`~`p6` `< @ C  ̖ 㿘 ("2  , "  0  @"  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`6a a%@%`   B   * 5   @ >B@ǖ@5  @B@%@%` ת`6"6a !`%@%`   B   * 5   @ >B@@5  @B@%@%` ת`  a`b`Ț`ؘ` -( +@ 3  gG#&`@  @`@ &` @6a@`@ 6a **`@ @   }4??(@  ?㿘@2  ?`" ` @O&&` <* & 2` x> )#H`'l  ! 2` 2cH2`> ?b  @`cHu2   '耢 4`H*   '* ?@ C cH2` *`: '2`  ` '䀢 4`H*   '* ?@    cH4   '>" >  hX!L쀤`2 !L * >'ؐ* 9$  2  '؀ 4`H*   'ؑ* ?@ܔ  cH`` 2    $  4`H*   $ * ?@   scH`  f`ؒ  ]cH T @?77ؒ KcH쀤`2 !L |ؖ "2   * !L"@!L4cH 2  ؀ * * ؐ " `H  n cH` 2    * *   " `H  R  cH > w- 㿈;  2 2  2z M2   ' 4`H*   '* ?@  ^ 2` *`: '2` `  '쀢 4`H*   '* ?@    `5 2  ?`; *> €& # A쒒  2   * *  " `H  Ɛ `    `? @   "@ 3     + `??'  $(,048< ?ݔ@         3  + ` `2j `? 3 + ?# 3  3  x> )#H'`    ?'/?7 ` ' `'  €   €€     &  (  ?# `"@   & 6    `  .   ``? `?'             $  ( ,  0 4  8 <  `?ݘ @``             ``       ` `     ``  `6 `  ` .  2h ?#6  . ?c6   6 H   > u 㿘 >  >   `> +>  "  > c   "c> !  > ""㿐!>"''€ 2 !> > !Đ!H]3 !  ?p> > !pS> Ő"㿘> "   :" !> => b $!X> "X  ; " > b!X > a @ > "b""0020""`0㿘  00 2020> @"`""0㿈> "Pp*> "xj &``&` > =X`ϔ` H/` /> c: > #.   @  > "E   > > #`5> c. ㄐ!`>"!d>"!" ?.)  :  @? (R@> ?).   (R#\#`#d > " > . "@`H 0x> c. !6` cH/` /> c:  > ".  `> "p ` > H 0U #`2>">"!d!"# )@  ;  @?(R@ q8?).   (R#\#`#d> # >  # .   " '''#  N@@'@` c *@ $cH 0 㿈> c> . !`>"!d>"!" ; ?).   (R?'H/` /> c:   H 00  . L@&  `c *@* > #%c"H 0㿘 @> *`"p@9 㿘> #`         H 7ʔ  ,/ & <&& & & @H/` /> c: > #,  ">  @ > #X> "p, @?H 0㿘H/` / 8`!> # `& 8 <; #  l @lHo @*$@` a @v@,/ \I  U lul 㿘H /:`@ H 0.  &s &s0&s0&s0&s0&s&r&s0&s0&s0&s0&s0&s0&s0&r&s0&s0&s0&s0&s0&s0&s0&s㿀!> #  > "cx ?H@ #`?H?L>  > *> "c#>  >  %> "> *@ 2`# 0'  |#\#> >  b"Ѐ??$b?!> 0$"@ 4` #`"  #\#d ?ؚ? b> #b> "!( > `""> ސ#ؐ "b" b@"> ѐ#>  #\   > "b> Ð ( >  P*@ F2`㿘ٽ!H!D "!D`@ʐ " ?   ? !P   $`!P ?&!P!L  `#>b$b7 *&!L@I P$a$= ?c$$$,$ 8 `$$$H&㿘`(  >    -0 -03> b[b b : > a0#> #[Ґ> 0 (H( `H`@'@`@ *@    $$( @'H'L8>  D?P@ ? 'P'L'T@'X'\'`` 'd`*'h@'l`'p`0't@   0'L'DxTD"?@'] H  ?@  S2 < *@@$``$`H$`$`x@'7 S @Ք "+ !H$ < @ * ## # # # 0# H؀  (a( a( ?"a(?" @&!?㿘>  `", +> H> ) "#@> 耢 > 0`> *!"3"耎(> Ԟ pH/` /!> @n> А"UU ` "> > ߐ @u> ֐ > Ր > Ґ > ͐   > h s*`  @h d*@  -*hh*@ *h h㿘>  0?(3  `*`> !<"  *  `> b ` ?,@"> `b,  * $ $> > "b">   p㿘> c@> `0?> "`%>  >  0? 2 2 >  ``!> `0> 2  *<"@ `*` >  M!8?> > G!@0`0`2` `*`" * >  :8!X@"h@"N> b `?* :  > D &!`> c> ? K dI`  > " =`  =` D>  !h ?@ 0 #/> 7> "@ 8> b @ p5`@p@ > p`0@p> !@@ 4  D@@ آ> "- €> ̐!x0> Ȑ!0> Đ!0 > !0 > !0> !㿈> !> !`'> %>  0 <  $ ( ,#\ 4#` 8#d 8#h 8   4@ 4 @ " 0㿘>  l 2 ?x# l ` >  `8@ &>   8   l& @?@# l > Ր"X2 > ϐ"h > c @. . !> !l`  &@㿘@R  㿈> 0 `"> > `8,"!> ("!> "  >  "#\ #>    > " >  , #    * @>  0c <  $ ( ,#\ 4#` 8#d 8#h 8 2 > #P㿘N@  t> 0``> 0> Q#h> ِ#x0 ֐#0 0А#㿘H/` />`0``>  aD` $` H p@㿘*` *  D`   2ג  > " \ """" """$""(", 㿘4q 㿘> #㿘> #㿘>  㿐> "$`@ `.@   2     h2 $$ #\#` ?  ߚ  \' ' ''  " 㿘`>  0` ` 4' 㿘> "$@">  P> ߴ.`.Q㿘>  h&{4&{&|&}h&}h&}h&}h&}h&}h&}h&}h&|&} ? 0        㿘? @2  `@, > `x  #>  x x`$ x!`bR  x  x!> " `$x> `> 2 $"" 2`> M  ` `   ?` ?&@ &`> : @2 ` > !x*` €` @ > " #> `, >   "Д !> b!؟@ `  `"@ @8b Pb !@_@ d`` ?G#@> " ?H@ @   8 %>  <@ `>  T@  2   "@ @8  @ 8  @?  B %` ; &`8 > #` E` #> bĀ '>   1l $b  @8bP `  "T@? @2  !>  x  xc $ x? -*`" "" 㿘`"@H "`  @ > >  hؐ "@㿘`"@H "`  @ > >  K "@ 㿘@ > >  =`  "@`H 0 >    㿘> "0 `"  @ " @  㿘#  0 & , ?㿐#@2> " &`> `|@ > "@ > H/` /]H p@  $|> "00`''@İ   #@P@ 0c@c@p 0؀` Ho o €H 0 @` &  0C 'Ho o  H 0Wp`r\  U |Ho o  H 0 @2b aC`E/ 2VHo o €H 0@ @ $&  ,4"> Ho o €H 0> `& " Ho o €H 0> " |& "1N  1H &\&\&<&&H&(&0&㿘> "Ԑ@㿘&> `> 5>  Ӗ  >"` @ ސ @< 㿘> > ` H㿘 `#҂@   ? . %$Ң` ` `? 1?` `?1?** ` `> ?.  ! g  2( $(@2  ?(:  㿘> !ذ0 Ҧ`z>   > +              " "  " "   㿘 @*`   `  6"@ @:"@  *K$ @$> > ""@㿘> !> "#   d> " dˤ  d  > ސ!P> ">  >  "(`h , @ 2@   > > " `d@*@`@  2@2\  `㿐> #쀦  > b(ʠ6? * > "@*`+   * < 㿘> #  > %?> /?"`<" T2 > %?> /?"`<" TK> !1> 4*` $* c`⌀`@Д`> c @&>!Ԡ?  +> )> "0a? 4"0c @2 4  ,  2" @ *`"Ƞ? > " Є Ф? *4&'㿘!Ђ* >a  à    ҢЂ ```> 0 > 0>!> "@!p> !@>!a à  㿘?. # , `$* @҆ ` (  .  )> ? @ ` `*@*    * ` `+` {?  ?*  @   " Ǒ, 㿘?.  @,  ҆ `   #  >  ? @ ` `*   `+  z?  @    t"@ ?$@㿘?> !ر.  > > ֆ    + `@  .`z`8 #`8PpN  ? 㿈> ##'L ='P ` "`" ?"@# # #  "@& # ` # `"&`> #,>  \",0 "04 "4L *``$ * P *@ 2`L# 3 3 > # #> "  2> > "!؀2> #` "`" ?"@$ $ $  "@>  \ & > # 4 0`" 0" 4 * @ $*` `2 > Ɛ#0* @'@# > #`@@ ( >> ㄀ 2  "Ң>Ь@@>" € > c   . * # . * > > >    "Ң> Ь@@> ㄀   Ҫ`  Ҳ` > "Ⱥc> ??"cL/> P* *`''+>  # @  @ @[?  * "**  * @`<<` @" @$  ۦ >     * *`:  c Ԫ`c c   *`*   *`* :`@Բ@`c  2 ` "` %  ? "$ $  @$ `$ `"@&``$L@ *  @ 2`P$ L4 4 㿐> .`P"* @`*  $* `> #``** @** <`@> #`` Ҫ`  Ҳ` > "> c"'> +> 5> @#   Ƕ?  * "**  * @`<<  @"  ޢ@``` "` & ` ?`"&`&` 2> > ## ` *`>  !؀2`@`"``"`> " ``?@"&@&`c0?"0@`"``"`> "#`?@"&@&`c4?"4&`&@&`"@"c`, "`,㿘 0 6`+   $* @6`` ?*@@> > #  `6 І@ "1?0/?@H /f * ' >  ɐ# > #`Ԯ@`> Զ@`> > " bЦ@`@ H 0 㿘> #` 0 4H /f>* '>`   @#@ "+<`@Ԁ@"??""`> "">aa,` "b @ `   `0&`44#@& F&  @>"П@> #  $  >  # ?> `    Ъ`   в``? 2 > ,,: $*` *  ӰH 00 !>"؟@ ,,`!:   z"@>"П@ "Ң`H 0㿘#> > 8#c &"#>b؟ "bT"bП "Ң` Ԣ/>% @>"`  "";c ">@>"П@  Ԫ@>>&c   "Ң>Ь@>a$"a㿘H /f4 * '    H 00 @  +>  2> Đ#4 *` $* 4   `?> #ؗ*` > # `@  2c> # 2< <  | *W$ 2 ?#?#(H Ҫ@>"ğ@` @c > `Э`c`е`c> `"(<  < ?,`6@ <` @& @,@ c 2< <  | "@    $ " ?$ 2{ @H 0㿘bH /f4* '   H 0b  @ S> ??" c  4`*` $* 4` `?>  *  > c "3 Э@@@@>"ğ@@@> c  Ԭ`Դ`㄀ <`  `<` `?,@ @ 6<   @2%  @H 0㿘  >  8- *> c   "> & # &   & &    & *  "&  " &  ?@& !> > #`  "` > { H 2  2 "ϒ      > "T    2 #`"`  & c㿘 ` ` > c` "` & & D& A& >  c` "` #> "  ! ## `& 0 c> bT #c "!cD 2>  X""" " " &㿘~H /f4 * '    H 00P" D??#c` `> ː xe ``((@ "Ԣ>bğ€ Ң`  :>   @& *| `  $` "@` ?$` @`2`"H 0㿘}H /f4* '   H 0B " 3 3>  2` " Т@ pꢀ`  2 `<    @>"ğ@ p` ?|2% "H 0㿘  > & 8- *> c   "> & # &   & &    h& *  "&  " &  ?@& !> > #`  "` >  H 2  2 "?      > "T    2 #`"`  & ˔ 㿘 ` ` > c` "` & & D& A& > #} 2> >  # `"  ` 2" `  ## `&   > bT #" 2 $$ $  $ $ &㿘| c  "" @"' %>  c ХЬ@ğ@  2 c  "0@H 0㿘> #!> $" v" >  c: > "b@Þ@㿈> #'D'H`'L`2 L>  "">"`>  "bL> "c > aP3> &`0#> a> "al%> d> "c'> > "`X)> "> "c+> c> "c-> > "`4/> h> L"b> > > > > > !> > ?"a!c(Оx!5> 7> 9> ;> > > > ?&H&'"'b ap!""  " 'L " ">  > Daؚ 0`k5> *+> -> /> 3> "$ ,` ,`@ *`  ?2 ,` HL>  > cL> *" * "`P@5!>$!&ئc" %c" %\" %\>    ,   &b'b"`Y> "b> ?""%!Ԑ  @  $!  %!Ԣ`@ & > "0%>?"> #c "?@ !@'6`<  <  ? > b $>  `\'>   `? D4   D @  `?D`@$$"@&$$ "@&> `0 "`04$`4`? %@4* @ 2` > " *  8@ # 8  - > b  > "ȓ* L   > " "  Ҥ@ >> > #c4$$"@",L ", >!Ԣ @ 60 > " + @@ > > c  #` <   '8   ?Ь` д`  怠 @  Ԫ@> 3> a#+  c> "  Є Ф `㿐> > !bp1> & H> "/> > %07> `&> "89> > '!p;> b+> 'bb> -> " 4> > > > #> %> '> )> "b̘"> ̞#> > > > bd5> > 3> &#c&c al!# X "! !> !" +"$","(@˒ `>  0@> +0  7> )> ;> 5> * * * @ #$a ?"?*>  > c#>a$a* &خ%@> " $aԮ-> ؀ " , @G}($az %#ܮ%@{ 'bܮ%@t &t @m%- '#> "`8 $(: $,`az(  $abܓ-@-*``$k`(-@ 2 @ cz@% @ 2 -> !H> - 0@$@-  , - tѐ 2 ,@  z@$@?ab;> b > ""`T> "b?> "">&Ԕ  "  &Ԕ & &>?!>"a@"a> > 3!ؚa4 *  $@*` 4  ! >`*2 ` > c > `8 > > #  > > #`<  |< z>  8 ` # 8!>"  > Tc> >  8 "@㿘 "Ң"   $Ң`5!2  ?!Т@ $Ԣ`㿘> #`  > !>+ +y$ 2   #  y! 2   @ y! 2  ,"@  &!&!㿐> > # a`#\  x > #`!> "> >  ah$$  x#\> > #\!Xax!! xu 㿘> #`> # Ԃ@`>"`  >  8> ("@ 2@ @ 㿘> @ " #> al@@ 㿘  "! @@ @  "!++y & > # & & $&  & & >  yc & ( ( & ,   z@`>!c @z` & 4㿘   ? & @#j "㿘H /f * ' > c    "> ސ!    > Ր!H 0 "c#9 "c   >   > !x>  (z & ,& (  " 㿘 V> !؀>  4w> "> c  "0 @H /f@* '@' #6` ?`6` * ** :`* @ **  $* @ ` @@ #H 0#  "0@㿘> #> `!ؐ"0 @H /f* ') #6  ?`6  * ** :`* @`@** $* @ ` >  4@ #H 0#  "0@㿐. $* @@ / ` `  Ԫ@>  b `&2  >"Ȫ €@>b @ @O> #b@ D" 2:` 2 >"ğ@ ?  * "**  * @`<<  @" H /f * '  הH 0 Ц@ 8& 8" @@ `',> #`../ / >`@>!Ԕ > #> c  Ԫ@@Ю@`ж@`l ?, 㿐. $* @@ / `j ` f "Ԣ>  b `&2  >b   bȐ€@b @ @I> " >`  ?@* ` 8@<2'? >"ğ@6?  * "**@  * @`< > @"  ʔ?p` ?@*z 8?& 8 @ @ >` ,`㿐. $*  ? / > }ѐ!Ь 3 > > }Ő!c @2^> #`2>` >`  | @A> #b@ 4> 2+$@ ?  * "** @ * @`< "$@H  *  ʔH 0$@ 8?& 8> " @ @ Ǣ`-  "% ? -  ؒ "%   Ҫ@>  `&2  >"Ȯ €#>b @  Ԫ@> c   `>  `> # ` >`  `>` `?,@ @[> b@ Q> 2< 2>"ğ@c ?  * "**@  * @`<<  @" H /f * '  4H 0 Ф@> c 2<` <`  | " 8?& 8> b @@ @7-> #`/ ../ >`@  # > c Ю@`c ж@` & "% ? -   "%#   0@"& 0 4"& 4㿐. $*   / > |!Ю ` 2> |{!耢 " Т@>℀ > "(&2@ ` Ȑ€@  @I> " >`  ?*  `9> <2'` >"ğ@4 E?  * "**@  * @`< <  @"   p` ?* z 8% 8> " @ @ >` `2-> #`/ /  ". ! Ң`/   z!> v^!X% ? ,  " Ң` (.@z@[ "!XvF$㿈` <t ` 0H /f4'* '' `  H 0 0Ԋ@' ?'9>   4-`$* @ 4` ?> {"@*   2?> {" > , @  # <  |< " "$ ? - @ "%@@   `Ԫ@>bğ€0 Ҫ@# >  Ъ`c в`c> `"(< `< `?.@ֆ@> `"@{J: @' Ԧ@`T# 2>` >`  | @J"> !؀@2@>!Ԕ > #> c  Ԫ@@Ь`д`& ?)-  # c Ю@`ж@`x "$ ? - l "%# 8 `8`0@"$`0`4"$`4`8?$`8> #uC 2, && & Ҫ@H 0 㿐  0r Ҋ@'H /f@* '@ 9> +>  -/6`+ @  $*`c6`  ?`+ + `:`* @ > z"x8 "o+` ` 2`f> c c  >`  |>` @U>  " @ @J@ "  Ҫ@@A@> #'%@`$ @ $`$`(>bĐ $`(€Ц@" @@퀦@0%@c`+`2 Э`> 2 е`> cb `>`  `>` `?@ *@ > " Ђ@ Т@@ @@ @ t6`H 0 Ҫ@㿘r<> "  > a؀ .@  !!`  @6`6` `?H /f * ' +   $*  `2  > "{m H 00 > > "{_ H 00x +` " > c    > #` >`  |>` @ @Q*@F&@@@   Ъ@@@ @= 2+>"ğ@%Ъ@@> c    Ҫ`   Ҳ` ` >` `>` `?.@@ @.@ @H 00  `" H 0㿐` <qz` X 0H /f4'* ''   "H 0 0҂'x    6`- $*  ` 6`` ?> y"-  ` 2?> y#,`` " Ԣ>bğ€p`>`   ` ":`> x#(  @z 8?$ 8 `0> !؀+ - - !``-  z#> s7aX$ ` ? -`  " ("` (-@z@4 "&`saX> #s 2 ` ?& &&"ҢH 0 㿘> 0!ؐ> b` `p@"H /f@* '@g > #> 6`c+   $* 6`@ ?+ + :`* @> xe"x8 ` *@ `2: " Ң> b `@$&:@ %$*+> > # >`  ?@*  @ b ( $(` <2p>"ğ@p` ?@*  zb @@ޑ>` @ > H 0"㿘p;.> "$> a> " .@  > ` "`H /f * ' ꎒ " Ң<  2p>"ğ@p Ң`"⢀  ?` "`|H 0㿐> "`>`  L ,` @@ !> " `6? * > "@+ *`  * < !> "  ?6 *@ @ @ @@> !؀ @ @@  > wn#H@㿐6`, $* @6`@ ?6, H /f * ' > `# D@ 6A `#@   H 0&0n2( 8?,/? * > "@*`+   * < ]2  8  Ԫ@>bğ€ 8?& 8 ` ,` @ @c ` (> 뮐 \ >4` >  -  c?Ԫ@``Ю@`ж@`> " ?> "Ȑ@  Ң @ 8 & 8H 0 㿐n66`+   $* 6`@ ?H /f * ' > c   0 4" 2  :  & & 4    & 0 2" "N   "H 0 o[/>  %-  ?4, @@> "Ȓ "**   H 0Ѱ o7$@ , />  - > #   c 2>` >`  | &    Ҫ@@>b @   Ъ@@c2 ֪`> ֲ`> c`"(>`  >` ?* 6G #@  H 0 < ?s& <2' 8?,? * > "@*`+   * < *` 2 8>"ğ@ 8? & 8 , < & < @ @ !c   Ҫ@0  Ъ@@c2 ֪`> ֲ`> c`"(>` `>` `?.@@c 2>` >`  | $ 8 & 8H 0 㿐`,(!> " `|6@? * > "@+ *`  * < !> " ?6@*  ! @> !ؒ @㿐@?x*  `@`<@!> " `D6? * > "@*`+   * < > b  > > 6 ؓ*`"@ . "@@  @$ @   > u#p    $ "  $ "㿐=6#@> #t6`* @ $*` 6` !H /f * ' >`  ?@*  `2< ` ?@<H 00G2% 82`? * > "@*`+   * < q  "Ԣ>bğ€ 8?& 8 ,`  7` Δ/@p Т` ?@*`@z@ 8 & 8H 0 㿐l6`,  $6* 6`@ ?H /f4* '  " "   H 0ʰ m"$, $ 2"> !Xm{  , H 0 $   ? z@`掐  (2   z@- @)@> !XmV 2 $@H 0  , -  , >`    ? z@`c 2   z@T >` ?*` `C ?@<H 0˖ < ?T& <2% 82`͒? * > "@*`+   * <   >"ğ@ 8? & 8  , < & <  7` /@ " Ңp Т` `?*`@z@ 8 & 8H 0 㿐`x* `  ``> b(6@* @ k? * > "@+ *`  * <"> !ؔa "@>   㿘 p6`* @ $*` 6`g ?*  > #  @ B# @@  kT> #`2  "Ң0Ь@@؆@' 1> kC#   "Ң#Ь@@#   Ҫ`# Ҳ`#> `"(>`  `>` `?*@؂@ @  > #`2>` >`  | @  > "  ? + + @ @ &     $ 3 ((  3 ;  >  (> ㄓ2*@?+ /@" 㿘 <m & `㿘 <  _  㿘 <U & `㿘 <  G  㿘 < & `㿘 <  ߐ  㿘 <Ր & `㿘 <  ǐ  㿘 8> "(?4 , <> b@> " k Ф@㿘)>" 8 `8Ȑ> " `#4 "(`> 4 < Ф@b jܐ>"ğ@ Ф Ҥ@㿘>   8` %> > "> !ؒ $$!>" > 퉐> "  "4@ *   0Ԣ`z@!>  j"   0Ԣ`> ` z㿘>   8)> `8`-> +> !> "#> % "Sa &aؒ M%`%#>b > G> "  4 b,   ; b4*`   0Ԣ`z@` 0Ԣ`z@>  !>  jR >"ğ@   0Ԣ`> ` z> ` 0Ԣ`> ` z㿐> #`L " Ң B> "> !@  "4 > qO#M?  * "**  * @`<   H  C " ?  0Ԣ`|@<2> >"ğ@> " ð "0H@@ Ъ@@ A#> ;b## & > q ?  * "**  * @`<     2> >"ğ@> " ɰ  @> @:88> P" "@㿀> "` 0@* 48'   " #`#\#d ??㿘> #  >F 0 >Ң㿘 $H /f * ' #>`0  h 2b灐0 > c  "Ң0 Ҫ@H 0㿘> #> c * > c > k * > "(<x> #`  "Ң"  Ҫ@"#ʠ'> b `> * > c?$  ' # # > # `  * # # >  0#)> @$  ` 0@" D`4@  ?)> ' @$  ` 0@" D`4@  ?2' *> >  d5>    ?? @$  `0@" aD`4@ ޮ> c E> #  5> c  `> `> "Ȯ9> І' @$  ` 0'ܒ@" +ܦD`4@> b ? c > > c c  Ҫ` Ҳ` > `0  @"㿘H /f * ' > "$>.  > c  " @㄀  "Ң Ҫ@㄀ > !Ồ   H 00/ 0Ң`{. 0Ң`{㄀ 8>ք H 00Ф.֤>" €㄀  "0@H 0㿘!Hh& P 㿘!L>  #>" 2!Lh !Lh! 㿘!H<`` *  h P@<!H "  `   2 !H !H 㿘!L !>! *R &!L!>"2!Lh!L$"!LgД! !D 㿐>  b ``@ 3"`  j? @M Ҁ  j5 2 >  `"`&&> > #coے >  .  >  nE%>0  2!D> *!!D G$!H#  "'  0;  ˀ 05 "$'   0+ $ ** 0% H>  />   % 0 ) 4 0 .  0&?+?"` > "`> > #ooc'  )"! 8> !'o`#'@. " 8! 0>  @ "" 0Ho 8 "` sf " > "4`"!K !v 2'`&&     !L  >  * J!> cfe!$!L>  D`2 '    L!#>b g}!Lg aL$b "aL &@Ő , ! > ` > mL (H` eX @ , ` "$`> m< 8ef@  H` eA @ ,} `X``e8 @ ,t ` ?> m H`$`!P Ѱ "s' . > m Xg!L$!L  > n  x'   '   `'&& eDm @> m  `'&&  !P .$!Pmܐ  `'&&  (Ș!+w!`  0(!@ *F  !% ,!$*`H >"@ *&㿘!D` ` 2 x  xd @ 2??  @$` 㿘d!D" 㿐> " >`0`  "> *!Ѐ "> "`>  f @ @   @.1 2!DH/` /> >  ȒmЖ> lB!( ">  >'"䀢@C>  `2@!D=# > `y 1!D$!H  $@  @Ւ &!Hym `    "   @ⶔ , !D   ``H/` /> > !8mm > kߐ!('`4'`@'    'ژ􀤠'!*!`  0(!@ )U  !% ,!$*`H@ >"@ *'@㿐> " > 0``" > *! +  `` ` @ @`  `@  ` `  h @ " > b_ @"b$Ђ`  X#Ђy `@.  @`  @2IaD* 2> H/` /> > !`lɘ> k;!( `2-aD=# > `x iaD$aH`$ x|   % "  ("'aD   ``H/` /> > !l!> j!(&0&  &􀤠'a)a` `0(a@ (n  a%`,a$*`H >"@ *&p>  >`" 0 @ @"> > j!@#!D "> j!#@"!8> j"$!H, `0 3   0`0`4  > ̐ L   `8   . !8*` * +* T2؀$`H> jn""-`@  \bx*    @`2P!8TVI!8*c   @`2`4TC`4'' 0@jФ 02!8Ѐ&`0 &`4  `    @*@`&@&`&`!8 `,@`@@&@&`&`0&`(!`  0(!@ '  !% ,!$*H ` 2@В8@>"@*&@㿘!H" 0* "" 4(!`  0(!@ 'P !% .!$*H `   0   B  㿘> `@F 㿘> " ` .  I  > #8`2&@`6  &@> ` @%    㿘> " `@ .@ @> #8``6@   ƒ 㿀> "Ę`)> " #"Ĕ"   @ 8  : H/` / "> ?b@"#\ #`#`@0#d?"> b?b@"#\ #`#`#d@ ZH 0`; -'> %> #> 9> 7> ؒ " h"( > ㄔ* `'z  Дؖ @ b  'ܲ@ >b 2b€㿘> "$.  > # . z0> !ؒ H/` /> bZҖ > j'"HH 0>b b€㿐 8@2 4> h"p> `$ P" > & T 8 $@ ల@  @`#& P+> )> 1> !> bؐ >h\"x"`" '"В!ؖ @   @ @ 㿘 8@2> > h>""$ P8 $@ > !ؒ荔@> `~ T>& P& T℀   H D"@ 㿘> 0 !D aD`?H $`> *!Ѐ" > h"" aN!L>"  *b   *  !&aL!La;!%&aL% @ &aH`Ŕ P& H $"  &   `& & 0& 4& P$  " >'"h $ $ $$ 㿘!L  #>b2aϐ$b * *_"!G 8 !\&66&(!H P`!D!L`'>" 2!La !L`r!@hR!"(H ''   '#\#`#d#h#l ʔ !\ #\ #`#d#l#h   &`   * 㿘`=> 3#a :N.   㿘>  ` > )#@`@> h#@?㿘|? #> > #` 3 >  * > h > b0 #> > T #> bX P_ސ`H`P `_ِ!>   `R$ d M  `H$ _ǔ `_Ô P 㿘㿘> TF 㿐N `?#> " @ <=#: 86>  @+>  c\cz  "'`H #>  %> )> .```P`.`X cx h  <=# 8є''P'%$'%4'%X'%`'''''&t'&'','(x'(x'(x'(x'(x'(x'(x'''''''''''''''('(x'(x'(x'(x'(x'(x'(x'(('(x'(x'(x'(<'(x'(x'(P'(x'(d'(x'(x'(x'(x'(x'(x'(x'(x'(x'(x'%H'%l'(x'(x'(x'%'%'(x'%'%'&'&X'&t'&''d'&4'&H'%㿘> "d P @ > g#c ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`> - > gn `L .L@ ,2&`!/-> +)> '> L a p "gQ gK gG(*LL@ ؀ ,> g: 0L` Б* : `Eܓ*`> Ȑ! €> 4  >   *> 4  4 >  @4 >  @g `¤?>  Hg , >  Hg '?4 , > @ f H??,* >0b\ , >0bT > f P4 >  X4 >  hfْ `>  ଑* 4 | > f̐ xL`72x4 >  fÒ `q> 4  |?>  f, L`82c> f ^> f Y4  ` >  f P> 4 "0- > 4 "P | > f A> 4 !,> 4 >  f, 4>  Hf .>  Hfz ?(> 4 !,> 4 ! | > fl 8> fg > fb > f]  > fX > fS L > fL!L  > !fD㿘  㿐> # <`# >  f $\  #&a4&   /'*4'*<'*D'*L'*T'*\'*d'*l'*t'*t'*t'*t'*t'*t'*\'5'2'2'2'2'3'5'5'3'4L'4L > ʄ*            ? ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S " `% 2T K  (< 2 0B  $ 0`` o 2/ 0V     $ 0    0  B@ B  B 2?@ (?  0' 0 ,?`$ 07c 0㿀eW!8'`" '> @d  `> @d `@''  / @2+ !< `2%  0 2!   2`0  &`0V` `2 `0` `a `0`,?`&`07 `0 㿘㿀d!8'@> d2 `&@''' 㿘㿀``  8`  @ @ '?'A㿈d!8'@> c `@''㿀` ``: @'?''4㿀```@'?''%㿀` ``: @'?''g㿀```@'?''X@`' ` '> ʐ!*` €`''`'i  & 'Y4 4` `@'44'''4H` 1d-8'00d, `Z  |OZ  r @?'"谒 hZ  b`0 c8',,c `'Y $ LY  B谒 <쀢 9YӔ  3` $Y*`   N0"`@'|'xx~ | &P`Y $  8@ N㿐  `b{&& bbb 09 4 b~0b| - @ &*@ @ ?!*@Yl  2 "| "{  YZ  㿘` @ "S   ?M # @b +> ""> <#> 9   03" "> !> ( 2$ > "  \  $! #  0 $ 0`@ 0 ,?`$ 05 0':':':':`':':D':|';(';':'B'B'CD'CD'CD'CD'CD'B'B'Bl "`"` "`  "@ "` "` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 $&`4 (&`8 ,&`< 0&`@㿘Β ,&` 06`  4&`$ 8&`( <&`, @&`0b!8` 'D``` 'r'> ΐ `*` €` `"b'``]`XU'` "O'` "H'` "A' ' DbkD"@耢 9H@ DXR 20`XM T& ''DbH D"`X7 T 2HX1 D 2  㿈` `'`''˒㿈` `'`''y㿘@ 0  0 W 㿘 &`, &`0 $&`4 (&`8 ,&`< 0&`@ 4&`D 8&`H <&`L @&`P D&`T H&`X L&`\ P6`` R6`b㿘 ,&` 0&`  4&`$ 8&`( <&`, @&`0 D&`4 H&`8 L&`< P&`@ T&`D X&`H \&`L `6`P b6`R㿈``'`'` ''2㿀``'`'` '`''㿐``''~㾰ay!8`'`'' `at`` *'C` ` 2@  '~(耢 7WR ` 2/xe` WM p%`  x' p`  px'W7 2nW2 ` 2 } 㿘@ 0 o z 㿘+ 6`4&`, &`8 $&`< 8&`0V (&`D&`@ ,&`L&`H 0&`T&`P 4&`\&`X㿘 ,&` 8&`  <&`$ 0&`8 B6`( H&`, P&`0 X&`4㿈` `'`''<㿐`' 㿈` `'`''`!8`'4` &' <`4`` '`` 4`` &`8` V p 2RV < "`E'`?` >> ΐ *` € 'v耢 0` * V^ < #8[` VY p '쀢" ' "'  2  'H 㿘@ N0   N0Y b gp㿈 "``h耢 //77U  'M'M 'M'M('M8'MH'Md'MX'M'Md'Mp'Mp'M'M'M'M'M'M|'M'M'M'M'M'M'M'M'M'M'M'M'M'M'M'M'T0'S'S'S'T'TD㿀@'` '_!8'_ʒ ''?' U 㿀_!8'@> ^ `@'''뷒㿀_!8@'> ^՚ `'`@''럒㿐y@` U{ &㽀`֤$> ) #H`  ?'6@ `''7m7"@UW  @ `@"$`$@H > :*! x`Ƥ$> ) #H`  ?'6@ `  ??7m"@U"  @ `@"$`$@H > 9!8㿈 @ > `` ''p _ `0?"`0`,  0`0 ` " &㿈 \@ > `` ''< ^`0?"`0`,  0ѐ`0 ` " &x`2) `2`#  `  `: $( @> $?'''''`@*@ `@ *'ؐذx`?2' ``2` ! >  $ `( `@'"$'''?'`@*@  *'ؐؒذ㿐  ʒ A@Ԕ ; (`ϔ`<`   ` @e   0" 0`, 0<`00` "$` h$`  0" 0`,  0'`0 x!8^'L'> LܔL]R < @ L'''=0''㿘`?* `@֒㿘` 2`# @ `+  * ``Ò @!<> ф`( 6"> 82"> <."„*"> &" #" < " "> DD"> d"> ""  "> ,"> 4"  㿐@   2@ &@@ 2` &@`@''cr㿐@   2@ &@@ 2` &@`@''cz㿀> "  @ $  (  `  >` ' $@( 3  `* `  * `'##`#\#d ?x? > !P\0` >@ @  ` >@"@$  (] !8']  H'' @ [R H T#> 'V@` ` @\@@\'V4` ` @\@@\?''  2R˔ H ,V` ` @\@@\'V ` ` @\|@@\y'vU` ` @\n@@\k&@R x@    0D5 < 0?   *2 @ 7&\!8'ܒ \`*  : ? ?Ru  2  '' B    `&    $`$ &   `&㿘R > 2!Ѐ "   8  2 8 㿈@`B> ѐ *` €''t "&!<3` "!< "* !<   `8#&4 ` " !< 2!< !<`  &``''A 㿀` "`   N0!2  NА"@&  ` v`@'''Q̔  N㿘@ 0   0 N> )#Hp'@ZS  'p 'xN 5 8`'|!X  ''``6`  ''t 2 > 6`> c #@'    #*` `'  'tQp cH > 6L!p㿘@ " !<  " X} ?y ` &`&` X U `" L 5 8  !< @ 2D PL 5  5` &!T` 2R` 2N I *`:  2& P 0 2" P(` ` " P`2& 0Ho  "`&!T*``R`  2`2`  @2 &> ! * " X ` 6  㿘  &@ &` `$&`  &`  $&` ,&` 4&` 4&` `Q&` &`4  &`4  `4 &`4&`8`<Q `\@Y] @㿘  &@ &` `<>`  >` >` (>`  0>`( 0>`0 `Q&`8&`L  &`L  `L &`L&`P`TQ `t@Y. @> )#H!8'Zw'\\Zv!@> \ Y@'`'dݒ` PT!耢 2 hy`PO cH > 5+!> )#H!8'Z='\!Z<\@'`'dΒ` P"!耢 2 hG`P cH > 4!> )#H!8'Z 'D!Z D@'H'LH O!耢 2 PD`O cH > 4ǐ!pY!8'ԐYݒ Yْ @''''Oʔ  2'ܐ''. O     ' &㿐@   sϐ@O 㿘"` N 0  0`O  㿘 㿈`'`@''㿈@''' 2 8  㿘M㿘 4  Ԑ'`'_'`0'`0'`0'`0'`0'`0'_'_'_'`'` '`  㿈` ?^  2`  ?倢` > א#@*` €                   7 - 0찒  ܊0! 2` 2 > #h""`(@#&`, ?",`0?"`0`,  *ؐ`0 㿘 (@I ! 1u/㿘  R` "`(0 > #h"` 1 V  ?`" "" $ 㿘@WL >    ?: *` + +@   `+@@ &@ ?㿘@W- >  # ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P W!8`` 'W  W آM 25ȐDM "@( @> `* @''' 2 ȐM ؐWM{  hWs!8`@ '̐Wn  `Wf MV 2/ؐeMQ "'" 'А'Ѐ 2ؐM5 WM0  HW(!8@ ` '! ?& > ,`  b"P  h`a"`~ NUdEu N@"h!p N   *@':'V V `'А'''@U 'ؐL۔ 2N  R ?&D LĔ = а 9&*@'' *@ ''ђ)V  ''''@UU 'L 2       *@* 'ߒ㿀`  a`L}  ;` 5 Lk  /̒Ho o@` ``  ?ab  $aa*@$a?" @$aH 0 㿀@   0'` 2!" ! '`@TҒ   : * +@& `L x@ L  dܐ'P㿐``>  *` @''Ւ  &@   N (a(! @e`KҔ!x`KƔ!x "@㿐!' 'p'p'pL'p('p4'p@㿘`(>    > """"` ""> " " >  2 | t2 | x2  |   "& St&   2 㿘`(>   > """"` """"?2| 2||`"`# |"@"|"  02㿐>    > """"` "    h$ x$ t$$  Jܖ  0 , , > ""`$ | |"` |"$ " 㿘`?`> ې!d*` € &`  &`  &` &` &`  2 2 2  2 @2 @2 2!2" 2(@> )#H 0'  H&!W  RH0!J > I 0'  2 `  `2' J 2*В bo@ W7 JJv  2 @  H > /M!''''''''''''㿘@S ?  2   *`@&@ <&` 0  ? &` > &` `X&` b&`     3`  *   &`$ <&`0 &`8 $&`< (&`@ ,&`D 0&`H 4&`L H&`P Da&`T㿘@R ?  2`   *&@ < >` 0 @ ? &` > &` `h&`  b&`$    3`  *   &`( 8>`8 &`@ $&`D (&`H ,&`L 0&`P 4&`T H&`X @a>``㿈` @'''@㿈` @'''@X㿈` @'''@㾈> )#H!8'S'S p`> '` Rѐ`' 2!Iz p 2h!< 0 2```Ij  cH > .C"㾈> )#H!8'SU'ST p`> '` R`'} 2!I3 p 2hڒ< 0 2``ؔ`I#  cH > -" 㾈> )#H!8'S`''S  p'ә H p 2h`H  cH > -Ȑ"0x> )#H!8'R@''Rג p' 2!H p 2X< 0 2`@e`H  cH > -"@x> )#H!8'R@''R p'˒ 2!H p 2Xo< 0 2`@&`Hq  cH > -J"Px> )#H!8'R\@''RY p' HB p 2X0`H=  cH > -"h㿀@Pؒ `H&   㿘  Đ%@Pƒ%> b!_> 3c!_!> b!_"> J#$##> J(2  J$ J* ) * JJ#2 J J* : * a*_!@%G̐$ 㿈@ 2`! "'>   +  N0l"!> 4> > "; ! "> 3!!Z N"> C" N0R> 37#5"3#1!> ."> +")!> &!$" 28` '#\  = ,ے 2'` '#\  , @PB `&  `/GS   `GJ㿐` N@' `@'' NpQ(!8'ԐQ' '> @ԔP] `@`'ؐ G   ''''G  "0'ܐ؁㿐P!8'@>  P0? > ܄(             ?㿐P!8'@>  O`?&` & &  㿘`?&` & & U'''0'x'x'x'x'x'H'`'`'''''''|''L'T'''''`''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''|'O!8't@No tO'tO p'E "#p 2 xEk p 2 <  2 2  'p    `2`2`" ` ` 2 (*  2 㿘` @@M .`. `6 `& 㿘` i@@MҒ j` `. @* *``2@".㿘P  (&@R@ "      &`   &` &`&` &`&`&`h  0   Dڔ 2(˒Ȁ   N '؀ 'ܐ  '' @''' ' '''D'㿈 D 㾈 "8   D 2.  ( ''쀢 " &  '   N  ( ''x'|'tDr  h ,0   D[ , 2)L耢    N ''̀'Ȑ '' 'В @''''' '''D8 ,㿈   D%  2'㿘?"@` &> "*` €"ՔZI  hȐ@L ,,8(  Cߒ "  2   ?  ?'' ,''''&'''''CƔ ,  > )#H' "`  p C 2Vp "P   K Nx 2 _0xp ) jfOr #`r 20'M8'\\MCx 2 '`'d'h`X `2 @L!  't'x  'pC[  H > (4"㿘``  `` Fs > )#H'g ` 'h@   N'H j'HpMa8'LHMLLM HC  2k`"'P`" 'P_ N`` NWH'T'XsP HK'T'XP H@> B͒ 28DBƔ  1DH@`*  B #@   N`[D 'd`]pD 'dhhBD B H > 'w"㿐 b'    &&Bx ` 2 % ?  B` $ 2 ''̒ 2 'Ԕ 2?& & 㿈''ג㿐'㿈 B+  2%?c @ @    0 Ȕ B  㿀? `]&> "0*` €gQJ ' '䀢 2?` @ ?'@ ` '' 2)`  `8''Ք  &Ag j 㽰> )#H`'@ 2`0  $`0`  PA 2}`0`?'T` `Ay 2p`00?'d TPb XAf 2]`0  V NT 2S`0" T XE&    2 jp jKCa8'KBA9 2*`0P %   N!`0@'D'@'Hd@` d h'(','@' '$''0'8 &`0`,?`$`0`0H > %"㽠> )#H0'@I!@k 2 0s  % 0`  0@ܔ 2a 0`?'4'0` @@Δ 2S 00?'D'@  0G ?@?A N@  ; p jJ8'JJ '@  2% 0``"@4 ``0  @ R @D0   ? '4'D''0'4$`'h'`'d`J 2 0@n 2 0     '0'<'8'@'D@  2 N'4 ('4p (?0'4'D'$`   ?'0'4'D''4$`@'X'P'TP 2 0$`@+ 2 0   ( '0'8'D'4'<'@@  2 NŒ'4 '4=6@" 'D'H'4'4'@ (?'4'D`'_$`0 $4 #! $'44!!'48?4 2r 0@  k NHpH@ '''' @''' '( 2O 0?Ô 2H 0 '0@  2? N'4d '4fp0 N'0'D$`)$`` "`48? 2 0`0? 2 0``@? 2  0` `?  2 0& 0 ,?`% 0 0H > $V"ȁ'''''''''' '('0'8'\'D'P'''''''''''''''!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (> (# ! 2 K n   !,"X$' )` "#%" !㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&` В `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` ~&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $X`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $ > )#H '  "      gp , hx `@ @Cs $ޒ  : {: $v  `@ 2m` %``` : $ 2X :  2N] C Ē?#`> "̓*` €      @&x`h@ :R :F  2 `g@H > "؁'l'''''''''`'''''<''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''8't't't *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&> #*` €`w@ 2Ͱ9S  2ư9F  2 `v`c@ `@ n ؐ9  2|     }`@ xȐTC 8  2h7 `Y`t@ T` 8˔  2DC `u5@ 2 8+8  2$ ~ " 8  }    }   ~@ '''''''''p'''''\'8'''' '4'4''d㿘!H`(`8'LӾ  @A!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$$ &@㿐 (`(! 8?`z ] @ 6!H   "`(? < @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ @  `??" @&!?> *` "@"` "`"`@"`> <*5 "` . "`  0%   0 "`"`>  (   "` "`    "`"`㽀> )cH>' 0  `(aHa(aH`@'䀤 a*@ " a a$#a( p= ?p! ''''d7f'ҡ ?7G"  ?7@  "a@u a@$H$$$#H > "㿈> a8#@aH5 ?``81 > "\*` €> @"" > @ # $ 0> @# [0$ 0*`" *  * $ 4[$$ 0$ 4  `$ $ 㿘@> @\#( 㿘㿘` ` $  ` "`0!" ! ! 0  M В K >  D&a4'ڔ'۰'۰''''ۨ'ۨ'ۨ'ۨ       @  !$ ( "@  2"` 0"! @0 0 @0 "# @2 2!"$(  @ > ("`"`$"`( *     2 @2 2 !"2@$2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &`  (> xcX & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` 5.`㿘&@  &` `&`  &`  5.`> )#H '@ 20Ȱ  $0`2 )  `!" -!!"C`d`a "` a^j P`$`d"` !L w ":`k  -d% %"Ӡ# %  "~`  !0FMe"`!wB<` `&03!0!'h.!,' -!" !!!)!( `  ` !2!1  -0 !%0"   -@"_PҐܒi֒/ -Ðǒ0 !0!! &``D3v  20D "'DD  @D@3a <'<3a  '8 `b@8`h@ 20`3B  20g77@v`h@x 2n0xp'pz`'t3) cv[&``w@4 `V(`"T0`< 2P0` `"J I0`43 B;&`>  `@ 2507` @2 `:`2  2 $`2Ԕ  20P `@ 2 0( '`` @`2 $ 20``  @ߢ02  20f@00`,2  20_@,0`2} 20@ 20`2t `2g 20@ 20`2^ p`2Q 20!@`2C 20~@ 2{0`2: t0`2- 2m0#@ 2e0`2$ ^`2 2W0!@O`2  2I0@ 2A0`2 :`1 240!@,`1 2%0@ 20`1ܔ `1ϔ 20!@`1  20@ 20`1 a@࢒ 20 'X'\'`'d'h'l't'x'|'''' '$'(''H','4''8<'@''`XL'p'//'''''''1n `H1b 20H?L'P'T'X'\'`'d'h'l'p't'x'|'''' ''T''D''' 'H'$'(',x'L`'0'4'8'< `/2   /` `/82   /80"aП@ 2>0K"a@ 4` '((0 ,`` '$``"'$ 2 '$ `@$   '  - b}@ J0,?`$0 Ɛ0H >  (R "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O> !|*` €> !|` 0 @ ?*@ @9&`:\8'`@'':W `'Ȓ0F  :А0B  0P *Ā '0-  !}`0*  -6``> !| 0  ?. '$'0'@'L'X'h'h't㿘@ ?"@Ր㿀9!8'@> H92 `&@'''Ḓ㿐9!8'@>  9H宔㿐9!8'@>  9HD㿐9!8'@>  8HDÔ㿀9!8@'> H8 `'`@''Ů㿀9!8'@> H8̚ `@'''ŗ㿐@''> )#H`'9m!8 ',    ` @@&`@ . 2}> `8GI  > ,9L  &@>  @/A  "df`HG3  [` /+ 8 2X/#  2PД 0U /А,9  X&`  '0 9,  > a  ?8'4'@'D'H`p'L L 'L'PL`'T@'L'X'\'`4't.  2` 0. X 2~H >  P㿐 ''Me㿐!!  @.'㾀Ԥ$> )`#H`  ?'6@ '7`'7Fx!@.  @ `@"$`$@H > k `㿈 @ %( <`  `> `d' ' 8} 0" 0`,   h`0 ` " &x`?2* ` ` $ @*@'䀊`'؀  > b$ $༒@*@ *'`` `:'`?''fذ㿘`  g㿐 @ I`2` ߐ   "$ (`) 2 ``> ",*` &``  `   `  -` "`` $ `(`` 0" 0`,  ϐ`0㿐 ) A@3 ; (`.`<`   ` @rĒ   0" 0`,  `00C` "$` $`  0" 0`,   `0  (#> )cH'@6 e> ". > 3#. > /". > ے`xE8 > !. @-S ecH > / 㿘`  @ 8Y0}㿐71!8'> @H6j `    K`2`2` 2`&` 2. 2+!< `2% 0 2!x  2`0  &`0V` `2 `0` `a `0`,?`&`0`0 N㿀@5 `,Ӕ    㿘!<  ` ` `|`x   i   " &    "& &  X @@5N d ' ' ' $' ,' 4 @' `''В,'H6!8'@>  H5@ @'''''Ŕ Ϋ X  0`   $>*@$ 0`㿐 @ !`( X  0``0?"`0`,  E`0  > $*@$ 0` 㿐6-!8'> @H5f `< @@ T0૔@>  ("> 8" <" "> < " "„"  㿘@   "@;Ր㿘@   "@;㿈@> " 6 > "@* " ` '`'`''N  㿘 > b @  b@@"```@ @ 㿈@`> (` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$ +^ 2` +O " ?!   $ - 㿐⨒ @''I@Ɩ % * @,`@@4,`@*` ,  ', @4ڒ '`H* , `H`@4͡, '`* , `  @4¡, @'* 㿘!?΀@.`  && "@*`" * *   ./2 @.*@5D ,`h H( h(  *H 㿘>  `" BK  @ `> )#H'>  b8 '" > ,  ` B+@ 2`@`B% 2`@` 2> "3> )> Db@3U`'`'Ā  > %> ,7> 9> ;> L  -`*` :`*  L?Ѐ  3ǐ`3Đ&``&`0`4 &`42 ` &`t` &`x`  &`|`6J`4 @ K ~`$+  + 4 &@ @ $ @   `@$ @ *@@    @  `@  *"@ *`" *  *  &!: !@3Ē#,` " ``4 2` * $ ``$`4 `8`+   "`4P p #8 k aT&`&`?=> ! &`> )#H > "㿘0    4 g dt %3 *` *  4@ `??P `? b?*`?"@" 2@  8"*` *  4@ @@  b?@ ? `$  *@ `b* " 2 ?"  " `  "$ @ `*@  ! | 2`*` *  4@` `m    "@" " @ `*@  `x `(2`* *  4`  c@ *@ "`b"  ]@@ *   T"* *  4@ 8@  @ c* @ *    ?#     c@* @ *   ?#  , 4 , c (   # ,`# (@*@* , $ ( , "@  " @@    *   ? # @ `*@ `㿘 s 0 o> Ѳ!\,*  4 `p \  $@)> Ѫ!T)>      @    $ @   #0 `h*`@ €  $@2 Ho o ?$ H 0   `h*`@ €  > c 0m `H (`P" `p `h $`p* @0,# 04  "0Ho o ?$ H 0  "0 0 P> P    `? 㿘 &   , > > !x`L`4 4$ `" lD$ " " $ $ z  $ $`$ `` ?@"  ޠ 0&`0>  > #H> #81&㿘? @2  `> `2  `*@` `0, *  4@` p b$ l"$ pe#  c$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @   @  *@@Bj-  * ` `2 p`  p %$ p ?"$ p$ސ I H /e `H 0 p =8$ p* & ``   p " #> $ p !cPkG   p "H 0 h> ѐ!@*` €㿘>  " *6 .  *  4@ >  h!@*`  €H /e * &  @ p  @9 H 0Zz 㿘  > "6 . *@ *`@`<> h@*` 㿘  > "6 . *@ *`@`<> h@*`   > 2 * *` (<㿘> "  *6 .  @*  4 > `h!@*`  @ h]ɘ ` ]@ P `y@3`x@0O `z@!`{@" F  k@ "+  j@*\@07 l@m@".    $ 7 0$    @ 0@ 0@ 0 @} &  &R "  $ l> 0*`( (4H4p(p 2 "p " H 㿘 l> `" `2`**`  *  4H /e4 p* & p V  H   & p HBQ  H   } H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l> b2 * *@ *``4`(       2 `$   耢  H /e * & `(    S`(`  v r* * `$   | x* * @D   @A `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @    @ N *@ *`@@2  "`` *@ * ! * H 0 > 8    `? 㿘 &   ! `l`T `4-> +>   4$ $c   P P` P &`0>  > #H> #X-x㿘?2  > `2 _ *@`"Z `06V . *  4@H /e4 * &    H 0;  & H 0$& @>?& @;  && H /e * &  h*@@C   @@   * H 0 &   >  2 * *` ( < 㿘@h㿘@b㿘>  # *`6 .  * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0 㿘?ɔ㿘?2  @> # 2`.  `*``*   4   @ 8   ̥  `$ $ v  S @@` 2  봔 PK  G  $$`H /e * &   8 <$ > h! H 0 "` 2 `% ` @8` j   2`H /e4 * &      ?$     8  ?$ H 0`  %` &`ʹ 㿘  X& 㿘  P& 㿘& & H /e * & 3>  h*@ r * @Ò   @   * cx!  h*@ *@   @ @   @ H 0 &㿐& & H /e * & /3>  h*@ a" | x*   * *@ @c   @` H@Y   @V   * c!  h*@ *@>   @; H 0 &㿘  . "* >  @+J* 㿘  1> $ @+>#耢  @+9#㿘@   `@  ( 㿘``8 > 8#   㿐4`> *#0􀢠> #* 0~80 & &`> &` ` &``> ` &` 2%&%"%&``  &`&` k &`*@`@(``h```0 h@  hk  *p` *hq` *(a` *hb`*(c`*h@`*(A`*hB`*(C"`` `#\> *Z > aL  t > b  n > cX&`h&`l??> #X&`0&`46?> `D &`> L `?㿘  @!& > > "b|`4, 0  $*e" " $$ $ $ B   $ $$  `@  4`&`0>  p>  x>  `)㿘? 2  > h`2  > c@  6 h*c@ @ 0+   *  *  4 p W$ l"$ p]ސ#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * &  ` *d@( `  *d@c P*`$`2 p`(  p $$ p ?!$ p$d H H /e `H 0 p =7$ p* & `   p " #> $ p !`d   p "H 0 h> ѐ!@*` €㿘  , > ch* 6 . *  4@@ h> ѐ!@*`  `€H /e * &  @  p   @ *hd*(H 0SH 㿘  * > ch* 6 .  *  4@@ `h> ѐ!@*`   @ lVј d ]@ T `y@7`x@4S `z@!`{@" ,J  k@ "+  j@*\@4; l@m@"$2   , $ , *(d  *0$  @ 0@ 0 @ &@ 0  $ &V "  $ $ H(ༀ (d"5``0O?LK 0  (2a@2`@ 2` 29`07  + 0 ( `+ 0༐  (`#("`+ 0 (`@ (` + 0 (`(((H  㿐 l> ` `* h* 2`*`  *  4`(    @ 2 `$   @ږ  H /e * & `(    X   *hd`@ @ @ @ "`$2 #!"  "  ""  B*( @(`@@  "  D*( @(  *h  H@ܐ(  *(   *h   *(   G*h   @* *( *h *(`(` *h9 *:`$ "   *h1 *2  @( h( @$ (H 0 㿘  *@ > #h*`6 . @ *``4 > h@*` 㿘  *@ > #h*`6 . @ *``4 > h@*`   (> ch(2 * (4@l> * ch(0((4@H4p(p 2`,"p`, "`,H 㿘 l> ` `* h* 2`*`  *  4 H /e4 p* & p" V  H   & p2 H9  H  u9 H$  P$  p & p *(d  *H 0 A0(( ( z4* x*" 2   ",",  ("@" ` A0(((`46`*`zx*" 2  ",",` ( "@"   (A0(( (4, .  *({  *({, ",,  ({ ({,",? `" " ({ ({ $ " , "     (*(,߆",#@  ( A0(( (4 @ , " ,"@༐ ((㿐'   ,w ```P@2?@?<   lv  2?o@?   lu  2?@?<   㿘   0> Ѭ!\,* *  4`p` l  @!> Ѥ!T    @ $  $  @  `h *` €  @2 Ho o , $ ,H 0 H /e * &  *(d (H 0  `@$ ( `h* €> ` #Ĕ `H `Ps" `p `h $`p* @ 0,㿘.`@%. 2?#@2..  >  Ā`?㿘  @& Ē`&`0>  p>  x> $    㿘@ 㿘@ 㿘7Ӕ 㿘a"  ``> $ . 㿘> 2`Ȁ`?㿘8 0 &`@@ `@< @ @ (@> 0 > $c 0> $_ 0$\ @2㿐 @'    @`@'   > !$8 !` @ "g @@ ?"@ @ ( @ *`㿘?> 㸑2 `  6 㸑. @ 2N <  2  v$& 4 . <& 0 㿘?2 >  . @ 0 @Ɛ# d  d 4 , <㿘 0 "B   @ `  ` #   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @#  $ @ @ ` "  `` *`2 0? & 0㿘?2 >  . @ P $ 8$ 0 ` 0@&` $ 0`$8$ 2 4  㿘> 1!0 2 U@ P> a@~> #UH> aX~> 1yah 0> #H!p0   &`D<   &`HH   &`LT   &`P`   &`Tl   &`Xx   &`\   &``   &`d   &`h   &`l  y &`p  s &`ta4 " '> 1a0 2'8 '> ?a~P@`D* `&`4&`0 "`0@`D`8*  " d@> "ѐ! !D8 `'` ''> Pݖ 㿘 4#> ~a   & @> ! "05 @#& < @a 4}ʖ < (`8 * *    @`4  @2 `   " `4 @@ ` "   <&`8㿘`>  "l! 㿘> 0#`?㿘4`> "Z#0 > #8"Q08  Ð0&`0> "F#X> > "0ch0k&`t 2`0`t &`t`0.`  `# `8``  * > `0  > #(&`8&`<?>  b@`p>> >  #  cx -> )`@!l@@!i P`! `2 > !#@!Y x> !#@!P@!M> @#6Ԥ`> !Ӑ# @  @ `p @"`0@`0 D*@@&`x㿘  0 ` *`   ? 0 ? @  *@    t " |  R @/  | "  > ? 1> : >    0 #!}  0>  & ?& &   @ & |& x #!e >   !` & & x& |  *@   & & |& x  |!M  0 | 2 t x  t t `  & t& x "   0 `"* 0   :r 0 n & @  2 | ` & | .  0 @ *@V 0 2S 0  . M& |㿘> X@  > `@ h#> )cH C '//ɒː/   ''@0cH > J hh> )#H   /'''@ݑ,  `  @W >  x      ܀@>    @.   ܀@ p  >  >  >   @   @  @@} @cH p  >  > !>  |  "cH p € `cH > ܐ!h!> )#H   /'''@ݓ*`@& p#H > !(h!> )#H #  /'''//ʐ@Ȁ`& & #H > !@h!> )#H $  /'''//ʐ@nȀ`. . #H > !Ph> )#H p ' @ t @ `? !   ///'؀` '쀤   69 a$"@8 t`  cHa"  6& cH > E!hh!> )>`>  `#H   //˒'/''/@ /#H > &!x㿘 x  x H/` / t`& t`\  & x`$`& `& & & א |` & x E 0`$@H 0 0 c 0" 0(㿘 0a b      0 `  * h> > ) H  H`'  H   /''ؐ #H > !㿘> H ` H` `  >  H H2 㿘> H `H`  ``p @*` >  H H2 @ 㿘> H ` Hp `""㿘> H `H *`  ࡐ   `` *ࡐ @?h> H > )cH 'H ?2 #@ @ 7 6` /'/'/$ d ."@ d  ; 6  0  ///''ɒ H > !> H H?"  0  2 `" ܀   "܄ `" "܁> `H`H`?  0    ``܄"`ܐ h> H > )cH ' H`   a@"za@ta @!@"0`pa@h kH !@2e "b "`"`W " ` 0*@O$`0*  0* @ E$`DH /  Ȕ /'' ܀   . z  /''ܒ `8. .`  .`?`e?. ..?&`p` .. - H > !㿘 ܀ >  b$   "b$??*c* @  /  <؀  ` 2``?"`"` ""  > HH   R`  > \"`8"`<"` ؐ 㿘> +T!Ȁ`? 4 0 #> axh@  4> ! 0^ ax2 x`0`?   ? " >  (&`0&`4?> ">  "> "&`p>  &`h ,`"*  t@ ,`,``* ,@*`&  ` 0&` 4 & & & =,   "@    & &0&&@`ϑ,`㿀> b' h> ''H'' & @g0# ? ?(? c ?ߐ c 2 (2 `   0   @P& 40 & 4㿘 > 0o"   #  # # # #  #   # #@  "> $ @*@" """ # ` *`  # # \#@   ?`((2` 0㿘   2X" , u2`O   ?Ϡ 2  @ 2@D 2@?"  a0(2 %` 2 d `   ` >  `"0 0`00 @  )  2 2@㿘`> > # h`l > "p;㿘%> Ho o p   *@ , H 0  p 0& pH 0*" *  tؠ  `   4 ϔ  0$ 4@_ 0 4 Ĕ ? 0$ 4 @ 0㿐 H/` /  t @ "  2@8  t `" @$  8H 0㿘H  p *@& pH 0 ͐ p㿘  ( 4`  0ߐ 0!  0 p* @2 ,> " 0  @?" @3@ ,㿘 $€ (Ho o !2H 0 㿘 , "& (8& ,& (& $`> "> "؁㿘> & $& (a/ & , 㿘 >  ΐ# 㿘 @ *` `? c *2`  > `#> `& 4> !x& <Œ  @$ $@`` @㿀& $& (& ,& & @ @ @ > c(' 4''> '' Q&    *  2  *`` 2   ??@*    2 ?? *`  `2  c *  @  0  2   *` ` ? c *2`    &   `@& 㿘`> > !0`8 > #8㿘?#%> Ho o < i H 0 < `\ 0 * ,&  #p @ " @}  *` `   2 *@ 3@  @?< H 0㿘`c deZ4%Z@#!@"@ @"@ @"@&`d  &㿐!,ؖ* *` @ #` `"   @ .`  *    ?# 2 + @ 2   *`@  `!2  0""" ""  0`# ` 4*` # # # \#@   0# < # #  0# < #  #@㿘   *`& `2 @" !   @*   "82 @"  @*    '2  *` `  ? c *2`    ` *`  ` ?# 2 *@ 3    *` `  ? c *2`     ? *      * 2`  3@@"  ?#c  *` `  @ `*`2@     >  `Ր!`4 `$4   *` `  ? c *2`    @ 2 ? ?  ?& & &   *`  ` ?# 2 , @2   ?& 㿘  *` `  ? c *2`       *` ` ?# 2 *@ 3@  $*` `2 @(#㿘> & $& (c|| & , 㿘 , "& (a& ,& (& $`> #> #㿐>  @b@>  `'> 00U 㿘> %#Ѐ`?㿘0 &`4`&`8&`0&`4 &`8&`&`&`X&`0&`&`@&``44> ̐#0N` > Ɛ 0H>  00D `̨?`p0``  ,   `ꀤ``&`\&`4%@$&`p&`` ` >  &a&a`a?}>  P> a&`&``ؖ}?>  X 0 D 0 2`@8 (D0 (㿘`$`?㿘> Y h> &`0 &`4 &ah&a`&al㿘aX@   "  $   +  2 㿈 0&!X ,@ 4@ 0 0@ 4@ !!T > K !,`"!X@ݐ!X 2!X d ?  2 > z p?$ `$ $$  $ $ !\ "&!\!X   $ $ $$ ($ T$ X  2$ !X  8)> '> !P '!R77'耢 $ $`  2!P`?㿘!X #>   "  $ "    $`  $ $  2 㿘!X   "   $ "   2 㿘`   "@ @`㿘 ` -> V 8!@  >  )> '> ` ȑ,``j`,````> ^ ?#@*`%`"> > O > L @"2> >   > = ?#@"> > 4!> 1!`> , > !(  $`  >   %> !> `!0``  ``>  ȁ !X" 2 `  (  㿘 ` "& (> X!8㿐 ( 2 > N!had  "ad `0,€`4 `   & ,0& 0@& @D  " & DH& H2 ` !X` " D "@  @@(,2`2$   ,0 4 2g   H 0 #\  4 D  "   0 4P  (aX ?`@ "    `` T 2`   (  @? `   ߔ  !X " `   OӒ  Nϒ  M˒  Lǒ  P L "  `#`g& `  ad? "ad `00€`4 㿘 ( 2 `> !h 6  ?'& ` & `aX` " D"@ @ *@`@8 `0`4  H  , 0€ 4 ad? "ad `00€`4㿘 0 4 " > !X ":   "6   "2    P  & L L*& L P@( O& P O:  N6  M2  L.  P L ("   !  㿘` !X`"` `  `T  2`\`\ 4``2`T+@ ` !``> !H /e * & ` $`T$`X$`\ 0>   4ฟ` "a`H 0H` 1` !``> !БH /e * & ` 0 $`4` $`T$`X$`\ 0>   4ฟ` "a`H 0` H /e * & $`T$`X$`\H 0` !`     ~  0 `  0  4㿘 !Xy "v   @"``T  2`\`\4``@2 \ !``2 0> 1"$€ 4< ?>  & T& XK"!`/ !``> "8H /e * &  0 $`4 >  0  4ฟ  "a`& X& TH 00H /e * & & X& TH 00 0 $4㿘 0 (4㿘!X "  T "   В  "  T@ X  "  ?Ē   2 T(}((((((((((|(|L(|L((|(((((((,(@(T(h(|((( 83!  ??<" 8# 3!?????????????'#!#! #!#!3!#! !X#!$'> !c@@ ?a 2a㽸'D 0D$ 4'H'L '$D> "`,#\ Ԑ  $  €D> "?0  ,€'$w  'ؐ '''(    А {# 'Ȓ s @ 'Ԑ 'Ԁ  LH€ Ԑ ' Z` `'> !T*` €̀ -Ȗ Ԑ Ѐ'(`?` ?ܒ`  : `*  4 `*  . *`  '(̀  !` @ ` @ԕ*Р  ` @ ` @ԕ*В` @ ܡ,  @< Ԥ cА@#ݔ   @ @ @ @D> " ̀ Đ?@   ؒ` @*`  2Դ`"2L4 В` ƒ@ ` `?%?В`@ ܒ` @  `*@   `*` @  `*` %֨ LH { €,( `"-`  ,#\ $Ԁ`ԑ2 'Ԁ`  ''( + WU/ 0@ 4* "@   ,#\ $@`2@ԑ2 '@   'и А C `'Ȓ` ; `' 3` @ ԀCВ` ) `I2 ` " `S2 ̐  ' €$㿘>   82" 8`  > '"  >  # $> > #  #8 >  #X @ 5>  '> %> `"hp``  `x> # `",@> #`` H> !*` €> א#C> > Ґ#>> > ͐#9> > Ȑ#4> > Ð /> >  *> >  %> >  0 > >  @> >  `> >  p> >   > >  > >   > `  `` "`> @    " >  > > {!  4w!  4s!0 4> o!H `!->  > g!X  @ 6 8> !p '> %>   န` P @   8 "1 T> E! 8 @ 6) T> !'>  <   > !ሔ D   ?> !@  8`@    T`> ! `>  !  > !  > !  > "  > "  > "  @> "   > "0 !> ܐ"@ "> ֐"P $> А"` (> ʐ"pȐx X 2;> ``2@> "x㿀 "2  "1  + 0 " 0 !"~  "V 0 ` `h! " `h u  2 `h"! `ha "a$&@ &`&`l&` |   Q`  @ `h"  G`  @`h" ` *  `h ,`!"  ` `X  U  `)@  @`2`h0I G  `  @  `  `h*` 2!   `  @  `  `h*` &2! #`l  ?2&`l`l 2   dG  &`l>  "@?" &@""""`h!$"@`l`h "a$  ђ`  @`l"    Œ`  @ < 4`2@  `l 2    d   &`l>  F"@?" &@""""`h!$"@`l`h "a$`l"   `  @``l"`l"   `@ ,   `l*@   " `l " `  `n@ ,   `l*@ `  "> aXؔ \&`d    T` `d @ ? s @ \   2`d>  ې" \%X`lX`"`l"`` % &`d` ` \&`d"    `    %`% @  %  %  % %   `@ ` @ ' ' ' `' #' @ @ `` 5  `@ِ ```5 @* @Ɛ  ``  2`  2`  ג@`  π %`% @  %  %  `@ ` @   ?%  @ 0  "  B 0" <   `s@ ` 1%  @i   c `*`@  % `@X ` @R `*@ K `*` @D `*` % "  @"  B >@ `,@ ` @3%  @!    `*`@ !%  `@ ` @  `*@  `*` @ `*` %@` "@ @ h *@%% %쀢 9   `ؒ@ `  ~? %`@% @  % !%   `@  @  `@ ` *` 54 * 54耢  耢  @ %8  `@  @  `@ ` *` , %<%@~%D2,  %8  `@  @  `x@ ` *` , %<  `l@  @  `e@ ` *` , %DR%@ `X@ ` @   %8`ha r2a  ` 66 28`ha 2a8 @. \ <  `,@  *`N%  `@  @  `@  *`8 2   ` @  @  `@  @ *`  @  *`  `@ ` @ `* @ `*` @ސ , %@<" `ha 2a\ @  `Œ@  *`N%  `@  @  `@  *`8 2   `@  @  `@  @ *`  @  *`  `@ ` @ `* @~ `*` @w , %@@" \  D  `f@  *`N%    `Y@  @  `R@  *`8 2   `F@  @  `?@  @ *`  6@  *`  `@, ` @& `* @ `*` @ , %@D"8`@خ 䀢 / +  `@ `  q %b%  $% (%   %T    @ߐ  ` 㿘9> "4    ` !P2!R@2?#@`!P?2!@` 2!D " 2|`@"4> !,`!!X>   Ð"!@@ +>  '> %> `"  ``  ` c!X"&!\`" `X  2`X|  2&!\&!X "4 d \   3 \Ґ$`X`X"$$   #Ô d$$ \   ` \$`X`X"$$!\"&!\ \ > |   @@  `2   `  㿘! @ 㿘#`H #` aR%b 5 =    㿐 &c` ې "8> # 8`" > #@ `> #x%b ahal  2  cH0 4@ 2  > ѐ#0f  cH0 4@ > #cHcL&c&c      cHԚc\ > #0B> cP#cT%b %t%V .cF  > (a 2 .cF@ 2 > #>&c@ `c` &`0J@ "> > r > o  z㿘{ #`  `0`4#\#`#H 0 €4㿘 PH /f`* '` `"\0]#`#`>  & 0|0 @2Z#`E 0#`H 0 㿘 2     @ `@  @.@  `@ ` @`,   㿘?# #>  !@`(@ `(   ""`(`& "#" " 2 2`( @2  V  $ 㿐&c  .%> '>  ``     "  X X   `0c `4@   >   X 2 2c> {!%?c&c&c&b&b > i!X c &cxc   c؀ > W!x0   qcԀ > J!c> cȐ!C  VV ,?c* %> !@(@ (   "!(`"`" "  " > 2 7   (`  `"``@ W0 @CV $W > !xc"` `@  `@  `@V` "b@@ 2^c>>>>>>ܐ#c@T"@b &c&c&c&c&c&c&cb *b ` P2c ` p2c>]>]>]>^"ch&c&c&c&cc? >>>>>>ܐ!a8T 0`&c&c&c&c&c&cc>[ `cܒ &cJ@ > t! c `0`4cc `0`4c?cܒ 0 €4?&c؁㿘#؀?  #ܰ  `0`4## `0`4##ܒ# 0 €4㿘 8H /f`* '` `"\0:##>[  &#.0 @2Z.ɐ#`#&##ܑH 0 p` B #ܔ   0  4 > ! 1#ܖ  0 #\   4؟ > " Β # ؒ @. `#ܢ `0`4 #ܒ 0 €4#      # *@ #  "# p#ܔ  0  4 > "H} 0/#ܖ   0##\   4؟ > "ph #ܢ #* #Ȕ 2 *#` 04 #ܒ 0 €4㿘> # {#>  ! "  `" e 2  ! "   `" W "" * > "?# " 2   @ "  @2    㿘@ 㿘! #0&@  > ! #0@  4 @ @@  > ݐ!m#,@    @  > ͐!]# @#$@ > Đ"#@ @  @@o&oԒb&o&o &o&o&o`2`d2o@ `4`ho  ?<#2`> D #耢`&@> " +@J "> > "H"P> "@> ǒb0 " c0@ !#@&@   `0, `4@    0c @ €49㿘 0! #0#,$   0 €4# 0 €4ܐ0 㿘 0H /f`* '` `"\0-# c0<>D  c& Zc@0 @2Z[/# &/ c0   c0 H 0 㿘> "X`?㿘0h&h4&h8&`4&h  8 pI &`  > > Ɛ"`0! &h&hh`j?> "> ,> ,c#&h&h> b_ &h@ &`&hL㿘(    㿘(    ڐ Ɛ   Ԕ  d  B    *@  2@* *@ : : *2@ :  &  4 @    㿘   `  `  @  `   *@  2@* *@  2  *2@ 2 㿐   `  ` @  `?㿘  `  `  @/# @*   & &@&&``"   ` 㿘?#@6 6`~ ` : & $ @$@&@ gc2   *  , " 4  "@ ,  4 `@ -` 5``@`   b    88 H 'T>  @C T :8?T2 7耦(7耢 2: , 4`444`4`4`ؑ45 'ē45 5 5  `B'? 8' `@ `@`*  @@`*  @@`*  @T  -`@T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 / @   7@', @@! '*^2 . 2, @ ( ?#   ?;@#..  ?B$$6`6'@  @"6``4@  *. ?  @26`@4@2@ / T$   . " @?* 2@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 0 2 + ( 2"@ @b  *  @    㿘  㿐  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* J " ?* /> =%/> ⬬%/>  @ E < @   7A2Y    @2 $ ^$ 4@  , ,2 @$ $ +> c`-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $ +> c`+?P `-`0+-?P%/> @̀/> % /> ⬬%/> (D=(  ,%+> c`+?P `-`0+-?P%  ,% +> c`+?P `-`0+-?P%/>  @̀'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  irqfunctionsocketcontrollerdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrwsmuxbiopppoevethertrunkvlantunslppploopgregifcarpbridgebpfiltersystraceksymsccdvndendrunmstsnmeaptyencsppppflowpfsyncpflogpfPortDB[%d] changed: current =(0x%x@0x%06x 0x%08x%08x 0x%08x%08x) database=(0x%x@0x%06x 0x%08x%08x 0x%08x%08x)Not RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dHBA PortID 0x%06x N-Port Handle %d, Connection Topology '%s'HBA WWNN 0x%08x%08x HBA WWPN 0x%08x%08x%d.%d.%d: FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)????Downloaded RISC Code Checksum FailureCannot setup DMA21002200230023122322242212401016012160bus %d is in %s Mode12801080LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode CapableDMA Failed to Stop on ResetFailed to come out of resetchip reset timed outreset didn't clearMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)load 0x%x words of code at load address 0x%xF/W Risc Ram Load FailedF/W download failed at word %dskipping f/w downloadf/w didn't *really* startboard type %s rev 0x%x, %s firmware rev %d.%d.%dloadedresidentFirmware Attributes = 0x%x2K Logins SupportedLast F/W revision was %d.%d.%d%d max I/O command limit setline %d: markportdbfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xSetting ICB Port 0x%08x%08xNo valid WWNs to usebad request queue lengthbad result queue lengthisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xFC scratch area busy (line %d)!INIT F/W from %p (%08x%08x)isp_fibre_initisp_fibre_initbad value %x in fwopt2 timer fieldbad request queue length %dbad result queue length %disp_fibre_init_2400: fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xisp_fibre_init_2400: rqst %04x%04x%04x%04x rsp %04x%04x%04x%04xisp_fibre_init_2400INIT F/W from %04x%04x%04x%04xisp_fibre_init_2400IOCB LOGXIOCB LOGX responsestatus 0x%x on port login IOCBPLOGX failed- no linkPLOGX failed- no IOCB bufferPLOGX failed- no Exchange Control BlockPLOGX(0x%x) of Port 0x%06x failed: reason 0x%x (last LOGIN state 0x%x)PLOGX failed- no fabricPLOGX failed- f/w not readyPLOGX failed- not logged in (last LOGIN state 0x%x)PLOGX failed: LS_RJT = 0x%xPLOGX failed- no PCB allocatedPLOGX failed: invalid parameter at offset 0x%xportid 0x%x already logged in with N-port handle 0x%xN-port handle 0x%x already used for portid 0x%xPLOGX failed- no handle allocatedPLOGX failed- no FLOGI_ACCstatus %x from %xisp_plogxisp_plogi_old: portid 0x%06x already logged in as %uisp_plogi_old: handle %u in use for port id 0x%02xXXXXisp_plogi_old: error 0x%x in PLOGI to port 0x%06xisp_plogi_old: all IDs used for fabric loginisp_plogi_old: error 0x%x on port login of 0x%06x@0x%0xisp_getpdbF Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFC Link Test EntryFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08xisp_fclink_test: not at FW_READY stateisp_fclink_test: register fc4 type failed4Gb link speed/s2Gb link speed/sFC Link Test Completeisp_fclink_testConfig WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?????isp_pdb_sync: bad loopstate %disp_pdb_sync: isp_scan_loop failedisp_pdb_sync: isp_scan_fabric failedSynchronizing PDBsportdb idx %d already validisp_scan_loop: state %d for idx %dno loop topology to scanFC scan loop 0..%dgiving up on synchronizing the port databasebad pdb (%1d%1d%1d) @ handle 0x%x[%d] not probational/zombie (0x%x)Loop Port 0x%02x@0x%x Pending ValidLoop Port 0x%02x@0x%x changedout of portdb entriesLoop Port 0x%02x@0x%x is New Entryisp_scan_loopscanning fabric (GID_FT) via SNSisp_gid_ft_snsscanning fabric (GID_FT) via CTct IOCBCT HDR + payload after putIOCB responseCT Passthrough returned 0x%xCT responseisp_gid_ft_ct_passthruFC Scan FabricFC Scan Fabric Done (no fabric)Fabric Nameserver rejected GID_FT (Reason=0x%x Expl=0x%x)fabric too big for scratch area: increase ISP2100_SCRLENgot %d ports back from name serverremoving duplicate PortID 0x%x entry from listskipping null PortID at idx %dskip ourselves @ PortID 0x%06xChecking Fabric Port 0x%06xFabric Port 0x%06x considered deadchanged WWN after reloginFabric Port 0x%06x changedFabric Port 0x%06x Now Pending ValidPortID 0x%06x already at %d handle %d state %dport database too small to login PortID 0x%06x- increase MAX_FC_TARGFabric Port 0x%06x is New EntryPortID 0x%x 0x%08x%08x/0x%08x%08x %ld already at idx %d, state 0x%xZombie Fabric Port 0x%06x Now ChangedZombie Fabric Port 0x%06x Now Pending ValidFC Scan Fabric Doneisp_scan_fabricPLOGI 0x%06x failednew device 0x%06x@0x%x disappearednew device 0x%06x@0x%x changed (0x%06x@0x%0x)isp_register_fc4_typeRegister FC4 Type rejectedRegister FC4 Type acceptedRegister FC4 Type: 0x%xisp_register_fc4_type_24xxAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)XS_TGT(xs)=%d- hdlidx value %dRequest Queue Overflowout of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldisp_startUnknown Control Opcode 0x%xRESET BUS NOT IMPLEMENTEDdriver initiated bus reset of bus %dRESET DEV NOT IMPLEMENTEDTarget %d on Bus %d Reset Succeededcannot find handle for command to abortABORT CMD NOT IMPLEMENTEDmailbox cmd (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyisp_intr: hard optr=%x, soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xResponse Queue EntryRequest Queue Entrycontinuation segmentinternal queues fullbad header flagbad request packetbad request handle %d (type 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)%d.%d.%d FCP RESPONSE: 0x%xasked for %ld got raw resid %ld settled for %ldRequest Queue Entry bounced backBounced RequestUnhandled Response Typeisp_intrAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)LS_RJT sentQFULL sentUnknown Async Code 0x%xfast post completion of %uIgnored Continuation ResponseMarker Responseunstable type in response queueUnhandled Response Type 0x%xSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freemarkednot markedInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dunavailablelogoutport %s for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%xisp_parse_statustransport error for %d.%d.%ddata reassembly error for target %dtarget %d sent ABTS%d.%d.%d data underrun (%d) for command 0x%xf/w resource unavailable for target %dcommand for target %d overlapped task managementCommand for fast post handle 0x%x not found?????OOOO?GET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPO/!OOOOLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET/SET DATA RATEDRIVER HEARTBEATGET PORT DATABASE ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDREAD RAM WORD EXTENDEDWRITE RAM WORD EXTENDEDUnknown Command 0x%xno parameters for 0x%xIN mbox %d = 0x%04xOUT mbox %d = 0x%04xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USEREGISTERS BUSYTIMEOUTerror 0x%xMailbox Command '%s' failed (%s)isp_mboxcmdskipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xUsing Node WWN 0x%08x%08xbad WWNN- using defaultUsing Port WWN 0x%08x%08xbad WWPN- using defaultisp_reinit cannot reset cardisp_reinit cannot restart cardinvalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understoodisp_read_nvraminvalid NVRAM header (%x %x %x)NVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM 0x%08x%08x 0x%08x%08x maxalloc %d maxframelen %dexecthrottle %d fwoptions 0x%x hardloop %d tov %dxfwoptions 0x%x zfw options 0x%xNVRAM 0x%08x%08x 0x%08x%08x exchg_cnt %d maxframelen %dNVRAM execthr %d loopid %d fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xispTarget/InitiatorInitiatorTarget(none)PortID 0x%06x Departed from Target %u because of %sadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%dfinished command on borrowed timerestarting blocked queuewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandisp_wdogtarget %d has arrivedtarget %d has departedrestarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATERrequeued %d commandsPortID 0x%06x handle 0x%x role %s %s WWNN 0x%08x%08x WWPN 0x%08x%08xPortID 0x%06x handle 0x%x role %s %s tgt %u WWNN 0x%08x%08x WWPN 0x%08x%08x, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPout of target idsarrived atarrivedchange is badchanged and departedchanged atchangedstayed atstayedgone zombie atdepartedPort Database ChangedName Server Database ChangedOther Change NotifyInternal Firmware Error on bus %d @ RISC Address 0x%x%s: ispmbx_sleep%s Mailbox Command (0x%x) Timeout (%uus)InterruptingPolled%s index %d=> %s %02xisp_print_qentry%s:0x%08x:%sisp_print_bytesisp_fc_runstate: linktest failedisp_fc_runstate: f/w not readyisp_fc_runstate: scan loop failsisp_fc_runstate: scan fabric failsisp_fc_runstate: pdb_sync failsisp_fc_runstate: f/w not ready againNIL PROBDEADCHGDNEW PVLDZOMBVLD UNK TGT INITINI%3d---%d: hdl 0x%x %s al%d tgt %s %s 0x%06x =>%s 0x%06x; WWNN 0x%08x%08x WWPN 0x%08x%08xespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p[flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA activetimed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled )`# )X%)H)@$)8& )0'@@)(&) (100-T4mii100-FX100-TXbncreservedauiutp#%$&'&(ep address %s , wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? /%s (default %s) (unknown/impossible media) default %s%s/autoselect%s: media_status on unknown chipset 0x%x epstart: no header mbufepgetep_get: packet does not fit in MCLBYTES%s: device timeout %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! wi)%0)%)$)$)$)$)$)$)$p)$P )$0 )$ )$ )$ )$)$)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)# )#!)#")##)#$)#%)#p&)#p')#pPRISM3 (USB)PRISM3 ISL37300P(PCI)PRISM3 ISL37300PPRISM2.5 ISL3874A(PCI-bridge)PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 USBPRISM2.5 ISL3873PRISM2 HFA3842(EVAL)PRISM2 HWB3163(EVB2) SST-flashPRISM2 HWB3163 SST-flashPRISM1 HWB1153PRISM2 HFA3842(EVB3)PRISM2 HWB3163 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3763 rev.BPRISM2 HFA3841(EVB2)Lucent Embedded WaveLAN/IEEESony WaveLAN/IEEELucent WaveLAN/IEEE: unable to read station address address %sWaveLAN/IEEE nodeIBSS wlanwi_attach%s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: wi_cmd failed with %d %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: tx buffer allocation failed %s: mgmt. buffer allocation failed wi_do_hostencrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x wi_do_hostdecrypt%s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), Symbol %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x wihap_assoc_reqwihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlleam7990_config: weird memory size %lu: address %s %s: %d receive buffers, %d transmit buffers %s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d ne: where did the card go? : setup failed ne2000_attachne2000_detectne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: remote transmit DMA failed to complete qhqx@qhqx@ shsxgem %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create rx DMA map %d, error = %d %s: unable to create tx DMA map %d, error = %d , address %s %s: cannot reset device %s: cannot disable rx dma %s: cannot reset receiver %s: cannot disable tx dma %s: cannot reset transmitter gem: invalid Receive Descriptor ring size %d %s: can't load rx DMA map %d, error = %d gem_add_rxbuf%s: status=%b INTMETXEMPTYTXDONERXDONERXNOBUFRX_TAG_ERRPCSTXMACRXMACMACCONTROLMIFBERR%s: device timeout %s: mii_read timeout %s: mii_write timeout ti%s: failed to send write command, status: %x %s: failed to send address, status: %x %s: failed to send read command, status: %x tigon1tigon2%s: can't load firmware: unknown hardware rev %s: firmware revision mismatch; want %d.%d.%d, got %d.%d.%d %s: unknown link state code %d %s: invalid command %s: unknown command %s: bad config data %s: unknown event: %d ti_handle_events%s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: no memory for jumbo buffer queue ti_jfree: can't find softc pointer!ti_jfree: asked to free buffer that we don't manage!ti_jfree: buffer already free!ti_jfree: buffer not in use!%s: can't create recv map %s: overwritten!!!%s: unknown hwrev ti_iff%s: board self-diagnostics failed! %s: unsupported chip revision: %x %s: bios thinks we're in a 64 bit slot, but we aren't%s: chip initialization failed %s: failed to read station address , address %s %s: jumbo buffer allocation failed %s: couldn't get mbuf%s: initialization failure not enough mbufs for rx ring%s: watchdog timeout -- resetting comcomprmcomstart%s: %d silo overflow%s, %d ibuf overflow%s s: unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes vscsi %s: POLL && NOSLEEP for 0x%02x vscsipollvscsiccbsoftraid%s: could not allocate memory for metadata %s: could not allocate memory for foreign metadata %s:, sr_meta_probe: can't allocate vnode sr_meta_probe%s%d%c%s: read invalid metadata pointer %s: sr_meta_rw: can't allocate vnode %s: 0x%x i/o error on block %llu while reading metadata %d %s: sr_meta_clear can not clear foreign metadata %s: chunk sizes are not equal; up to %llu blocks wasted per chunk sr_meta_chunks_create%s: save metadata failed %s: no in memory copy of metadata %s: could not allocate metadata scratch area not yet save > 1 optional metadata members%s: could not write metadata to %s not yet read > 1 optional metadata members%s: invalid foreign metadata %s: not valid softraid metadata %s: %s can not read metadata version %u, expected %u %s: invalid metadata checksum sr_meta_validate%s:, sr_meta_native_bootprobe: can't allocate vnode %s: not enough memory for metadata buffer %s: not enough memory for fake discipline %s:, sr_meta_native_bootprobe: can't allocate vnode for partition %s: native bootprobe could not read native metadata sr_meta_native_bootprobesdwd%s: failed to allocate boot volume! %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_boot_assemblysr_meta_native_probe%s: could not read native metadata %s: not part of the same volume %s: not all chunks are of the native metadata format src_dev_mm == NODEVsr_meta_native_attachsr_locksr_hs_lock%s: controller registration failed negative wu sleeperssr_wu_get%s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: chunk not part of array %s: could not save metadata to %s %s: unsupported state request %d %s: %s is already a hotspare %s: %s is already in use %s:, sr_hotspare: can't allocate vnode %s: %s partition not of type RAID (%d) OPENBSDSR %sHOTSPARE%03dsr_hotspare%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s: discipline does not support rebuild %s: rebuild already in progress %s: %s not degraded %s: no offline chunks available for rebuild %s:, sr_rebuild_init: can't allocate vnode %s: partition too small, at least %llu B required %s: partition too large, wasting %llu B %s: rebuild of %s started on %s sr_rebuild_init%s: roaming device %s -> %s %s: could not initialize discipline %s: chunk %s already in use %s: invalid metadata format %s: can't attach metadata type %d %s: disk is currently in use; can't force create %s: failed to clear metadata %s: %s was not shutdown properly already assembled %s: one of the chunks has corrupt metadata; aborting assembly already assembled; will not partial assemble it %s: trying to bring up %s degraded %s: volume level does not match metadata level! %s: %s offline, will not be brought online %s: volume %s is roaming, it used to be %s, updating metadata %s: unable to create sensor for %s sr_ioctl_createraidsr_downsr_raid_inquirysr_raid_read_capsr_syncsr_raid_startwu%02xsr_checksum%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xsr_shutdown%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s sr_check_io_collision%s: unable to start backgound operation %s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %llu%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuildsr_yieldsr_rebuild_threadRAID 0%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d sr_raid0_rw%s: %s: too many ccbs queued %s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue RAID 1%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk stateinvalid volume state%s: %s: invalid volume state transition %d -> %d sr_raid1_rw%s: %s: too many ccbs queued %s: is offline, can't read %s: invalid target on wu: %p%s: retrying read on block %lld %s: permanently fail write on block %lld %s: wu: %p not on pending queue could not requeue ioRAID 4RAID 5%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk stateinvalid volume state%s: %s: invalid volume state transition %d -> %d sr_raidp_rw%s: can't get wu_wDisk %llx offline, regenerating buffer %s: is offline, can't read io error: disk %x %s: invalid target on wu: %p%s: retrying read on block %lld %s: permanently fail write on block %lld %s: wu: %p not on pending queue could not requeue io%.2x %c CRYPTOsr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_change_maskkey%s: %s is already in use %s:, sr_create_key_disk: can't allocate vnode %s: %s partition not of type RAID (%d) OPENBSDSR %sKEYDISK%03d%s: could not save metadata to %s sr_crypto_create_key_disk%s: not enough memory for metadata buffer %s: native bootprobe could not read native metadata %s: %s is not a key disk %s: not enough memory for chunk not yet read > 1 optional metadata memberssr_crypto_read_key_disksr_uioplsr_iovplsr_crypto_alloc_resourcessr_crypto_ioctlsr_crypto_rw2%s: %s: too many ccbs queued %s: i/o error on block %lld %s: invalid target on wu: %p%s: wu: %p not on pending queue sr_crypto_finish_ioRAID 6%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk stateold_state = %d, %d = %d, invalid new_state%s: %s: invalid volume state transition %d -> %d sr_raid6_rw%s: can't get wu_wDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy Disk %llx offline, regenerating Dx%s +Q singleio error: disk %x %s: invalid target on wu: %p%s: retrying read on block %lld %s: permanently fail write on block %lld %s: wu: %p not on pending queue could not requeue io/dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf: pf_src_connlimit: blocking address , %u states killed pf_src_connlimitpf: src_tree insert failed: pf_insert_src_nodediagnostic ../../../../net/pf.cs->key[idx] == NULLpf: %s key attach failed on %s: wirestack, existing: pf: key setup: pf_state_insertpf: state insert failed: id: %016llx creatorid: %08xpf: state key linking mismatch! dir=%s, if=%s, stored af=%u, a0: OUTIN, a1: , proto=%u, found af=%u, a0: pf: key search, if=%s: pftmstate->timeout != PFTM_UNLINKEDstate->timeout < PFTM_MAXpf_unlink_statepf_free_statecur->timeout == PFTM_UNLINKED%u.%u.%u.%u:%u:%x[%u]IPv4IPv6TCPUDPICMPICMPv6%u in out wire: (%d) stack: (%d) - [lo=%u high=%u win=%u modulator=%u wscale=%u] %u:%u @%dFSRPAUEWinvalid address type: %d pf_change_appf_change_a6pf_change_icmppf_modulate_sackpf_send_tcppf: pf_test_via: kif == NULL, @%d via %spf_step_into_anchor: stack overflow pf_get_wscalepf_get_msspf_calc_msspf_tcp_isspf_test_rulepf_normalize_tcp_stateful failed on first pktpf: loose state match: seq=%u (%u) ack=%u len=%u ackskew=%d pkts=%llu:%llu dir=%s,%s inoutfwdrevpf: BAD state: pf: State failure on: %c %c %c %c | %c %c pf: state reuse pf_test_state_tcppf_test_state_udppf: icmp type %d in wrong direction (%d): pf: ICMP error message too short (ip)pf: ICMP error message too short (ip6)pf: ICMPv6 short optpf: ICMP error message too short (tcp)pf: BAD ICMP %d:%d -> state: seq=%u pf: OK ICMP %d:%d pf: ICMP error message too short (udp)pf: ICMP error message too short (icmp)pf: ICMP error message too short (icmp6)pf_test_state_icmpnkpdpd->srcpd->dstpf_test_state_otherpf_routablepf_rtlabel_matchpf_route: invalid parameterspf_route: m0->m_len < sizeof(struct ip)pf_route: pf_map_addr() failed.pf_routepf_route6: invalid parameterspf_route6: m0->m_len < sizeof(struct ip6_hdr)pf_route6: pf_map_addr() failed.pf_route6pf_test: kif == NULL, if_xname %snon-M_PKTHDR is passed to pf_testpf: dropping IPv4 packet with ICMPv6 payloadpf: dropping packet with ip optionspf_test6: kif == NULL, if_xname %snon-M_PKTHDR is passed to pf_test6pf: IPv6 more than one rthdrpf: IPv6 short rthdrpf: IPv6 rthdr0pf: IPv6 short optpf: dropping IPv6 packet with ICMPv4 payloadpf: dropping packet with dangerous v6 headerspf_test6pffrentpffragpffrcachepffrcentpfstscrdiagnostic ../../../../net/pf_norm.cBUFFER_FRAGMENTS(frag)pf: expiring %d(%p) !BUFFER_FRAGMENTS(frag)TAILQ_EMPTY(&pf_cachequeue) || TAILQ_LAST(&pf_cachequeue, pf_cachequeue) != fragtrying to free > %d frentstrying to free > %d cache entriesLIST_EMPTY(&frag->fr_cache) || LIST_FIRST(&frag->fr_cache)->fr_off > frcache->fr_end*frag == NULL || BUFFER_FRAGMENTS(*frag)frep != NULL || frea != NULLoverlap -%dadjust overlap %dmissing fragment at %d, next %d, max %d%d < %d?frent != NULLdrop: too big: %dcomplete: %p(%d)IP_DFmff and %dmax packet %dreass frag %d @ %d-%d dropping bad fragmentsrc->scrub == NULLpf_normalize_tcp_initsrc->scrub || dst->scrubpf: %s: multiple TS??pf_normalize_tcp_statefulpf: src idled out of PAWS pf: dst idled out of PAWS Timestamp failed %c%c%c%c tsval: %lu tsecr: %lu +ticks: %lu idle: %lus %lums src->tsval: %lu tsecr: %lu dst->tsval: %lu tsecr: %lu tsval0: %lupf: did not receive expected RFC1323 timestamppf: broken RFC1323 stack did not timestamp data packet. Disabled PAWS security.pf_normalize_tcp_statefulpf_normalize_mss/pf: pf_find_or_create_ruleset: RB_INSERT1 '%s' '%s' collides with '%s' '%s' pf_find_or_create_ruleset: RB_INSERT2 '%s' '%s' collides with '%s' '%s'pf_anchor_setup: .. beyond root/*pf_anchor_setup: ruleset../pf_anchor_copyout: '%s' '%s'*pf_anchor_remove: broken refcountpfcnslkpfruleplpfsrctrplpfsnitemplpfstateplpfstatekeyplpfstateitemplpfruleitemplpfaltqplpfpurgepfpurge thread?pf_setup_pfsync_matchingpf: pf: started pf: stoppedaltq: startedaltq: stoppedpfioctlpfrktablepfrke_plainpfrke_routepfrkcounterspfr_clr_addrs: corruption detected (%d). pfr_add_addrspfr_del_addrspfr_set_addrspfr_tst_addrspfr_get_addrs: corruption detected (%d). pfr_get_astats: corruption detected (%d). pfr_clr_astatspfr_enqueue_addrs: IPv4 walktree failed. pfr_enqueue_addrs: IPv6 walktree failed. pfr_mark_addrs: IPv4 walktree failed. pfr_mark_addrs: IPv6 walktree failed. pfr_lookup_addrunknown pfrke_type %d pfr_insert_kentries: cannot route entry (code=%d). pfr_reset_feedbackpfr_route_kentrypfr_unroute_kentry: delete failed. pfr_unroute_kentrypfr_walktree_pfpfr_add_tablespfr_del_tablespfr_get_tables: corruption detected (%d). pfr_get_tstats: corruption detected (%d). pfr_clr_tstatspfr_set_tflagspfr_ina_definepfr_commit_ktablepfr_update_stats: assertion failed. pfr_attach_tablepfr_detach_table: refcount = %d. pfr_pool_getpf_osfp_fingerprintpf: fingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d)0*% pf_osfp_fingerprint_hdrosfp no match against %xosfp matched %s %s %s %x==%xfingerprint 0x%x didn't matchpfosfpenpfosfpadding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %xTSFound "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" pfiaddrplallpfi_kif_get for pfi_all failedpfi_kif_getpfi_kif_ref with unknown typepf: pfi_kif_unref: rules refcount <= 0 pfi_kif_unref: state refcount <= 0pfi_kif_unref with unknown typepfi_kif_get failedpfi_attach_ifnet: cannot allocate '%s' address hookself:network:broadcast:peer:0/%d_pfpfi_dynaddr_setuppfi_dynaddr_updatepfi_table_update: cannot set %d new addresses into table %s: %dpfi_address_add: address buffer full (%d/%d)pfi_address_add: no memory to grow buffer (%d/%d)pfi_update_statuspf_get_sportpf: pf_map_addr: src tracking (%u) maps to pf: pf_map_addr: selected address pf_map_addrpf: pf: NAT proxy port allocation (%u-%u) failedpf_get_transaddrpflogpflog%dpflog_packetpfsyncpfsync%dcarppfsync: pfsync_state_import: invalid creator id: %08x pfsync_state_import: unknown interface: %spfsync_input: PFSYNC5_ACT_INS: invalid valuepfsync_input: PFSYNC_ACT_UPD: invalid valuepfsync_input: PFSYNC_ACT_UPD_C: invalid valuereceived bulk update startreceived valid bulk update endreceived invalid bulk update end: bad timestamppfsync_insert: PFSYNC_ACT_TDB_UPD: invalid valuepfsyncioctlpfsync_insert_statepfsync_deferpfsync_undeferpfsync_deferredpfsync_deferred: unable to find deferred statepfsync_update_statepfsync_update_state: unexpected sync state %drequesting bulk updatepfsync_update_state_req: nonexistant instancepfsync_update_state_req: unexpected sync state %dpfsync_delete_statepfsync_delete_state: unexpected sync state %dpfsync_clear_statespfsync_clear_statesdiagnostic ../../../../net/if_pfsync.cst->sync_state == PFSYNC_S_NONEpfsync pkt len is too low %dst->sync_state != PFSYNC_S_NONEreceived bulk update requestfailed to receive bulk updatepflowpflow%dexport_pflow_ifbioioctlpppoepppoe%dpppoe: alien host unique tag, no session found %s: host unique tag found, but it belongs to a connection in state %d %s: wrong interface, not accepting host unique pppoeintrpppoe: packet too short: %d pppoe: could not get PPPoE header pppoe: unknown version/type packet: 0x%x pppoe: packet content does not fit: data available = %d, packet size = %u %s: parse error %s: tag 0x%x len 0x%x is too long TAG HUNIQUE ERRORTAG ACCOOKIE ERRORTAG RELAYSID ERRORSERVICE NAME ERRORAC SYSTEM ERRORGENERIC ERROR%s: %s: %c pppoe: received PADO but could not find request for it %s: received unexpected PADO %s: failed to send PADR, error=%d %s: session 0x%x connected %s: session 0x%x terminated, received PADT %s: unknown code (0x%04x) session = 0x%04x diagnostic ../../../../net/if_pppoe.cm->m_flags & M_PKTHDRpppoe (data): dropping too short packet: %d bytes pppoe (data): could not get PPPoE header pppoe (data): unknown version/type packet: 0x%x %s (%x) state=%d, session=0x%x output -> %s, len=%d pppoe_outputpppoe_send_padi in state %d%s: timeout %s: failed to transmit PADI, error=%d %s: failed to send PADI, error=%d %s: disconnecting %s: could not establish connection pppoe_send_padtaltq assertion "%s" failed: file "%s", line %d altq assertiontbr_set: no cpu clock available! altq_add: no cpu clockinit_machclkinvalid weight value %d for red! use %d cbq_add_queue: no parent class! cbq_add_class: borrow class != parent altq: packet for %s does not have pkthdr rmc_init: root class not allocated _rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_root_overlimitaltq: packet for %s does not have pkthdr hfsc_dequeue:altq: packet for %s does not have pkthdr All breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d * %-12s? No such command Ambiguous Bad modifier Count missing db_command%s the kernel did not panic nfsnodesnfsreqsbufsvnodesmountspoolscalloutprocswatchesvnodeuvmexpregistersprocpoolpanicpageobjectnfsnodenfsreqmountmapmallocextentsbufbreaksbcstatsallpoweroffreboothaltdumpcrashsyncdmesghangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine ddb> %sBad function Too many arguments Argument missing db_fncallELF[ %s symbol table has bad start address %p ] ELFbad magicbad e_machine.strtab.symtabsymtab unalignedsymtab corrupted[ using %lu bytes of %s ELF symbol table ] [ %s ELF symbol table not valid: %s ] : = 0x%lx %-*s%-*lx%-*ld%-*lu%-*lo%c\%03odb_examine%s%*lx%*ld%*lu%*lo db_print_cmdBad modifier bhlAddress missing Value missing Count missing Symbol not found Syntax error Divide by 0 Negative shift amount 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| () Score: %lu/%lu db_hangman^R Bad character in number Bad escape String too long Bad character --db_more--  -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*luFaulted in traceback, aborting... Starting stack trace... End of stack trace. %-12s%s %s+%s db_show_regs [after %6d] bsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s %s Sifting table %s: %s+%s [%s:%d]db_printsymAfter %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! loglinestabstopsmaxwidthmaxoffradixUnknown variable No value ? All watchpoints used. No map. Already set. Too many watchpoints. Not set. No watchpoints set Map Address Size %s%p %8lx %lx * Unknown size %s = %s Nothing written. db_write_cmdcdlinemichpspkrrecordinputvolumeinputsmasterdacoutputoutputsmonitoraudio audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer sourceselectaudioattachauddetaudiodetach: %s didn't detach au_portofaudio_attach_mi: NULL oplmpuaudioprint: unknown type %d%s at %saudio_open: 0 precision aud_draud_hraud_rdaudio_silence_copyoutaud_wrau_get_muteau_set_muteau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfowskbd_set_mixervolumeccdattach: count <= 0WARNING: no memory for concatenated disks ccdlockccdbufplccd%dccdinit: device name too long. ccdinitccdintrccdiodone (mirror)%s: error %d on component %d%s ccdiodone: countccdfictitiouscnopen: recursive/etc/firmware/%sMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d %s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... , address %s %s: device timeout dp8390_initdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%ddp8390_xmit: no packets to xmitdp8390_start: no header mbuf%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed  "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗systrrd%s: attach to %u: %d systracef_ioctlstrprocplstrpolplsystracesystrace_forkdiagnostic ../../../../dev/systrace.cstrp->proc == p%s: %u: policy %d systrace_answer%s: new, ents %d systrace_policy%s: %d -> pid %d %s: %d: code %d -> policy %d %s: %d systrace_getcwd%s: %u: %p(%lu) systrace_io%s: Trying to detach from %d systrace_detach%s: allocating %d -> %lu systrace_newpolicysystrmsg%s: %p: pid %d -> pid %d systrace_msg_child%s: free %d systrace_msg_policyfreevndencryptWARNING: no memory for vnode disks vndlockvndbufplvnd devicefictitiousvndiodonevnd%dVNDIOCSET: device name too long vndioctlvndioctl: null vp;n vAMaX ֣d° xextract_entropyarc4_stirarc4maybeinit: prematurearc4random_buf_largerndrdcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASP   T   ( 0  cd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ..cd9660_strategy: spectag VT_ISOFS, isofs vnode udf_disklabelspoof & & 3t 4 5 5( 5l 5t : :D &T :` :hudftrpludfndpludfdspludfCan't read sector %d of VDS Cannot read sector %d for Metadata File Entry Invalid Metadata File FE @ sector %d! (tag.id %d) FSD does not lie within the partition! Cannot read sector %d of FSD Couldn't find the fsd Cannot read sector %d Invalid root file entry! Invalid file entry! unodeUnrecognized file type (%d) found a vnode alias *UDF Virtual Partition*UDF Sparable Partition*UDF Metadata Partitionudf_find_partmapshash entry is NULL, up->u_ino = %dudf_allocv: failed to allocate new vnode udf_transname(): name too long udf_transname(): Unicode translation failed udf: invalid FID fragment udf: invalid FID Invalid FID tag (%d) uiomove returned %d udf_readdirtag VT_UDF, hash id %u udf_lookup: Invalid tag warning: udf_readlblks returned error %d Cannot deal with strategy4096 yet! Unknown strategy type %d SFile offset out of bounds (%d > %d) LFile offset out of bounds (%d > %d) Unsupported allocation descriptor %d exec: a VTEXT vnode has writecount != 0elf32_load_fileexec: a VTEXT vnode has writecount != 0OpenBSDELFcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldcoredump_elf32coredump_notes_elf32%s@%dcoredump_note_elf32#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvmcmdset_extend: not necessarydiagnostic ../../../../kern/exec_subr.cocnt > 0exec_process_vmcmds: RELATIVE no baseCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2010 OpenBSD. All rights reserved. http://www.OpenBSD.org %s swapperfork initcfpendvscsisoftraidcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initacct_processacctAccounting resumed Accounting suspended acct_threadinitclocks: unable to register softclock intrfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfilefdlockclosef: count < 0closefclosef: count: %d/%dkqueueplknoteplkqreaddiagnostic ../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != iinit died (signal %d, exit %d)cpu_exit returnedreaperwaitdiagnostic ../../../../kern/kern_exit.cTAILQ_EMPTY(&p->p_p->ps_threads)procppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qktrsyscallktrsysretktrnameiktremulktrgenioktrpsigktrcswktrace write failed, errno %d, tracing stopped lockmgr: process context requiredlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: release of unlocked lock!lockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d not locked with %d pendinglkmopnlkmlookupDDB symbols added: %ld bytes DRMAGP MemoryBluetooth HIDUDF file idUDF file entryUDF mountbwmeterbluetoothkqueueNTFS vrunNTFS decompNTFS resident data NTFS file attrNTFS hash tablesNTFS dirNTFS fnodeNTFS nodeNTFS mounttemprp_addrip6rrNDPip6_optionsemuldata1394data1394ctlpacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey datamiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeVFS clustersubprocprocfile descfileVM pmapACPIdirhashsemVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopssysctlsooptsifaddrfragtblroutetblpcbdebugdevbufmbuffreesysctlklk??malloc - bogus typemalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple freeskmeminit: minbucket too small/struct freelist too big%d,%s,%15s %5s %6s %7s %6s %9s %8s %8s TypeInUseMemUseHighUseLimitRequestsType LimKern Lim%15s %5ld %6ldK %7ldK %6ldK %9ld %8d %8d  $$rw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%x%s: lock not held%s: lock not held by this process%s: lock not shared%s: lock heldphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbufputphysbuf: private buf B_WANTEDprocinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc)))))))onprocdeadzombiestopsleeprunidle%dPROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s plimitplidle%dfork idlediagnostic ../../../../kern/kern_sched.cci == curcpu()curproc == spc->spc_idleprocsched_idlecpu_switchto returnedsetrunqueueremrunqueuesched_chooseprocpstunrsensor_task_unregister: unexpected state %dsigaplpausepsignal signal numberProcess (pid %d) got signal %d issignal postsigpostsig action/var/crash/%s%s.corecoredumpcoredump_tradpid %d (%s): %s write of %lu@%p at %lld failed: %d usersystemuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cntpowerhook_disestablish: hook not establishedsysctllksysctldlkkern_sysctl%s,tsleep: no identtsleep: not SONPROCsleep_finishsleep_finish !SONPROCwakeup: p_stat is %ddenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks (%d) < 0?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasks%sunable to create system work queue threadwqdestroyunable to create thread for "%s" workq boredschedstatesmashed stack in %sdiagnostic ../../../../kern/sched_bsd.cphzupdatepripreempt: cpu_preempt not yet implementedp->p_stat != SONPROCmi_switchp->p_cpu == curcpu()setrunnableresetpriority>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s at root%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_pending_decr: config_pending == 0activate: %s %d config_activate_children: device %s failed %d failing resume cannot be handled resume %s %s%d%c: %s %sing fsbn readwrit%lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)dklkdisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 cannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %dcannot close disk , 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs dk_mountrootuse one of: exit %s[a-p] %s parsediskroot device (default %s%c): exitswap device (default %s%s)b%s%d%croot device (%s) not foundnetbootcan't figure root, hope your kernel is right root on %s%c swap on %s%d%c dump on %s%d%csetrootfindblkmajorintrextent_register: already registeredextentplextent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixedextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusiveextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx klogdiagnostic ../../../../kern/subr_pool.cph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpoolpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)pool_getpool_get: PR_ZERO when ctor setpool_do_get: %s: crossed hard limit%s pool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentpool_put of NULLpool_do_putpool %s: putting with none out pool_do_put: %s: page header missing((((vaddr_t)pi) + ioff) & (align - 1)) == 0ph->ph_nmissing == 0 page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s NameSizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s AddressAllocator%-10s %18p %18p inf%u%-*s %*u %*lu %*d %*s %*lu db_show_all_pools%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%dlogpri%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad basekprintf?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at root%c ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s already enabled %3d can't enable free slot command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... sys_ioctlselectpollpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipepldiagnostic ../../../../kern/sys_process.c(p->p_flag & P_SYSTEM) == 0ptrace: impossiblesysvmsgplmsgqrmNULL userbuffermsgwaitfreeing message queue with active referencesmsg NULLSysV message longer than MSGMAXsemaplsemuplsemwaitsemop - can't undo undossemexit - semid not allocatedsemexit - semnum out of rangeshmseg free count inconsistentshmpl@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk iowaitrunnablerunningttyfree: tty_count < 0ptarrlk/dev/XtyXXpqrstuvwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZptydevnameptyptcreadptcwriteptmattach: Can't find pty slave in cdevswnmea%dSignalGPRMCGPSGPS simulatedGPS estimatedGPS autonomousGPS differentialGPS invalidGPS unknownmsts%dSignalMSTSendrun%dSignalEndRunputc: required clalloc b_to_q: required clalloc WARNING: mclpools limit reached; increase kern.maxclustersmbplmcl%dkm_clget: request for %u byte clusterunknown type of extension bufferm_defrag: no packet hdr or not a chainmbuf prepend length too bigm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufdiagnostic ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRm == NULL in m_pulldown()unixsockplsofreenetclssoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic ../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3sonewconnsoqinsquenetionetlckdiagnostic ../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d netconacceptnetcon2uipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfreebremfree: lost tailbuf_putdiagnostic ../../../../kern/vfs_bio.cbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybufplneedbufferbp->b_lblkno == blkno + 1bp->b_vp == vpbuf_dirtyTrying to dirty buffer on freelist!buf_undirtyTrying to undirty buffer on freelist!getblkbuf_get: dup lblk vp %p bp %pcleanerClean buffer on BQ_DIRTY!(bp->b_flags & B_ASYNC)biowaitbiodonebiodone alreadyCurrent Buffer Cache status: numbufs %lld, freebufs %lld bufpages %lld, freepages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bufinit: can't reserve VM for buffersdiagnostic ../../../../kern/vfs_biomem.c(bp->b_flags & B_BUSY) == 0buf_mapbuf_needvapg != NULLbp->b_flags & B_BUSY(bp->b_data != NULL) || (bp->b_flags & B_NOTMAPPED)bp->b_data != NULLsize == round_page(size)bp->b_pobj == NULLbp->b_data == NULLbuf_page_offset > 0buf_alloc_pages: overlap buf: %p page: %pbuf_alloc_pagesuobj != NULLpg->wire_count == 1cache_lookupcache_revlookup: found entry for .cache_revlookup: found entry for ..wtf? leak?nchplcluster_wbuild: size %ld != filesize %ldvop_generic_revokevop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vnodesvfslockvnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svgetvref used where vget requiredvref on a VNON vnodeUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockvdrop: zero holdcntvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s) vprintkinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} UDFNTFSNNPFSVFSEXT2FSADOSFSISOFSAFSPROCFSPORTALMSDOSFSMFSNFSUFSNONtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail $lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,fsync failedmounted on: %s sched_sync: fsync failedsyncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lock..getcwd: oops, forgot to null lvpgetcwd: oops, went back too fardefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfiforfifowfifo_read modefifo_write modetag VT_NON , fifo with %ld readers and %ld writersfifo_badop called(%s)* * * * * waitrunstepdetachattach********** * * * * *****x*p*h*`*X*P*H*@*8*0*(* **usr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_controlprocfs_doctl total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB procfs_domeminfoprocfs_docpuinfoprocfs_donote %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld %ld,%ld %ld,%ld %snochan %u, %u,%u procfs_stat_genprocfslprocfs_allocvpprocfs: invalid directory entry sizeprocfsʘP ʠ ( < execmdlinenotepgnotestatusctlmemfile...cpuinfomeminfotag VT_PROCFS, type %d, pid %d, mode %x, flags %lx %ldprocfs_getattrprocfs_getattrcurprocselfprocfs_readdirprocfs_readlinkspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) !#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activefatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAaUmsdosfs_sync: rofs mod7CCDX DE FF Gmsdosfs_create: no namemsdosfs_createmsdosfs_write(): bad file typemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_renamemsdosfs_mkdir: no namemsdosfs_mkdir...msdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED) bpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfwritebpf_mcopybpfattachifaddritempooltoo many interfacesallif_attach_common: mallocif_startif_clone_listif_downallif_downif_uprtinit: rtable_addifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ x      ;n C&vkkMGP&"/+Ka5 d1͆< 8O!*`#%d&&&'-0.0x2L223,lcp!*5d55555:L;>>???EEGGGGGipv6cp#*0r r X,XXZZr r [pap#*pr r OP$PPQdRr r Rchap%s: input packet is too small, %d bytes %s: Failed to align packet! %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow %s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: no memory for transmit header %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%x 0x%x 0x%x 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%x %s: loopback %s: up %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: %s output <%s id=0x%x len=%d> %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: invalid proto-rej length ?%s: %s: RXJ%c (%s) for proto 0x%x (%s/%s) unknown%s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s up(%s) %s: %s down(%s) %s: %s open(%s) %s: %s close(%s) %s: %s TO(%s) rst_counter = %d %s: %s %s->%s %s: Up event(incoming call) %s: Down event (carrier loss), taking interface down.%s: Down event (carrier loss) %s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] max_failure (%d) exceeded, send conf-rej send conf-nak send conf-ack %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: lcp nak opts: magic glitch %d sppp_lcp_scr%s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-ack %s: ipcp rej opts: %s: ipcp nak opts: [wantaddr %s] [agree] %s: ipcp_open(): no IP interface sppp_ipcp_scr%s: ipv6cp_open(): no IPv6 interface sppp_ipv6cp_open%s: ipv6cp parse opts: %s [invalid] [rej]%s: ipv6cp parse opt values: %s [%s] send %s send %s suggest %s sppp_ipv6cp_RCR%s: ipv6cp rej opts:%s: ipv6cp nak opts: [suggestaddr %s] [random] [agree]sppp_ipv6cp_RCN_naksppp_ipv6cp_scr%s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%dsppp_chap_input%s: chap TO(%s) rst_counter = %d %s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging suppressed %s: chap tld %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: pap TO(%s) rst_counter = %d %s: pap peer TO %s: pap tld %s: LCP keepalive timeout %s: sppp_set_ip_addrs: in_ifinit failed, error=%d sppp_set_ip_addrssppp_clear_ip_addrssppp_get_ip6_addrssppp_set_ip6_addrsppp_suggest_ip6_addrconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%xchallengeresponsesuccessfailurereqacknakmruasync-mapauth-protoqual-protomagicproto-compaddr-compaddressescompressionaddressifidinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegaldeadestablishterminateauthenticatenetwork %02x-%02x\x%x%c%d.%d.%d.%d%s: phase %s lolo%dlooutput: no header mbuf%s: can't handle af%d lo_altqstart: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedifmedia_match: multiple match for 0x%x/0x%x, selected instance %d sl%s%dsl%d: can't allocate buffer %s: af%d not supported %s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d slstartslinputppp%s%dpppdealloc%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x pppioctl%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: af%d not supported mbuf packet without packet header!%s output: ppp_requeuepppintrif_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full %s pppdumpmpppwritepppasyncstart%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! %s input: %s pppdumpbbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary z_compress: deflate returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_incomp%d: inflateIncomp returned %d (%s)       0F*80K*9L*9unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check??invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat #+3;CScs !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream endtun%s%dtunopentunreadtunstartbridge%s%dbridge_ioctlbridge_brlconfbridge_input(): no HDRbridge_broadcastbridge_rtfindbridge_ipsecnot implementedbstp_notify_rtagebstp still activenot a bstp membervlanvlanattach: hashinit%s%d%s: initialized with non-standard mtu %lu (parent %s) %svlan_ioctlvlan_ether_purgemultirn_addmask: mask impossibly already in tree Mask for route not entered rn_addroute: t->rn_p is NULLNon-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2next == NULLraw_usrreqrtentplroute_init rtable_addrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtflushclone: called with a non-cloning routertflushclone: no rnh_walktreertrequest deletertrequest1rtinit: wrong ifa (%p) was (%p) rtinitrt_timer_init: already initializedrttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroute_outputrt_msg1sysctl_dumpentryroutesl_compress_tcpenc%dgre%s%d%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d gre_ioctltrunk%s%d%s: capabilities 0x%08x trunk_port_lladdr%s: using proto %u trunk_ioctl%s: failed to remove multicast address on all ports trunk_ether_purgemulti%s: ioctl %lu failed on %s: %d trunk_ether_cmdmultitrunk_enqueuetrunk_hashmbuf%s trunk_media_change%s: port %s at index %d <`ج%s: ADDMULTI failed on %s lacp_port_createlacp_port_creatediagnostic ../../../../net/trunklacp.c!TAILQ_EMPTY(&la->la_ports)la->la_nports > 0la->la_refcnt >= la->la_nportsla->la_refcnt > la->la_nportsTAILQ_EMPTY(&lsc->lsc_aggregators)lsc->lsc_active_aggregator == NULL(lp->lp_state & LACP_STATE_DISTRIBUTING) != 0best_la == NULL || best_la->la_nports > 0best_la == NULL || !TAILQ_EMPTY(&best_la->la_ports)i == p->pm_countla->la_refcnt > 0la->la_refcnt == 0lsc->lsc_active_aggregator != la!LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)lp->lp_mux_state == LACP_MUX_DETACHED || la != NULLla->la_pending > 0 || !LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)%s: unknown statelacp_sm_muxla->la_pending > 0lacp_set_muxlp->lp_timer[i] >= 0vethervether%darp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s in_arpinputarptfreerevarprequestrevarp[NULL][%d,] ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold_head=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) in_controlin_controlinvalid argument to in_lifaddr_ioctlin_lifaddr_ioctlin_ifinitin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectin_pcbnotifyallin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d in6_pcbhashlookup: faddr= fport=%d laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in6_pcblookup_listen: laddr= lport=%d internetdivert_packetdivert_usrreqicmp_erroricmp lenicmp_reflecticmp_mtudisc_timeout: bad route to timeouticmp_mtudisc_timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dKgpqrstuvwxyzipqeplipqplip_initaeshmac-sha1deflateipintr no HDRsave_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_savecontrolip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_init ip_mrouter_done add_vif #%d, lcladdr %x, %s %x, thresh %x rmtaddrmaskadd_vifreset_vifdel_vif %d, numvifs %d add_mfc update o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x add_mfcdel_mfc origin %x mcastgrp %x del_mfcip_mforward: src %x, dst %x, ifp %p ip_mforward: received source-routed packet from %x ip_mforward: no rte s %x g %x ip_mforward: ip_mrouter socket queue full expire_upcalls: expiring (%x %x) wrong if: ifp %p vifi %d vififp %p phyint_send on vif %ld err %d bw_upcalls_send: cannot allocate mbuf bw_upcalls_send: ip_mrouter socket queue full bw_upcalls_sendunschedule_bw_meter: bw_meter entry not foundip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %dip_outputmalformed IPv4 option passed to ip_optcopyip_setmoptionsrip_attachrip_detachrip_usrreqm_pulldown malfunctiontcp_input: TCPS_LISTENtcp_inputtcp_dooptionstcp_sack_optiontcp_pulloutofbandsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanupsyn_cache_respondtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_outputtcp_output REXMTtcpcbpltcpqeplsackhlpltcp_inittcp_respondassumption failed in tcp6_ctlinputtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_signature<Htcp_timer_rexmttcp_usrreqtcp_identm_pulldown malfunctionudp_inputudp6_ctlinputIPv6 inpcb to udp_outputudp_usrreqTCP MD5 Signature Option, RFC 2385IPcompIPsec ESPIPsec AHIPv4 Simple Encapsulationgettdbbysrcdstno tdb hash table tdb cnt bucket cnt %d%s %d +%d.%d.%d.%d(unknown address family)ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) ipsp_spd_lookupipsec policyipsec acquireipsp_spd_inpipip_input: should never reach hereipe4_input(): should never be called etherip_inputipsec_common_inputipsec_common_input_cbipsec_common_ctlinputudpencap_ctlinputah6_input: l went zero or negativeesp6_input: l went zero or negativeipcomp6_input: l went zero or negativeesp_initesp_input_cbah_initah_massage_headersah_input_cbcarpcarp_hmac_prepare_ctxcarp_hmac_generatecarp_hmac_verifycarp_setroute%s: carp: packet received on non-carp interface: %s received ttl %d != %d on %spacket too short %d on %schecksum failed on %sm_pulldown malfunctionpacket size %u too smallchecksum failed, on %sinvalid version %d != %dincorrect hashreplay or network loop detected%s%dip_output failed: %dip6_output failed: %dcarp_send_adcarp_update_lsmask: %x%s: master_down event in INIT state carp_join_multicast6carp_ioctlcarp_vhids_ioctlallMASTERBACKUPINITstate transition (vhid %d): %s -> %sstate transition: %s -> %s%s demoted group %s to %dcarp_ether_purgemultiipcomp_initcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj ggQRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOj ggʧ;l٫Ak[~!y1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("cryptopcryptodesccryptocryptof_ioctlcrydevcuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for len66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRAES-XTSARC4NULLHMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptaes_xts_cryptHMAC_MD5_InitHMAC_MD5_FinalHMAC_SHA1_InitHMAC_SHA1_FinalHMAC_SHA256_InitHMAC_SHA256_Final H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fbind failed krpc_call: sosend: %d RPC timeout for server %s (0x%x) prog %u rpc denied, error=%d rpc denied, status=%d nfs_read modenfsbioread nfsbioread: type %x unexpected nfs_write modenfs_write procnfsvinvalProcess killed due to text file modification nfs_doio: type %x unexpected nfs_boot: no suitable interfacenfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%dreverse arp not answered by rarpd(8) or dhcpd(8)nfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot_getfhnfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply xid 0x%x flags 0x%x rexmit %i procnum %i proc %p mreq %p mrep %p md %p nfsmount %p vnode %p timer %i rtt %i size %llu flag %i vnode %p accstamp %i pushedlo %llu pushedhi %llu pushlo %llu pushhi %llu commitflags %i nfshshlknfs_commitlkdiagnostic ../../../../nfs/nfs_node.cnp2 == NULLnfs_ngetnfs_inactive: pushing activeNULL v_data (no nfsnode set up?) in vnode %p nfs_reclaim: pushing activenfskqlknfskqpwnfskqdetHnfskqpollnfsrv3_accessnfsrv_getattrnfsrv_setattrnfsrv_lookupnfsrv_readlinknfsrv_read iovnfsrv_readnfsrv_writenfsrv_createnfsrv_mknodnfsrv_removenfsrv_renamenfsrv_linknfsrv_symlinknfsrv_mkdirnfsrv_rmdirnfsrv_readdirnfsrv_readdirplusnfsrv_commitnfsrv_statfsnfsrv_fsinfonfsrv_pathconfnfsconnfscon sotypenfsreconshort receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilis alive againnfsretrynot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlocknfs_realign_fixup: no memory to pad tonfs server %s: %s nfs getstreamnfsd wakeupnfsrv cachenfsrcdiagnostic ../../../../nfs/nfs_subs.cauth_type == RPCAUTH_UNIXnfs S too bignfsreqplnfsnodeplbuild > MLENnfsd initbad nfs svc reply, siz = %i ndscplnfsidlnfsionfsd6d 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 nfs: sillyrename dir .nfs%08X%08Xnfs physio/asyncnfsfsyncnfs_fsync: not dirtynfs_fsynctag VT_NFS, fileid %ld fsid 0x%lx bwrite: buffer is not busy???dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialuid %u on %s: %s file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,ffs2_reallocblks: unallocated block 1ffs2_reallocblks: non-logical clusterffs2_reallocblks: non-physical cluster %dffs2_reallocblk: start == endffs2_reallocblks: unallocated block 2ffs2_reallocblks: alloc mismatchffs2_reallocblks: unallocated block 3mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs2_balloc: block too bigffs2_balloc: ufs_bmaparray returned indirect blockffs2_balloc: unwind failedffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizeDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlap?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@S\gj,klq@qstffs_mountroot: can't setup bdevvp's ffsroot_deviceWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1 ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsfs = %s update: rofs modinodeffsinodino1pldino2plffs_read: modeffs_read: short symlinkffs_read: type %dffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtynewdirblkdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepsema_release: not heldsoftdep_free: unknown type %dsoftdep_freequeue_processadd_to_worklist: already on list%s_process_worklist: Unknown type %ssoftdep???softdep_move_dependencies: need merge codesoftflushpagedep_lookupinodedep_lookuppagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplnewdirblkplsoftdep_setup_inomapdep: found inodesoftdep_setup_blkmapdep: found blockbmsafemap_lookupsoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entryallocdirect_mergeallocdirect_merge: old %d != new %d || lbn %ld >= %dallocdirect_merge: extra newdirblknewfreefrag: frag sizesoftdep_setup_allocindir_page: Bonk art in the headsetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: lost pagedepdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %sfree_allocdirectfree_allocdirect: extra newdirblkfree_newdirblkcheck_inode_unwrittencheck_inode_unwritten: busy inodehandle_workitem_freeblocks: block count handle_workitem_freeblksindir_trunc: lost indirdepindir_trunc: dangling depfree_allocindirsoftdep_setup_directory_add: lost inodedepsoftdep_setup_directory_add: lost entryfree_diraddfree_diradd: unfound refnewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %dsoftdep_change_linkcnt: bad deltahandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncatehandle_workitem_freefilesoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %sinitiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepageinitiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2initiate_write_inodeblock_ufs2: already startedinitiate_write_inodeblock_ufs2: I/O underway%s: direct pointer #%ld mismatch %ld != %ld%s: indirect pointer #%ld mismatch %ld != %ldsoftdep_write_inodeblock: lost dep3disk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %shandle_allocdirect_partdonehandle_allocdirect_partdone: dangling dephandle_allocindir_partdonehandle_allocindir_partdone: dangling dependencyhandle_written_inodeblockhandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %ddirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedepdiradd_inode_writtenhandle_written_mkdirhandle_written_mkdir: bad typehandle_written_filepagehandle_written_filepage: not startedhandle_written_filepage: attachedsoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedmerge_inode_listssoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdevsoftdep_fsync_mountdev: not dirtysoftdep_sync_metadata: Unknown type %sflush_inodedep_depsflush_pagedep_depsflush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedrequest_cleanup: unknown typesoftupdateclear_remove: vgetclear_remove: fsyncclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2softdep_check_for_rollback: Unexpected type %sgetdirtybufsdsdtydrain_outputsoftdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error%s: got error %d while accessing filesystem deps: %s%s(%p) state %b %sATTACHEDUNDONECOMPLETEDEPCOMPLETEMKDIR_PARENTMKDIR_BODYRMDIRDIRCHG GOINGAWAY IOSTARTED SPACECOUNTED NEWBLOCKUFS1FMTONWORKLISTmount %p ino %u lbn %lld fs %p ino %u nlinkdelta %u dino %p %s bp %p savsz %lld fs %p newblk %lld state %d bmsafemap %p buf %p lbn %lld newlbk %d oldblk %d newsize %lu olsize %lu %s bp %p inodedep %p freefrag %p savedata %p savebp %p off %d newblk %d oldblk %d freefrag %p %s indirdep %p buf %p vnode %p mp %p blkno %lld fsize %ld ino %u previno %u devvp %p mp %p oldsz %lld newsz %lld %s chkcnt %d uid %d mode %x oldino %u vnode %p mp %p off %ld ino %u da_un %p diradd %p bp %p mp %p ino %u dm_un %p pagedep %p worklist_print0x2g4xklq@q4t4mfs_mount: dup devmfsidlmfs_open not VBLKmfs_strategy: bad devmfs_close: dirty buffers mfs_inactive: not inactive (mfs_buflist %p)tag VT_MFS, pid %d, base %p, size %ld mfs_badop calledufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specifiedufs_getlbns: indirect block %d not founddiagnostic ../../../../ufs/ufs/ufs_dirhash.c((((ip)->i_ump->um_fstype == 1) ? (ip)->dinode_u.ffs1_din->di_size : (ip)->dinode_u.ffs2_din->di_size) >= (1 << 9))(dh->dh_onlist)ufsdirhash_lookup: bad offset in hash array(dirblock < dh->dh_nblk && dh->dh_blkfree[dirblock] >= (((slotneeded) + (( 4) - 1)) / ( 4)))ufsdirhash_findfree: free mismatch(offset < dh->dh_dirblks * (1 << 9))(oldoff < dh->dh_dirblks * (1 << 9) && newoff < dh->dh_dirblks * (1 << 9))(offset == dh->dh_dirblks * (1 << 9))(offset <= dh->dh_dirblks * (1 << 9))ufsdirhash_dirtrunc: blocks in useufsdirhash_dirtrunc: first free corruptufsdirhash_checkblock: bad offsetufsdirhash_checkblock: bad dirufsdirhash_checkblock: bad dir endufsdirhash_checkblock: bad free countufsdirhash_checkblock: bad first-freeufsdirhash_checkblock: missing first-free entry(block < dh->dh_nblk && block < dh->dh_dirblks)(dh->dh_hused < dh->dh_hlen)ufsdirhash_findslot: '%.*s' not found(dh->dh_hused >= 0)(dh->dh_hash != 0L)dirhash((((&ufsdirhash_list)->tqh_first) == 0L))ufs_inactive: pushing activeufs_reclaim: pushing activemangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory undefinedgroupuserchkdqufs_quota_free_blocks2: vnode is not locked %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too longchkiq %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too longchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquotquotaon: mount point not busyquotaoff: mount point not busysetquotasetusedquotfree dquot isn'tdqsync: dquotdqsync: filedqsyncchown: lost quotaufs_link: no nameufs_linkufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_renameufs_mkdir: no nameufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no nameufs_makeinodeext2fs_alloc: missing credentialfile system full %s: write failed, file system is full mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapbad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodestart = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapuid %u on %s: %s ext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %dext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cacheext2fs_inactive: pushing activeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_indirtrunc: bad buffer sizeext2fs_readdirmangled entryi_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrydirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2ext2fs_direntercheckpath: .. not a directory checkpath%s: modeext2fs_read%s: short symlink%s: type %dext2fs_write%s: nonsync dir write%s: typeDisk overlap start %lld, end %lld overlap start %lld, end %lld Disk buffer overlap5ACPEFIJd3xJext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fsroot_device%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsfs = %s update: rofs modinodeExt2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_makeinode: no nameext2fs_reclaim: pushing active%u/%unnpfs_devclose never opened?nnpfsreadnnpfs_message_rpc: deadlock avoided pid = %u == %u NNPFS PANIC Error: Message to small to receive wakeup, opcode = %d nnpfsNNPFS PANIC Warning nnpfs_dev: Unknown message opcode == %d NNPFS PANIC Error: Could not wakeup requestor with opcode = %d properly, to small receive buffer. NNPFS PANIC WARNING! nnpfs_message_installroot: called again! NNPFS PANIC WARNING! nnpfs_message_installnode: no parent nnpfs_message_installattr: tokens and no data NNPFS PANIC WARNING! nnpfs_message_installdata failed! Reason: lookup failed on cache file '%s', error = %d NNPFS PANIC WARNING! nnpfs_message_installdata failed Reason: No node to install the data into! NNPFS PANIC WARNING! nnpfs_message_updatefid: %d vrele: bad ref countvrele: ref cntnnpfs_node_purgennpfs_lockfailed to allocate syncer node when nnpfs daemon diednnpfs_attr2attr: bad valuennpfs_attr2vattr: bad valueNNPFS PANIC WARNING! nnpfs_dnlc_enter: %s already in cache lookup_nodegetfh_compatnnpfs: remote pioctl: got a negative data size: opcode: %dnnpfs_pioctl_call: got a humongous in packet: opcode: %dnnpfs_fhopennnpfs|,4PXhlnnpfs_readdir: mail arla-drinkers and tell them to bake burned cookiesnnpfs_lock: lock NULLnnpfs_unlock: lock NULLNNPFS PANIC WARNING! nnpfs_fsync called after reclaiming! nnpfs_uio_end_lengthnnpfs_lookup_commonnnpfs_create_commonnnpfs_remove_commonnnpfs_rename_commonnnpfs_mkdir_commonnnpfs_rmdir_commonnnpfs_link_commonnnpfs_inactive: failed writing back data: %d xnode: fid: %d.%d.%d.%d attr: %svalid in data: %svalid flags: 0x%x offset: %d amappldiagnostic ../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpage(( offset) & (PAGE_SIZE - 1)) == 0amap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereanonpldiagnostic ../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anon_pagein: uvmfault_anonget -> %duao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic ../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_detuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_getpageuao_getudv_attachdiagnostic ../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1diagnostic ../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)uvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startentry->next != &map->header && entry->next->start <= entry->enduvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic ../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerkm_pgrmuvm_km_pgremove_intrsafe: no pagevm_map_pmap(map) == pmap_kernel()km_getwait2km_alloc1wvallocwaitkmthreadkmallocgetpagevmmapbsydiagnostic ../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries uvm_mapent_allocuvm_mapent_free# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# back merges skipped# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_pUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthuvm_unmap_removevm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsvmmaplkfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> BUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< diagnostic ../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)diagnostic ../../../../uvm/uvm_object.cpgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)pg != NULL!(pg->pg_flags & PG_RELEASED)diagnostic ../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0pg->pg_flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! obj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %dsaved_loan_count == 0pg->wire_count == 0lcv != -1diagnostic ../../../../uvm/uvm_pager.cpseg->start == 0pseg->use == 0pseg != &psegs[0]pseg->start != 0pagersegpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)size <= MAXBSIZEpppp->pg_flags & PG_BUSYuvm_aio_biodonenpages <= MAXPHYS >> PAGE_SHIFTuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0rvpg != NULLpagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic ../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLdiagnostic ../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)(m->pg_flags & (PQ_ACTIVE|PQ_INACTIVE)) == 0%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrsys_swapctlswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filesw_reg_iodonediagnostic ../../../../uvm/uvm_swap.cvnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrswap_decrypt: key not initializedsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attachuvn_termdiagnostic ../../../../uvm/uvm_vnode.cRB_EMPTY(&uobj->memt)uvm_vnp_terminate: io sync wanted bit setuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncgif%s%dgif_output: recursively called too many times NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egress%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d in_gif_outputin6_gif_outputin6_pcbconnectHuh? Thought in6_pcbnotify() never got called with mapped! in6_pcbnotifyin6_ifloop_request: %s operation failed for %s (errno=%d) ADDDELETEin6_ifloop_requestprefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_controlin6_update_ifain6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifain6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified divert6_packetdivert6_usrreqget_rand_ifid%s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach_linklocalin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_ifattach_loopbackin6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifattach%s: didn't unlink in6ifaddr from list in6_ifdetachin6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6m_pulldown malfunctionm_pulldown malfunction%s:%d: ip6q already locked ../../../../netinet6/frag6.cip6q_lock%s:%d: ip6q lock not held ip6q lock checkicmp6_mtudisc_callback_registerm_pulldown malfunctionENOBUFS in icmp6_error %d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_notify_error: in6_embedscope failed icmp6_notify_erroricmp6_mtudisc_updateni6_inputshould not reach hereicmp6_rip6_inputsanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d icmp6_reflect(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_inputicmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s m_pulldown malfunctionip6_inputip6_savecontrolip6_pullexthdr: invalid nxt=%d ip6_nexthdr: m == NULLip6_nexthdrOpenBSD-currentcannot forward from %s to %s nxt %d received on %s ip6_forward: tag of length %d (should be %dcannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forwardip6_mrouter_doneregister_mifadd_m6ifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fccannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full ip6_mforwardip6_mdqregister_sendm_pulldown malfunctionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_outputip6_ctloutputip6_getpcbopt: unexpected option ip6_getpcboptip6_setmoptionsip6_setpktopt: impossible case m_pulldown malfunctionm_pulldown malfunctionnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookup: failed to lookup %s (if = %s) unspecnd6_lookupnd6_freend6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_rtrequestdefault router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_ioctlifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_inputnd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_ns_outputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_na_outputnd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_inputdefrouter_addreqdefrtrlist_del: negative count on %s dr == NULL in defrouter_delreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlinknd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlinkin6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifaddin6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_detachrip6_usrreqrip6_usrrequdp6_outputPF_KEY @@@@@(@(@PP   pfkeyv2_policyipsec policypfkeyv2_sendaesaesctr3desdesblowfishskipjackcast128deflatelzshmac-sha1hmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512pfkeyv2_parsemessageexec: a VTEXT vnode has writecount != 0compat_25_sys_statfscompat_25_sys_fstatfscompat_25_sys_getfsstatcompat_35_sys_fhstatcompat_o43_sys_statfscompat_o43_sys_fstatfscompat_o43_sys_getfsstatcompat_o43_sys_fhstatfsK%  `   X,nK22Kn,X `%KCLGET: returning %x ttcompatgetflags: %x compat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsockname  %ciommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB name_bus_dmamap_load_uio: not implementediommu_dmamap_load_raw: size botchwarning: %ld of DVMA space lost iommu_dmamem_map: nsegs = %diommu_dmamem_map: size botchiommu_dmamem_unmap_bus_dmamem_mmap: not implementedobiovmelvmesvme%s at %s addr %p vec 0x%x++++interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxio2Tadpole no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02model: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintrWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained%s -- CHECK AND RESET THE DATE! power ledleds sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s cpu_attach%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemepwr-on-auxio2%s: channel %dzs_set_speedttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. consinitfdc1.2MB/NEC360KB/x720KB1.44MBfdSUNW,fdtwo drive %d pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c : %s %d cyl, %d head, %d sec : density unknown fdstrategy: controller inactive fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d %s: timeout but no I/O pending: statu %d, istatus=%d fdc: ierror status: state %d fdc: spurious interrupt: state %d fdcintr: block %d != blkno %lld timeoutsoft errorstray interruptfdcintr: impossible%s: read-only medium %s: no medium? hard errorcontroller statusfloppy diskfictitioussbusslave-only"%s" at %sdevice_type class %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supported%s: dma card found in non-dma sbus slot %d: not supported sunkbd_input%s: reset: invalid keyboard type 0x%02x ;X?@ABC8jgFˋ )v7SӸGHIJ !"#$%&'(+KLMRɒE*,-./0123456OPQ:s9tN '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_+ `+T+O+ V+$`+M+j+ L+P+b+b+& O+n  + ++N+`L+ O+Z+C+,+i+ J+ZK+U+|U+ O+  + +        !!zsms!,!!mouse%s: input overrun zstty flags 0x%x input output: console%skeyboardmouse: %s zstty_attachzs_shutdown: not enabled?%s: device enable failed zsopen%s: %d silo overflow%s, %d ibuf flood%s szskbdkeyboard, flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : no keyboard %s: %d silo overflow%s, %d ibuf flood%s szskbd_rxsoftmii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@mii_phy_setmediamii_phy_setmedia: MASTER on wrong mediamiiautnsphy!!! +DP83840 10/100 PHY: %s, rev. %d nsphyter!h!!H+++DP83847 10/100 PHYDP83843 10/100 PHYDP83815 10/100 PHY: %s, rev. %d gentbi!L!t!H: Generic ten-bit interface, rev. %d qsphy!!$!`Q+PQS6612 10/100 PHY: %s, rev. %d lxtphy!@!|!!@!4!++LXT971 10/100 PHYLXT970 10/100 PHY: %s, rev. %d luphy!!4!H` +0LU6612 10/100 PHY: %s, rev. %d tqphy!!!H9+78Q2120 10/100 PHY: %s, rev. %d ukphy!D!4!H: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphy!l!!+`+H6+(!+(+3++2+BCM5222 Dual 10/100 PHYBCM5221 100baseTX PHYBCM5220 10/100 PHYBCM5214 Quad 10/100 PHYBCM5201 10/100 PHYBCM4401 10/100baseTX PHY3C905C internal PHY3C905B internal PHY: %s, rev. %d scxsplscsipluggetxsscsi_sizescsi_donexs->cookie != NULL in scsi_xs_sync xs->done != NULL in scsi_xs_sync syncxsscsi_done called twice on xs(%p)scsi_scsi_cmd: buffer without nosleepunknown error category (0x%x) from scsi driver scbusy%s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense,x,`,8, ,,,,,,P, ,,,,,,h,@, ,,,,,,p,@,,,,p,8,, , ,h ,( ,,,x,H,(,, , , , P, 8 , ,  , , , , , , p , P , @ ,  , , , , h , P , 0 ,  , , , , x , H ,  , , , , x , X, 8, ,,,,,,x,H,(,,, , , , ,H ,(,,,,,x,H, ,,,,,,p,@,,,,,,`,8,,,,,h,8,,,,x,@, ,,,x,P,0,,,,,p,X,8,+++++x+X+0++ + + + +X +( + + + + +h +@ +!+!+!+"+$+h$+P$+$+$+0$+$+$+%+&+&+&+h&+@&+&+&+&+&+& +`& +@& + & +& +&+'+H'+x'+P'+0'+'+'+(+(+x)+H)+0)+)+)+)+)+)+p*+X*+@*+(*+*+*+*+*+++P,+8,+,+,+,+,+,+`,+H,+(, +, +-+.+/+`0+@0+0+0+0+0+p0+@0+(0+0 +0 +0+1+1+h2+@2+ 3+4+5+5+5+5+h5+@6+ 7+8+8+8+8+9+h:+P:+(:+:+:+;+;+`;+8;+;+;+;+;+;+; +p; +P; +0; +; +;+;+;+;+x;+X;+@;+ ;+=+>+>+>+p>+P>+ ?+?+?+?+?+x?+X?+0?+?+? +? +? +? +? +x?+X?+@?+0?+@+A+B+C+xD+`E+@F+(G+G+G+G+G+`G+@G+H+I+J+K+K+hK+PK+@K+0K+K+L+N+P+P+xP+PQ+@Q+R+S+S+S+T+xU+`U+HU+ U+U+U+U+W+pX+PY+8Z+Z+Z+Z+[+[+[+h[+H\+0\+\+]+]+]+h]+0]+]+]+]+P]+]+]+]+x]+H]+]+]+ߨ]+h] +0]!+]"+]#+ވ]$+P]%+]&+]'+ݨ](+p])+8]*+]++],+܈]0+H]1+]2+]3+ۘ]4+`]5+(]6+]7+ڰ]8+x]9+@]:+];+]<+ِ]@+X]A+ ]B+]C+ذ]D+x]E+H]F+]G+]H+װ]I+׀]J+P]K+ ]L+]P+ְ]Q+x]R+@]S+]T+]U+ՠ]V+h]W+8]X+]Y+]Z+Ԡ][+p]\+8]`+]a+]b+Ӑ]c+X]d+ ]e+]f+Ұ]g+Ҁ]h+P]i+]j+]k+Ѱ]l+p]+@^+(^+^+^+а^+Ј^A+h^B+H^C+(^E+^G+`+a+ϸa+Ϡa+ϐb+pc+@c+d+d+e+f+Ψf+΀f+Pf+ g+g+g+g+͘g+xg+Xg+0g+g+g +g +̰h+̐i+pi+Pi+8j+k+k+k+˸l+˘m+xn+Xo+o+o+ʠo+po+8o+q+r+ɸr+ɐr+hr+0r+r+s+s+Șs+xs+Xs+0s+s+RMA/PMA Is Almost FullProgram Memory Area Is FullProgram Memory Area Update FailurePower Calibration Area ErrorPower Calibration Area Is FullPower Calibration Area Almost FullCD Control ErrorNo More Track Reservations AllowedEmpty Or Partially Written Reserved TrackSession Fixation Error - Incomplete Track In SessionSession Fixation Error Writing Lead-OutSession Fixation Error Writing Lead-InSession Fixation ErrorDecompression Exception Long Algorithm IDDrive Region Must Be Permanent/Region Reset Count ErrorMedia Region Code Is Mismatched To Logical Unit RegionRead Of Scrambled Sector Without AuthenticationCopy Protection Key Exchange Failure - Key Not EstablishedCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Authentication FailureCommand To Logical Unit FailedRecalculate Failure OccurredRebuild Failure OccurredRedundancy Level Got WorseRedundancy Level Got BetterState Change Has OccurredInformational, Refer To LogParity/Data MismatchMultiple Logical Unit FailuresData Loss On Logical UnitLogical Unit Not ConfiguredSet Target Port Groups Command FailedMultiply Assigned Logical UnitAssign Failure OccurredCreation Of Logical Unit FailedAttachment Of Logical Unit FailedRemove Of Logical Unit FailedExchange Of Logical Unit FailedModification Of Logical Unit FailedAdd Logical Unit FailedConfiguration Of Incapable Logical Units FailedConfiguration FailureDocument Miss Feed Automatic In Document FeederDocument Jam In Automatic Document FeederAutomatic Document Feeder Lift UpAutomatic Document Feeder Cover UpVoltage FaultInvalid Packet SizeIllegal Mode For This TrackPacket Does Not Fit In Available SpaceEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailurePower State Change To Device ControlPower State Change To SleepPower State Change To StandbyPower State Change To IdlePower State Change To ActiveStandby Condition Activated By CommandIdle Condition Activated By CommandStandby Condition Activated By TimerIdle Condition Activated By TimerLow Power Condition OnFailure Prediction Threshold Exceeded (false)Firmware Impending Failure Drive Calibration Retry CountFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Controller DetectedFirmware Impending Failure Channel ParametricsFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Access Times Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Calibration Retry CountSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Controller DetectedSpindle Impending Failure Channel ParametricsSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Access Times Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure General Hard Drive FailureServo Impending Failure Drive Calibration Retry CountServo Impending Failure Spin-Up Retry CountServo Impending Failure Seek Time PerformanceServo Impending Failure Throughput PerformanceServo Impending Failure Controller DetectedServo Impending Failure Channel ParametricsServo Impending Failure Start Unit Times Too HighServo Impending Failure Access Times Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Seek Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Drive Error Rate Too HighServo Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Calibration Retry CountData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Controller DetectedData Channel Impending Failure Channel ParametricsData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Access Times Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure General Hard Drive FailureController Impending Failure Drive Calibration Retry CountController Impending Failure Spin-Up Retry CountController Impending Failure Seek Time PerformanceController Impending Failure Throughput PerformanceController Impending Failure Controller DetectedController Impending Failure Channel ParametricsController Impending Failure Start Unit Times Too HighController Impending Failure Access Times Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Seek Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Drive Error Rate Too HighController Impending Failure General Hard Drive FailureHardware Impending Failure Drive Calibration Retry CountHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Seek Time PerformanceHardware Impending Failure Throughput PerformanceHardware Impending Failure Controller DetectedHardware Impending Failure Channel ParametricsHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Access Times Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure General Hard Drive FailureSpare Area Exhaustion Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededFailure Prediction Threshold ExceededSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change InputUpdated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsAuxiliary Memory Out Of SpaceInsufficient Access Control ResourcesInsufficient Registration ResourcesInsufficient ResourcesInsufficient Reservation ResourcesSystem Buffer FullSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase Failure - Incomplete Erase Operation DetectedErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationInitiator Response TimeoutData Offset ErrorNAK ReceivedACK/NAK TimeoutToo Much Write DataInvalid Target Port Transfer Tag ReceivedData Phase ErrorCommand Phase ErrorInvalid Message ErrorInitiator Detected Error Message ReceivedSome Commands Cleared By iSCSI Protocol EventProtocol Service CRC ErrorAsynchronous Information Protection Error DetectedInformation Unit iuCRC Error DetectedSCSI Parity Error Detected During ST Data PhaseData Phase CRC Error DetectedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)Medium Auxiliary Memory AccessibleMedium LoadableEcho Buffer OverwrittenReported LUNs Data Has ChangedVolume Set ReassignedVolume Set DeassignedVolume Set DeletedVolume Set Created Or ModifiedSpare DeletedSpare Created Or ModifiedRedundancy Group DeletedRedundancy Group Created Or ModifiedDevice Identifier Changedcomponent Device AttachedINQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Unable To Update Self-Test LogLogical Unit Failed Self-TestTimeout On Logical UnitLogical Unit FailureLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTIFY MessageMechanical Positioning Or Changer ErrorMedium Magazine UnlockedMedium Magazine LockedMedium Magazine InsertedMedium Magazine RemovedMedium Magazine Not AccessibleEnd Of Medium ReachedMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Beginning Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumSequential Positioning ErrorMedium Not Present - Medium Auxiliary Memory AccessibleMedium Not Present - LoadableMedium Not Present - Tray OpenMedium Not Present - Tray ClosedMedium Not PresentSaving Parameters Not SupportedESN - Device Busy Class EventESN - Media Class EventESN - Power Management Class EventEvent Status NotificationRounded ParameterRibbon, Ink, or Toner FailureEnclosure Services Transfer RefusedEnclosure Services Transfer FailureEnclosure Services UnavailableUnsupported Enclosure FunctionEnclosure Services FailureEnclosure FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedMedium Not FormattedCleaning Request RejectedCurrent Session Not Fixated For AppendCannot Write - Application Code MismatchCleaning FailureCannot Format Medium - Incompatible MediumCannot Write Medium - Incompatible FormatCannot Write Medium - Unknown FormatCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorInsufficient Time For OperationOverwrite Error On Update In PlacePartition Or Collection Contains User ObjectsPrevious Reservation Conflict StatusPrevious Task Set Full StatusPrevious Busy StatusPersistent Prevent ConflictIllegal Power Condition RequestCurrent Program Area Is EmptyCurrent Program Area Is Not EmptyInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectImplicit Asymmetric Access State Transition FailedAsymmetric Access State ChangedRegistrations PreemptedReservations ReleasedReservations PreemptedLog Parameters ChangedMode Parameters ChangedParameters ChangedI_T Nexus Loss OccurredTransceiver Mode Changed to LVDTransceiver Mode Changed to Single EndedDevice Internal ResetBus Device Reset Function OccurredSCSI Bus Reset OccurredPower On OccurredPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Conditional Write ProtectPermanent Write ProtectPersistent Write ProtectAssociated Write ProtectLogical Unit Software Write ProtectedHardware Write ProtectedInvalid Parameter While Port Is EnabledCopy Segment Granularity ViolationInvalid Operation For Copy Source Or DestinationInline Data Length ExceededUnexpected Inexact SegmentUnsupported Segment Descriptor Type CodeToo Many Segment DescriptorsUnsupported Target Descriptor Type CodeToo Many Target DescriptorsData Decryption ErrorInvalid Release Of Persistent ReservationThreshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedNonce Timestamp Out Of RangeNonce Not UniqueSecurity Working Key FrozenSecurity Audit Value FrozenCDB Decryption ErrorIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Address For WriteInvalid Element AddressLogical Block Address Out of RangeAccess Denied - ACL LUN ConflictAccess Denied - Invalid Proxy TokenAccess Denied - Invalid LU IdentifierAccess Denied - Enrollment ConflictIllegal Command While In Implicit Address ModeIllegal Command While In Explicit Address ModeObsoleteIllegal Command While In Write Capable StateAccess Denied - Invalid Mgmt ID KeyAccess Denied - No Access rightsAccess Denied - Initiator Pending-EnrolledInvalid Command Operation CodePartial Defect List TransferRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data With LinkingRecovered Data With ECC - Data RewrittenRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With L-ECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Data RewrittenRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Sync Error - Recommend ReassignmentData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend RewriteData Sync Error - Data RewrittenData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorLocate Operation FailureRecord Not Found - Data Auto-ReallocatedRecord Not Found - Recommend ReassignmentBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldRead Error - Failed Retransmission RequestAuxiliary Memory Read ErrorRead Error - Loss Of StreamingError Reading ISRC NumberError Reading UPC/EAN NumberCannot Decompress Using Declared AlgorithmDe-Compression CRC ErrorUncorrected Read Error - Recommend Rewrite The DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block ReadData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retries ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorInformation Unit Too LongInformation Unit Too ShortInvalid Information UnitCopy Target Device Data OverrunCopy Target Device Data UnderrunIncorrect Copy Target Device TypeCopy Target Device Not ReachableThird Party Device FailureError Detected By Third Party Temporary InitiatorWrite Error - Not Enough Unsolicited DataWrite Error - Unexpected Unsolicited DataAuxiliary Memory Write ErrorWrite Error - Padding Blocks AddedWrite Error - Loss Of StreamingWrite Error - Recovery FailedWrite Error - Recovery NeededBlock Not CompressibleData Expansion Occurred During CompressionCompression Check Miscompare ErrorWrite Error - Recommend ReassignmentWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorWarning - Enclosure DegradedWarning - Specified Temperature ExceededWarningError Log OverflowHead Select FaultSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorUnreachable Copy TargetLogical Unit Communication CRC Error (ULTRA-DMA/32)Logical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalVerify Operation In ProgressSet Capacity Operation In ProgressRewind Operation In ProgressLocate Operation In ProgressErase Operation In ProgressCleaning RequestedOperation In ProgressNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02x%sCheck Condition (error %#x) on opcode 0x%x DEFERRED AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) onoff COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Error in %s, Offset %dCDBParameters, bit %dActual Retry Count: %dProgress Indicator: %dXS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibusscsibus at %s: %d targets, initiator %d, WWPN %016llx, WWNN %016llx scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links%s: unable to register bio %s: unsupported act %d ,,,,,p,h,X,@,h,0,,,,,h,,,h,,,h,,,h,,,h,h,,h,,,h,,x,h,p,h,h,`,P,H,@,8,h,,0,h, ,,,,,,,,,,,,,h,x,h,h,`,X,h,P,@,h,8,(,h, ,(,h,,,h,,,h, ,,h, ,,h,,,h,,,h,,,h,x 1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P1.0gMemorex CRW-26421.061.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TE02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 3.SDT-5000 SONY DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROPjaz 1GBiomegaELS85S QUANTUM DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID A00MD21/S2 ESDIEMULEX RZ55 (C) DECDEC 1588-15MBSUN0669MICROP 1.01CD-ROM PX-40TSPLEXTOR offlinescsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUvendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEunknown targ %d lun %d: <%s, %s, %s> ATAPISCSI%d %d/%s %s%sremovablefixedscsibus_printlink%s not configured scsi_probedevscsi_devidcd,",",",",",",!,","NEC CD-ROM DRIVE:260 %s: WARNING: unable to establish power hook cd_buf_donecdioctlATAPI CD-ROMSCSI CD-ROMfictitiousdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcach,#,#,#02009000SPECTRA sd,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,# %s: %lldMB, %lu bytes/sec, %lld sec totaldrive offlinesdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook sd_buf_done(unknown)sd_ioctl_inquirySCSI opticalSCSI disk%s %ssdgetdisklabel,)0,),),),(,(,),(,(,(,(,(,(,(x,(,(h,(P,(,(,(8,(,(,( ,(,(,(,(,(,',(,(,',(,',',(,',',','p,'X,(E,(,'@,'8,'(,',(MT-2ST/N50 TEAC ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st,(,(,( %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d st_buf_done%s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d generic,-,-,-,-,-,-,-,-,-,-p,-,-`@ "",-,-H,-,-8@ "",-(,-,-,-@ "",,,,,-,,."(,,,,,-,,. "(,,,,x,-,,hFujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ss,0P,0P,0P,0P,0P,0P,0@,0(,0P,0@,0,0P,0@,/,0P,0@,/,0P,0@,/,0P,0@,/,0P,0@,/,0P,0@,/,0P,0@,/h,0P,0@,/P,0P,0@,/8,0P,0@,/ ,0PC7670A C6270A C7190A C5190A C6290A C5110A C1130A C2520A C2570A C2500A C1790A C1750A HP MUSTEK %s: %s %s: generic scanner %s: already open ssdoness_set_window%s: not queued %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi mustek_read_donemtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC2570AHP ScanJet 3pC2520AHP ScanJet 3c/4c/6100CC1130AHP ScanJet 4pC5110AHP ScanJet 5pC6290AHP ScanJet 4100CC5190AHP ScanJet 5100CC7190AHP ScanJet 5200CC6270AHP ScanJet 6200CC7670AHP ScanJet 6300C set_window failed compute_sizes failed %s: set_window failed %s: compute_sizes failed *f0S%s: trigger_scanner failed scanjet_read_done*f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a0I*a4T*a1I*a5T*a1I*u2T*a%dG*a%dL*a%dKscanjet_set_window%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Escanjet_compute_sizesuk safteSAF-TEsafte_match %s: unable to read enclosure configuration %s: unable to register update task %s: unable to register ioctl with bio Fan%dPSU%ddoorlockalarmsafte_read_configsesDell %s: unable to read enclosure configuration %s: unable to register update task %s: unable to register ioctl ses_attachPSUFan%s: error in sensor data dmaledma%s at %s offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2fasunknown (0x%x) nameesp%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b INTERRDR1DR2IENSLVERRRST WRITE ENDMAENCNTTCDSBL_CSR_DRNDSBL_SCSI_DRNTWOCYCLEFASTERTCIDISENNXTDMAONALOADEDNALOADED%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer%s at %s offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping network: no interrupt : only %d register sets : can't map registers local-mac-addressSUNW,vge: no interrupt : only %d register sets : can't map registers hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed SUNW,fasptscII: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency: expected 2 register spaces, found %d : could not allocate dma softc : can't map DMA registers burst-sizes: can't map SCSI core registers dma espattach: no dma foundespaudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio: expected 1 interrupt, got %d pri %d, softpri %d mulawmicvolumespkrhpmonitorsourceoutputinputsoutputsrecordaudiocsSUNW,CS4231: expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d %s: error interrupt %s: timeout waiting for reset mulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration micvolumedaclinecdmonitoroutputmuteonoffrecordsourcespkrhpinputsoutputs%s: attempt to free rogue pointer cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %p %s: trigger_input: already running %s: trigger_input: bad addr: %p depthwidthheightlinebytesstdscreen-#rowsscreen-#columns' char-height >body >user %lx ! ' char-width >body >user %lx !stdout @ is my-self addr char-height %lx ! addr char-width %lx !stdout @ is my-self addr window-top %lx ! addr window-left %lx !fb_get_console_metricswsdisplaydiagnostic ../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memory mux %dwsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl devicesc != NULLwsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000%s: couldn't allocate copy buffer wsevent_init: already initialized wsevent_fini: already invoked wsevent_readwskbdwskbd at %s mux %dcannot load keymapdiagnostic ../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s %s: attach error=%d !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach wskbd_input: evar->q=NULL %s: event queue overflow wskbdread: evp == NULL %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmousewsmouse at %s attach error=%d mux %d wsmdetwsmouse_detach: %s didn't detach wsmouse_input: evar->q=NULL diagnostic ../../../../dev/wscons/wsmouse.cev->value >= 0wsmouseread: evp == NULL wsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory wsmux_mux_open: busy wsmux_mux_open: no parent wsmuxopen: dev already in use wsmux_do_open: bad child=%p wsmuxclose: bad child=%p wsmuxread: not open wsmux_do_ioctl: bad child %p wsmuxpoll: not open %s%dwsmux_attach_sc: busy wsmux_detach_sc: %s has no parent wsmux_displayioctl: bad child %p wsmux_set_display: bad child parent %p sun$4$5$Cp$H0$Kd$Kdiagnostic ../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %d888rasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedagtenPFU,agamodel: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d bwtwo: p4model%s, %dx%d cgeight: p4, %dx%dcgfour: p4, %dx%d cgfourteen pri %d: expected %x bytes of control registers, got %x expected %d registers, got %d expected 1 interrupt, got %d model%s, %dMB, rev %d.%d, %dx%d cgsixSUNW,cgsix pri %d: p4model%s, %dx%d, rev %d cgthreecgRDI pri %d: model%s, %dx%d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %scgtwo: %dx%d cgtwo_getcmapcgtwo_putcmapmgxSMSI,mgx: %smodel %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d , %dx%d %s: unexpected engine id %04x pninekp9000 pri %d: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d btchambt445: id 0x%x, revision 0x%x pnozzp9100 pri %d: expected %d registers, got only %d : rev %x, %dx%d stdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx ! addr fontbytes %lx !p9100_romfontp9100_pick_romfontpqrs   $(,0#Sqn|uqn/C"c ]""%##rfxRasterFLEXRasterFLEX-TV: %s %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %d, %dx%d rfx_putcmap$$tcxSUNW,tcx pri %d: expected %d registers, got %d model%s, tcx-8-bit%dx%dx%d blit-widthstip-roptvtwoPGI,tvtwoPGI,tvthree: %smodelrevision, revision %sfreqcodehresvres, %dx%d vigravs10vs11vs12 pri %d %s: expected %d registers, got %dmodel: %sVIGRA,vs11, %dx%d zxSUNW,leomodel: %swidthheight, %dx%d %s: zx_cross_wait: timed out %s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout xdc_tickSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsiswsi_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d si_intr: DMA conflict si_intr: DMA bus error si_dma_alloc: already have DMA handlesi_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_start: bad pa=0x%lxsi: DMA error, csr=0x%x, reset si_dma_stop: excess transfer%s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer xA'W COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.37 Customer No. 15 Product No. 00 $   qp \ pISpP p p?p 10 y8xc/   @B bxx xxO 85 xxx i8@h< !xh(hh hhhh#hh' i:  h hhhj-  i;  h? h2h7 h @hhdpx xdx1xGx62 ppxxxxx4xMx22xxxxp  p  z zp@xxVxU 8h!Ux'xx 8o!e@C 8j!!! `xOx> 8o 8i! @S @xx| a`@^|ppppp 8yn.. HW2 &cl{z 8yetrq @xsrq @p a` P @|qxp@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I] ApO Ik Awpp qWpp@kp   B J &Sxp @kHk&Sxp &Sxqp! rxp%ppxprstprstҠ@xr@xx @xzz{~|vxxxxxxprstprst֠@܀x@xx @xz{|xxxxxx 8Y! rx 8A! x 8B! x a8@a bx 8E! x 8F! x 8G! x 8H! xyz xqā:jh@#kx$k xwxX kj 'x xHF a; `<F<xN   xS{zyx xwxX ijk xqġxxqġ 8A"~!xxq  "@pxxآ~ 8B"!~xxd2K a8@a bp`p`x a8@ap`xq  (@  2@  < a8@`~a#xx6xqġ 8G"!~xxqġ 8H"~!xxqrȡע!yx "z xxqā: rh~&@@@"" j @)@/@@@@@<xx@xx@r̂@rh@r a8@a(@Y2@_<@edHoxiPHoxiCHoqqrxj hhk qxwxX jk phph'x 85" p xqrs̡xxwxX jj 'xwxX jj h@xI 'xwxX jj h@xI 'xw A I Q xe 'jxwrswrsxh@'x x |  @x xww A! I Q xe a8@`g`xxI |wwwwƧ a8@``gxxI  A! I Q xeph>8< |xl 9 A! I QxX h i 8U?8?U ih0@@hK hH@pxyhK hH@px px y8x a8@```xxhh hF |xxx0qqyJ|tsrtsr y8 @x5@x@x>x` x 8h  # " $   , .%0~x1eeff``xI |p@xqpyxqq!hx ii -h p@x!p@pxqrs!!y/F[]_p@qrsxBp@pppwqx 1a&$0$"F3H 1aHx:x:x:UUwxX h0  'xwxX j4 'xw~ rȂxX l0j2 8''$xw~ rxX l4j6 8'$xy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppqp q p|p @pp pqrs 0x ppp  p 2q 2,Sp|xPe@=,xR c|~ y8xP b,xR| ]zR r@U/  xL | ;|xX)h**h.h i 8O! h@ ``h~ x ~he@`hxxx+'hhx+'ii |e@`` x>!x|`  @h(`h,`|~ q8@p@ʠ8- pB|~ q8@ 8r@!H!Ӂ!tB|xX hxe@/x,x`e@/` `,( 8O @/h` `hhxdx `d,h%`x`` xx+'hh | 9 A! I Q xe8:?8?: |h\ a`\xx]|@cxyeuw}uuuuuuuuxx0 x x xx0 x  8," x  xx0  xp a` @|,`, cxdxfxhyj@,xyn| ~ a8h- k`d`f`haj@-xanx+A |x@ ~`e@x `x>|xle@ xdxf,xnxj |xMytprТ"x@MxhM @xMx5@Mz|{x@! x$ @x@Dx>xxM xxxx xMxx`yN|VeVVVV 9xx``x`xx|x@lxVx`x`@x@xxxx|xxVxx|x@xVxg  `@  @ 9  @xxX- h+h/hh - h pxĂ@ xx>|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x1eeff``gxX h@4 x x xxx` ;`"jh HJ@J 9xx, he@RaiVi!``hhxx h@@v@h x~~i0!h2i4i: xI xx|`` x xe@`x`xxx|ypxt xvpx@xh @|h )xle@x@~xą(x@ @| {yrpԢ"# |H | | q p?pr?? q@ x z{ `$@ @x@1xx? xxxx x?xxyx <xp֠ q | 8h ~ y 8@!b 8!bx0bbxD|~ # q8@ y 0^ +#@|x##S3xox xx pxpxpbxxxCxSx pG8pC | " x|  px" |  px¢! |  pxӡ" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@e a\xm@S a[ ~xm@? `p=x2xe[ q8@p``q` pxDxa q8@``q` pxD xg   |,@ `` ``x`xn| 8A"  ;"@ !!"|~h䠌 @堄`:p q@塌q~aap  @! x x pppp~aa!p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@|0"x礜P"xy'!"Q"w$''((()bM7 'f7x  |pp?p0@Kp3 p\pyV^l^xx Fx&jpx9x/px~xxx x`xx[ x& ppp38px9x/qx~xxyxx`xx[ x& ppp38px9x/qx~xxyx qyx x`xx[ x& ppp38px9xx/9p hxox/,Phxn A xAx/9xp\ hox/,P`` hx 1 Ax0K x, t@@28 0qD*H) 8!de?!#qFpp?x9v@8qD&x.qF%h%Xu>,P`<p2~ / p"x"hhhh#x-ڠ-y"#"###--#--$$---$x禄@# x:xx9h@#hx/xii#3h#;h#+h@#xXx9@#;xXx9`@#@##Ix#c~Znxtzyx#V?k!hk"h@@#k~Znp#xx1x3exgx9x4jilk"@#""!|{##@~Znxgx9xg"#x3vx9x3x9xjx9xXx9xx$ i@#ši ~pH ````` x#@#i ~pH ````` ,H @#x/ x,X@#x`(x~X~Z#xUx9xix9~X$xXx9xjx9x-x- y@$xx$-#| @$%H$%x$'x#$z$'x$ $#@$=H$=x$#@$hh~X 0~Z`` ~pH `` ,H @$ax/ x-=x$p ~pH `` ,H @#x/ x,X@#x`(x~Z$xUx9xix9zx$#@$H$x$-x-x-x-xx@$xzx-y$-+-,آ$xx-xix9$xx. xix9P$x#y$$%%@$x p:py$$$$''L&$$x禄$x1M@%xh@%W%`` x*@%Wx+x1Mx%>(%Wx1M`` x+4`@%>`@%4@%4`x%>h(hx%`0@%.`` h@AhhpT ~ `h` `h-%T``xA~x&hh'o@%%%t`@%txzh.j*:"%x%" @%h%x&xA@%@Aih@%p8hix+ x+%`` h%x+x%pT `h`xxAH%x"y%%%%%xp@%x-xixjx9xxy@%x-xjx9hh&x-x& @&xx. xix9x/x0&&y||`&&h/h+x&&5hH5&5x1M| @&_xЀ&Cx4xx4y@@&Mh/h+x&2hH5@&Gp8&Yyzi.j*x&2@@&ih/h+x&2hH5@&cp8&uyzxЀ&|?i.j*!&x&2x4|@&`` hj(i,j:i>h+h/h3 hh py&&&&&&&&&xh&x+x&pT,P `h`*` !8W$@& x&-" k|wx.x/`@& ~ \ h  !\  x!j@&~ ![~  x!j@& p&x&8&xAx+ x+h'xox4J~!G@'x'/ ~h:`` x/kh@'9i ih@'@h !8Wh "j8ip2"y)-)))-xp)x+x1Mp4` x)p@)p \ hp>p2"y))))))xx. xix9p)x+x1Mp4` x)p@)pzx| i\--qV h@)h@* hx)p \ hp>p2~ / p*x)jhhh#n~Zh @*mx.x*mp*$x+x1Mp4` x*)p@*pzx|yy[--qV h@*Hh@*ahx*;p \ hp>p2~ / p*Yx*Rjhhh#n~Zh @*mx-~Xx*m~: `pJ`pN`pR`@*klih*{{||ަ~Zx3vx*h!#$@*{{||h~Zx3x/ j@* i ~Zy-p>: Hx9` @*̀`"`` p`&|x1Mhhh@hpy****+****xx+ x+xxAppy*********y pxAhx'h+ ``|x+'`@++x``` |x+4`@+&`|~~ 8.!@+1 |~~ 8/!@+> |~~ 80! |~~ 8/! |~~~ 8.! 8/#  80|x/hx+x/hx+x/hx+wx/q[-- h+xAhr@+hx+h hpx+ h+x+x+hh xxA-}~ii@, i@+H+@+ 1++x.@+x,x+x.O ~)```x, ii~X~Z+xUx9xix9 ~)```x, ~X,xXx9xjx9 ~pH `a@,KbH,@, &,$"0bp(,4,: x,: ,:  ",?"(x.S++x.@,Kx,x,Ox.Ox,xXxZ xix9 ~)``,r@,l,la | 2 x,bp(,, x, ,  cH,@, xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |-zii@-i-x-cx,ȩ x/ x,X@-x`(x~X~Z- xUx9xix9~X-xXx9xjx9-%@-/qH! -/ x.Ax-cx,xXxZxix9 ~~)``  -S-Qax-` xxxzhh | ~pH `@-k @`xxx`x`` |~p@-x-x-֦ @-x@@-x@-{?-@--@-Ҡx4xx4yx-֦@@-x-?-Ҧ~Zyz -Ƣyyzzx4xgx2x9xgx9xjx9x. xix9x-xix9h#x.i ih@-hxix9 x.  x. x.  x.  x. xx~Z|~?;;: y@./x```88y@@.?x```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 8F (@.} !.  x. !/  d$@. #p.x.|~ 8F"2H.@. !.   2x.(@. !.  x. !/  d"@.H.̄ #p.x.|d.xpx x전@.$. !x.$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| ;|yzxЀ/%?|~ y 8@ !y/5/g/?/?/?/?/?/=/=xxKxH/AxKxH/Hh@hxX@xZx0/g/gh /exx/gx | ~h:` /a@/`/`~ii  @/! x/ x/ ````~ii!` ` ` |xjx9xix9xXx9xUx9xx9xx9xx9xx9xx9xx9pxFx9~x0/xx x전!@/xx |xx |x0@00 x|xx x전!@00x~xx |p@0. ~-`/hx-x,h hxX?hh/h+xKx!̠ @!x전@!!x- ~h: ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I1Mprr p@1_x1dp |p1q1qx2.x1ip @1p1p1p@11ipx1@1x31@1ix1p |d$@1,p 91'hh 0h)!@18'1pu@1 91x1| ~ " y8 qp pp q p pp Ix | I1p2pqp1䡄0@101p2p 2q 21x2hppp2 pqH2xp I|~~~~ "qx2. |r!qp 2p 2p y2H2R2b2p2b222p2xp2[ Ix2_x32[x|p2ix2mx32ix|px1x/+h@2}h|xxx2rqp (x@2xx2x2',X`c ""c!$@22 +`x2+`1=,holkpx1|8'2`@2 ` 91Q@2p| Q|P9'2 91`d2-`|~ ~ " h `hklW1~ h@@2~ yxX@@33pp3p@3x$3!x3^,X'``~p`p !3N@3N3Nppvpx`p`pb $pb#pvp+`x2x3`x33^ |~ ~ " pp3lp |~ ~ "  I3vpp3~ h@@3h$@3 P 91-`x33 |~~~ ~ " ~ h@@3 I3h$U@3-p.` 91'hh "hH3ՊQ3x8'3pu `@3 91x3" i $"i#3x q x3 |p@4'!p!p!p!p~ yxX@@44vpx2|~~ ~ " I4 q4*h$@4:x1dx4:q42x2.x4pq44x2.p4p4p I |~~~~ ~ "  I4J 1p h&ppp@4hSpp4j Ip |~~ ~ "  I4yh `hklW1~pp4,X'``p`pppvp 1 4qp 4 H4x2pklp Ip | 4Ѣ4̀|~ @44H444x4#4~2 |~2x45c `x x"5[x$x" 84!5  ~?x/ `d5 i8@h@58@58h0 @58!@58 @6@ a;  `<@5N`>5N`@5N~xIp5Tx5> @5[ x5>x5xx5fx5x7 |x<x>5wx@x>xH@5wxJ5wxI|x4x65x8x6 xD5 xF[ @ e@5` @5`"@5`,@x5|x(x*5x,x*x05 x2;#@5ˢ "@5À 5# xI| i8@h@5h<@6@goxXh 6= 8+!@5`#x6=h!``?````` BgoxXh@6hhh h6xh`/`+,hx i8@gh xD A! I Q0xe 85"j>86" 8+  8, i8@h | 8O!d ix`hX?``H``/`+h0@@6|hK hH@6ip6ix6`hK hH@6vp6vx6m p6|x6xhh hF 8h xLxJ | y8x6x6x6x6x6 83 84 x3xGxK|  8F"<@6 {*{.| 0 8F"2@6 9"<@6 '{6{:|  8F"<@6  "2@6  {>{B| / 8F"2@6 9q"<@6 &&{"{&|  8F"<@6 ~ 81# 82# | 81! 7U 82! 81 83!7  ;"#@7U"@7@@7@@7@@7@ 7U #  !~ xI|np COPYRIGHT 2001 QLOGIC CORPORATION ISP2200 Firmware Version 02.02.06 $    ɫ Y+xx# ( Q*p ) 1 9 !h Ϡ 1A4ubvfw^tjtn qd   !A4qd4  A8Ќ   !A 4  A  2    K? |  . \z R5 fu $ h bs #H $\ 0 x#x Px#@x P @*pp*ppX >I .A \ S f  & p  YP Y yx(x* Xpp( a  yx'z(/z* X gC X g X gC J gC 0 p  C yxD J gC X gC   xx@xB s > r<„r>  ! {  - QI YX K(@pp El Q z ´z`ps pМ(p Kppr Yx  (O !pSpWpw yRxЬ•r YH  -ppp yx'x(x* *  } o YH a (Oa. ppp yx'x(x*  } o YH a (Oa. Y   Y  ~ ,psptpvp& pp0 * opЬМ@Є0  ! !Ќpؠ +m opД   + opܠppФд  Q S ЬV   N`8h^(^  ! !q   @   @ppqt @    @p0p2pp  '' > y YP Yx(x*    }  } o o.F& y 4! ({  Jy@yBy$Ѵx'@ќx'6VyTѬK YX Y(  p Y     XX Y@  JxCxC x М8 Y8x$Ь*px$ YЬ p  ''xPxRx/ FS gSxPxRx/ YX Y(  p Y     X  J xPxR Y xCxC !x `x МX Yx$Ь YF !!N!x'H  gx$h    p g` 4!   ({ Y@d( Ypx'x$ YЬX p(  ''H 4 x'Hx(x*xPxR^> X.N*p a c`` `  p !pSpSp[pspw a` `` ````` a``` ````` a`QL`OG` IC` (  pH 1 9 ! )衆    X  (U 8 M    a,#b,"b    a,#b, a, a"b   a ,#b,"b,#b, a, a"b  i8 7  Nx`( P"  yxЄy.x*x&9x:x#x P&VF  @  "@  $@  &@  (@N^. yx @   y$/ zX z y&/ zp y&/|(   @          @x   @     i  a ,V&! `.^ qq`q. !00@pd(" "# 8ЌHpd(pg  H tt& qphpp, h-p. kh.n q& p`pp, h-p. kh.n & qp, j-p.pp.8hh I  qp  qppp qpp& "pp qp" pp( y. qp( yprpqp֡ p hqx&h$x2h(x6h,x:h0x>hph phЄ p)p&q @@!prx"x xA.&6FVp x&q @@!p"Sx"x 3px^N>.6FV  Sx & xApppp .^N>6FV ) x& * S +  Sx & xpppp &.^N> q yyx p#l6d5 (6FVp x@p S4p^N>p px0x2x4x6 p p lp  Pp x0x2x4x6 p p lp hx0h&x4h*x8h.xp ]_ l  > H ( p l  > & " y0 q"pp.p.xx.i4,FhLм h`h.h\h*hXȡphLм Xh`h.h\h*hh "c h2hX@hLЬ hh "c h2h.h*hXhLЬ h.h*hX"c! i2-ih&hLhNh i|iiihLЬ h3"`-ihXh&hLhNh h.h*i|iii   袀 lhL   8ޢ  hh &F6& ".>Npq " # $ I .qp  8 .r "`&&6 "N>.$`a!hjbk^  h @pp qHpH  ЌhF N$``  @   МHx` ` xhxhxpp `aH H hpp qpP  Ќ`F N$``  (  МP  ЌPx``xhxhxpa H .&6FV q"p p y0p x ` 2   x@ &VxxЬxx pp^. ]  Y8f 1 ZEnX `% 8"  TV .! ^^N>.p q !p `!!$I .qp ( (O 8!`` h-Xh(Xh,@hL(hhhP0xhxhxh$ Ph `h0 @`4  -X   ` t д hh "@ p >'0hP((h)pTTpphpTpYYppp`YxhRkljpml ٜP(hon 0hRkljphkj mlkjmlon h4@ "% {"z&}2|6:~>srut"w&v*yqqh(h*h,h. -` "%(hhh "%(hh`hHh0h  "%!h  p `` hp  'phh i|iiih+h/hPhR W & "+hh `yxx XpxМ pѼќ}x }     xpѼg&6| }$~04xhxh  @x(x p k(j,$hn%hrk*j.>.no"%( ";hPhR*h&,h(h2hh HhL0p ` H p p V} ռ g^ h+h/hh i|yiyxhzjќ`Pp hLhNx phh p `` V .! ^p ` H  xhxhxyA   ?xxxx xxxpp ` H  8pєxМ8xМ   աH   xhzj xpѼlh4)ќ&6| }$~04xhxh  @x(x p  k(j, ";(h`4М(hh  hhє 5*h&,h(h2hh k*j.>.V}  g^ h+h/hh i|yiyxМ | x$xh|l xut w$v(p(p!x0Px48x8 x< xxpp Phh 0p ` H  xpp `` hhh l(k, .p q wp!  w!l- uh uh hhP!k,u!j(uhPhRhlx"phpx&phx2ph x6p"h ``4Мhh0 ֬hhx:p&h x>p*ox:x>p&p*o!uk,u!j(hPhRh0 i` М`x"phn` x&phr`x2p`x6p"x:x>p&p*`x"phn`x&phr`x2p`x6p"`x:p&` x>p*hxhxx  <"  x Ф ٠ & "p`p q@ ( (p.p.. Y `  8  f 1 ZEn  ( (p q!0 `` ``` I .qp @ (O! ]  `% 8" ( ( ]  q"p q!0 `` ``` I .q P 8   ` ,  YH !# `! ! A h  H8  !p qx i  0 I H& H +  )   0 I x 2 6 !    ps$t p(p(t&p7q.p/p7s&t" `% 8"& ] y   @ `  p p `   X x0y(y Ѥ ` .x dxЬ   !   ! q yp8xx x0x4x8x<x y0xЬ  yx>x:x6x2x"x0xЬ  o qIp֢ liLi4;;;;oN= hLд  h`h.hh\h*hh|h hhiXh48hLд  h`h.hh\h*hh|h hhhh "c h2iXPHhLд  hh "c h2iXh.h*hLд iXh.h*-hh4"c h2i&hLhN y x qIp r \p hxh hhlxh @ yx yx+hh$ Ph `h0 @`4iyqh xppppi,h i(hX6Fkl "N> Πx& y Y 9.ΠvfVF6&  ~p r:pr  }  }>'0hP(h) ` E E ` ` Y ` E ` J J ` ` ` Q JhRkljpml ٜ((hon kj mlkjmlon h48 "%  {"z&}2|6:~>ypph(h*h,h.p ppp "%.>N^n~ &   @xpp `` h 'hPhR` ab `Ȣ`hj`hfp ` W  P @ ~  } o.!& $ y qI+hh `yx p! !U!pќp  !  !xєHhPhRhLhN&6k(j,x hnx$hrx0hx4h"k*j.>. ";hPhR*h&,h(h2p!&xx yzx6  x м>yyxxʢx.xphpєhx ќ  &6k(j, ";(h`4М(hh  hh!! . qIp y  ! є  ! h 3   @  ! ! !  @x  pxxЬ @xp& qI y p@p `` h 'XhPhRh z hz   @xpp ` W @ ~  }.hjhLhN, '   @xp ih3h?@(p`hh ``4"c E Q PPA(, `- `h`4"s E !%)!'"X"T"b"X"_"\"b"_"Z"Z"b"Z"`"`"b"`k.l*hXU #-``4"c0 `\"``(E@#`e # (hٜ(h"h  h"h #PQ #@ @`e #0Q #@(X`e #`4"c( @+hhPhRX" +hlnkrٜhi$"i # h h`i$"i# h h+hlk"hPhR,h(h2*h&(  #(#)#,#/#4#7#<#A            & & y q i $> $. yx '\x ᐀ @ x/#d ᐀x; .& &xФ $+######## b|x b` b| b8A(1!.& y0  p 3    d W @0j Yx     Z X J_ $.h6FV q" ^N>( y2. qq( ! ! Y С I p! @   yyx '\y8 & q r p(p  . x7x/x/x/x/x7 x0м$Nx7x7 & ( a q`$`&`S0 '`P`R a2a6 '`a``K`C`/`/```  `+/. 2  1 & (&a$,*$$$$$$$$ i  i i i xh i yH iY( i i )..a$`(Мќ& Yxp`$x Y YH`' `C  X Y`$       X&Ѭ`$p0p( [R&  H    Z& [&Ѭ & Y`' &6 Yp     X>.>. YFdL8 adJ`C`CtΤp4Єx`p<ЄHp>6$  > >pTq0ь S"q2`b@ %bH%p4Ќ@  Ѭ%!6s  > >q0q2 S" Ѥ   h  - '  ѬH  +pV   N KK%^N  }  } {6  |w>`  (ќb(b*  # `'  Y@  X gє &b Ҵ &{ g z2`' #}px2P i@abx`x``C `Chhab n% ox pp7/`  i@h@ hh a`(8`* z%& #e ' &Ҽ & g```' i@h@ hh a`D`F`<Π@  g 8aaaa6  |w> #e O ќ '#p4Ь`V`'`/ & `&`/aP`R f& `` М0^aR`' (k&^aR`'`(`*  }  } {6  |w>`   Z  `' a&&& qqpơ(  >  > r 6 ' { a (  +>..& a'o"` '|"`.@@@ HX@ (!0 d8- -  i@   hRhV'& i@ ! hS( hV'. a`0`2V& i@i0" " h'h.^ S PФ@F . N& y@xH  # # h 0"Lx ! " 8  Y .x & (& p ..  h p L(   V y xTЌ(r^ a`0`H```P``` ``(``/`/`/@`/``*`````R```J`2`6  ' q!@ p! )^)b)f)l)r)x)~)))))))))****************))))))))))))))))****************))))))))))))))******************))))))))))))))))****************))))))))))))))))** $* $* #* #* $ #* $ #* #p* #p* $ #p* $ #p* # #p* # #p* $ # #p* $ # #p*  (:* (: $ (: # (: $ #` (: #p( (: $ #p (: # #p (: $ # #p@    &F ! Q*r  ҜH҄8Ҽ* *** Y p*Ҕ p*   ' Nq`  +@( ,3 +38sp>*- =? A~p (H  p'VpĄ N  Nqxą`rҌ`Ԅ N( ,p ,X ,3 +3p( ,@^*p^qN.p ~ Nq8 ,3ppv,h W hB -` `  N  N!& pp.  ~v,h W hB 8-`h~@h + `  N  N!& pp.  ~&  Nq 1p.v,h -` `  N  N!&  +p܀p.  ~&  Nq,h p-`c`b   " .f6& k k9 $!0( ~   N  P KK+܆ .>n6&b"pr& ) kv 9 j, ~.` Pbc KKbc.>`( P qpp qpܠ p ``6&V!x  S PФ@F - N &~ , ,࢈5! H   !`  R ) kv 9 j&!`b`( b., ~!` P.,W^.>F& S HФ8" ' ) .N&6r S"Ҭ! ' ,ӄ 8 h>.& &6!& ) *. >.5 eX aa + N. 5 ~}|{܀zـրՀԀӀҀyx̀̀ˀʀɀǀwvÀutsrqponmlkjihgfedcba|`zy_vutsrqn^ml]k\j[igZfYeXcW\VZUYVUTTSSRRQQPNOMLKNJMIGLFEC<:96K54J3I2H1.G-F,E+D*C)B'&%A#@?>=<;:9876543210/.-,+*)('&%$#"!   qpppp:p>p3p7p a`.@.@ q+xxЄ@*`x i/%. qp.I.J.S.d.R.R+xxЄ+x a`( /p h*`pp hh4*`+xp*`x @aB!?/a.//+/3/7/?/E/I/U/X/b/e////h//w//00$0M000111101Q1Z11/1/////11////////1/////11//////22r22/37KAs/////////b/e7M/7ZB BgB/C.CXCwC///7^899.999:2:A:P:S:v:;8;E>>>?////@@8@A\q< !@ =& / xЄ. |"y&z*{.x @p P. !@  !@ !@ !@ !@.% {(z,x$y0=x#x$.% {(z,x$y0=y$x(! /y$!/ Sy$z({,/x$ `   x;/}8|<@}8|< a ,`   //" iRx$y0/( /(hJiBx,hRx(hVhZh^ \/ iRx$y4/( /(hNiFx,hbx(hfhjhn R/.% /%y${(z,  A = /%  =p/h4 8 /% /%qp (p = /% ab$c(d,e0@ =p/h4 /%p hh8h: Mm(pp0 S&  S ! .=ax$`/ x#@x'ISx+P x/ !x2?x6 ab a`<x: !x>x P @ q '/%y$ N/(~8?@/(|(}, PmҌ P PF a& `H`m0h<h@P.  /% 0 W. /%/  S&   R.//% = /( Ok /% Py /%//% = /( P /% y$ P /%x(/(  gO/&  P )dP$% N P( b%  P xx$p  gO)././%./( = /( O Pm//% = /( O Pm//% = /( PH /% M P Pm/ = /( Ok /%b  P a kv 9 j  ~ Pm/ = /( Pm"/V ihi  h   ~ i5-u0pLqpYh1n#^/}@ / !x  iib//%aP-"cpbtgל 1׬ 1hפ 1@ Y 1 1~:>/a@bD #/& a4 c8./ = /(bDc8/a@bDx$`B{(cF iRhx, i- j/& x$`6x,`:./x8x(% /(x,- /( N bDc8dFe:  = /(x( /(x, /(bDaFc8`:/  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/(  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/( h0 /%/ as& `Єxab*``hx:`x>` r cH./! /% Y /%& bH`hH ' El././(  p aR` r  hr& x$3*333:3'3'3'3'3'./( !  4p   48(. !@ / 3 !  8  z 4 { , H P X 6 6T>' -` qI y ih$д@ } x> | x:  6 6 5K 6( 5 5  5; yx$Д0xx y@ 40x yx'x2x 4x$м x'&|x$Ь0X 44M 4PH z& {% 4@  398 " 3 3 1)% 4Mx$м()4M`3 0 x$ЬH "  0  @`' u `&,` @-hh3 x$Фh'  a `  4"@h' t h& y a x' r ` s `xx3e a`'aax$ (`P`R`/`,`.`K`C`C)*++./. !@ /4 ` d   0    "  I  & y  y2y6 'xP 0xR  xRx,x. F4 `4xPxR  x,x.xKxCxC 4xPxR axTЌx'HxPxRxC@  @ x' xC x'Hx$Ь q" y0  `p@Qм8pxx px z& {% дPЬHФX yxЄ@     q  p ! qnpcqfqpkps pwpxpzpppppp~pp6pp'p2p 6( 4!(p$м p' q" y0 ih$д hh8x:  6  6p q" y0y 5x&ќ5p5555ѼPPp xx y$xx"y&   5' x yp8x@ `0  `` %b2pxp`$ `&`a0@(x2@(x6@(x"@(x&@zpp`)8` `  `2 qI y yx-`&p6P6;6Gpќ  6` 6Hpx0  6 a  ` a  ``` t  8 v $ w  =h3 o&-h !8 '>h -h =h3 ph'-h v  r w p a y  ` @ r p ` s p`xxʠ`:`> q p&t2s6p:p> ! q"pAp pp@St0s4-` =` p-p`Π u  8 x $ y  =-`h3 o&-h !8 '>h  6-h =-``3 p`',` x  r y p r p s p 0 x$Ьx  !`' "  0  /&  @ @./}8|</ = /% Y K0 z,{(|<}8 =p7r h /(hЬФ /(Д aa8b aЌ aaa ! hЄXj(/(-! aZ0h(/(`Rh /(A/(/(h  /(h /(hHi@ /( /(hLiD /( /(h = /% z,{(|<}88 =p7 - in-Sp t ЬXx$  2?0 - iR-ShaB`F \ R` R`8h`* #  h p 6k (>hij k$`abc"lHh0i4j8k<`a bc  @ hi kpӄ 5  bhx`ht ` ```8z iR j0p @  (O !! a`/@`/ Y( @ '`Ƞ` 8 Yx X gC X g   X@ J_(` 8/  X p L 0 0` /% iRx0hBx4hFh 0 -z,{(|<}8= 'ˁ/% Yx     Z X  K0 J_//% Y/%ap?  @z,{(|<}8&  =p..p? i @ CeP-! !j ! N`8 8#$  -  j @  J9; = /( = /% S дPx$~ `Ќ`h7h8h:  /%pp9 = /( +,-S    J   J- +z,{(|<}8=/% = /( P//%x(/( = /( P /%  Py$z(/q` )~ adP$%) N8"  gO/% = /( Ok /% P//% = /( Ok /% Py/a/ = /(  /%֬ y$фh x>hx:kja/x$д`/%bPP @ z,{(|<}8=/% = /(`/% = /%h7h8h: P /%pp:h0 /% z,{(|<}8= 'x$/% Y K0x(/(y$8/(! '&& a`` Yx     Z X  }  } {6  |w> a  `J`C`C - J gy$ Y z( :../y$ Nq,/(/ /%`Ь0М /% = /%y$z,{(|<}8 =p;e  N0` !@ /֭ ijk lmnh  ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ!1qȠs h0h2@(h h8h:࠾/(  <"  <"H  <0P <0  <" =hh8h:h7hShO h[ i~hjklmihh7h8h:h#h h l /%pp< /%h / /%  D L) ( <$  D L T \+ * ) (  /%`Ь0М /%y$!@`Ь /(/(z,{(`p@`tN /( /( =,h@X-` QF@$`@'&0@  @ /-p",p -` .X =+pP  /%h7h;-`h3h8،h:&  +.`  N  N!   /%pp<h0p `8 b/% h8/ QF/֠. 5 Ь0& q50 !  q.0!p$(X ho'n&$`-`؄h`8 @( @$hn8 5 Ь @ p=0 @ H 0 Nqcb/% = /%h7h8h:x$ /( /( - + /%pp=h0 /%/y$`Ь /(/(&  T5"e` KK 5 Ь`././% hp -pp0ph `-`p y$ N0~(?@f~$ N(@fq(!hi  qq 1 1 afa`b&c*d.e2, Cpp/& y  h>%xЄ@z"{&|*x @ qq8p0 `xp0 a,p2p6q:"bcd . qp8p& >| yxЄp4 `,x"`x&`x*x @p8p:0p3p7H p6.& S   > ./%& `0`2 Yx     Z X J_./x$ (a a//(/%`/% S Ь/% = /(` x( / = /%h7h3h8h: 1 /%pp>h0 /%/  /%$z,{(|<}8 = /% 1p#p/p&  N?d`0?d S Ь( QFלהׄX 4 S <0הH 4 S <0!הج S  4 S <"& Sה  5 Ь@׌ p~Pה (P?  q /p/qp p"w* a`fp$`b&c*d.e2, Cpp?p,pqp$ w( 1 ab$c(d,e0? q / )~y$z({,|8 /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( aabc d/ S  r мahz$cy&//( /( `l /(y&bj/  /%|(}$~8, = /% p#p/p& 5,d`0`X` `  *H q /p/qp p" a`cp$`d&e*f.g2, Cpp@p,hqp$  ad$e(f,g0@Sq //%`ЬМ /% = /%y$z,{(|<}8 =p@֭ h(pHq0r/(h i$ ' Nqq"fen = =h7h8h:h#h h /%pp@/%q  ,h  /%-ph *  J jk lm a`no(pq@ /( =r/(T /(``*b&c*d.e2, CppABp hh  *  J * ab$c(d,e0=/%y, ! = /( Ok /%&  P./x$ЌЄ 9 = /( = /%`(x$Ќ ``0 S д 9x$~ 9ˠ 9ˠ 9`Ќ9h7h8h:  /%ppA = /(9 1!  /%   /% S Ь /%`ФЬ9h7h3h8h: 1 /%ppAh0 /% = /(A /%` /% S Ь /% = /(` /% =  /%h7h3h8h:y((iRy,iVH/(hShWh>   /%ppB^h0  /%/ /%` /% = /(` /% =  /% z,{(|<}8 =pB֭h@h(h/(h7h3h8h: =/( e  /%ppBh0  /%/ /%` /%~$ N/(P` /% = /%h7h8h: h   /%ppCh /%hh6h hz,{(|<}8= = /%y$/( z,{(|<}8 =pCJ *   S/ = /%y$/( S z,{(|<}8=x$/(&   aaB./ Y     Z X 8 a`0`2 J_& ay$aRaN`W`K x8`jx<`fx(`bx,`^ a `````7./& a q`DФЄ EFhЌ Dg@Д D8Мa.a(ќa* bLP`H0bJ`C`Cxq4Ѥ`b@bB(  J`@@`B`Cp{ppp pp J gV t ЌpSp| J gC`@ `B `DЌhDObBp`@`BbB0bBpp^p# DsDEEp  # ᐀ @ y {"xx xx8xxxx#x'x+x/ y {x   S y {x  S` ` JFp`C`Cpp% E-` дE+q E E&  " #D`C```Cpp  J g ii08h4 ih   " #0Ehp ᐀ @  S`C`C`@`B` д`  p ᐀`V`u z) 0p# EyEEEEFF9FjFFFGG1GGGgGzGGGGH"HSHHHII:ISIT a` a`````Cp  J gp`C` д yz0x4z8(pp J gCp G J_p`C J gC J  E` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gC yz0xx4`z8(ppp) J_p  J  40 K(Ppx8 IUp '  &S ` JF Elp J gC@ yz0x4 `z8(ppp xz8(pppp Gg J_p " @ C  A J   K(  pT " BS` JFp J gCh yz08x4 p ) J_p  J  @S ` JFp J gC yz0Xx4@p Jp) J_pp```C`C  J g7p J gCp K(qp pt '~8  I ᐀ @  t S` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gCp yz0@x4 Hz8(pp`z8(pppz88 t Фpp) J_ ᐀ @  S40 p K(Ppx8 IUp '  &S ` JF Elp J gCh yz08x4 p) J_p J  40 9' @S K('(%  *pT#$""'& @S ` JFp J gC yz0Xx4@p Jp) J_p ᐀ @  t S` JF )S%,  A( S   ( HIjI؂` ? ? Iء   ! #$@I# !&%I#()X 9":'IuR-)-uve2e6% '`e # p{&( S ( ! !   ! ! !#8', :qR-$-uve2e6% '`ep{ qp y q@ z2p@ pp& q# sx@&  JxBzB..&  p. ᐀`V`u z)  J g&&  }  } {6  |w>  J a`` a` a`C`C - J g7..& q z2 q@p@ pp Y Y   (O !   X0  '' J_. @ 3 J ᐀ @  S ᐀ @  S a 1 8  `JF S ФX *   ! *  +N J_pp  М&  !.V 5 KE^6V6F iR``` ``-#c #@  #@`>`B`N`R`V`Z`^`b`f`j`n`r`v`z`~````````a`m ``m `ޠ`Jh`:h `Fh`BN>^>& iDnH?@LBLG  L*5!e L`L`  P`  QpiL NH MiL  OiLx@ O( O( Mp`P 0- h`R(-`R`Nh j?.   (  5 Ь``мHa K )  ( ! ь hф @ )a ` H ) ) .& hD L5!e`,p .`-`` `  ` (@ 5 ЬX`м@a )  ( ! ь Pф ( ) ). , &  yiDMh N`phdoP 5 ЬMQ`мMQhdo Mih!@xЬjpklxp`xtN"#@"# =,p0 @@.` QF@$`@'&0@  @hfijjn 0P 8 @   .` -``h8،h:&  +.  N  N!  . ( ! ь 8ф  ) ) iDnH?@ࡈ5!e`hL  O10!hL O P ( @a ) H ) ) & `P 8- h`R.-`R`Nh & `Lp qph`Lh-`N.-`R`Nh p`L pph-p.& `Lm0h`R`N.`Lm0h`R`Nh`  - `-`` && b"`b…„b..& b"`b`Ьh S Ф@ b(b .& b"`bx`Ф` S Ь8 b.&5"e -` , `` KK.& &֡5"m -``m `m  ޠ..05!e V6F` ``` YX`~ i0 5 Ь- i ah bh`h` h`ލi- i@ h ih ih`^h`ba8 `:h`f ! S ! S ih`ji anh`rh`v`~ ii an Y С I p! @  aN>^& q.h qphph.& `mi@jH !(O} & j -`h  Ohn. & ` !hh` Ph hh  `.&  Q. M PH P.& `miP@jTp !(O & jV -`hS  OhWnb Nࠅ. &  j?. & `L h`p hHX0h<h@ -h h p }j`LbN"aR. ` h hHX0h<h@ -h h pj`b"a P  Q QF  QF i QF  QF  QF & `mhh7kJhG `  R P``.` !pph !0P٠& `m( -`hh  P. & `m0` .` !ppP` !(Q$&  ` hhThV  `.`Ф Yqqќ ~5 }Hxxx yRxФV   Nh```Qn^ Q  8 yRxФ0  Q g Q gC Q   ! S Ф0  Q g qpspw *V   N0`Fb' ) ```` ) kv 9 j  ~NQ^` ```  }x&& b5" bb.. 5"8  R+ g R+ gC 5"  qppppppp pKpOp[ p_@p q}ppp p]p p@p7 q5qqp S P S МqR r  s! RnRRRRRnRnRnRRnRnRnRnRnRnRnp6FV v S^N>(pp" 0pp! ppp"  p! ppppp qhL0p(p*(j`r6kds:hhp>pvhlpBpzhLp.hDp2 p ?!rnsrp(p*pV&h8SUh  qp,!hi j-p.pp qpSe 2ScS q5ri4SsiHhD@ "ScS:SSSc q 2ScpЄq"h q}pppp . C qp UBpUBh< q q VUBpUBh< h@ q q VUB& T qpЄq"h8 @i"h @p.p  (p V ࠎppmX V@p VpPpPp0p Vep VV q5qp q! r&V: r*V: r.V: r:V: r>0p"^V q5qؠp q! r& r*V\ r: r>   Bp"^p,q00p4pnp8prHpl@pn ppprq2p p& V  ! @ p .  p .pmp& pp-pp.   ## 0## `s,q0# -p& pVpS& ! . _p) 3 `'WWKWcWWWX WcWVWV ihhp( i-p Z`(`*p( i-p`(`*6FV q" ^N> ihhp( i-p [R`(`*p( i-p`(`*6FV q" ^N>ha$ Xx`8Pp  Xx(ppha$h@`` ` Y $.Vh hW}H hh0W Z^x^p(Xp@p(p p`` ` Y $.ha$X0Xp(@p(ppha$88 pp Xa$ Xx (8p p Xxha$`P(@p(pp! Xa$P(@p(ppha$xP(Xp@p(p p& a i@ q  Y  Ѵ!`'`$Xh    (`(`* YP Y8  '' Y Xx  ''p p"p%p!.& X g.& d X g. z2 q X$&6& z2 a i@ q `(`*  }  } { g6  |w>`   `'   ''.>.  @    ` Мh`hV -X `X^ a i@ q  XXXXYp"@p!(p# p$`C`h  '&  }  } {6  |w>.p`+(`+ V& `$Ь .^Yhhi0hYK Z.^ Y`Dh`P `R Z`R(h Z& X g.   V YHh0   a i@ q    p`h  'h`C`C`'`+/   r 0 r 00 r 0 r 0   Фp '6 ( +>  q . r`P``` ``(`/`/`/@`/`*`````h  'hhh`R`PV&6 a i@ q` 8  !Z  !`(`*`'h `$Zl `Zl  }  } {  |wh    h   $.`   '`h `' `$ 8Z `Z `(`*phh>.^V&6 a q i@`  h[h`h  ' ihh`(`*`' ip jp&p Z `Z[J i@ `' `$  [ `[  }  } {  |wh     $.h i@`phh   '`>.^V&6 a q`   }  } {  |w i@h    [  Ѵ`! X~ i@ $.h` ihh`(`*`' ip jp'p [ `[[`' `$ Ƞ[ f qp& X gC X g. i@`phh   '`  !>.^V&6F a qq0ь` S"q2 p0Ќ \Xq0q2 S" Ѥ0  V  ~ Np'     h\#^ѬH  +pV   N KK\O^   }  } {6  |w>`   XN>.^ qpppp+pOpSp_ pc@pppp qhH0p(p*(jPr6kTs:hXp>pzh\pBp~hHp.h@p2 ?!rrsvp(p*pp+x qpCp \\\\\]*]+]]]^](]]]]]]^^^^^^p \](](])])x0y0 x0y0p0 q,  -pZpc@ pW& ! p. _  -pZ  -ppc p ]2]5]C]\]\ \&ppX a  \H&p apX hppZhhh4:.. ^ qp ]i]i]i]k]npp^^^ ^_^^^^^^ _`$`m`^^^<^ ^^^`a^^<^^^^^a^^^^^^^^^^P^^^^^^^^^b^^^^^^ep h p ]]]]] \&ppX a  \H&p apX hppZhhh4;..^^ _^^ ^^ ^ ^^ _^ ^ ^ ^ ^ ^^ _^^^ ^^^^ ph8h:&  R.ph8h:&  R.ph8h:&  R.ph8h:&  R.h4  p_Ipp-pppK_Ih4 ^ p_hpp-pppK_hh4^p 1! h8h:hS L& h79hJiR R. ( hL pa.-pp $ ShXp^.j^.8hi __ pp ^ p-p"p `,h6p "q  q q" Cpppp h p h^.p hphh- hiq^p hph(hih4 a.__  vfonh `!' p xpxpxpx~ ( x`e0n~ 1! h8h:hS K S&   R. ( 1! hXh8h:hS LN& hJiR R. (  xph- hiqppp0p hppHpiDhH  xiD NfnP OnF  "$Ą$N N Q_hLЄ &  R.& p S Ф asaфxhXP`Є `8`` h` `hXx`hXH` hXb.a.a.a.a& p S Ф as`ЄbcЌ0lHpiX ! (! iX !0h!Ph``bc .a.a.a& p ascӌ c c .a.a& phLЬH as``HhXh\e 1  h``'iLѤiPa& A iX @&  h.hLH as`Ќ `` .a.aiT. @- (*0  !ࡆ p)0iD Nx``Xh\e `$  ` as`ЄЌa& b b.a.hSahSah4 ^x 0 pQ@pp-pppKa.& > 1! a ! єahH p a  aqp a a asa0hSh-pXqhLa.` h. hhi!hhLa..hSaф iD N`qhShShShhSPhS58 r hH p`\qpp мX 9pa9pa9hS(hS).hS* .` ` 2. >X @ (  hThV&  R. p,q00p4prp8pvXpp@pr0ptpvy2q2 h 6&pjDbd҄pjL5"e`,  bhDbCbHbKbQ  ` DH iP [iP D hW&  R..>hW hW phW XhW @hW ( "  = =p =`Ѽ>`pXh\@ G z҄ ^ V6F 0= >(v8p c 0x(x( c7N>^ ! o ऄpH cp դxVF  $. `% 8"N^Hh ? 0x(x(N>^90ph ? 0x(x(V f^ @  Ќx  H&6 H% > >.h` .  S .  S pd Hi C 9  e hj dq #d#p f dq$a p0Pp4d  d0  ddp4d  d"dp0hФ(hqirphv yyx  'y2y6 'iRp< q@p qpp4d dWXp4dhh 0dW@p4d dW  dW! dWR@p4d dWP@p4d dW@p4d $dW$ -ȠS * XSȠa " !!$ > d< #p` ?@x E  ""  ' NqfeXhpht``FPhp8hth ha`q a      (!0 d ~襖   5#Ӭ8 ! q50 ! ~ q.($#ho!k F$x X pd͂" eeeeeeeeqѼq !``Hh\0q$a F Ƥ eiqѼei ""  'ei Nqfe`bHbb 0a`q a q0a" D  a`q a ``` jh o   I >   a`q a q0a"```A j" oqѼxp `P8h\ E  -hq0 eeeeeeqѼp q ' Nqhfeb a `q a   Xa `q a  qѼ@0q$a  qѼ@A0q$a  p `X@   1i 1I 1) 1 p fF ""  ' Nqhfe,N`  -`&hh7l: /.Snf`>`` jh o n N qppappvpppp&p+zIp2p7zp;p?pBpGCpJp[g    :pn qg2 `p ppap& p@ ( qBpD a`4:rlPpn C  > & p$ p p"hp# q&p(p(p0 p,p.`p/ q2( zp4p8p:p<p>pL hpHpJHpK qN qPqNpXp pt Xpppr8ps qvpxpp 8p qp.pgXgYgq qp qrp  qppp q`aq NX`@`0&  o.pqp `& ``a` hhTphV  a . q  pp qp'p#    qq2p/    qqrp &pTpV a`Xph`2pd`.p``*p\`&, C. f qqvrzps  qpxpvpz ass `hT P as`Π8   ahLд8м  h0 t!Є8 B  C 0 B `H A a  C   ` hiRh`iLX asbҌ bb R`mv 9 h~V as``^hЌ8h h  h̀V ( h(#h2 ^2 & ( y. ih i- j`'xii;ii i;iii  g ob J gCx((x* JV  Jxx'x+ @ g<  @" xb`x+x$e   9 x$e x ix('0x* z% a qpЌP a q J_  8  b`x+x$e   U9 x$ xm hhy$!` i<  i>hTzyyxx' oa(igx ig n% jh oiU`'b`Ģxy<0 I    9 y< yDu0yFy<! 8````xHxJ& `, a` `"`H!a.aa i`hh h",hho`hX`V`[,hhZ i `V`Z,hh& `, a` `"`H!a .aa `, a`40!a6a:a6 vfV6&&. qv8&`&x k`( k  ` k p<6  |wp3p?pCpGpK> )p86f v:p46@,6/p6p7f f,~&x` '` h`h7kJhG6v   R~>  j,x` `j 6 o>..>^n~`X6v  ~>` jjf 1& yx8eh` `x<6  |wx3x?xCxGxK> 'x` h`h7kJhG R  ~:~6.n` `` & A lX.& y  l mW.f& qv&`&x l.`( l) ` l)p$8 ih g z2h ~p'6 i@k hh ih$Єh'> ` c p6f vp6@,6/ppf f,~&x`` h '`@h7kJhG6   R>   }k,x` `k.n`X6  >`(` `x` P& 5 e lf qfTpvp0ppv`X}~V/hZ`W`[`` M lv$覀  ihH g z2h ~p'6 i@k hh ih$Єh'>`<`>&` H&`` c lXh7kJhG   R }ln.f 1xe m7` `x$@ ih g z2h ~x'6 i@k hh ih$Єh'>(` c ,0` h 'h`h7kJhG R   }l~~n` X`(` `` `fxe m`T`W`[`` M m~$覀  ihH g z2h ~x'6 i@k hh ih$Єh'>`<`>&` H&`` c mi8h7kJhG R }mim\xxnf``LmhHp qp$5H  ``!n yx8&`` c  z2x ~p'6 y@{ xx yx$Єx' ~> M`<`>&` h7kJhG  R } qpn7n:nPninn7n5n5 p$eHp p"` Pr`pp'rr ` ` M``p p" `T@rpp'rr p$ep ` }`  r`Hrr 0p` }`  r`rr`` ` M`` }pe8`Trrrp'p$e@ }` Pr` ~p'rr ih0nnnn h@ha.b  c>,xq 5 ЬѼPq q@ (-, aa ussh/k&h+xxx@> h e8hh&h+ o ih0  Ѽ`h8}h3h>hGhK& $. 0. x.hCxx @j:xh3h? `h:h6 !f 1 ZEnX` p ptuptup p n% oV6F` a!xy 5"ҬѼPy y@ (-/ ,x aa@p3N>^q3q~qrhrrrrrrrrsHrsisqrsqspppppppppppp{={R{u{rprrpqrhprprprq,pppppppppp{%p !3N>^ppppppppp    sx h $  h< hP hT ` zx hh ijҬм   s  xh h h h h h ` zVF   s x x ` zN^VF   t!   4  S  S 3 q `L zN^  ` z   s R iRhЄPh(  '!(  S  S 5 Ь8x( 8   @   ` z   s  5 Ь8x( 8   @    S` z   sx `  Rx( ~0 b ´b  x( ~r* 5 Ф 3 3 3 ' 33 333 Y7? 3  S  S  r  r 3  r%h 5 Ф@  ` '` S  S  S  rH  rN S  rY r_`t z   s     yRyѬ Ѥ ` z   s Pq   s !  ` z   t!  ` z   t!   *` z   t! q   t!  x(  x ` z   t!   x hhi0i@ !X @ ( p yRyѬ Ѥ t! ф ` z   t!    ` z   t! q9   t!   *` z ᐀ @   t!  ` z& ᐀ @x( ~ " "   ""Т0 " 5 ЬҼȢ( " H5-lh" h i-h-֢5-lh" h "" )  z" / .& ᐀ @  " i-h- )    & ᐀ @x(  5"Ҭ~֠5-lh# h h@h( ( i-h-֠5-lh# h ""   z" z"/ . z" z"x .`  a!xy 5"ҬѼPy y@ (-/ ,x aattttttt F  ` zNF   u( x x `  zNF   ub   ` zN& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h "" s& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq,xx@ S y!`a 5"ҬѼPa a@ (-, aa@uvv~x:uuuuuuu}j}z}}uuu}Y VF   v5y!hiHy"!"""iL @ф  Ѭ HѴ  "0jn| 6! S>  "&` ᐀` `      N^ ᐀ @z# "x(  5#Ӭм֠5-lh h i-h-֠5-lh h ! ! ) " / V6F  x hh` h\ h h|  `  zN>^& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F   wx h"""""x0xC+N>^w wwwwwww  6iLPkx#hh hd >wá kx#hh hd "ht "h|  wh|htV #wB^"""  ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" a> z    (( """ " """" p " "" %"""""`2 z (""""""` z """"" "x$ ""`  z 6{x"> " >h& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F6x;>N>^xTxTxVxTxTxTxxxT yy   iRhм0h,  ?"""` z    & ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h "" ! z" z"/ .VF6 a qqTx hh (v֬0м ijtT ijspttx y{ 衅`bbfcjdn`s )`whh`z`/`x`x pp`p`p `p`hl```` v `Ġ X g>N^pЬռ8`bbfcjdn8`bbf`kdn`s `whh`z`/`x`x pp`p`p `p`hl```Hj j b v `Ġ X g>N^x ppL y 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p``p\`p`p|`hl```Hj j b syi 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p`p`p `p`hl```Hj j b syiz# " ihC ᐀`V`u g` ` aa```a& a i@ Y  f 1 ZEn gh ai@P1hh aa(Xa*a$΁ g z)pa$@  g  .   aa(a* g J_ 8& g qq< a i@ Y6  |w>qqp6f vp6@,6/ppf f,~&x`` h '   }},x` `}Ԡ.n~`Ψ f&& qv8&`&x ~`~ɇ('~H`~Ʌ` p<6  |wp3p?pCpGpK>p86f v:p46@,6/p6p7f f,~&x`` h '  ~v,x` `~v..n`Χ q  ppf&& q,v8&`&x"p86f v:p46@,6/p6p7f ,~&x` ,x` `..nf& qv &`&x `( p$ ih  z2h ~p'6 i@k hh ih$Єh'>p 6f vp6@,6/p p f f,~&x` X ,   ~  ` h 'h`h7kJhG R    }8,x` `8.n`0 6V6F9 "* Ƞ8 !""SN>^>   t!  ` S  xx  z   t!   x x x( ` z  yy! ` ᐀`u z) gV66 ᐀ @x$ hrrrrqsqr pr pr .S`5j8p0`7>>^  `6a a*pphpJpO& q uHpL ``H p\ a `)uJ p\0uN.pO  quHpL ``H p\ a `)uJ p\(uNpO Ƞ Ȭ    `` ```````"`& a`H`J&  o. `:U*Ep( n% oG ^f` n8~ 8888888888 f` nSSSSSSSȏȁS i iS f` nn㊞܁nnnx{nnnn f` n  `a` hhO@h|h hhhhhT b, ' j&  o.GÁÁŁށÁÁÁÁ  n o`a!hhO h\hZhth~hxhhh na!h ' hK R  o n +a!h ' hK) R  oG! ` hhLhN => , ^a!hhKhS R  .` S 34 34(".#&< '0` ppp7 6s00` hhh`0 hhh7k2 > * ` S *`  S`  pp7  p0@p8 p<! `  J '@` ppp4pp7  .` SX` hV6&    .>^V6&   .>^Pp8h p.&6! ( kv 9 j`e P, ~>. N   o    n% +  ,`(  框~( 5 !  `2X q y /%`! P" 砲@ vwz}tttttttttttttttttttttttttttttttttttttttttttttttt        p N! n%`  ` o N! n%`6 ]#  @c> o  n%   o q y /% n%  o8 n%`  ` o& ЄЄ & '` pp49H 0 @ p8xp`!`=Hp7p3. .tp pp7p#f&hhޠ  fC  uf3 0f( Nf) ehf .0f f" Vf= pfD PS(1  م? !H@ => , ^.tp pp7  qpt p` h  N! , x   N! ,`` jh hЄh  N iRhФ  NN !"t` hj~  WG M` h( hh`8 hhh7h3  N! ,  q5.М qqr 8` ppмqr` hh8xh49X  @ @  N!`` jhh\  Y 5"    yx 'x 5"     N!  N yyy2y6 ' yyv!  'yR Nq,`  N!``` jh  N!    NN , & qpp(` >` h OZ  P` hhޠ  N!`up49H  @ 0pp7p3 ,   . !"X  N!`` jh  !"8  N!   J~ ?,f   <x  N  N!`` jh ! `` hh@phB` X ! &  J i-h` hh~8 i- jx  N  N!`` jh` h 'j4 !4  ! h p  N! (``K .֢9`` h 'Hh49h8 P` hh@@hB` `h~8 q K +` JX  N!`` jh   iX  N!`` jh X   N!`` jh  !8 !*!d N6` h q5. r ` 5! S ФX *   ! *  + q *V  ,^ Mhh q y. i jxp. i jxx2x6  ( "  ' Yp i qh rhphp hp @  N! , >&6V (# q.p   H   ^>. qppp `8p$ФЬvVF&& )%, !$$ a qrHph Bgh%P$8` LH 0  ` h '`h7kJhG R  ά p\9..N^~ 0 " #0#  `    h( , 8 n%  o @ՉՉՉՉՉՉՉՉՉՉՉ׉׉׉׉ՉՉՉ `a j"&  o.(`@o' n% +a!h 'hh7hK)hGiLiN R   o `@(F8E G   Є& (& i ..` MKKKKKKKKKKhhhhKKKh  n%a!h 'hh7hKhGhPhR R   o n%  o  n%` o`!  n%  `` o@Y  qa!hv =  skbsk^(( hKhKhLЬpij!Hppibj^8hKhKh7nF@  s(s,kVp  6#  G>q$iZp!` q# G h8 iZ h-x   7hKh7nFhLЬ0hi  Rb"hj<j> ` y|{~ }` xxLЬ8`!0"(X$y| #z&%|{~ }, ' j o`a => , ^@ 7  pxbpx^ 7  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x ~` y|{~ }` x|{~ }, ' z` n oa!hiL @iHh8hLhP V!# r^hRhN!h   7h7iD(hK`hK8hKhK R   |w` n o n +a!h 'Ph7hK)hG R   ohK8hK ibh^@򍟍 v qa!xv~FLNb"hj<j>   pxbpx^ @  ~F (  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x 0  qrs ~ => , ^`a!hiL v IiHh8  hLhP!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi hHxJh`xbh\x^ V!# ^hRhN !h t!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi h`xbh\x^hLxN   7Xh7iD(hKHhK iDiFhKXhKhLЬ0hi  R  n% n 'a!hh7 ! ьфaiJ) hG R  o ohK hK p@  & ^.ԎҎҎҎҎҎ ` a j"&  o.``  r'   n%  o  n%  o(` ' n% +` h 'Ph7hGhK) R   o  ࡆ n%` h ' `h7hGhKhPhRSQQQQQ^  n%  ``  o n%  `` o  zzzz|z  ' ` hhL h7hPд(hKhRHмhK hK hG R ` h 'h7hPд(hRhKHмhK hK hG R  ` h '@h7hK(hG RH0' 0 n%  oVf ) !0 i#  G xm  (h7h;- |=(&Y< <-x (/}6(/}6n^Xh}0h R/h  RV !# N^& `.}}xkxmxxkx 6  2``>` h 'h49(hKhS(  S  R ڠ `  ϐސ̐x}}xxxxxxx ` h ' `` ` j" o L 8 qp$ { { x6 qp<8  |w>P ~>( x` z ( z    n% o ` ' `,`  68Xjw6 jj6666t ` ppPpR qp$ {`` `  ` j" o` ` hhPhR`` ` j" o`` hhPhR  L`   ` hhޠ   aᑮᑮᑬ `P8 K ]`  z! ~" z= ~P` hhޠ +  a N 5 Ќ Y     Z X` h 5 Ьhмh@hB``` (-``P``( ~p 5! q K   +&  ,.   N!`` jh o  ,a 8` hh@ $hB` jh o    +&  ,```.`    ``  j" o  ' + 'h` hh7hKhGhPhR R,h Ph` -` -````` jh o `     ~ a!hhK R X@   &b.6& a qsHph`H   ά p\ P.>5! ( aa +V&  ^fe ` K .^ V& b ^P`e `%` P kv 9 j, ~ф( ڠ0 L .^ F ,x~,xx ! /` M NF ,xx~,xx !/` N NF ,x~,xx !   /` (/` R Nv&  PH ( PX %$ S R$ mb A 9& k j/&H a< lX o.~&  f a `-`  . &  f a `-` ! . &  f a `-` = . &  a `-`  . &  f a `-` D . &b"hj<j>.`p``  Q`f 1S&4(f&`nH On`@(`mHh498h8&  a `-` + ( . ءx !"tH M``) jh   (  N!衆 !"` h OZ p` hhޠ8  N! H   hH hPhR& q uHpL ``H p\ a `)uJ p\0uN.pO  &6   2 h  "   qqr d h  " R>.  (   qpp`$m &  xa `-` 3 . qp` hj<`,x pppjP`ptjT@b("  ,7 H   pTjT H &  a `-` C . qp`,x pppj0ptj  + H   pTj  x &hLЬxij!Ph`h\ ibj^.6c#hhJiR@c#` h8  QFjfijjf9#hkkrc#``hn R`>iDp! (hi  of` n(>(((((`(((((( f` nC͗CCCCCCCYYC f` n^Ğ@^Ǡez^^^^^  !@u| gb(;󗪗S  QP 5 ( @` `+ `p Q6&b"pr& ) kv 9 j, ~.` P.>f&` NΦ&4x a  `p` p (  xa`  -a j`p`p  -f&hn  N7pn@( nP&b("  ,7. OZ` p` p +`p  -f&hnަ P&b("  ,7.` p Q@ 5   Qf&48&  NN.P7 a { `pFd($$'F +N S! ѤX ) ` hhhN`p  NV&6    >.^h7 a a`` p Q@ 5   Qf&47 a 8  `pFd($$'F +N S! ѤX ) ` hhhN` @7 Pa`` p -  a`` jh`` jh `   - a` ` jh -`#` jh  - a& ", "` "``"p ",  "!``&` "`%h`p`$ !``%` jh.  NV&6    >.^ `1p  Y&6 YX     X Y>. - aa `+p`,p  - aa  `.p`/p& QX Q  qpp yrprx梄rtpvxp S Ф  Ь( * . t &  h -P8`E` jh +`` jhff&hn7pXn(nIh h bh$`* `hi h$ '0!  ,7 ih(`` ih@h` 0 @'    NN n%  oxzxxxzܜ  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  n%  `` o  N yRxЬ  N` @ yxx` ``@`( >  8 yxx  N! n%``` jh oa!`  gOf&hnަ7P8    > f&hnަ7p H 0   NN n%  o&#####%###  n%  oa!hiф@ N!  N ,f&hhޠ  ;( km yRxЬ`}xx  N  N!``` jh o ""  ' N  h`` KK``  J8`` jh `  n%  o@ݜݜݜݜߜݜݜݜݜݜݜݜݜݜݜݜݜݜ VF&a qtD 9 0   h  `-h7 hh;lZ,h^`h` xxq0iJhFhOhShW6 R 0  0  [ D  isj҄ h -x`  xЌxx`hh7h;`h,hJ` xxq0ihFy(iy,iy0iy4ihS=rDhO@@hOhO  ! i i~ R.N^  Є  N```A j" o ( i- ihla a``C j" o@```A j" o   I > ````A j" o` ``p`@ S @ G`A  Є& (& i ..`pġ'  `@  NPPtNNNNNNNNNNNNNNN  n% o6`m`` мx  ``  ``> n% o ' ` h   `!  n%` д8` C ` o n% h  o n% A@ڞܞڞڞڞڞڞݞڞڞڞڞڞڞڞڞڞڞ `a => , ^@%%   n o` hhLPh A`` h h 6 n o` h  `(  ```>P`B  n% o'`B   NN n%  o@yyyyyyy{yyyyyyyyyy 6F => , ^N>` hhj xhL A0`` h ! ќ``! h@  jjhf@ ԟ֟ԟԟԟԟԟԟԟԟԟԟԟԟԟ `a j"&  o.`a j"&  o.`a, '&  j o. ^& 6֡@#>.1La ` hhL`a j" o` hhLh@`a j" o``  ` hhL  h`a, ' j o ^ n%aX!h 6 ) >  o naX!h 6 ) >  o ` a j"&  o.&  qr$br  `@`r$`` j" o o.``  '0 P  NN n%  o  n%  o   H0' 0 n%  o6  1``>&6 ,@ }Xv,8 ~g~(```@`  ` L` h ' ``  `>.6V yy8x< ' Nx.& ) * kv 9 j~v 9 ~ P&bb ,. KKfe^> !!t ii i  `` ppp`ii iii ixii```p`X` @` (``-&6Vb"hkxH0-` N      8Fj' S! Ѥ8 ) hh ) kv 9 j, ~  NNN^>. ih`&6V yy0x4 ' N   @   ^>.&6V ""  ' N   @   ^>.vfVF&& '@ )%, !$$ a qvHphP(M M! D B Dg h h%$ R` x`  LH 0  ` h '(h7kJhG   R   ..N^n~P(   hP Rȁ  0 -X`8 0  8 ,   D,!p  `Fp( $',  N6  2>  NV&6    >.^vf&& '@ a y 7 qvHph7(( y Bx$`g@(@`` `@`  ` L` h ' F N   ..n~ vV A ), b } 9 ~g ^~&FVvV, !(  6 N,V A% ) } 9 ~g ^>g^~^N.vVb A ) H } 9 ~g,  ^~&FVvV,  6 Np, A(( } 9 ~g >^~^N.8Ќ00hh}8hkR R/h kR RF6 a8 qtHph!h`H`0`$$@   @>N  h7 h^&    " .hJiVlFhO  hRhhh:hZ RgX@ ( ` pp(` ¡'x n%6` h  > o p   n%`  o     ` pp&6V (" #46؃#4"6 `  P `  ^>. q K *` pphPhRvfVF&& )%, !$$ a qvHphxg%$ B R`  L  ,    X..N^n~& q@դp4p6մp0p2լx%H0 qJ.& q@դp4p6մp0p2լx%H0 qJ.& qB!.. r p. r q@  qD i& q@pDpF. @ @2PTI,ptispptispSUNW,ispSUNW,qlcQLGC,ispQLGC,qla: expected 1 interrupt, got %d clock-frequencyscsi-initiator-idispPTI,isp%s: no mem for sdparam table ISR 0x%x SEMA 0x%x%s: cannot allocate request queue %s: can't mapin request queue %s: cannot allocate result queue %s: can't mapin result queue %s: cannot allocate FC scratch area %s: can't mapin FC scratch area %s: kdma handle already allocated%s: Request Queue Overflow++ %s: kdma handle not already allocatedfpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiestwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath_fakebootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector romprop...Hled............virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error...X.H......eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d getpropintsearch_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !romgetcursoraddrPROM exit failedPROM boot failedsdconfig_attach: device name too longgetdevunitvndraidrdstxdxycache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent fp align without being the FP owning processfixalignin4_cksumstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b VME0VME1VME2VME3VME4VME5VME6SBUS0 SBUS1 SBUS2 SBUS3 SBUS4 SBUS5SBUS6KSEASCTVI5MIFVMIME MAnmiclockprofih_remove: intrhand %p (fn %p arg %p) not found from %pintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to unremovable fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsoftintr_establish: level %d interrupt tied to unremovable fast vectorreal mem = %u (%uMB) startup: can not steal dvma mapunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %lu (%luMB) WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapiodevmapdev: zero sizecurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed _bus_dmamap_load_mbuf: not implemented_bus_dmamap_load_uio: not implemented_bus_dmamap_load_raw: not implementedbus_dmamem_free: nsegs = %d_bus_dmamem_unmap_bus_dmamem_mmap: not implementedmmrwmmrw: out of space in kernel_mapmutex %p held in %smtx_entermtx_enter_trymutex %p not held in %smtx_leaveVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%lxpv_syncflags4m: no pte pmap: %p, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) rp->rg_segmap == NULL! pvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below VM_MIN_KERNEL_ADDRESSkvm_uncache: table entry not ptekvm_uncache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 insn access MMU missv8 data access MMU missv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 intwatchpointtag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsdvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvmapbuf: null page framevunmapbufcpu_fork: curproci7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt kernel: %s trapFaulted in DDB; continuing... prom?%s(0x%x, 0x%x) at i7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), /emul/svr4svr4_readdir_callbacksvr4_readdir64_callbacksbrk: grow failed, return = %d svr4_setinfosvr4_waitsvr4_sys_statvfssvr4_sys_fstatvfssvr4_sys_fstatvfs64svr4 socket cookie mismatchsvr4_sock_ioctlunknownsvr4_sys_xstatsvr4_sys_lxstatsvr4_sys_fxstatsvr4_sys_stat64svr4_sys_lstat64svr4_sys_fstat640unsupportedti_bindsvr4_stream_ti_ioctlsvr4_sys_putmsgsvr4_sys_getmsgsvr4_term_ioctlsvr4_sendsigT_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR (sparc) svr4_sysarch(%d) /emul/sunos2Kn,X  `  % K2Kn,X `%Ksunos_sys_ioctl4.2ffsnfssunos_sys_mountsunos_readdir_callback1sunos_sys_uname.Nx.Nh.NX.Nx.NH.N8@`.Nx.N(.N @`.Nx.N.M @`.Nx.M.M  @`.Nx.M.M.Nx.M.M @`.Nx.M.Mx @`.Nx.Mh.MX.Nx.MH.M8@`.Nx.M(.M@`.Nx.M.L.Nx.L.L.Nx.L.L@.L.L.L@Magma 2+1HS SpMAGMA 2+1HS SpMagma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_SpMAGMA_Spmagmamttymbppmagma_prom %s (unsupported) clock pri %d softpri %d: %s magma_attach%s%x: fifo overflow %s%x: ring buffer overflow : %d tty%s smttydcd: %d port%s mbppdelaymbpp_sendmbpp_recvspifsttysbppSUNW,spif: expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMHz stcpri %d ppcpri %d softpri %d : %d tty%s ssttycd%s-%x: ring overflow CCR: timeout : %d port%s bppSUNW,bpp: Zebra : DMA2 : Unknown type %s: draining still active (0x%08x) xboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %sexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl: expected 1 interrupt, got %d : expected 1 register, got %d pri %d Tadpole_S3000XT %s: %s%s, %s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected return value (0x%02x) %s: command %x failed %s: (op=0x%02x): unexpected data (0x%02x) in state %d tctrl_set_glyph%s: SHUTDOWN REQUEST! %s: LOW POWER WARNING! %s: main power %s restoredremoved%s: external vga %s attacheddetachedtctrl_read_event_statustctrl_read_ext_statustctrl_belltctrl_brightnesstctrl_tfttctrl_lcdtadpole_powerdowntadpole_bellapmioctltslotts102ranges: expected %d memory ranges, got %d pri %d: %d slots pcmcia socket %d%s: slot %d still busy after 3 seconds, status 0x%x %s%s: unable to create event kthreadtslot_event%s: spurious interrupt on slot %d isr %x couldn't establish interruptstp socket %d: rev %x pcmcia%s%s: unable to create event threadstp4020_evstp4020[%d]: spurious interrupt? couldn't establish interruptstp4020_delaySUNW,pcmcia: only %d register sets : expect 2 interrupt SBus levels; got %d : attach: cannot map registers pri %d and %dpcmcia pcmcia_card_attach%s: error %d detaching %s (function %d) %s%s, " (manufacturer 0x%x%sproduct 0x%x)at %s function %d "pcmcia_function_init: function is enabledpcmcia_function_enable: function not initializedcard has intr handler, but no function doesfunctions have ih, but the card does notdisestablishing last function, but card has no ihchanging ih ipl, but card has no ih%s: can't alloc memory to read attributes %s: can't map memory to read attributes %s: CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx-; memspace %lx%s%lx%s%lx@; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS pcmcia_parse_cis_tupleV1-1FD605 PCMCIA EtherNet CardSVEC%s: using CIS quirks for , %s : function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, %s:.p.pxz.pp.ph .p`.pP.pH.p@.p8.p0.p8.p(.p.p.p@.p.o@.o.o.pH.o.o@3.o.o.o.op.ohl.oP.o.o8H.pH.o.o0.o .o.o.pH.o.n.n`.pH.n.n.o.n.pH.o.n.nHT.n.oGC.n.n.o.n.pH.n .nx.n`.pH.nPHT.n@.n@.n0@.n .o.n.n .n.n`CGCZ)IeI.n.m.mZIZIIIIII0I0PI0.p8.mI0.m.mIE0.p8.m]IE0.p8.mPIE0.p8.m IE0.p8.m@I I.m.m.p8.m@".m.mx.o-/.mh.mP.mh.m8.mh.m .mh.m.mh.l.l.l.mh.l ")A.l.lu EE.l.lx.lp.lh@&o@o @o @  @& 3BIE0@IE0HTIE0.p8.m@IE0.p8.mIE0.p8.m I@#(01.00CFE-10CompactCard EthernetXircom8041TX-10/100-PC-Card-V2SMCcorega FEther PCC-TXDFEther PCC-TXFcoregacorega FastEther PCC-TXcorega EtherII PCC-TDcorega EtherII PCC-Tcorega Ether PCC-TDcorega Ether PCC-Tcorega K.K.PCLAE-CARDLINKSYSDFE-670TXDPCET/TX-RI-O DATADE-650Ver 1.0EtherFast 10/100 Integrated PC Card (PCM100)Linksys10Base-EthernetCFPCMCIA LANFast EthernetETHER-C16Fast-Ethernet10/100 Ethernet CardiPortEthernet CardR01NIC-2000pGVCTAMARACK004743118001ANDCLNT-10TN1.0VFastEthernetNE2000DCN40BC EthernetCNetP/N: EEN10B Rev. 00Seiko Epson Corp.V1-1FD605 PCMCIA EtherNet CardSVECAdapterEthernetW89C926ETHERNETEN2212ACCTONEP401 Ethernet NE2000 CompatibleRPTICISV100EP400RPTI LTD.DE-660+DE-660D-LinkUE2212PCMCIADEPCM-XXDIGITALPE-200PMX AMB8002TAmbiCom Inc: unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't allocate I/O space : no suitable config entry : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s%s: can't alloc mem for enet addr %s: can't map mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Vw.y.y.y.yx.yh.yP.yH.y8.y(.yH.y.y.x.xPttt3V.x.x.xV.x.x.x8V.x.x.xV.x.xh.x`.xH.xV.x8.x .xs.x.w.y(.woo PM.w.wk&h= = s qPs&! qh.w.wxl C.w`.w8 .w .waWR211PCMAllied Telesis K.K.D-Link DWL-650H 11Mbps WLAN AdapterD-Link CorporationGW-NS11H Wireless LAN PC CardPLANEXLA4111 Spectrum24 Wireless LAN PC CardSymbol TechnologiesEval-RevAPRISM 2_5 PCMCIA ADAPTERIntersilRoamAbout 802.11 DSCabletronAWP-100 Wireless PCMCIAAddtron11Mbps Wireless LAN PC CardNTT-MEVersion 01.01Wireless Card CMZ-RT-WPNECNANOSPEEDSMC2632WSMCVersion 01.02HFA384x/IEEEINTERSILWLCFL-11ISL37300PWL PCCL-11coregaWireless_LAN_PCCB-11corega_K.K.Wireless LAN PCCA-11Wireless LAN PCC-11corega K.K.: function enable failed : can't alloc i/o space : can't map i/o space port 0x%lx/%lu%s: can't establish interrupt %s%s , modem: can't map modem registers pri %dpwr-on-auxioOpenBSD4.7GENERIC#152 @(#)OpenBSD 4.7 (GENERIC) #152: Fri Mar 19 02:33:48 MDT 2010 OpenBSD 4.7 (GENERIC) #152: Fri Mar 19 02:33:48 MDT 2010 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC .ۀsun4c compatible.ۀd'(^ <<d d@@GF1vED-| @5wuHI@H0 0     ((((((((((((͸(ͨ(͠(͐(͈                              |Z[\]^kiabefgh_`qcdjtsmorYlpMNOPQ !"#$LKJRSTU()*@AB()%&@AEFCD7+CEG-/)/)./x//,./6/x/./6//./6/D/X.///0.//l/.///.//8/L.//8/L.///.///.///. //h/|.(//h/|.0///.///.///.8///. ///.@//$/8.//P/d.//P/d.///.///.///.///.///.//p/.//p/.//p/.//p/.//p/.//p/.//p/.//p/.//p/.//@/T.//@/T.//8/L.//d/x.//d/x.//d/x./+/./N//./N/4/./N/d/x./b//./b//./b//./b//./b/,/@./b/T/h./b/|/./b//./b/ /4./8/L/`./ //./ //./ //(./ /x/./ / / ./ /D/X./ /l/./ //.///./#//./#//./#//./#//./#//./#/ / ./#/H/4./+/p/\./+//./#//./#//./#//.///./#//./+//./#//./+/\/p.//\/p.//\/p./#//./#/p/\.H/,//.H/}/,/.///./#/X/l./#/X/l.P//X/l.X//X/l.`//X/l./#/ܨ/ܼ.X//ܨ/ܼ.`/// .X/// .`//H/\.h//H/\.p//ݘ/ݬ./#/ݘ/ݬ.x//ݘ/ݬ.//ݘ/ݬ./#//./#/`/t./#/ް/.///./#/P/d./#/x/ߌ.///./#/p/./#,y/./#//./#/L/`./#//./#//h.///h.///h./#//h.///h.///h.///h./#//.///.///.///.///.///.///,.///,.///,.///,.//@/T./n/l/. //l/.///.///.///$.///`./#0606./#0606./0707./07,07@./#07T07h./07|07./0707./#0707./#08408H./08l08./#0908./#09D090./0?h/./0?/./0?/./0?/./(((((((((((θ(ΰ(Ψ(Θ(Έ(΀(x(p(h(`(X(P(H(@(8(0((( (axf`  Ҵ  T    uT4/ rX\aҜϜ$#(x(8(0(((( ((((((((((p(X(H(@(0((((((((((((h(P(@((((((((((p(X(H(0( (((((((p(X(H(0((((((((x(X(@(((((((( (((((((((())((p(X(H(@(0((((((((((()(@))(H)))p)X)@) )(@)))))))p)`)P)@)0) ))((((((((p(X(H(8(()))))))))))))))))`# )X%)@$))!pۘߠHlL 7n)0)1THIS is A memory TEST pattern)3)60);%181@)<1"83P9:PXdHdPdd)=(ldol]^lbb3$2345''49''4:4M4Ll @ @)j/ p/ x)t@ac,@ @T  @@t 0@ T  )t`fh )x8X)xԸ 4W,) g4) ') )o,)o)o)))/"()q)j\)n)q)n)xn)po)hpx)`p)Xo)Pp )Hp)@q)8q<)() qp)pL)X)th)tt)t)t)t)t))X)|)|)))))j)j)xj0)p)h)`)X)H)@)8T)0)() ux)r) g4) ')/")/#)q)H)t)8uxy zzhzpzxxx4b@4b@P/&L6)/' p)/(p)/'p)/'p)/'p)/(p/(4s2)`)X)P)p)h)X))))))x)x))x)x))))))))))))@Tdˤˈ) |   ()X)P)H)@)8)0)() -Pa ##$ 8 l t  h p x t44  t Ր PX \TF @ PN RR CE ST NM $ <CL 0PL 0RE ,@RR CE ST SL RR CE ST ER CE ST /K| /K /K /K /K /K /K $/K X/K D/K /L /L /L /L0/L< (/LH /LT /L` /Ll /Lx /L /L /L /L/L P/L /L /L /L ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdefDۀ@`۰@4LtL4LtL          *>`*>*>*>*>*>*>x*>h*>}h}~*>ac*?\ *? /]d/]`b5 _^3@x*D7|/]/]*E t*Eh*JD,2/bXcxy/bXtȈ/bX, {/bX$/bXQ$M\T/bX@H$D/bX)@H/bX$h /bX3.0X$-/bX206$-H/bXa$d/bXl1$.h/bX/h$h/bX7$/bXp$`/bX|$/bXEL$IDE,K/bX$*P/^/bX. dd/b/bdX/b/b/b/b/b}E#(D<8Q @X,/cx/c/c/c/^/^/^/^/c/cH/ct/cL/cP/cT/cX/c\/c`/ch/cd/cl/cp/c|/c5)(@AAA==(A*E@ dd%(i @@@@@@@@@/eX/e,6X6X/e/e/eP/e0/e`/ex/e|/eh$/f /f(/f$/fX/f`*Zp*Z`]]_foh*ZPEEHISh*ZHÈè*Z 0dl/f/g(/g`/gd/g,/g0*]@,`*_*_*_*8*hX*pŀŨD*x8lƈƤ*҈$@\Lj*Ҙ ǰ *Ҩ |Șȴ*$TTʄ,* @@\xʬ * * * X@\0`* `@.P.* `@* @0p4* 00?͐@*0@@ 5 Ͱ?d *@X\0` *P`.P. *`X\0`*h`.P.*pZ*xZ*٨*ڈ @@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''/n/n/o/o /o4/o@/oR/od/o|/o/o/o/o/p/p"/pJ/pl/p/p/p/p/p'd-3(=0EXwS]Hbox/K| /KJ/Kk/Kk/K@/KB/K=(/KC@/KDP/KX/LP&=&=,&<&<0!:P&=&=,&<&<0!@(!;!@ &6t@ &A&A!KH!@(!;&9<4&@&@&@&?&?X&@!KH!@(!;!@<&9< &@&@&@&?&?X&B&@!KH!@d!;!@!A&78 &Bt!J!Ap!;!A&8TT&@&@&@&?&?X&B&B!I!;&:H T&@&@&@&?&?X&B&B0!KH!A!;!B(&: &@&@&@&?&?X&B&@!KH+/+/+x/+/\+/\+x/\ +`/\+X/@+P/p+@/$ +(/$ +/$+/$+/$+/+/+/+/+/+/+/+/+/+++x+h+`+`+X+`+`+@+8+(+++`+`+` +`|x (D 8(8\(\|(d0!H!Hl+ޭޭK %%%%Fh P!K!L+x!P!V!V!V!V!W !W4!WD!WL!Xx =/+h+`+X+P+H!`t!`!`!`!a !b+$TP @+ *PP+ *P(+5tM+!f!gT+!hT@!!(++!L!!\+4+4+!!x!L!8! !P+!!!!+ !!!˜!t!!!!!!!@!8+!!!@!8+@!!h!@!8+!!@!@!8+ !!0!@!8+x!!@!@!8+!!!@!8+X!0!8!@!8+!!!@!8+0+++++x+h+X+H+8+(++++++<"!\"!d"% "#(,h"9"9":":,!"?"i0"@h"i"i,""v,# ,#,#K"w"w"z`"z,,#0"t""`"@"l"8",)@"",*` X"p",.""Έ""д"L""""|,3,4,4,4,4,5,54"",58"h"$",5H"4"",,60x#p#,7x#$#,7H##,9\#L#,:P,;P`##,=8#1T#1x(#C#DSp#E#E#Gt#G,A#^#_@"8#ep#e#e#e#e#f #f4#fP#fl#e#e#e#e#e#f #f4#fP#fl#f#g ,Damd7930xaudioamd#h#h#iL#h#i#i#k0#k#k#k#l#l0#l#m#m#w#z#z#|\#~#~# #`##########sT#s,GSUNW,CS4231aonboard1@%+>IV"k}3 3 D ,K#@##\##L#,S##@#h#Td2d## #,##d++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy,W($$$$$$"$#$ $%T$&$'$0@$0,Y,[P,[H,[@,[8,[0,[(,[ ,[,[,[,[,Z,[,[,[,[,[,[x,[p,[h,[`,[XBoldface.iso1 / wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp//   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް/ / 2/()/`a/א///ش//////  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/o/ڀ/////$&/(!$$<$$,q$8$$|$$,r$$#x$$4,r$l$#t$$,r$$$P$$,r$p$4$$$,s$$`$<$H$,t1+$A'* + + $$$4$X,t8$$$|$$`,t$x$ƨ$P|$$$,t$ $t$$$,u4$ޘ$޼,v0$$$$ $0,v`p9100_romfontE!c$P$$0$$4,x`%t%%,y0%%%|%(%l,y%%%p%%,zx%!%"%&\%% ,zx%0%1(,|x,|p,|h,|`* %5%7,|%bX%c,p%g%h,x%xH%%$,`%h%,h% F%Ԙ(%%,(%%,%%%@%%%,,%%l%%%%,,%0%<  0&%&%.x. .. . .@..X.. %%8%%$%% X "{`"}"t"T""P \ t $ " $$ % . 6 5%ul%q%xH%r%rx%w4"p"|"h""@ !o!ph!hT!!!     ";">@"?"E"]"]

@"E"E"E   H @          $ӜԄl (d &0&P & (        # ##`#### #T#P###D # #p $l$4$ $ | $" $$$&<$' $'t $,                   (     (   '((($(((  ( D( (4(L(d (( (D((%8(%((&D(&  (/H(/P(/`(/x(/ ((/ (1(2 (3(4X (  u`uvHyHz 0            (       (   \  fhsvlo { || 20 6 6

.?8.>.Bh .>.B`h.>.Bhh .>.B`.@.9ph.>.Bhh .>.B`.>.Bh .>.B`p.>.Bhp .>.B`.>.Bh .>.B`p.>.>p .>.>.>.9p .>.9px.>.Bhx .>.B`.>.Bh .>.B`x$.>.>x.>.Bhx(.>x.>x.>x.Bhx,.>p.>x .>p.Bhx4.>h.>x.>h.Bhx8.>`.>x.>`.Bhx<.>X.>x.>X.Bh.@.9p.>P.@ .>P.@.>H.>@ .>H.>8.>0.>( .>0.> .>.> .>.>.>.@ .>.@.=.>@ .=.>8.>P.= .>P.=.=.= .=.=.=.@ .=.@.=.>@ .=.>8.=.>( .=.> .=.> .=.>.=.@ .=.@.=.>@ .=.>8.=.>( .=.> .=.> .=.> .=.= .=.=.=.=x .=.=p .=.=h .=.=`.=.=X .=.=P(.=H.=( .=H.=.=@.=x .=@.=p(.=.=8( .=.=0(.=(.= ( .=(.=0.=.=0 .=.=.=.=x .=.=p0.=.=h0 .=.=`.<.=X .<.=P8.<.=8 .<.=.<.=x .<.=p8.<.=h8 .<.=`.<.=X .<.=P@.<.@@ .<.@.<.>@ .<.>8H.<.@H .<.@.<.>@ .<.>8P.<.@P .<.@.<.>@ .<.>8X.=.@X .=.@.<.>@ .<.>8 .<.<.<.@h .<.>8.<.@ .<.@h.@ .<(.>8 .< .<@.<.<`.<.<.<.<.;.<.;.< .;.<@.;.<`.;.< .;.<@.;.<`.;.< .;.;@.;.;`.;.;.;.;.;.;.;.; .;.; @.;x.; `.;p.; .;h.; .;`.; .;X.; .;P.; .;H.; .;@.<@.;8.<`.;0.<.;(.<.; .<.;.<.;.<.;.<.;.<.:.< .:.<`.:.<.:.<.:.<.:.< .:.<@.:.<`.:.< -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYYYYXYYOY$#Ysvr40' 0 '(&i 1 1 1 3\\ 5\'a   |     '. H'E'0\opqx'Etb 'F0 'Ldy z'N'u  T j@ | | u, k | |'\'u'm@' | |'1,'^ |\'lX | 'SX | t 'P | | w l'g'?' |'CP'< '6 | |',L 'E<bx '2'Q | | | | | | | | | | | |'_ | |4 'H | | |'T' 'uTp` v lT xy }8 'j 'l 'ft 'e'kL'l | |'ZP'[8 | |'V |'U, | | |', {'IH p' ` 4 P 'u 'v 'w'L |'Nd'M {'^` | | '{'^'L  '}0 | vl | | | | | | | | | | |'J'd'L']  t | | | | | | | | | | | | | |'1'2'0 | | | | | | | | |'^<'^X | | | |   \ | | | | | '] | t t | | | | | | | | | 'H 'J'x'y'z |'\ | |'1'2H'0 '0@ | | | | 'o{$ uu  y<<   < @ }p x  | | |sunos&j0, &i |     '| H','\opqx'b | 'y { | T j@ | | u, k'@' | | | | | |'ܼ | |\ ' |'L t 'x T | w l | | | t |' '' |p` v 'ݔ<bx 0 | ( \  | |xx' |p  ' | { lT x j'( t | Ǹ  `  @ | 'd  |L } t y<  { @ | u'u | '   X  ݬ < | D @ | 4 P  }8y  t t     Ԑ |}p<{$4~'  x L |'' ߐ | | |  | |  |''$''P'f  $ |'''x' l  4'\ | '8 l`'4 | | | | |'8 | m`u H''d@  @@ @  !"#'t'.N4'P'.N( 8( t.N((.O(L(x.O4(.(..OD(0(0,.Px(4`(4.Q(.R.R.R.R.Rx.R`.RP.R0.R.Q.Q(8t(8.S(L(L(Md(M.U(P(P(P(Q@(Ph(P(P(P(V(V<(Vl(Qp(QH.W(`(`(`(`(a(a(a$(aD(e\(e(e(aL(dH(fT(fx.X`p(h(hc0' c'c055$s ?/ ޸5090:50:t0:=090:=0:t0:(0;40;(0;0%@LIƈlS/IXa4\{'dPt(l qt|# !_$0| ,"4z$2!0$p>/pIH]'j#M<v[(\jh&0X!n/0?/cl/?@  l0((&]d2%;/x<Q L^0f"p,n `wè/!` 42 %d/^ tl/C8 $</ rd)N7+R`Ct@N0]5m,~ 0D/((aD&Ӥ/m\͘d/x!PX<#S$/c| HT)|T7KTE6f\TTh!\uB8y404XD l'<tTs@/g`0 PtP %0-(0@7G`O'w_$ޘ$l/K } ̸mּ/U( 96E|ĸa<# d*%d8?@P PZ(hu6|/j$ ttÔP5)|ӀH8 /J< )8 <&~`t*:3 (TB#XQ4a!T<4n $z!x"L(@!xLL D W8 (/` 8  '#ɀ 8ٴ J< V l4 ^6θ j0\ }l #  /^ ӬH !0` 6ː( /c , 4Ud 0 5 "PT 24X  ?5# K8 ]5$, n 3 t5$0 z\p $# I  "`H $| $4 L  + L h Pt & )H 9 D( N!H [ g bxL y/ %  ( dd "  /]p "rL t(X /g|  / )$Kd8 ;,, O L jT | @ &:H g ` 4$ Y|  , \ 'a| 5 D p #> 4&} ;$\\ H%` X: j6g yP ,( &0  % #L  8 h  /PH /|d$ P@/C$V  6-<6f<Il_j&%$x!WL,/zt(/L T!@</#0|5)'H+#484xB 1(LW,t^$lʰ}/uDx5  V0Hq`/<5)@ *p5d|H!x1DF(N hW4b'{hq +,<z$$<m +/E0HX6/``H#E7 @B$\NϬW(`3Hi4LXq% ~&/T(5)P `6 4\(l #h@ l)< Tzn.|@wt f<f\89L vhiD"z`d `L#۸5#(pB$MP^ 4Tf8hw`/]%\p/ x74'o4P4>|% F$*" >/vDRc'^\q|pL,pl./ވ( _x\4#80p  @"885tAU06](RHw/]4t <@ |h xh0`Z\5l@ 0(y"tl96 `=(NRpaq/w @H$4P@E M @ a " dx(2|p/?xL <O\& T7H@J`U _4`[oyLx |`n,cd(Thp@@$',(H\ ($2$\A'ft,Vgey5/L Ӝ/T:|@$dR/K`{<Zlp 0 ݼ4t""l2\C5iO/Yʘf5@pQ$vHt l0xp%r5'`  < 3,t* /hX,.0;6F ]pP]#w$i!;Du xx&#@ X$~!fT!`  <d$L#  3xl)!5>P/B8R\ kd'u6_L5  [@<% 6(|< p<% d /fH/cX0u9 N"@` Ppk }{4 4L ŸX/clP @ ,4( #X<@&45B$L U/M8b _k6vר7$Wl/d<x+$TT شh *H;||GX/Dd ,l50y/ & X+RԈX&Mhl!L(6{% 8< J ! /( B%q J4$ W!  bL8 j4Ƹ u Ȱ X  //P H #p< D( lp  6t $!!I!#|!2!?(>!W#RL!e{@h!v/B0! 1D!p!$-!$4!#4!h,!;" P\"4"(/"1! D"=6L"K\"[5`"g#ep"t/l"4x" m`L"\"!lP"ތ"4"T"4"4s@" #  #, P#)"(#70#G {8H#T6{#^T#f <8#r/# 5(D#]<#/eh# oDD#>#P#/?# #$/e$ $(' $<$F#"D$M"$Z&BH$d/J$w6g $P4$0 0 $!QL$=$P$(ht$$5m@$5#P% !L,%/ l%$5%- d%>/G%H/%X/ch%j <%%l%/c%/Y% $\%/`%&NX%#+%/}d%.E %4|&:&!&!~4&7/,&M $ &Y8&c/&j#'D&w"h&&!st&xH&i\&/g$&\T&r & &9\x&' &s$' nd'*'=/h'G/?'NŨ('[5)'fZ 's&8'6'6g$'J' '"f'+'!8t'e('(4(#H8(  (,6 (4(= (L8(V!J(d! (u(4$(p(3(!X(('((&t( [$) T))*/s)7(D)A!)U Ǹ0)j6[0)s4)/C)'^<)$84)/^T)tT))&4) vl)! <$)/ߌ*#pX*5*d*- *8PL*H/<*U/*_*g-H*r4*0*/*0* Ԑ*/*h* 4*|** `+ + +x+* 4+4 +B/*+S ht+b +i ` <+u$,+/+6b+&,+$p+x+ X++(/x++T,/,"0,$4,, Č,5)h,F`,T F,`$L,l4,z5 0(,48,)p , ,8,?,$,#iLH-*-5-&(I-/%t-= $-I l-W/8-a60-t z8$-z(%h-<-,@-- 0<-&Cx-X-#d-6-f\-6E-8.4W, .6{.$.:C.H$ .UX.d<H.v"@\.~" .`. .< .%@.I|`. ـ$./0L.8/dD/ Hl/z/&]h/6"/G6/V/cx/r/b/(I/!1//L / -(x/t/p/|</À/0 !0 00%!k\0/$@0C0P<0^/w0s/?0 uX0T0 00(ih|0vH0 lP0$0!0Ψ01 ݠ14.H1#a10%bX19 l(1B 4l1Rx1]5#1f/P 1wiP1$1101/C1  5I5T4W5aq5u/5~#i5P5 5/B5'[85&?h55([|6S86`<6$!3p6/66B*(6QT6_"6f/6p(6z!lp6&=h6x6Ͱ6/d6"}646'06h7 7d7 `7( k0737>$7Lj$T7f#`7nY,7w  770@7 7/(7t787 D7t@8Ȥ8@48//H(8=8K$x8]#~ 8t#78|H8p@8 Ch8 8$x8 P8 yP8eh8" L8ld9 (&<9n(9!p9;59C/[h89T !9]0(9l/9,9/L99 H9$9=p89 s99: /b:Qh:&($:0/@:;&vx:F:[H:e$:u/i,:d::cX:p:(h,:6:/q:/|;T;;+ b;C'_x;R;_`x;m/?$;z<; `8;5P;; ; 4;p;;t<"t<"e<%| <8#88T=IP=U$=e5%0=mp=|.D=,`4=p==_,(=!W4=/=#k0P=#*=t>UX>4(> /N>6/*,>L>W%{T>b0,>o >> p8>(x>'x>ИD>/M>/>#S> ?09D? ? p8?4?-?9$x?D$L<\?XÈ ?g ?y_?5?']`?%F$|?#?&"DT?6h?$?2(?L@/c@ X@1/@F54@M4/@c'nD@vB@} (@|@;| @!P@@  @%,p@//@p|@L`@QhA!%TA DA&E0A8 AGddxAV/Ad <xAo#tAy4AA|A/i A#A A0A/DB/B 4(B!"@B) B@ BG$BV 20B^ LBh <BzNTB#6B`B $hB!XB8LB/TB/f$B%BkLBC5$8C HC.TC' C3 UC;PCG,CV0$Cs(4`<C}[L CdC %(\C#[@XC6ʈ`CDC//CCq DD D$ D9PDCLDRJDc'Du"#HdD/0D6_`D4D5D D 7D6DhDq@D'ݔ`E!1H@EE#E+'LHE;!2t0EETEOp`Eb/IEoEx5E DE"<HE- lE!+\E E/0EdE+$4EF ,F l |F /F%5DF:#eFI |FQ|XFbfFkftF}/!F!"XFF0F `F"TpF! lF/|FiTF4G"G'!AXG9/x GI0GU Gi.Gv G~GPGG(d\GTGG8G|G$GqH 0H (H)#xH= PHT $HkqHv LHzpH8HH HtPH L$HưH/@H( I &I?DI%|I*6hI6(VIG5IQجIc#@IkpIrT(I~^l$Iְ0I/t(I8I6hI%p$I5zɐI>I&дJ#J J3pJ)5iJ4&f4PJD.tJNTJ]/ hJq&eJy!U0dJ LPJJ x0JN(JHJ L|J+tJ%$JJHJe,KlK (K6_dK(hK3/CtKDR$pKTtlKdKs'IHKT8KK 8K%ϔHK/bK4@KKF K L4K(;(L lL L.xL&"-lL8|LK4:LWLn'@L!6@@LdL(L MlL8L5oL2L/4L L̜L/fPL<M &M $4,M0H@M:8`MDxPMO TM]6Ms(/M}xMjtM(M$#M/c`M.hM58M FTM 4M&x4M6DN 7hxN,N`hN)& N2tNFNQ4 Nj(0Nt0N{e0NN@NTNJ$hNHN5NxN OlO& O /}xO.@O=\OS+` O_7$Ok.{Os2TO~!\LO(QpTO6O!,hO&x,O O5O dOl`OlO%PXPP[P*QpP:|PJ+TPZPf'HPz4,P5!PhP5 X(P$PdP'4PGHPsP E`Qp8QQ$4Q0 pQ8/cQVQ^/Qg۴Qt%w0Q|/FQ@Q apQ.zBQ(`Q8QDQQ'yR/TR /<R`R'#TR5/CdR:4/RHLRZ/XRbF<RrR0 R/RRR/q(\R4@R (R dR/PR+ R/\ S 6X S/ES!S3tSB/USX =Sj/Sy0SLSH4S SESPSS/*lS#hPS/}T (TWHT#T5u8TKt T[1Th tTu.LT~/T<(T (@T#HTl T4LhT/i$Tp,TT/FU 'CU"P4U !hTU+U7#eUD UP OU[/L Ujv4XUzm<UUU/bU U,#4xUDU"UqLDUq$VlhV (AV/i4V ( dV,/TV8/(HV@4LlVN/<VX/Vb\Vh ,VoPV/H V&,V<`VV/V(V6ڰV0xV6μV$8W/?| WfpW' xW25W<0WE*FW^/We8$Wn(,WvsW! W5W $ W tWi@WQ<WW$ TW$"0XX/\X$#PX3%<X:#,XG/XZ!:<`XildXt3X(8P$X*X0<X XYX`X 7@X X/XBX&XDY+4Y :Y hY-T0Y75PYF.z YP xlY` |YpYhY Y 7,XYY6ihY Y/Y5Y YZ Z3(Z:`Z*tZ; (ZE"4<ZVGDZk>Z~<tZ5Z${Z/m\Z tZ/XZ Z(\Z Z[L[ [ [' [; Ĵp[D4;\[Op,[d#z8[q/\[ |[ l[dP[5[ [$$[$T[!Vx[/E[ ([4\/p\ \&Cd\#(\=t\J\SFL\iP@\ {4\4q\6p\H\/i$\|\`\/U\\ ] ] MP]5%]$| ]2(LP]B]Y4b]f#Լ]w6d ]]qL](p$]$|]48]]'b<|] ^^4^,!^3D^Aud^LR$^V$pL^b6c^u h^~T^^ l^ \^0^'p4^0^$^G__$HP_ |_6_E h_Q#CpH_`9_xD_x_T_$%T\_H8_(__$|_$r_/ `/bX4`$wt` `+d`2'$`C&88`V ,P`c"l\`s/<`!0@` e$8` `#,`ZXd`/dT``tT` ax,a|a6ra#a6/caV/?XadjpLaq.ava 0Da,a?da a"T8a6_ha48a!t (a (a TXab!BHbbJb-\bA/dbW 4bia@b tbhb4ba b%Pb"8pb8`lb/sbM c c/KTc+ c2(cAcG |cO tc^ zdcx$4chHcuPcf (c'Etc/uc c Xd(kTd`d#<4d2 Dd? TDdK͠dXڬ<drxddKd a(d8d\4d D (d4|tdHe'|e 4W(e1%'he=heLd@eZP|eg4ǀetelxe/?4e T e/(e/e͐eb|8e$e[Le e#>Hf!\lfPflf.X(f;/DfI(l@fS .fb6fk&:4f -Pf"Wx\f5mTf f%0df/f&ff!f A$g sLg"e$g2Hg> mgQtlgd#gvx|gۘg/8g'Tg$`gHPg/Dg/|g|g4g/HhXh// xhh'$xxHh2hC {0\hY,hi#1xhr/h~'x(h",DhthV xh*h h \h h#th0i'ZPi ti1XTiM `iX!pi`pis/Ji{%idi6i$diOHi `Ti#Eidi ui |i+j<j\j.|x&'bx<mxJxZ&(xg,xuq<4x g4 x T(8x/8x'x6tx6 xb x<Px/L$ y kyy"y>/'yQ/by^Ix,ylAy$Ty!y4y4V4@y!S4Ty/lypy(L,y_ y 4Pz$4z # z#&@z5z?#k zSWlxzd 8zy/z,zp<$z&>PzIDDzz~`z0@Lz%|z{${4{ p{0Sx{; <{M^X{Z $h{h {0{v L{/$h{#{`{5$${6x{ {6tx{! l{ l||"|"#@|06|E<4X|M,|d!KHL|mt|}!H|%%D|S|5$|/| (||/$|'^|%||'}q}D<} ,h}& }8}AEL}No<}_#kP}s40}/} } P}}*G} k(} |}/T} @~ ~!ˆ(~{~0~: Xt~L$$~V~n<~z'^X~\~hX~4@~/T~ D~/y~~ 8~H<\%4d1&1ph:")lI@S4(aoW4<ypn` FLhr\D¤@HX /t  ,! t./ ;/@LH@T' Pk40!6Fl]l&tP tt $@6"% 0. >094b@D4#HK/$LZ<l xv%/X L$&/dX/}LX ,H!*44` p@P\MPY/j o,yv\'2H<6˸/A ˀ %""9 ܈/l\ t*c> N[/Ddw 0r/h0~`XK$/k  @"D(;h 6Dt#5%46 P,>/lEW t`e?pm$\800(p<(.dX d4q/!6t&}t!4-@7TM 8La(d}4( A@(D/ h0*8ը)2'$&T/lL\*DA 8Q6\li r w/EP  6(Z(h/ 45% ($HD;!xHC(TTS X0c/Cm~$ m, 0d$ l8" L :x[ D68!,$@3/w:dDOH[ !e d~/y</!'lDtMx !X+#8, 8/%h6!p(@ DP\Z C,hh'm@$w@!/,6\/BD0S@P/'ܼHE, > ! ? L(/./4DAkLdX^Te Ɯo/^#L 8$/i\$/ 40"h&/\2<< 8P4rp(,45E/i(X+S` {lp/#P,0  6_p5% P|\(a-"D=͌@MYY]n6<w(Lp //l4X#g H* T $)90 (>#t,I5jQ L^rD~( t&XhL'PDV&}%t5) h5 % XD6%h0>HNqPx`,w54050$l6 K</p(/&L &j,4 Ph(a84>;@_'ds/B!8 /L /!<"]l܌(.`#Lfl-<'8O$-l\<t}`}iHP&mӀHOXm L5(4/)P,#H@%/: ҴE&TN!jHVL`bn6~ Tu/i$$޼P#enL D6z|PZ(, 0\#Y ,#1!D<?!0K!Hl|X kDt Tt~ /Bq<(d/c/G4D 0$ /s08(. A M'G<e%- m/T} ?P6\4#l !`(L!7 @6t`6/]4` ,"Y+" d>0I ^hn/trDr/0 `!p@"'@ /.p' H54UhA(L$,dV'b/^Pm> |x4 9(P"P!gT !h.@/x /H4S(/D(&$36A#dK_/k(h$x-d4h /ܨ$1D 'E`T A6it)/^X3%B#$R B]<k0 vl$p 5<#H!Ҩ(. h5 'Mp6q/<D!nX/ /dUlh; p#sx# 0"$x\.08sL09db$q/j (v , c0l(QH(5//6 h (06y\ -T=G hN5W'pfDu5% /, &dy 5x(( 1d T!o/lT84DA/HT a`w5H`(( dhX h07-0P$X/|4 < "$8,> 'xHY<XDfFv07~0/Gb @%,H6j4?8 /L # 0/0(@oH z(Tdf#8oD3 @"T,0 gp55 tĨD*' l6#$L9](x`n"dv t g( \/| `/,0@0X$$ |D# $'%>x|.4'H5ĜULf'|L~ ٤@/vT8 "L(dT#m xK[d<d 0&$<56tB/L XX/?Dfxr4H z?Ͱ 5n/\"X,O 5#f (6j8)v82=aN P]LTd08m/ps/K| l(\$P0H5#RҜ4^&2Po!RT| @`0P@u|%.T,+R< T 8%OdהH* 1,>6GXM!AcLt/,007|%|+|p< @`H07T (/H$x#@+43,H ClU$xe!(ql  84,p ,#lD(&B0<6Y& U - 66!; B6lN<H^$lj#l0{8X!Itp+& e$414'}0#8` 30/.. T\=hN! D_/ j tx I0<M<>#WEX< !("h.pD N/dW.d$_!l z4 L/ 4p4C8 hp$ 0Lh46j@ H$,dP6T,F <TX8`prLy'm|H\T(4"vxH60|$# h (h /dC%4r3d?pO ^z,j {<k@ p)#t0/^x4t41 (L$//"%5@.`@<tQ#"0X&8 g`}us!HzD T8# &"D%DP&hhΰ(/cA`<OP_.fx`q/C x M;p6ZPG/R(((! 5޴/@8? )p6<= I+8 V3\lwt_4< p =`hop4<6_P H uh8#*(./C>5%8HrLQ#XLY 0f-d|5n/ 6c 4 z\0 = TD@<%l,.: F7`R)2j&78~*Gt$P DCT!(!,/[8 0 X8/*(4(` K$Ta 0 nhyv;(#`0 tL x4;`#@";h/ /'!h4s FrDYj (w6ڴ+`#`&b( p `<(@/ $X$6t4A/fhI\V\PLl#@@y(,D/6^L: J̴ / #!D0d&7 B JHTWd fhl( Du /k P,sttD/!6T< x84| S|4  * |;#0TH/}hX <i,dwV\4@(D48 \ l"]  h"X5</(5$#((! `(<!P|M 8YE`gG w/܀( ۜ4 /0%(D/e(5"/C $h6jD DTn/l=tJ Q 4e +m`wY0PX&4/} $q/I|4 #'&?XP@ h6,0I6jH\k6pq/K 6jL}m ll/c y&l2q@T=(`F܀LT,|h/0wxDt t4 G6 (j (DH k&zP4 `T0?MdW #le#t Lf t4M% ,/vl8!6^tH"$|HT#"@1>/ H [?@gz#x*$Mhd F (<"h0/0 (8P(CP6 P@K z,Q@^|m<{4 …0P \@™ |¤/P¬$"X¸ x"!<  < \/>u&/8-$lX:I/C$ W/-n:L~tÊ8 Ý'dô'^`4/K !qT0 Y%6Hq@4LP(%6ڸ.hF$N W.{`#hm $Hĉpē |ħ#vĸL'p%`$ X}8d ͐ j0,0%SX6"h4CtP<h[6d#.Ps!lŀ#tō"[Š\ūz(ŷ8 P|h%$5 4@/00# 84:+C45V#agHk/&{m0ƊnƛdXƧ5<Ƴ# |Xx |&8/H% א@7(Md$CdY/|4pO@DǐZHǠrǭǺ4`d7d4< y@'u4/D$& h-LG/N/B U%B]00p5w/?\ȃȏ0@,ȗȪPHȶQHe6rt6L x("9, ""o $- .<H8MI<XX0 ,b&p0j!,|Ɂ/bɐԨɥXHɵ [,\k$H6`0/J\LT d,Gh:/\J4Q^ djt<ʊ`tʖjʥ#^X(ʵe&yh! AtX# f8#hx(07//(="ߨlNLa=(lH{4Sˌ0˔nˤY˵l˽4N< (Xft( A@4 Y( < ېF Q%ulhX\huX@u @̌ X̘4h̟/̪T,(s/C $ L`,!/,(Q:HXO(<Vi":r/eX~͇8͓/eͣ ͩ$ͱ6jPYT#,/" /l̀D,2 <GU$ztcl%-x`u "t<Ά.΍6TΞ 8hήθ@οmT$\h|8Rؐd#Z180Bc K(`d6 m,`z/$4φtϘ|Ϯ \HϹ d'U,d6d$'|TP&S0#|+/'$P6E U|,g1rxx"Ѕth Жv@HС!й l/U05%$0#^H $</L %0%<(GC`DWXc&ۨ<u`у'ѕ6ѩxDѴѿ @\/ Ϥ6d 0 74#,"(;xD4 VJ$aCXn/' wh`~ Ҋ#pҖX8ҟ5"Ү qT#<L/B(/! /y3hQ+4\=Hf#Xs<}/J$ӄ/}ӝ Hӷ&308ӿ!8lE (@ h(.p ? "lGƐ|[/ (<jolx%Ԅ/q ԑHԛ/e0ԪHTԱ"(XԽ"\t /H.P<dh6`4/\$(L5#<@LHN3LX |g/(u Յ \Ք՝ժ/H$պ !P8(`l8 Pp/w+9fTGVZ,@dr/XyO֎֒#"֙{L֧/g(ֲ(/X־ 7`xh!t!'X4d5,H$//NH7_?$dD,lT/ep`/C@$l D{!6xׇ @זdם/?׬ ׻$6T(Xǰ!5(01<4;dJ/cT `r/zD؉4؏ $<ؙ"$ء4عĄ`'t5"(n\5h!8H ^1h(p1/l@xLX]#Hq5Xz(ك%%َ/!tٛ٨b0ټd$ %4/C4|h+%aP:"<H0S dE\u#N~ ڊ5 (ړ#Lڦlڱ"ڼE8 /H 4l0<"hP t  </68$!|IH$_/f/}`x6[p`ۀ<ێ/@ۜ :ۧ$8۴!4 ( 0?|T <D!40x5%PO#4V6|j]w0܊ xܘm\ܨ4DܱLh t($9 DSp0  %p(* z\T2/^\;4 B x K €XS%X cq/J{0ݏ0ݟ ҼDݨS\ݲ$&/ytx/!, l8 d@,-7 GX#g&Hdt!,Dލ7dޥDX@޲0#e!lɨ(M̈́4D,eH|4\C 3tO/]dY|k1@߉xߙ/Jdߤ/>߯ ߷ ,'l L8 0T 5 ,,47 d`DU$`Lf$5x&\]  @4 t6!\t09,!@t@ xt/)<6X4D%T0L#pb߄8k/>w/L i'uT4%\/86J4(T<`t*08\:&8TR1<`/Xi$4yP(FlH$8!$/-<807/6q 4"`,:8G$U$Kh#5tpv<{!L65 $$X/e4'p  !X5"\DLV#g+z%|$Ǡ<h/B+3!ZLKppVmpiv/| tx@\((6Dx'<6(D.$0:6d$D6KXXTPh Dv p}X$#<t/z0200%;<6k_'V$5l"\H$308l<6Ĉ8E\YPePq6$fDl" H/k  #D43d | ֘+6X9/M NdZHth̠x$H/LH "E0/x/E ;X`D[ 4/  |'x2EF;pUo6D|~t#< F86&"@4b #/|('p/cp4/h <+: HE(Ub,Ds H n, h/?$%|"|$"k|D6kz@H06t~@`'3'DBӨM ,YDeq4H5j T8|dF #L<BlH44 6X |'dL,> M"h`X!he$o(0@{6f@'`u0 (X , X t#m((D3/B `lJ,0Y'kdTl/C40P7$Xl6p|r ! =-$0\8$DCO%rx\Vqc @hs~ sh&d t/+3 %/Cid&|5EhP/?_/Ll n/w6`8'x/(2px,\`X$/?T x4*"@,2"i,:" L (T/ d$` ti$\/etH(̈́$8!D@` L@!$/k |4p" d,% 4l.ݴd=& LE!TT4^ i r |\,86eH/H"W0 \ # 2 ;49 y<J6rxS @P\(h lr4s4D# ,dvL8(E,4(pD#$\ /4( 7/dE/O"8ZH c?HDkD8x !P`.,'Hml`/e  ` :`0hϠ(4|ڨ,D($3"]L<O[\PL|\@$d"E0<X  egd'CP$'}p\(*p,/b:/IJ U%)0a$m|{ #L8!4!(4 ag<HXHT ;h40# jp$/'\BMdP $a( lx/BH' ( (5#/D(0H%T"&  otD`XD!h#/0/71JLY5zdn yh t`P wL_h(/p!]#ј$ /E (S 0/L;+H/K Xj do4t}(  ""H9DL"[`<4$45 "4.07h6'kLJ J R")`b`n d~6X<4Ĭ / !V  lx"\$$4"E @4 h <%{P147+ DhUdH^'N8m(wXH  (T!Vd `Xd$˼k"Ch"t)>(T3(4>"6N4TY6X b(kȐ$w/@dh݄  v t,l, :/L< I0Yb5% n/,w6c4(/}< ŀ,%- Xn\@&H |4'\` /*t*ȘD7 8HrVgxp/*&H!pht /(/K\$< D b 04hA(`0K78\/cgt|l4,Y('%ר"Pt'1D a6k  )#Ơ4>$\J =@Qu\`k0<t!D/R "T6%H/|&~\/"T x8 4(eh}h% /߈B@dT#Plf!Pq+&}d4b$H4&j+.#`4 ` 4#x3dPBXTZ<ny,%G8$ @d0<ln45 $l'dL0/s90E PV7iLy D  /d0<H]j h60 C@ G,  =PQ`X[%<lgȬ\y/^@$!V@\(/6r#M`!Q x L&4(;&N€,b'J(s0{$/l 2k4!l< h P$h8(D#L& Ѡ;LET#i#8q /|4CX]8465nP&cd0 $p4-/6(T?#pH(V<]!,k/dhTy/u 8 p $6 &/(4 ( /!!t" n@.`8; 9HG4R<hajHwۘG< U@88< & " 0"v Ct W\ g H s8T {ϸ 4 l +Rp h4  . +R 4  { &4V( 5'1,X E!, P 0 c r | z XT 8 6 "Έ, i H $ (P$ /z| ] HH /D #4N , 6'\ F45 R ,X Z(( k5 $ z  :X L 'F0@ #@4 5) ^<| ԰x %g0 /< g4  4< 0 Ϝ !  ,8 0 6/G4 A/" Y!. d u&0 /P %) "!d 6[@0  Ԅ g ^ #  6E<  0 K|  6 #4s 2(CL @. K V&3hD ^/T k',0 { 5  /T 4 3  @ 5%< /B & # /D &dD#sTD /cT6 |B6PO^mp/ z"  / lF@#,P/|T$H L @+ +6r`<vJY$STl=`|t h" ' 4|l/T* t ux( T/d'$,8F.`( <Q$$Z =mX(qh<8 4/i0xl/h6Pd/eT5@*!;4;gTJ5[6l!Hu5\"<0/G \<05)'""0/ t0 +d6kE ^Hxm&\y$ lH(<%$d(\/&4 $Tl/C s(#qL05 :FM%L^tm6v/)6rd(`<'SX $<PU \'Ld,HTL",<p0= 8Kl8TX!VaLtX| Hh/X0D4~ ( m\o6 'T8(h4x ($; I/CW#f6`<p 6y(L 9pz ?T("|pXq8!\(4 ތH Q f`%'u4`B(X c xw/|@HlΨ,y/0@d< ht 4s /k` &i`."8;\K5Xd`o,~#Zl/ 6l4rxx\05h %/x$#Հ70B68M&Bh!3$r<6D/"$'dH [|+L !P $p4#D$,q=%pG48 Upam!tu6 Xt$  P e46_H|$/"<@<p 7p/#'p3#pTA!FKy,WTg8 Dd4xd4C4.Lx\0  $H04!+646`?+S|aEn&h${5@ t ~d0.H!ψXuT &8h49|,/i$48",4q2(C$pT"pg!@(s  :h&p(  <n`$ 6D( <"p"//(BW `Hm P4|/DJ(P1D p&`/ pʘ!D ې5# (/'4{(= (N(hL\48r q40/^ 8 Z('`$/p'6k/-`$#$(20:/&HJ'c&\mf\ $'E6kx4h (YxH $%T$ * : I X QuT ^. o P |  $Nx@  r 4 6     "0@ &dP!/!|p!*P!5P!Bo,!VfH$!l08H!u!d!!!+!/k@ !9$!!$4p!/C<!/*0" t<" \"%."5"?f"IF"UWp"d/]`"p6$"zP ""@" $8`"H"r "/N("$ " X" H#&D# # #-<#=n`#LP#Y/ct#n#,t# #_H#1 d#8`# L#$#\$ Z$$6$$$\$1(d$7Gd$F $S/' $bJ\$t$$}/L$#$ʬt$|$<$/X$@4$.($ 4$$(%u8%46p%#9p%/%C6H%Sf`%] <%vy%*\0%( %%/^% %/)%&p%P$% zH&4s&\&(_&06l&E ,&S .L&^ TD&r'lXP&XP&|&5&qx &'x&!oX& &'|X& ('4'#'-';HT'L'[h'h5'p|'f ' L'\,'/f'`'-$' v'%88'/L( (/( ('4{(0@(A/(J!|T(X/h(a(n ID(|%p<(P( \$((pt((z((8(#<(!a (!%\( P)5%$)8)"'0@)2/M, )B )J4@)SH()[~d)r)|)5#))<P) j) u,@)6x)%ܜ )"p\) ()/H* 4*$~*+\*=*T͜T*_@*k2L|*xH* `*/*p*1@*$*$F<*T|*|+ ++*&+39@+Bp+N"+X(+i.GH +y'_+"ͨ+8P+6rl+<<+ǰ+$\ +!l+&0$+ 0,4;h,&,!0 ,8/,A"p,M,[,l 0,{.$,/F,\$,d8,' P,&y,"p, $4,k<,(4,#*(,j,- T-5-&&Ɍ-1!`t -> D-R L-dT-u/f(-/P - -'T- :D-\-Wl@-/C- `@-<-t.4.]4.#X..8.< 4.Iw.W/gH .b/*d.i +0h.z .. P./L .!(@.0...6l.gd`/h/?P/)</:%L/JL/^/i/g0/w!(/ #t/!H/,//b//^//\/Hp/p/ t0H0w0+|09I4D0K, 0Y(Yd0nt0/H(0'd0 <0kLD0(40 ð0<0%&\00k0/1!kD1/1!/e1( g104h`1=1IT1]%p1g/F1o414s1H1!q1vl16(1@1'e\16 `1%$1$ɼ<1p2 (T2!h<2(@H24 Ŭ2=%2E-t2P/&2`%),2l$&<T2w<2 rX2062!PH2&22$2082/s$2/]X2/!T2 (3=H3W3 (%8h3)$ݠ3=$3N{(3[5o3g+3z=`3 |36H 3H3|3qD3&3.3P3PH4 l44 "l$4,!t4?X<4K604_"4ql4}4 `4gd454 84ŀ(4/B 4x4\@4 t45g5j 5##Έ,50/,5@ 5R&3$5b͸,5qD5 5 5 <\5@50@(5b85$75"Ht6UX6 6-/. 6A/#p6Nc6V3$6] 7@6e'L6y @6D6{6 h64<(6"i06 l656<767 7t@7$079 ؜7S47cH7j \X7v ߼87' 75d77$L77 j87(&7+*7 /H8 (70 8'H8-6l 8A8N <8^#08o#X8x_88u`X8"?P8 `886_T8(84@868J(88/j|$9"9LT9%/'9249A 9S S$9b"9i/m 9u6c9H99#ް$9/fX959Z9`H9!,l9">@@9Lj(:`L:dt: /`:,#::P:E4:N':a(1:i5D:v4T: : %:5):&w::/}t:/]4:6 :/SX@:\ :/;/rx;qp;1()T;@5%;M{;YnX;i28$;z$n;5#;4@;$8;!dt;*;;ˈ;/t 0<6X<'Fp<+<6$=  =z8=+n=0= x=4b(=0`=(P==/p> &>"x>"<>-t>8X >D>V >d >x/p>1@> l> >(Od>&x8>+>!T 0>y ?4~ ?C<|?(8?4r??4?I.z?P6?\4X?d?v ? |t?\??5n?? 6$?t?4yX?6l?@/!p@ =@.8@%088@5!t(@Cx@O&(@c%܄@t6l@DP@Hx@5@B @0@L@5%@@@(D@#|@&lA6hA XhA5A6`@A,|A@88AM470XA_iAr+ A~\A/Lx A8A A$FA#DAhA v$DA/A(qB 4lB0mB=BRBg<,LBuB B$B04B E`B BpB`B XB !l`C>LCC60C2tCECT X<C[0:\Cv/lC@Co8CC/C%CDC! CnHLD DD]dD.pXD?/ݘDH#DR>D_ X(Dr\D xD D!0D64D+ DDD'8D(4XDD\DzxxEEE$ DE0>EC$VEWEp8E/f`E "|E`Ep4E"\EytEJ|E:E b|F$RFF$TF/AF@/vFJ!0HFQ/hFZHLFeQP8Fp/tFz,F(F/>FFE`LF&u@$F&0F#3XFtFqF`HF(.,F[G d(G G'|LG7!LG= |4GNGZ<|Gn ,G{ % LGG4HG ܨTGG4GG5)pG EH˜H'<H**XH75)xHC4HQ`Hd/BHtHdH#4HpHH'u 4H(H/!HTlH$I /lI&oHIHI'I0!LI>iLIP ^DIZ~XIh/Iq ՐdI6HII!HI 4II.IhI IqxJ QJkxDJ%MJ0&,J9}J?JH/e`JXJjJ|6t Jfd0J ِJxJJdJ l`J#dJP(J$4K K K&/TK2 ڈXKA |,0KS K_ h`KkK^<KY hKXK KxK!+8PK&w\K0@K'(K"w,L68L DL!4`L' "DL/(LD@LO#HL](PH Li6rLw'JLpLLtxL 1,L#SXTLL]LtM4NM M XM!.M(!@M/O$M6,\MD/(M[!LMh!LMu$M0dMLMM.M4M/elM\M f,N?(NPNlN& <N8 TN@/NQ N^ @Nk\Nx!@< NNTNCN/TNN @N5)tN(HNBpO(Dl`O#H|O&`O7CtLOP(OV&\XO` TOo&x8OcHO*FOtO$|O"O"UOcdOO!LP|HP _`P) W0TP1"PxP: PDڸ4PQ8,Pb6_XPo{`8P4P *PP47P/4P&PwP@P/xP/cHPPP07@Q'XQ%(Q!# @Q40QD QS8Qc$4$Qq)2Q4 Q6lQ#DQ/Q 0Q#,`QxQ'j ,QDR&|R/ePR#$}R.R< ?RK,RT$0Rc$4RzPtR% R!]<dR4 R/'R/R*4RAxdRR SS&XS&SF$8SV(Sg4SwLSm8S(S8S/SS `LSp8S/X S%"T y<TpT$%xHT/T@TJ4HTS ~<Th4To<T6lT^T TT|T'T&(U6H U HU'U!/\U1%l`U=! UF DUZPUj . Us\HU9,U ULU/L U$U0,DPU!VUUtV'P<V TV4V)\V9 % V@<VKYxVYLVdÔVsiHVXVul4V$xV&`V!8V+ZVklV'oW -hW lTpW#! <W5 BD$W@6WR `Wa'aHxWq&,|@W| fXWW\W$W@WW%ǘ8W#|\W 1DX/JX! tX!X(+hX68XD*(XM/mp$XX@0PX`6\Xn(nXpX,lX|X$|X6X%X}DYY5$Y TY. 0Y=/YH@YRL8Y^(V<0Yv$ƨY!@YtY5)Y/^Y YY Y&XY B LY<dZ <4Z WDTZ#fPZ#jxLZ=DZN(Z_6<Zk!: Z~wZ4ZLZ+Z6HZ Z!(Z$Z ?TZ![!U[ T[`[ 4X,[/ ,`[?'[D6@[R$[^ 1[g5,[l 8[zl[!\[lt[#@[#[[8$[/[/[d\-@\/h \:88\C/C\M \a D\is$\}X\&\$'tD\"\ h\ \\V \l]%P]/cx] H]'px]>$d]QK]b4T]s%T]{/J`]\ ]$ D]]$Tt],`]ҠD]4z]#(] g<^^ T^+ jp^7+p^G&^Y^f^r^|oL^~\^^tt^0^ ^_/h_  _ l_< _0&sH_:$_G$Xt_X6(__=_&8_(G0,__J0_'_47_0_#,8_*F`P`# %<`/(e$`H `Xa `b8`k `wP``(TX` Ҹ`M`(U<`o,`|`(<`6l`a Ta8a}a'`a6aBtaO\a[XahcLav Ha}a]Dha)a/^ a/*xa0aaPa b8b$b(J4b75#b>&֠bR |bj/,bsb Tpb(A`|bLb&[bNb4zb$b' Hcqdc$PPc%ncD$LcR$dc_cs6}`chDccc,Xc c#׈Tc|Hc+( d , dPd! hd7 dCdXx0dc dk6dw@d1`<d uhLdd/K d#6d!dM`d5dhhhe6leHe,%D,e7 le>feKLeX0edey/e#e5 e0e/\e6leHle&eHee|f fb,ff& Gxf=$Hf[6pfj5%,fp6Hf{/\ fk8f$x0fO\fܘffK@df Lf6̀g !gTg&/g g1  g: ~\gO2g`o|gq8gT g/\Lg/|gggXgg_tg#X@g9|@h5!h&`h'$L`hD5#hP(Dhb`thuh"Thh lhnhjhh ($hhh(@i6|i!ui,~0i;Z`iI"iP iUibvin <i(`Hi#Hi$i i <i`ii"`i6ˌi+4djDj."tj<jM6XjV \jd5njwp@j4<j6Hj6tj<4j xj4jX j<k hk/\tk$Hk,!k66mkKhkQ(k]%Xki4k\k $k \kk!(kik3@ k Gk kd0l%l/pLl!/f l*/el8q@lM5$lWle/(lo6LlzelTl l/Ildl6mll(F,@lߤl(8t$m"% mlm%m7 ttmH e\mT#mgmx//m~4b,m%h m0m hmSpmhmTmmm5"n/L nln(2n2n=+(xnMPn`Hno/nu%8n}Tn 4n Tnnn# ny  n n 4xoooho+lo7 0oF+oRB o`#doj:$Xov/(o$o+<o (o%w4oo̔o/L o/Cp 6{p'p(0\p<EppN"LpZ`pu<@pp4Vxp&p$Dp!شlp4p#l p (p \pq /q(q q*\@q2oDqG<,qX6ˀqa6]qqDq$q*(4q OqNq&qh(q;<q$q44q/[8rbPr |lr,$mdr98rO6`Dr[%xrd%(d4rq"9,r|6@r(xr 4r4Nr(xr"#( r!rͰr/edr/K rϤs VHs !<sRs.%&s:(4sC'Q@sS,!<s_/sp6^ps}s"s2xXsˤs(s sDLs%Ps#Tt yXt4t%/t,HtI(p4tZ/^tg(PtvNXtHt t $lt% t5\t &TtӬ|t%4t)(Ht$0@t&3 t"u /su pu#(L `u4#\uA0uKu\8\ul#Ltu}hu"4uOu$t0u .`uQu|@u5u(dv! v  |vIv(0v8WhvD`vWT0vb (Pvq/e\v}%hvX v: v5nv!ʹv 4,v v/ v Ҩw/L` ww)DwBwKwalwz& w$Hww4 w Pw0tw!АDw/wxw8K5 (V Jp_TnGl| (( ,t h% #Vt!0(l0x(00/6.=T=cArD $X$W<0#t<#4&@w$P %$D*&@xE(V$Uf&@s" <hH<`#^4$@/BUd/T ? 'P(2!s T@O?d<[`i 8u :D!h (T/ "d&yD# POd߼CX"/g;5$@J/P@Lgtp44z H `$</]O/(6H  ( )/B<=0<H޼\DŽl `ys8Z8/ܼ'd/UxP/C /] &\&Bl%/x,6yB/|NNTZ#L<c0t" x4/xL 6X l#Z(! T ~ AH *x8&F |W(cL|1!W ( @H/L 5l(($#@5/}!L!`)4xP4*ѐEN# h!L r4l"l"iD&iDxXp\P8t$ 83H@! 0L6cP\ (x 9/4r$48T4?!G/eX/c`Dtl)'v9!dDJXU5%\4c"8t 8}D4]He  WX*\\/dP !P&Jd(4 <=/PEXW,y`(E\r #e D</c 8#k #h` |< JT6P 6sX+<L3W4F+X\j/Fx0?/@ </J7H#p#p/?ܨ|h" `/PP? I@\Q"LYoe6o<v7TT < xrT'Xa/b +h HRx%<= ,xPL ktU6p<_7Ll`u(L//k/Ix T/:` r&$5 o <&]!# 4&#D1! D:$R.` gA v48~@H l"h#-h h #H/E3'  t J l%6o@6PC P"E Z8(q4<y H BT$ <!m$d*4/e&/C@t $Cp(0L$@aXQ [' Ph"eyhL 'L"Ȝ@t&P$ 8|6\(aLL1(xB!8 Q8$]6̄h |!q$0s4#@o`/L/j4$K/ߠ(hh :|f. h7y<C")V ^$i|u/ !@8 L'l+ 4q/$P@ <&/K 4/E{$LT :Pl[/Xd(> 4s!~4|/Z04|#d }TX"/e<zh*#Gh46T>80G 8RDn/w %"R4</\&(h 0"xP0hb /C<#/l, //?D$- t#KP4$H"mH t/e| | 4\  4L*:/C6P/]l:%cR-X4'l"\,"#L\85,\ &l&A$ eP//;([$XOo0WHc/cPu0 }<,#X&2 D @( $_/P@5 H c\//(//| ;LI LS#tk6˄sR8e0:l@(ELPtd%4$$y4*Yx#5n/x?dNl\"t,j`0y6\%;|5%Xs$pphDt?@l50"#M|d+ 7&| ?PS% [r$f|| e<"D <h!/lDd!K/tX (Vl$x('l:L X\Xd#f4o6oH|HEd5(48L#p6p pp `p $T#`&H$4(aI&\6h/.}",D  #^DHP ՜ 4L ?X\/',/ex@5"JX@H`lm 5</$pl6d#$/&pxE| t & 5 > 8(J% ,V Rxe3( p@|/P @Ül~\/(t&<0 1PN6l_- g/Lv`/|X  ( //(!04l$l "Y|p* \`;!O6pbA s\@Ґ "x/"48'!m/ &*P+@5/@(x$S l`<mƔy/ %H/;tx"@/((D/l i@$ '@'+4:4G *Y 5tb ͔8s/z'8/d..z @\8œd"'X!B( <4 ':(5hh?ʘ@Kdl@V6ci$0Lp#Gtt6WH489L0T D?5p `&/|8@@(/C1/t<$4,M P[vxml`yM0 Ax͸#͠ l-l8^X/L4Ԡ6bnh Ō&0A<Y7c5pq £h¬¸ /&.`pL/}0 @* Dd;6,E/cdX/gvHÈ&BtPá(pè ö$$s"U<4@/C/ ng @0HH;"%tK5&X8,s~ă|ĜJ`Ĭ C8P %0 y/M (x L8٤.&P(DDU/K g#lx/Ņ<Ř ŬIdTż<h@6^x d|4X#(]!"X3xPDGL N Y'0Ti L8tdƁ,Ɣ%v0ƛ Ʈ4Ʒ+R ,۬' T -$6X,5$=.ltL/\&@Pt/}LJ0nj Ǩ t0Ƕ /4%(6t F E t !;H0 X8:!FZQldCu4Ȅ :xȌ(8Ƞ TPȨ ߐ4Ƚp8 !`  w /(!'. d> zp\T|h$y"0ɇ>ɕ0XDɢ Ulɮ+Rɸ$.oh\ #ː p$*J;4Nj [/Tj/Dr6Dʀ$4x<ʐ̈́ʝ ʱgdʽ o'z4#t@ h:L)4dP8&`Ke\<Zf"[ ToۼTˎ P˗ (˟48T˰/˸u/cL/*`ܬ't@ DZ2?5p(GT4T49\/ c'Et\r"{`yp<̃!D̝̎!H̫ dlH̾+R(l4P\l"*ph& ݜ4!,@ V5&_2f Dvh(ͅ!D͒͟#1T$ͧ"Zpͳͺt|$T!xl$!Q0T*h4 y8,#iD+pR<`k @\v|HΆ uΓ +(lΛ1ΪøLο 4 |5 P/@"+ yH`/H0( @`6BQ\d/((t$Mπ̘ϑ/k ϭϹ/8"t,*h/5P 0"2`D/B!MW.e 8,o6LЂ%(Ќ hPС%tЫl$зU)//6p  +lX #h ! `d0xBW/vPf<{'_ 4ы#Lџ6XѪy ѴPѽ^P8/x5q( 0/" ژ '\* ͤlB0Q j{tҍd,Ҝdҩ<(Ҹʄ(Lh5 |8!S4)/b: ސJ(XeRw6pӃ ӓ"$hӠ=0(ӬӺ!@,#t!TDʠ/F /ݬ(X /(|%/c8PHD4Y ,,d+R/l(ԇԏ 4ԡ'|Ա#Ҽ&u(IH,`/C'8,#6b,8,84P?xM\Y(\mdx}Վ5<P՚4b0ե(UXչ -(/&M/J8$jq /s82BL94C"lO%`Y4ʔd!l n، ֑lx l }\'936b? < I(W#`c <w ݄5%(ݏ24ݜ!`ݵ o8/^/s0  eH&]h0$#@@9 TK^Mk <ށމ0;\ޮ(F| [4z ,0<07.<l ,6rp0x4A U4*H\6l&x߁Qߏ ߧ ߯\E  d$ |#e5op0 5oHp& "h2# <l<<N8,Wְc4`q%{-T$P6^|5`&(r@&04$({ 5\(_!#X/49?/4(IQ4T] f i[y/D <+%ܼ"H6\Zp@Ҥ##|/h 4)/I@4 pE/e4Q4\aoY<~bx \/<@/i8$_T L| #`/LT ':Tp5h`@L/|,$W|$f"p m"j@<t){!|!WD \ D'LL#~5$(g6p$I6xAP`Vd0_ʴXk.{x#H| ~x#,  tP/x!SP 6,D #6-,31pl> lP i -r#46 T XlT=|  /\'28t<+X8 @h/dE/,W=ez/U #٠ |/$$t,p:L4<H0#/`+03/):ܘxJ$W a/@j%08v#&9< Έ(4h/X4@p8.LH /)$$3EhQń<a%~li@$q l~ j@06(,H t H</cU'.\ <)4X /#L<48|@vZ"z,4e r hzp#ȸlh0'HL"g HL)H {d!`,% <1%= 50G \Yf8y/e-rLh(@tp/e8̴d@&vd,T /!@5q@ (7%,4? jpK<a07@i!ܼxrhH~5X"d4!h07,/H HX"H!1l!<, &&X049?PJBtdS5^hdm$2\y0t6p#56Eh#-t%x`/@   +L6[X/F04H8/`F<X',th 8t &<<}/c\5//P yT4"H Lt%P,/B< |#C4 !,/e,<)DEb XO'\c (lr %P#,d"`RP/C#D,5zP&)d 0<'(hD@8$I5T/a/gdo x#$m!"6p 8> T$4H 4 <t(+"  2"°d<eLI0p^$'dhvx49#  (0$ :p5  6ڬ$S< x%dL'-l6FY/ (bfqU`x~^ p.ۀ!h ,T$Z\Y85jl/m  /f, !p0'6XX@/xL/M ] r-L  sT9 $L $/"|(/P #Lh 5 h' 5$D!8 V(Xa ht@ / %$ʹ${h|!hDxd@, / (\4(0-/L <LE<S!@\d <w/PFD 5"o `8  `X'@h/L -#%4/l A6EpY`Le >r'{<},[(4X$$\ t)u L$<&D#D k0"/.5