iB 1R``@00ھze0X|5 ``@! ` # `` g!" $@` ``d@ g P ga@2`"` H*/+ e g"a 0 "#@h㿐' f@ X- f`B f`E` ?c/?+*`@..`@0  `   @@"`@@ ׀?@`@ e f"p@` e f"X@` e f"@` e f"@@`㿐@ g  @q  f e"@`  @ e` ga@@ g? `  P?`°` g`P"? g`P㿘 @E㿘@    㿘# ga` `"` a`@ '@``",06 @ * '@. @ …`㿘 ga `ట@ (@ 㿐 ga/` @ T@㿘  㿘 gat㿘# gat`2 `` 4 "$atp & 4$at㿘   ?$  g`$p(㿘' gt`$ ?` ) g!`$ $ $ %!$ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   e @""; ec) + X`S e c\ D e@ ( e(cP  f`< ;@?" (@ Ġ@ @ ` f` @$ 0  ` @! `  e@c#$ 4@$ @+"%`t`$t   e @"㿘@ % e` ga`!# g`@a  $ $  g`, g`$$ J# g  a e@#(`$@a• 㿘 ec ' g`1 g g@ ?``````` ``(`$`,``\` g`h `p `P `d `l a ` `t$ `H ` `L `T `` `X  g apI,`8 g g`X H`)H`) )㿘  8$ $ $$ (`@ @`/  '@ ` (@`@ 2(@@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  g`D`D ?@* @ @:`? ``  g  `H   #`H! gD?"  D㿐 gx'H'L'P'T` 'XH@' e@# { xH㿘 e#55555555555555555555555$㿈 ecؠS @,  ?L ?㿘 g`L g!| ecH@ !!|x d eaDت@(`8` % ` N@ %`  @N@`` ` % @(` 0  x @  ` + ,3`3  ?L*? @y @Lq`   (`8`G (@@ @?  ,   (`8  8 (`8` 4 †`H@ w`L  o@ i@ , _@p # V@"S@ >O@ l0j  -  a dbT!<㿐 aH'H'L'P'T'X',!<@   ( 2 @ "@   @@* (@`@ 2(@%s: alloc failed%s: block table corrupt%s: read failure%s: short read%s: can't open deviceInvalid controller number prom_mapin: length=%dprom_mapin: invalid maptype %dprom_iopen: "%s" error=%d Can't open device `%s' prom0prom   exit0123456789abcdef|/-\bootxx )) )0)@)P)`)p%J5@5d5555H5555555P5P5P 55t%5p.5h@5XO5t[5k5px55`55555X545(5L55|55 5555<#50*5TO5[ PPf < @ PLuSdP hI /mntƭ0 hI PfP@@<@T PPL < @ PLuSdP  PLP@@<@T UPsP PۄgYA PMPf) Pf) XUAPM0PM0PMQLU9APM hPM hPM hRB>\PM7$XPN'7iPf`hpx hMPT 8PT1HPT1HSn<HPT˰PTPT3TcPTVXPT PT3Y zPT!GPT1_PT1_08@HPLe5aP%UD(P"_\P"_\X`hpx-P 'P'TPP'TP^`LmP*@PEPEv_m))upy&{J(PvyDu2σhSr2OMUF[x!dVNڪO] v VSpJ@bB]e;54EJ5RĬH~@%>OՈ ZQb\QQR6 ݪF >cn3IK`Q! HK׎ ovZZ ĭh5S.j0N'0aNSh) 0RqMN\MPJ[ͻ.Z8ƕ!~`,|Sn%]|?asS]̜&w4Y}W„/ELW+@:.jU\ M]nr(f~z& XhWB^L)TD[>[[%#h8 Da/+yfgwUY=f *z^&=> N$}<P'T85 @;s#5J!";(RBuKY"$J^% +S"{_cr moY=!<WJ:r ;(Yg;IVxڿy6)^ֿ׶wPa 3o3MwS&SfS~g8''j٘8e쐃@Y2HkE> wmf&2]_Nna(==<Ҕn~vk}{@ ,YO}hoѫ:jhʋ @lfH@)ه|<|c+!x/2I4,I=JM /5~X$?p AVUsB11yG/J̔^fgi?Hm])z9%f7}hI +tBw}ߟ?0[i["l_ B'w2Py, hm{Hӕjsvhp ... ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up  . .. bin dev etc mntmnt2PsbinP tmp usrvarinstbin.profile upgradeinstall  install.sub bsd  install.md boot #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == "none" ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi _i=${#_fsent[*]} while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent[$_i]="$_mp!$_pp" : $(( _i += 1 )) done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF `tar cvf /dev/null [A-Za-y]*` >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && \ (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp $FTPOPTS -a -o - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=`/mnt/usr/bin/encrypt -b 8 -- "$userpass"` uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward mkdir -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_rootpass"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up MDTERM=sun MDXDM=y MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' md_installboot() { local _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi cat ${_prefix}/boot > /mnt/boot sync installboot /mnt/boot ${_prefix}/bootxx /dev/r${1}c } md_prep_disklabel() { local _disk=$1 _f _op _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create a Sun-style disklabel on the disk. The disklabel defines how OpenBSD splits up the disk into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } ELF`44 (RRR!R!RK K 33DDcc<<ttm444OpenBSD㿠@ @D* @ +#@㿘!$!@ 耠`-# H/   H/`## `#  H` ؖa  " # )# H `# )!@@@  `ؖa 㿘a0  (@2(`@@?㿘a$``  `  ͞@㿘 `   ` ` ``` 1T@2"㿘) T"bT@Δ0 ` $` " `@  "@ @`O$@h* @Ь  "@h @E 㿘@`#L@`@ / 2  ````@2 2  @@ TTc80@o"㿘 ?Ɠ`?“`@@ `H `㿘U @Lb0㿈" `x `@U'a|C%6a@$ {VaX@Ւ = 2J *` Ub`@LԐ '  @" (UbH "Ub@$(@  $ ( @b (( ` (U@gM"  (`Ub@L ``%CbCbD# `C! ! (C bD! (CbUߒc ``2 U֒bb `0  U`h` 2UĒc8``  UcXq #@? @4U@  $@ U ?@r#` @4 U@ `$@ Uc @L?㿐 @ˊc   ` [ @O͒aZI`b"6` `m`K`M,6` `w`k$6`. .` @6`. .`  @6` . .`@6`. .`@' @! 'J`x 4`"`* @ @ ( ` @: "ϖ`@K ` U @Kc 㿘8`P㿘8`㿐 @g?` [ @OLa@"?H@b"*  mKM2 . wk2. . 8`. * 'J`x 4``* @C8` @Ԑ "ϖ`@KE ` U @K@c㿘`(` `x㿘`(` `@㿘 b0㿘  ? 㿘} `㿘v `x `@a@`8 `p㿘[ a@J 㿘[ a@J 㿘[ a@Jߐ 㿘[ a@Jא 㿘` `0``   (2`0```h $  $ @   $`$`㿘 `h`h``+``hV-`0`@[ 4 V`9`@v` `[ @NNa>  @ < `" ` $ `$ `$ `` `$`2`` @e%$``"$`V`X@JZ ` @`$``h``h@"@ `h`@$` @Nh p [ @Na#<@@p  @a@?``@& p@0 `& 㿘`0   V$ `x$ @"ʔ 8$ ! 0 b0` 0`V```h  # $ V`#$ `(3@!@? d@"b $ `( @!@? d@"b $ `$  `63 [a3`h`(!` 0 `h`@ ?$ 0V `&`h #`*@ ~  $ 0``h`@ v &`hV`@Me `0h`0 $h$&`@` `$#@`(@@`(`` `@  @Mh`(b" V`@Im @`l А F@b, F@bE@#2(`@@(@"  @     @   @  r$ 6- (d2  @L @}@ `(   @3Ė  ( @}(@  `$ $`$  ( `$ $`$ @ $ @$ $ `$(`@  =&$ "  " `$ @LV  ਂ@$ #-[`+ `3;@/b0m%b0`Cb2Cb2C bD`(`h: @ `  @ `h` ``p`Ր @z Ȓ @_`` @' @'?'Ђb@'VVaHLH?8 ?8```` @#\ dV@ m@ '`'Ԁ VaVa  dV@ Y('@  '`VaVa  dV@ D@,@ |$?$?`@A##\@#V H8 dlV ȔX,@ #;`@ ]$?ؔ$?ܒ@0. 㿘x@w 㿘@t)p@t%"㿐h```` ``@  @2| ?KW5` D `$`'  7a@- C!`h@ 4/`  7  'a@-?h h@X[ @K^a `D @4@$@8D  @4@$@8㿘`0``@` ` ``@  @2 ?CA8``0 [ a-1+ `0@-  `"% D? (b0`V%b0 @G2ad 2@{ [ @Ja耔2@0@  㿘V "p B @@  a' VG'VaР  %ت@]Ô? ?`!7(`@]?? ct&(`@{ I ?'''t''x'|V"@Ut 6@r`-*Vc@F ,   @ŏ#耢  ,@    ,V @FubtVc(@J5 @e `V @J.b㿐Vc`A@y’ "L`"`n"@L  @C = ",@``LV`"HV@ؐ 2  @ @ @QV; `"&@`&@ "' (&`o2°   @rF" @³@ c&@c@E  @&@r$`"2&@W`@E cVcVc@Eؐ 㿐@Ő'  c`@ @I @Ӟ@1$.......................11.00.0.....0㿘 ` W"@` @ 㿘 @0(@^ @q ` @  W"@Ȼ``@q㿘 @ @s  @>\@? " @>Q[?@y!h `~'HW$`pW W@xH`> Wb   ?@eD@'?@#W b H?  `!     @; ;h#x ;`#\;pW ؔ@x| Hư!@@/ @ @ @@/ @ @ W"`㿐@?W@x5!W@x.!㿘  @֐    @Β  @ǐ Փ 㿀W!@x      `躤d@E (         *d@// @ @ @c#\Wb@z?@OW b H?W@w!8 `$W ( 0f@[?@WW b H'#\W@w!H 1W@w!hW@w!` 1W@w!h@.͐ @ @ @4#\#`W@wp! W㿐 `耠3  `%$ ''WaWWȐ!@wV `2WW@p!`  5 !@;@w9!WW'WWȘ!@w-!p 㿘 WN``nW @Cb"&N  `ؐ  @ ,   @t  b4 " .    @@j , 2*. $`o   `ؐ @G, 㿘 b4   0 @   ``؀@ `؀`?㿘)  䀠` b47 `:   - + 䀠` @"` "`쀠`,,"!* @_`耤@!,, "@@*`@G~@`쀠@o|  㿐 @ou   ! @    WHb8/ ;9 + - ' % ) @YŔ? ?`$(`=@Y?? ` 􀠠ct `􀠠W @o2 ̡,`Ģ&@!耢 ' [WaW b- /)<'+@ z@@h@g, @, ,  (@F@ m䀠`@@"k@@ F `@  qw  @Ð`ꀤ&`@a耤 $  `􀠠]@J`?@4`XWb,o k%` h% $d$ a%  $]$ Z' @@ @\ߔ`, @, "@@*`Œ@ 2` @ @@v`@\Ð` `耠R  `􀠠NW@\"HpF @ @`?  @Ab @E |W @Ebp㿘 !X F %\aT"& @ I  ?%\Ua& 4& 0F&%\aT>$@> 8#@8`$@B>$@ < d"@ޑ:  @ d@d@b>  ,@9 ? >($>0&`&d = Z@ Z@W b@  (&8`& @9] 8 ̤<> < ( d"< @:  @ d@e@b>  ,@9B ? >( ȃ8&4&0Őb 㿘 $1$–  ?`8;cS`L`$&`(@&`4(@&`` `"?@+"`(@+4 @+@9$ >`   >`@c >   >(`&`  &d>0  Z@g Z@cW b@t b @T@NL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L NL L NxL NDL L L L L L L L N L L MMMMML4㿘 W@αc  W@@c  @  @Μ W@Ζc  W@Ώb "W@Έc` 2 W@΁b W @[&#hW @[ #(㿘W #  @׍@[ 㿐@*'VXc(` &&&@@s,  H -2&,  =&@0  , *  &&@㿘 L@` @@@|@y @  X@. @  @CВ 㿘 b< b<"  J@` 㿘 WN``nW @?b"&N  `  @ɒ ,   @  b8 " .    @@ʹ , 2*. $`o    ` @Cv 㿘 b8   0 @    ` `@ ``?㿐  @}' Vc@ސ@ې`?@rݐ @o 0㿐 @k   @c   ! @Z    p a@'  X  (  @r̘/ >`(Ф 7 b<!b<b0xX`@ ``2 @`@r@, `@뀈X`@`x?Ѐ@Xb X@r H`e# W@c ?X `@`x!`XbpX`x#@rnb0!T  X`@`x!PX`X`@rZb0!`X`@`xb0X@rK!`@X`@`xb0X@r<!`@X`@`xb0X@r-!`@X`@`xXb0@r`!d"!hX`@`x!XX @r `!hX`@`x X@q`!lX`@`x X@q`!pX`@`x X@qܔ`!tX`@`x X@q͔`|!xX`@`x X@q`q!|X`@`x X@q`VX`@`x! X@q!!XX!(@qa0!!(X@qa@!X!(@qaPVIa@q@ FW`7@X`@`xb0X@qs)!`@k  X`@`x@qcb0 !`Z!X!ld!X!p o!X!t z!X!x!X!|!XVaaW@˶c` '@5ФX`@`x@(j!XX!`@q$pV p'Ԓ@Ԓ/X@q `X@ˋax }``!n! X"0`@V @qX@ !X`@`xXX!X@p!`T!X`@`xXX!@pߔ!``X`@`x"0@pϔ0!``X`@`x"0@p!``X`@`xX"0@p!`VX`@`xX"0@pV`2!2!V@ b 24!``X`@`xX"0@p}!``X`@`xX"0@pm!`VX`@`xX"0@p]VX@ђa V``2!D!H`VX`@`xX"0@pAV@W"X@p:!!H㵠 a@' @qؒ ڀ "O@jXb@ʖ o`y @@z   ''" < ('(`'(' $'X@o"H`  `/`@@o`@/`@M_ @X@U @ W@K?| X c\XX`pc\$@['@m@hp`@p@hb`~@ ;Vc  @c@@ f@k Z  @@c  w @ ` X" X@o~b00@@@oq G`$ 0`` `& 0V`>X:b 5b X@pL"X@ɐ@ư 0qV @pA"0k @@/ @Vl 0a@@* a 0VX @p'"0QX@p#"0@G#X @p"0FX @?ab@㻀 a' WXbMVPcXVUc ' / 9 %7 @Rl? ?`6(` ߒ 2:@RR?? ct&(    XUРcXV`?cXȤ  @u  @@ @;     w    s "٦פ  % "8`W,, &o }ʒw,J@`snXZb hXba  ] [  X' b8   `@B@ XҐ#h@bc( }@q2b  耢 @k ?@˕@ b8-@oђ "nVc 4&'쀢  X@Ȉc t@Q  ``" "p@$ `  a  @f  mX @>(b@f < U@Zc  V@RcX " X@KbȀ " X @:Ac@W@Ւc :Wgc@8 0g@ W@Òc Vb@= @= 2 @8 2 X @:c  @:b@` 0@fA`\X @=Ȓc@M +)   0a@A "@@ܐ X @=b@X @9ےb@@㿘 a" YY   @ @    @ 0㿘 @Ob  `Y@Ǹ` `?3 af b@P? k s" a@P? k ct  !   "Y@Ю!"@TR @y Ԡ Y Т`  "Y@Н "@TA . @@㿘@eܰ @ƞ@a@㿈@'Y a 1U@ p "? p$ D,< `u`<(``>< `^(`(  &` N  `? `-? (`([@"`؀ 2``?@(`([@` 2``Y a @K ֢[@S @V@  H@`@(`( [@S @=[@S!@6`㿘  [@8֒a[@8Ӓa㿐 :'H@ 'HHYY[b [[`b8@[['Hb0H`C@l >L@`:@Ɯ = b.@`@\ @(`< `c.`i7`l?< `oD< 0@`J@2` @Ƅ 2` `(`@H`H[@kb ԃ< H& @a 2H&@X 2š< H& @O 2H& i.@[@Ab 2< [@b(H~& $@3 2< [@b(Hp& (HZH㿘   [@k"HYa`a[bx`@k `2@fk@fK1[@k" $ ߂wC" " $  * +* -  * 0"   * +* - "  `"    $(" " @ )" " $  $` " @ " " $"  `   a" "  "  ~" "  "   $`c $ c " %˂  " " $" "  `   $`" b " $" " מ@㿐 ` ' @ `` &   '``@  & 㿘@ ג`o [ @;(b㿘@ ɒ`n [ @;b㿐' @ ` [ @; b㿘@e 1j@jő# F D[`"㿐    ?@,#`6 D &  [ @:b㿐    ?@#`6 F &  [ @:͒b㿘 `N@:  ?@ c& & 㿘@m @  & 㿘@c @gQ  &    Xc|`D   Xc|`D㿈L@`-'&`'  ch W @ #Р  ``"  `$`&` @  `&`[@QL"@ " [@Q@ @ a@㿘Yb(`b(`Y@x 2  ` (@&`   &` &`  Yc`c`Z@] 2  `(@&`  &` &` Za@`a@`Z@B 2  `$(@&`$  &` &`$ Zc`c`@' 2  `(@&`  &` &`  s(ssrr؝㿘! !` @G $! a㿘 `/[``` M a4( ^(@(( a(a -. `   ^( ?(((!  !}!@㿘# a   a@iE $a@ H ]@i9 P[@i5! $a@i. a$a a@'   `(`]@i @c@cӐ]@i  ]`@@i  ~ ]e!\!b\b\ b\$ba\b`\ a\a 2Q\\!Ȁ 27\\" \"}@ 2!\\u"p @2\\o" 2\\i"\"bHc  `4 `\c U`"4\\L# 2\\E#(2\\>#82\\7#p(2]]1!@2\\*#]ݐ! 2\\  而!\\a` @2\\ 2\\ !2\\!("\\a9`$2\\!X(\\ay`"\\aX! \ڐ" $\Ԑ"而$ \ΐ"`  \Ȑ!  \!ɀ 2q\ 2>\ 2b\ @2V\ 2I\"P\JbI \# \#)`[\#9`Y(\#q`W(@]! `U@2\]3!  \\v 逤`V!\!Va @ \i `X \a! `V \\X!)`T"\"Ta8$ \\K!Y`V(\(Vax\=`   \ 3@ \`而  \( ـ  \" `怌 2\] А!  \# \`퀌  @\#ـ @ ] `뀌  ] `逌  ]\#逤`瀌 ] `8 2l]] !(([ #a"[ab`B[[[c`[Ő#\@ $\ a`逌$@[#`@\ q`\ T Ya9a]aH ((`.`@"  d$@`@=`@V` 2 @_@_ ݲ `@_@_(@ r[W! \ R@\ `\`J` "6\\B ـ 2\\< 2\\6 ] ! \#-@\ c\c%` "\\#ـ @2]]  2]]  2\\ #而 ]]`9` 2]] H] !([(c[c #a[#"[[#\\`A` 2\\А `$2[[ʐ#@2\\Ð p\\` ]k!0Ya`a]a8 @j  d@`2 O 07# ] D! `t Y #]9!`\ 0| I] /!(`[(`\`\j"\"2\`" 2\"W"q‌ @2\ N"  \"G@̀ #h:!ɀ 0v@B  ]@e} r+!x@'# @#! @!8%$#  @A #3 ΀   8 [#0]@eO 7]@eJ 2]@eE x-]@e@ h(]@e; X#@Q \Hb㿘 ` ]"@aP@ 8 a'  ] cp']'a ' -t@(`@@@ߐ@Hk? e"  f a" t(`@@̕' @В` @Ȓ`h ]u@`t''@`Q]]aȢ `'`5j Ւ  N@Ѐ` M   @#`v @@a '`'`ѐ`<`  @i`g G] H  g}^ ,@   X',[ @4a:@0  ` '@7 ] @4an@Ki v@e.!0@e+!X[@M ] @0a] @4ha[@a@4b @@|{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|{|{{{{{|{{{{{㿘 ` ]"b@ @V 㺰 % 0a' S a(`тa@ <@@@ P$#]bX@K#L@7  0`I a  @e7 X a,  [ @d! T]@r  a$ <@@ @\' " [@dd!0ߒ[ @d^!0@\  ?"@dUbX0@r   a 2 ] @Jq"p0@[` ] @d."`0@R"(]]b+ ) ' % @F? ?`-(`1@ %a0@F}??  ct0&`(ca . a, 2 ރ* @@rY .<@@@@    `@@@P %!( $  $$@s b@@`@ @:[a@3 @ @~~~~~~~~(~<~~~~~~~p@( ,㿐('`@?`` Jea (`_ea@ Hea畢H8 '`ea8 Hea( Hea0 Hea쁠H㿘.`>` * .  TP`(`> p< @  ?@@ "( ` @ @ 2 ( 0` ( @4˰ @ @4 @ @     Ā@ Ӣ @ (  㿘!   8"e@Y!H  <"e@S!  +"e@M!Ȓ  @"e@G!"  5e@A"@ c"e@ibx"eeb@c  5"e@0"  B"e@*#0"eecx@Q@} h! !' `!@2̔!@-P'`T'7X\'''7 '7@+! ]@}k"㿘 (`Oe ,`e 0`ze 4`|  8`2 < 0@% ,& 8 < p @ "8 4 "Af@5W ( Xf @ @5N ( Kf (`0``?f`Wf a @    @ 2ݓ*` X`"  8  @B @ 2ד. @ @@ ϓ. X`"f p2c p  @CXJf p < @@G @ @ n. 2q h. @>-f `?C` ?(`0`a  @@GC x ? @ "??? #@G @G!  @@ p < @ ?.@G:` p <        @@G @ @ .f:`@Gl! @1  @ <@ p @ Ɠ.   Қ f:`@GF " X.> @0`f:`@G7! 8 %f:`@G/!H  @(@ #@G"  8  @  & < 6 pf @G  Ŵ f@G ` (`0``ƴf @F  (`@F x @F 0  #@F f  @F  8 㿈 a' @   ? *] І`` 1 ``1 @8`@(  (& D& @۰ ``Ն1 @{"㿘,` c8``   ,`8,@Ԙ, 㿘#f@bXJ` * bX@5J`㿘f@*bXJ` 㻈 a@'  6`rfb&` &``  `<$@ Qf@'b` 2*Ӑ "@x : "*Ȑ fb@| D`rf@ b ! #fb!   " @ n  2   ?b#쀠`X'f@E"6`$@ } :  &ݱ6 @3ah G`&'L@`&`X`'耤 L`M@ f@bЀ 耤 `'m&`Xfbf@E"he`6`$8`Y6`f@E"Ȁ f@b *`IL@`E    ?ߚ쀠`'f#@E{$ \ +L@`' 4%f@rc `"7#f@cP "o@b 2`@9Ҕ `@9͔ `f6`f@cX V "f@E.#`ˢb @E'#0 6`f@qcx    ?q쀠`'耊aݔ&`(]@y"f@Xc    ?X쀠`'&`,f@Ec    ?E쀠`'&`8f@2c    ?2쀠`'&`0f@c    ?쀠`'u&`4f@ cЀ   ? 쀠`z&`<_6`pf@c Zf@c耢 Sf@c Lg@` Eg@ڒ` >g@Ӓ`( 7g@̒`@ 0g@Œ`P ") ``L `2`(8`@ `` 6``ِ  ?쀠`ߔg @DD ݒ  ?쀠`”g/` @D,o!  ܢ " @    a42LЀ`  '쀠`g@D  '(```O``2`"Cy   ?J`"3i  ? :  @@!  " '@]G?@]C, '`,`H   ?#s4`p(`g@C jh0   ?`["   ?   @@ Š " '@\?@\, '8(`耠zq    Ϛd'/` `B0`/` `$0`g@Cb 0m܂$8`Y(g@CV! g@CO `㿀Uga@0''''g@쌐!8 "LgJ`"Hgg?@BaX?< '@  @  @  @ @7ʢ? :@[ ?*@T`"?@T@p @m @j @g @C@T~"@=!@ gJ`gaH`0`ݰ`@Tj? "g@Y!`@ 㿘@T]    2 1[1g@BǑ! 1[@\!1g@B"1g@B!1g@B!h㿘N``gN``g %g "X@ `8g* g@Ab`(g@<b`,g@7b`0g@2b`4g@-b`8g@(b`<`p g b@BgbФ  \z 2 \``Zggbgbggc g `ܤ`   ) 0`@E  @ "   @  a (`8`@@ڐ @@Δ "`1*gc@ `" ` ) 0`@4@B- @`. @   @`@@ @bP`( (`" 2  @ ( 0`` (@z "Ӑ  bP @o` %bP @h`N`㿘`(`2 @"&`(&` @ @V!N @`  H`Ag @&c(㿀 `Xr ` ``Y+e) `r"@G+ &ig' d ag@A7c"`G`@`A`B`C`D`E`F#\#`#d#hg@A&c@  `l@ .    @d@  a* @,?@ @   d@^@@`h`@"`h`e) `e@" ' g @*@c@`s  g @*6cX @*3cp㿘 aW6&&@~!6 `  e@Œ`g  `e `e@  @H g #g @*c㿘@L! !@v @ꀔ `@5\ h`@&! 㿀. @   (.08`  @(B ?  (`0` @ S ` `hVa  (`0` @;`.8``Bh#\@ `0@4a `. h@+`P `3h`h @!.`l@h@`p b2q `n&  (@`&  (`h@`H `h@+ h3 `X@˅.  `(`V ` 0`` ( `  `(@Va (`0`) 1  @ @hD `#\@a0z  `( `WV0@@u @@ 㿀.:``h@`x`8h* h@` `h@` `h@y``D`E`F`G`@`A`B`C#\#`#d#hh@i` h  @6`X`h`h b `&  (@`&`(h@Ha`,h@Ca0`0h@>aH`8h@9a``4h@4ax`<`p h a@*B`<`p,  8` @B Va ?Bh@ a@ @? `P`L h a@B`T`N h aЖ@B h !@Ö l`N2l h a \@ݒ  @?P2 `@2@Β`J h@ȒahXbph@H`` C` @4@@? a`(  @y!K  ! @r@`X`h @?`@?y D`( a@'  @ɥ`?g@<`  ޖ   h@F"P !h@@"`@ `b; /  7 r ?r@c( er@k І  @ @ C  @!B @:9'''77 7А x!@ d`h e@i@WO ( @y"b`>`F&0@`%0"0 n?nb`  `$ 0@` %0nN   @X a@ 9]@Ր׀ @Ӏ @̤͠@ [!@W  @[@W! g @'.cp@R  @X` i@P @G@Xw  @r"㿘i_`p7 5-% + / ; 9@:0? ?`67(`@:#?? # ct`(`&  `\ ```h` ` d@ ( !@9 ``(w(` @r`e $⼂`& T` T,iL@ H@ "iL``р  c, @P`(`& *(, %b \`# $``%``X`~'`X` x$b,` %bq \`  k$ h`g' hr b$m ]$h X$c S$ m$`_hVs  u `d J D"s `h`s?`u 6! "' Zh"!@娢 YhT?`d! + ">`h"!@卢@c( "W$`@$`D 6@%01 C `T" ! """`" .@}i  X  @9@r H`!   "’"0`hȠ! " ! "" [ @%a[ @%a (``   (`0`Tظ,Xب   T  `  8 $    x      h 4$  \8 @``    @ @ C ?   @ 0 L P  @8b N T   @C 8b b i ! ` 㿐.>Va   B?1h@ @TD!1i@T?"㿘.` :`i@T5"%  ٖ@1 -! " Җi@T&" " ,``<`Ɣi@T"0iX"@aph@TH `  b\  @㿘 `l, ` `` ` ` `@@_ $@ ` < p @& 6 (@$͒? @;! e@`r & g&@i @$bx{ @ 8aX @#cp2@@@ `?a㿘  `@    @  2`   㿘i@Lǐ"1i@Lđ" - \a'  p@F `l   `    `) @ "ࠂ #@ `  ` be% b`G`F`C`D`E#h#l#\#`#d`@`A@`BL?j#p@ђ$@ *; n@B,\g@L` -^jadpj cX  (` @ `a#\@  *@``2a@Ӕ  @d -]#jcP@ǔ  2L `r@U / L `r$, И @n0, cP А0@e$0@n"㿘 @ @ޘ {$@е  @  " @!$  @2 @aX㿘 H#  bX@g `+  `"` "   @ " *`*`$ `*0`@  ` bX m@hᤀ j @"c㿘Ő    b C8Q1 L1  !8 b  / w@kf      @8VP@8ZT 6- 0  7    +0` @   B B Ôʖ1 >!8!8`` @>     (->@8` ͤ-   (   ( b 1 >!8!8> & & & & 㿘.`@`S.```.` @   @ f 8     8@ @  (  ( @ f   㿘     @ f @  @㿘j# 'Hc/ b0,bb 7 @5 Lb?L` ;Lb`?=A`?@H$Lb`?98@QF$@ 2ݐ/"`+` 0```Ґ"`&0 2  ``'" ` X (@`" X ,Lb`?ǀ@JRHLb`?̀ʔ@Iׂ@ @z0 b  ؐb0 X@8    @8b 㿘"ujJ U" % D d+ u2#1k"w1k<p(,048& ( & , & 0@& 4& 8& <`6 p(`("$, `1k7  ж @a "`"P1k`<`p`(`,`0`4`8& ( & , & 0@& 4& 8& <6 p`,0`04`48`8p<`p`<  @ @C 1k7   @ 2j#c@ 2J1k7  ` @ 7  x @ 㿘 `\G.`@` B @ > <բ`l.`@kkak a`+Ԓ "2k@R "6@ . @`"  " @  a  . L`/% ! @Ė@ڐה  k"a8@   `   @@{ $@@v@@j $@{ @raX㿈 E F @ A B C D Gk#\#`#d@O!fkcXk b `#   @u _ 2J1k7  ` @g 㿘`";kJ *5? %`"$  @ ,` `    @ "1  `,``! ` ` ` l@$ .1 63k`"@\b3k"@Wbk"8bP 2J1k7  ` @ 㿘`"BkJ? "`"!  @ .1 63k`"@/b.`@ " (@  @ 3k.1 6"`@b  @ "1 @`^(a@1 3k"@c0k"c 2J1k7  ` @ŕ 3k"@b㿀  ' ''  @e ?k @c`@ X^b@޼@Ð'Di `Jk`rcxb?@,` 0.@`i@^ 2.D(`0``@H k@H#k@N͐#i-k`@Nǒ^/ a ∨`x  @Y .@ @@N`  `q 0```|"```X (@`k"`Xkfc`xl∢`# bb0 "@ Si `@@ <D.@No  l@ (@Ne   @ .@ @@NV`  ```%`X (@`%Xi_`0`@5א @5Ґ kkfD 0X@5ې `X@5֐ kkf㻐 a' s `  `, 2   ~    @   B @D@  D  B> "$l0`0 aa@Mڐ @hX"aph@MӔH; b& b! 9 l`h"0@M/$@ 8OO񀠠 @(`@(`0 @(`뀠@ג(` @2@( ]@i" b"0```"```X (@ `l"`Xb@5  g `X@5 b `'XX ?`a? 8@' l) "0'/`- @ ?H` "A() 8`?D`*@Fr) 8`?<`*@M/$@ /`x` 0```"`w"0 2  ``" ` X (@?`?" X @ n]) 8`? 8`*O   h`" ?X`Ԁ @鳔 8 @  F@驺  @`B @tȲ@b8`h2 l@L  @E&@ h?@H{ c(Pۀ`O (`l    ?,`8``+7`-@E*'"@Q)@E$??`"f?H@'@؁ @ H?@7,`8``+ `-hh@ egOȀ` ^ VϠ2`X= @D 7"@NF@D@@zb@({O`+`- @Pؒ W Ȓ$l  ?<p @@ܧ(  @Ŕ  @({  |?( @({8   m?(^  ` :8 0 @ 0 (8 @  צ (!Β @({(  ` H?@({O`+5`- @Pr Wbȁ ̐$l  @G?,8E@-`C @"0 b  ?b@3:? @g"nҐ  @H$  X? @3;?{  kb0㿈.`ࠀ`8*l(`!^!ll `  C @w F.``D 2`2l@KX!.` @(` la0l ax  #`#d#h#\ؒ?(`    @˖ k  `   @@(` 㿈'H.`@` ` ~  b  ( 9 2  @(> : @릒 ll cPblbH?#`#d#h#\?{?/ @: @lb@?     ll"8 @玖 '@|Ƃ?l  @C!x?ဤ0ˀ8k  `   @1@’@8 H(@(` @K ?@K, 㽨 a@' '(  b(%  $    @ "Ş*0` @8 Ѐ8  $& (: 8`^G?`?8'X0 @0 8 ( ?HL3`+ (` ? '0'4'T?! l@ё$  (!@А`X 7**'D @@R ',X@ٿT`H`ӄ`,H`` @ 8`,0H` @ 8`d`D`,0`     @啖 <@厖C<>@  D @| dD?8'\'$ @ @ `@,Tu TX 'T'XZ  @  / 0M(Ű @ðf(C @ ;$@8 /".@ 0 ~0(  @ 䀢 ߀` 8,  `\,   @I?*   @ ( 0 H`/ӂ (\D`'\@@Ь,(`@!  ]L0,2; #',0,); o$\ ~ 8@8` D{@ @亐B @魖@ e M `      ` 8    "  (    `@4@ d @}E @p 3@-@<@$,T`( Ty @G D @C@ C @(@EΨ`$ $, %, 2q`(ne@(.0(U`. l@ @`l "$ { @֒aX8, \VS@dn#㿈 b.`@ `"  @  ( : 2  @!( 1: < ll lbblax?#`#d#h?#\?  ( @ #@Ӓ?   ll"2 (  @ς?8@ @蓠 @(` k  `   @sl @A#0@@Hg ?@Hc, 㿈.`@` ```=`: #h(0`) 1   @ @ B #\;`Xlap6`?. 9.`@    b @@ B @  d "l @HcЁȂ 1%@@ `0` (Ӏ l !x   @l #   @@ m"`@ (Ҁ@ k  `   @ږ㿘`":mJ !"    .1 63k`"@b.@`` @21 3k"@ޓb 3k.1 6"`@ՓbG m@F!;m ` 2J1k7  ` @ 㿈.`@``` `  `@#\ #`#d#hhmbHmp  b  {⨀@ ⨀@" m"a@ ^ l !x   @G@⨀`+.`@ 2, , , K0@ `0` ``,1  @b@ b  B? `0` "س.`m " A  @ 8Ґ  Ղ@2Ȑ ς@Ð (  k  `   @   #m "`@߰ ŀ Â@ `㿘`"]mJ? -",  (.``2 `` @ "?1 ``````'  `0`(`(`0`0` ` .1 63k`"@ȓb8 u  ߂ قȐ ӂ03k"@bm"ba 2J1k7  ` @i 㿐= X` g 8 ["n/J M`K`J .`@ `2  (`0@`0(    `6 (`0`@0` ``% % % !     2  k` `  2(     k pb@0"m   .@#(@  m   P@"Ё    @ ) `"'``a//mm#XÒch 2}Jk   @ː `  @ "z  m"@c``2/@ `  ""*222࢐ 2J% > 2D%  (( @``  @ B @垔 8,  8` 8,  .``,   @Ev?*  @(`R 2% c 2% t 2 %  % %% % Հ`ӡ, ˀ ɡ, 㿈 p <mmc# b) 0` @#`#d#h#\0F  < p C` p2bbnn% ` b) @0`b @` #`#d#h#\?# p < C`` p@@B<& T6 N` 1"  * 2k`"@b ],  @n ` n` #   @ 0 i #\#`#d#hnncHh  8;  D?@@ݏB@ₖ  b @@ C@ b@ "%5 `,@>`z nc  " ` ` `"  @`k`   @`"@   b    B @B@ B 8 (` n#(n(`0`$  @ @&4  d$4 @1H   @#0Ck"c 2) k   @ `032(؆ @ :%n   @א#0!@!0k`8P 8 @]C#8( a@' ! @גb '@} 'D  @v  { @p  `o`D#손 .`bX  @C o0`4'04`'4! l!@Ж`!@Бo@: !Hea- ' l5o1   r@b"P$@"0 M @穒x o @磒axL`u `U!@c8!@_֒Ӑ ``pV(`*`o:`@@#@^! ƒ ޒ " !8@=  r@"P$@C"0  b ```&```X (@`&`X q//{ @ ҒaXo@9 p.` 7. 7` '\@/dC 7f/e'XX7bl` ``ho`oߨ"`bx-  . J * @P``y * @P``n2  y c* P y D `h  b@ϵ! @i@g@e  @_ a@ ]`SoD `h  h `` !@ωb<8@ς!@~!!@zo@8#!`Gg@Ȓ` a ֖ @7@ `  o#\#` "@[b 2   2   o"@Ic` L@ 4ސ `\Ր,А` L@扖 Ɛ\`@! "8!@`!@!@pmjo@8j#h` bܒo  2 "@ @ௐ 'o@ω!࢒ "#oL@`"#oo@%a?g@#}ߐ   @&6b4 q 2]oE8@7Ð" zao@?w!o @7" 0h` hh ho@?b"0u`X@&    qoo#8cH АL@`"͒o  7 !@ooo@?8#po@%h" !@bo oo@7i"Hꥰ 05@ZE#Ho @%O"0.o @ `@@4Ϟ@"h""!"!8!8<  ȝ㿘 a<a8  SSa< p?@C!bH p?@Cb㿘& 5&# aD` a<!  !L  @  a@B !@ c>  !L@  @6wp @C#?$aD؂ `# aD >8ކ@ >㿐`' ?D` `Z     ` a</+a $! 2"! !L  @  !L> @  d@  $D p @Bc"! D`  p?@B}b ! $D aL7  'a@0 D$D p?@Bcb?c - Da'   a<`-`" ; aL  @C  ﲢ@b  aL@7   %D  p@B)cP??%D ; [aL +?c $ 4% @' 逢 L $ @4 Lc?@L8 aL@L1? 4aL <Lc  5?$ + @ݬa a5%D@N* q 5?@$ La@ݗ 6#S@5] q @BJ??caL@K? 4 aL@5Fq @A4?S t a<@ r? c0@3aL$  @Wa 6[ @5 q @AȔ ?@5q @A ??H%Da@ 9  p@Asc??;%D 6 `(4 = / `- ; @4q @AHڂ?@4p@A ??%D @AI`ʂ?@4q @Ax?p@X4  `<  q@A0`??%D@4p֔؝㿘# aD  a<  @KOaL   `@KEaL S᠈  `! ᠠ a8  $aD a@ q@@aX@4y a@q @A#00?c a< '  '  pD`?# caL@J? 4aL$D@W 㿘% D (! !L@@4 a<:  @$D q!W  !!8  `!8`*`'` q@@a   ?0``     8 กi?0``T c` @L   q@@\b a@ q@@SaX q@@MbH!L  @B  7!L@c@  &.$D   逢  @3`"$D@3`"$D@3`E"$D? 0`@3 a@ q@@N @3`  @3`"$D@3`"$D@3`؂?$Dq@?a _$D㿘 a< 造 8 1 !L  @ؖ   !L@  @3]?q @@ 㿐@ >q@s 逢 ; aT "#@` @] ga0@@ @9 &q"@H@@@@ @= qb@8@@ @ bq @ bb@  x# aL??@?) $aL# 8 `' % S $P$< a( &@i! =$aL $PaL?Sa`aL~ aL`!S! "aL@m 6aL!# @  Ȁ 9  <@aL  @ ?b#$<` SaS aX  aD  $<<#`$P C) "S X  aD qcXS   aD  @! $aL@2qq @?8aL { @! $aL aL?Sa`aL aL`!S?#@2E`# $<<?S X  aD `S H>cfa;S'a` (?a  aX`^S 8?;S>'ab   /?@D@Ē " 'a~D?>>@ 'a`? aX  aD  q$aLS! aqSb$aL   q$aLS  aSaq @>Jc@aL?$P$aL?aL@a     1$<;S'a *$<a` 8<`@o ?S a% Xa"| HS a X@1q @>MaL@1q @>C3 @1?!q @>9`@1Sa q@>.x0㿀# aL`'S̀`o % P`aL c! @9aL!T @8 ̀` a<) ข?$aL `! S a! # ฀`  @` @̀`S#Sb`)  b#``"`@ (@`"@$b# Sb<T@# ]Sa #Sa @'S r@'`(@#$ᘁa<% Sb)  bx#``"`@ (@`"@S#b<q@c#@b% P`v aL!@  Ȁ o  `< @@g `<`8@b S@9a\$PS a  `T#@'S  a@Sa#Sa#\#`#d#h?r@Ò`80#Ȓ  q@##S@ bDSb.!T +@4Ȓ 0'Sb<#Ȗr@`@#7S@p S@l U$b@} Q$b@y S㳈 a'  S@wa؀  @n  1 `$ ? p@0Ir @<x @P 61@091r @< a8"ݰ?Sa2ذ?)S"<T@# "ϰ?r'S@< q@c n q@ْb g  a<`"b 造`^` a@r@<!8r@<!` r`!!@<7Srrasrrbrr"0hb"<@<{@ @ 쀠`A` ?`]@ c!̀`[S`W `P ``d"`@ (@`"@SE b@.4 60a􀠠203(60@͐ŀ c@ S ` @  +$@| /@@f?cL@ @!@ !`@MӐ!@;  c@Q S b@-!!@*W3hs @70J?cL@@0D@N S b㿀) #?' @ #`, G#SD`0@u{  %S'S/S;S9 '@' `@)V  ?4'@/ & `-@C@ 뀦`  #`4@  S@aySa܀ @@-z @,1@0x@ \`` ` "@$ S@c@,0 @H '@)s @6g@,z00`9̀`" ᘀ`E#Ȑ@2ᘐ`ŀ%ᘀ &>̀`"b`" `^#``"`@ (@`"@'b@ 0b@. 6x`@\ `2r`4@- -#@ 'b#`@@̀``b`& `M#耢 5@' D#`@ #@ 8# @" 'b@Ȓ@+)``"#``!"`@ (@`"@'b `0`т`0@ `@  'b@ 'b@ 'bSb  ' @/ @  cD ? #X@ p@L=! a' %    s @5,a p`D! 逢 #`  'S `M#` `O-S̀`Q?cX@@--   @@  @'  `怤`@. ݀``(@+ @j ̀`"?!S"`  ? #X@0@.z #0@+ 0 Sc<s@`b  S bcq #@( $"@K! a@ ?S @ XS a㿘Sa+Sa@Qa s@4bP / ;SXa@S@ %a%aG D&   #S) 'S-SXa@X 7a%a%a M!Xa@@)$DXa@&Xa:  @ =a Ca@@Da@!X@%HϠ$/ ;S @à   a@ &9 @ @=a!S@$!Ha@ @$!H`@@f  S? b/ ;S zaa@S aH S%a%a bʤ?㿘`#S'S) DH aH @aH&@@$aH` H!X aH?SH @  H@l@㿘% `` !S#  1S   &!&!aX!@ @S! S S aH!!D: @ ;!S? b $`㿘`%'S%S @*H&@$H @DH H H&@  (`P'S S%S) DH ,8H% @=  : H@@d $H ` 9`s @3Bb> !X ӕ8>?D䀢 @ $  @  s @3b>Ѐ`̀) @&`s @3I>@&`q @3=x>XP ` 'H'( 1 @  )  v  @ NȀ`I")S'    +  @ @`<`D!@aX@<H `@#\@ К@<``F! P@$ s cH@2` 􀢠 `P<@ @&"s @2ɖ)S`݂ H@R * @؂ s c@2sр`` ( @%`s  @2`Ȃ`@% s @2p` 'D'` `P, @  Ȁ`"'& &%S /S7SDH  e: QaHL #\@ / $>0`MH? H$H@: d 4D E`􀢠 D`PY@  ; @?Sb0  D` s @1Ԓc #\ @  0>@$H 4: DS`(b0` @%4"s @1ߖl'8o%S  ` 㿘'S 2%S) DH $8H @$H@@<`f $H ` DH 8!X ۡ8?쀦`) D㿘#SSaHa@!S!D @"!D aX$aH㿐%S'SHD @8`  @ f $H 2 @ Sa8@Ǵ@̧ '' =@RSa@ b @ @B 8aHD @8`(H@ @ f $H `HDH `: ކ?ۀ0 㿘% \`G cE  F#St `! 'S!Xa@ a@\ "  !X !Xa@$$u \a@S! S S aH!!D: @ ;! @0 !X?s?@0{c S a aĝ㿘SbxS`J-S/ %X0 |+S)SaD!HX 89 @@@ۖR M@  & @d N%SX@%!H %aD@aD@%!H !H t?@0!`x/ %X@ :  SXa@%!H%aD SX!%S` a9! a   c @D t?@/`@ `SXa@%!H%aD?S%S㿘 c!Sa@$!@S[a !!@SaS aDSS H a aā Sa"S? S t"`@/?ΰ? !@ t?@/`㿘!S!#Sa@$a@ c$!!? #(b SaS  aX #a@!S a aSS H aD  t?@/ra t?@/ka t"aH@/c?~? a@㿘! !d`#  a|`?!=@  $!da| `t$a|@/AaЁ㿘@ 2N?`' d`O@$ d* @ # `@y 3`# ah` @@ ( $ $$&@ @ ah`$ah @$d* @  ($ @  &@ $&@  $? 0㿘! !l`#  a`?!=@  $!la `t$a@.Ēb㿘@q 2N?`' l`O@$=!=l* @ # `@ 3`# ap` @l@O ( $ $$&@ @ѐ ap`$ap!=@$l* @ ($ @3  &@ $&@  $? 0㿘! !t`#  a`? @  $!ta `t$a@.Gb@㿘% t`L@J t* ` ! @!h`$@"`!h``"<t@ `  $`$`@ $@@ !h`$!hb `b  $`$`$@ @m`b  b @ ($㿘! !x`#  a`?!=@  $!xa `t$a@-ϒbx㿘% x`L@Ғ!=x* ` ! @!p`$@"`!p``"<x@֐ `  $`$`@z $@@ !p`$!pb `b  $`$`$@ @`b  b @ ($  W  |`JJ ) @(`ǃ0`@ ( @(`0`@ S?P`   P  &x a' ??c@$ 4``0$g؀/0%,`,`,`,`` % q?,@,`8,`,`(@a` t @-c(@ p`8,`%P`,`<++6 @ +6 6  @ `,` `(`( ,`,`0   (   t @,Ȓb0,` 9 9 9 ///`(( (@/%0,`,`(@ 0,`,`(@(0,` ,`(@,0,` ,` (@u$0,` ,` (@i08,`,`(@]@9 9 9 ,`,`,``(( (@G,` 8`,`,``(<D  A>  :   $@ ` /` )`'` %`" ,  S%@C!(, , $@ ` 6   t?@,c0 ` t?@+b0㿘`P   t?@+cX  t B, `P`(l N, &,  t?@+͒c t?@+ƒc㿘l  H`" N  t?@+c`  t?@+c0 t?@+c㿘    @ `  & &< @H(-0#. P  o  " "@$::    @$&:   @$ &:   @$&:  @#&:   @#&:   @#&: 㿘 Ґ ? SP`"```(`@&``(&`` (`@&`` ((&` ` ,(`@&` ` $(&``0(&``@(`@&``(`(@&``P( > `` + 0 @ (  > ``(`@! @ 8 H&`&&  ` " `  <(  P@[ &,>., `(`@&``(&`` (`@&` `((&` ` ,(`@&` ` $(&``0(&``@(`@&``(`(@&``P( > `` + 0 @ (  > ``(`@b    `   a' ??@!? !! @@` 0$@Sb0! @ ɖ  "`@ u @*`@ p!” @    @ @   @`"l4`! `@  6 @   ! @  @    @  @ }   (@  @ t   ,@  @ k   @@ . @ b   $@ & @ Y   @` > @ O  @+?  F  2  @ B | 0@` N @ 8  r@ V@`2  @ ,  f ^ @ #  ]~ n Bx` ;o  $ `ܐ 0 @` M`K` I`"/lA `c! P@ ` 6<@ @   "`! @ u @)B`0%@ K @@3!8`@ u?@)2`@01l  l $ ` 6  @ u?@)`h0 H a' ?c@  1    @ `` 0$"=,'`(&1 `A @    !ǔ @   (1` u @(ؒa@ p 1 P`A @     u @(`0͒ ` @ U   `  @ L   ` @ C   (` @ :   ,` @ 1   $`$ @ (   0`* @    @`0 @   `; @   h L & b   ` `` `",{ @?H!HO, 6t   u?@(Ca0kj   u?@(9`0a S b0@>@@:@ S b0@[@@W@㿘`m u ap@f̰ ?㿘`m u ax@f ?㿘Sb0mܒ n f%   @ `@ >` & @ 8`   &@ 2`( & @ ,`, & @ &`.@8&H&& `6@   P> @ `&$ & @ `>  @ `F  `!?#@@(`@ & @`N  @`V0     `, `f@& & @`^  ? n %0?&Ɛ  n `" `> <(@@2 @ &,`., >ȁl  ` ` 㿘`K u a@e ?㿘 L !?    @`  & @y`   & (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx ( @s`   &@m` ( & @g` , & @a`$ $ & @[`* 0 & @U`0 @ 8& H&& `A@ڒ  P >`;@E  ?&/ <(@@2 ,l `,l $lB ;% '  !?#X@@o    ,''t`u@a c0@ p@=!P㿘u @{a ?`P T,8?c  a' `W`` 8+?c@0   :  @ D @0 ) P@  u?@&Ra ,p` c@   @ (  @1 `&ް `&ڰ   u?@&#a0@=!`@ q x@&U?0@ u @&J?0㿘??@    @Ga @5u @&.@{5u @&(㿘F `@ '&@ @&%L` `2' 2L <`@׳  /'#@(2$Sb@`&u@` $$@)$(@SbD@?\u @%(@ ?\u @% @b8 u?@%kbp㿘@+Ӓ @5u @%㿘o@!֐ @۶5u @%㿘@P Sb<T@z# @` S@? u@%gà@? 㿘@ֶ  Sb<T@ze# @` S@? u@%;à@v? 㿘@ Sb<T@z9# @j` S@d? u@%à@J? (! $!! &9 #` c@  #` $! c&@W! @%u @$Д@u @$Ɩ㿘`-Sb42 SaЀ  s& c c `8`@  @亐 `   `,`( ,@ ƈ@Ͷ 5u @$y( @   Sa䀠    2  u@$c@(! $!!&7 㼀` c!@ޒ  㼀` $! c!&!@Վ @yu @$$@ou @$!㿘@  @3?S&@܀``8``@ (N?`/'S`? ,@x / 1,@  /!@O "4`  @Ւ  /@q 2 / b?9a@ Ղ /  /?,(@S S a䀠?<@@@ܐ 6  @? u@#@  ` @ް? u@#p   a @' ,bL  , (`(` v?@#(` a@ p@S VS@ &?SaȀ vB 6v @#68ϰ? u?@"c @㬒Ӏ `0@Nɀ `0@D Sb<T@x'# S,`I@n Sb4  ^,(Ő  I#SaЀ  s&?%F' 㼀` c,`8`@ r ` ({@Y <@(@@҂#?@u @"?= @9Z!h` %( Sb<T@w# 㼐@>  aЀ` ' 㼀`2 c" ` @ 㼐@   b?ҒaaЀ` &`  @' @ v@"PP!(@ Sa䀠+@"5`<@@:@i #S@  @vaȀ` ``" $  @`? v@"  v?@!`p@l #S0 v?@!` `` `t  (, @s <@@   v@!`?@  v@!?㿘#`  .@ ` ?`,'S`(&@q @Ȁ`  & v@! ې?|hPP aĀ  㿘; a 3 @Y'a' 5S+ 9S0) a,aĀ`2Y`%aa ` '!XTX@ Y 'a S@b a@5@ a@?a@ v@!4S`0!X`$`0@`$0?* `*. "*.?"`"`@yq?* C ?@y怢?`%a0,@`g @u ;"*2T0 0# `$ b0@`$b0 ? `" @y8 v?@ a`@yNꀢv?@ a8@?s @ `` ` ĀƤ @ǐ  㿐S`+ 造`% cvvav#av`Ⱥ``` @+a $ <` 3(`&, @ `.,  @ ` D p@א<"`I(q0j L`P `@,,&,& a`&   @ O 0 @ J 0Sa܀ D@@ ` 0  @ 2 0 @ 0A` &` >& `S&܀``8```@`@` &` &, @Ȕ, /@B a v@ 0Z` & |&t ` @?@)`g B0@v @ɔ0&,^(l 㿘Sa܀* a # bv b@  `4  `4  `2 ` @j   2 @ @Q  aĀ  SbS S a`Sa쀠` a` aa 㿘  N`v?@ bp@B   v@ɐ?  N`/". $$ $ $ `$  a a   aȁ ?@b㿘Sb,S * T  TSb8ST` TSb( T`@ T a@,S  aX Sa܀   T@ ? v?@b J` "`0 %@ (8`/`7$ + 0 (8`/ `7 + 8 @ Ё   2J߀@  0@@  ?+ (Ѓ8` Ѓ(8`Ʉ``+  ``ւ @ $@ `0(2   @ `0(2   @`0` (@ 0` @ (2  񀠀 ` (`0`W(  I` *`0") ,d (8`/^`7   0Z(8`/`7T2`8*`І * 8@  @ 2   2I؀    07* *` 8`@ C 2`(Ѓ8` Ѓ(8``` 2`9 * C @*` @C``ɚ 2`8*`C * @@ ԐC  " ``0(`0)?* 2`2 @)? 0 `  0 W0 +`* 2`2 @   `W +` 8 J`  J ` (  @8( 㿐 b@V` *`` N :`@@g*`` @'r@ 2@gܒ@Sb ' "%@@D @@7 "/ @ v@,# p`@; @[РvנbvԠb@3!x0SaS ̀a@' @?*`   b~&(@`&@|ϐ@ p@gp b"@00#` @ꑒSbw`@3`@@D$ @@72 "/`(`$ `,J   #h#`#d#\v c@g* ``<`Pv@gc@@g(! "`2+D& (@`& `H`<v"`& 2@ؒ0@  `0? v22 c0@fݐ;avbvb6@   #P @z, ǒ"v #H@3!㿘 S!h#$b,`8SHd` !h(`8``!!h@q=  :" @J `: @ v"cX@f ?@ S ah?#t@ v"cp@fx ? ߰?`!!hH`-   ctSSd`(d(@$b,!#tɄldXL44ǼǼ,Ĵ4444444444ĨĘĀ4444 44444 444444444444 ¼4¬44 Œ h\4@44$  444xɼʔ|H(T4ˠˌx`L8$ȸȘȀɤɌt,`x@0l`X@0      㿘 " J`  v?@c@`) 餒 '  @v `$' L`#@oْ , 2,@@oӒ = v@  .  ` `#`$%# ݤ @ @jcؐ@?v@bc@??@Zc㿘v #!1 @xΖ@1 㿘w !(! @xÖ@1 㿘w "H"7 @x@1 㿘 c x@.` xb@dАh 2  (Xb+<)@Xސ@X *@$F @@,`` /, @ `!@ؚ ,` [?@a  [?@a@㿐 @`cF? H" J`k"#6``m`b@6`J`x)4 ``*"  7`w2J6`. @ .`  . @.` -@ 'J`x۲ @4۰  @    . @.`   6` . @؇.`  (֐   (  㿐@Zِ H  '@x  @@( S al b  0``S al @ @ H@ /@'S _$< $<<T@nz#  ; 'cxx(a8'    %xH??Ѐ`J|(`H?? 9 ct  b #`倦`(g@Ҫa  xb0x ap/S-S9 逤2<@ @n- :```@n! hd "@ ,  Y @n  _l`р x@aZ"@ `Ѩ @@m 2H`L#%``'#@ Sv b,   c4 Sa xM  xxapҺa xҸc(x xb0/ %S25@ @m f` `@m 04  P @m ]l`׀ @4"@  5  "Ր  А԰@mt Ԑ@Z ϐ @0 0Q``@/R #`    b SU a 9  '# c S bŜ` Sx aSx a S a&8b,?,S a  S b8 #b,S!# aS aS aSx aSx a9 '#@Eb, 6X9  '# S b SS  4   cSxz ab,H-"HS'p a m a\9  i'##b,!S`$!!(` ^$!SxY a SU b(S'cQ @YYc(  x@Vax 0@ol@` k S a`!S!`xH@`q@!Ѐ $!J`hx`$!@ S b `@`   a\0  Sal T@lX# 6SS  b4SS a?)S ' +S9 /S'# %!$%a%ȶbD%x@&?7?ʀ`D3(` b쀥W x ! 6RSNST b<k`xxXb )x@#@??Ѐ`J(`p@%!  '# cȄ S b '#  '# b  $ S aSU aSx a '# S a%   c S ā S aSx a S~ b,!",'  H@!, 逢 p c", x@Oa- x ! @tź @`` H!2b  x@t"Ob,H-"+HF%a#b,@X!c( b,ɐ @  @nYSal"/b, x@ a&@Rb,S aS a '#  c0@@kJ `    㘲``%@n!l ` 6vr  a\@$<B@; b9  s Ȅ'# @`#` #`(`0# t(`-@K@O- OĨ`S a 'C(9  @@" `ꀡ '#b @(`@ @ג `x@bbh ! #t4? x@Ub@?. @S #t4 (`S `N$#t(`@ 6#t#t! #t4(`0m`$#t(`@@ 6#t#t! SUd a!",'%  ̖ H@!, 逢  cR@@O@ S I@@b, MA@?hb, (`*%S+S- / : x@b  (`"'d``8:(` $Ђ %b4% %%b4$%%㼂 S @ S @ S @S@ b,@ S a S ,@ S 8@@ eb, ݢ@b,@@i ?  a\ S ʢ@!",%S <m@b,b 6, Sa b S` a S`@ aSx a S`  bb,`S a S` a S` a!",f`S` a", x@4`wt` S n@ S h@ S (b@@ Db, fZ@@b, ^R@ @"I@`2%a%a '#a? @ a\<- x@^cppx aH4@@^@\ 2 b+ 0``"`` (@`"`db, x@`tO!pHx q'#` @ c4 @+ j@Py 逢  a\ @]Y9   '#aׂ @", x@b- x " @r @^'` H!2  x@q"0x@kb@D@",`8", x@]bx@Vax06`@ @ v@Fc@* 㿘&`(` 8`?? [*N`sS %8`N `(`8`? N``?8`N"`0(`8`*" 2JL N`(`8`!`?20 8 ] N`-8@" ) 8]  ɀ Dz`) N `"8`]連@& @$  ) ч(`  L`0a쀠`/& 㿘@N`/ ,&@( 8 .(.   x?@c㿘 ϖ `, , ?㿘 c  bx  c@]    `2 `2 @O  c a#?@' c,@cD'H@ @δcP  @٘  @@   -Z a(`8``&`\" @, /$ @(`)8``&`) 8`/9`96Ѐc(``@@䀤`ߔ"܂$S@@\ * @$ J  @L`` * ",`` @-` *M@?-O` O`D y"`X@\>O`2H  a@ :p"  y @{` @M?D   Ŧ2= ٰ M@`€"Ӱ  y @X`0 y`p@["O@(E!㳐 a' ! y ` . #Ā` #Ā`! N `/}N ` .@ݐ@|&#Ā`뀠`  $@#Ā`2N  c  ,Ė  ``;`9` "8, Sb S b<y@ yy`(yaPyya`@ @ @@L, ې?@f* @0, ,,~ SbSb<@n,8O@0y`, ,  % ., #Ā`! Ā` N, `/ ` N, ` .@I@|S,&,#Ā`4Ă  $@?`,`.O`".yy@! @,@D,&,&```` b , ,@,\ y@!W p@'G!@x!㿘 c6   1Sb) `*Sa쀠, `"$ (@@Vt  D$  /($ @Ӑ$ ?J`/"3* $ `& `$   ݀"c`  " `` y?@b0 @@ `& $  y@b  /($ ?㿘 `&   ,S H`/"   S `2   2 `S&a耠 a耠`?@N_ 2 bSa耠?S & 㿘  N`y?@bP@   $$ @0 $ $ $ `$  `   c y?@gbh㻐 a' ' N$y (``  &  (``8``\   (``8` y?@8b0y?@3b {p@O  S , @ m ,(`    (` 8`\2N   (`8`@s@M y?@b0 $,$(``* 8``P"`g`G"-@U@/, y?@֒c@0y?@ђb0`p`$(``ۃ8` `$  ` `$@%!Ƞ$@ y@c@?0r cn @ a'  SS   a̰yc@d P@=@֐ Й@aSa܀@T @>0ych@J P0ps @"S  by@#آ yL@`y@ H`/" ?  (`8``/?2 @o%S $ 2 /,S` $А @͸ ؐ @Ͳ ؐ @ͬ ؐ @ͦ |z@o S`` 'S b('' @ T`K  @ڔ J`{  @Д @`  @Ɣ 6`}  @ ,`z   '@  @  @T  c`io``hES@  @Cz @  SbMc@Bf?@ͫ z?@ͥ w ?@͟ k ?@͙ _ @y @ ƔSb@X  0Ɛ y@ xcSb@I  0@B  0@;  0SjS`SSazS @ԙ`@```T````ȝ㿘 c؀``(!=@8* @2 ?2 cԀ``,!=@ * @2 '2 c̀ 3`H`@  `/`  &  "!   $  2   @&& "    @$  &   & "   $  2 0Ԁ4 ڀ㿘@`(``" 8`Ѐ` .(``8`@4``@F "xL`?`@4 $ ,NN (`(`@@}$DV $NN (`(`@@} $Ղ} $NN (`(`@@}`$ ` NN (`(`@@}`$ NN ((;$@3>&@? NN ((((($N N (` (`@@}@$~T$L (`(`@@}$`=0㿘  ,` 2z?@ ``@  /   ,,` '    Ђ`` (< ,.: z`x@   z?@ ܒa`.( ,` @  & L`"" $  *:M"8 1cC"=  z@ `@А z ,` 0$ @J N$`&$  L`2) ̀`>$  ` Ё mӖ `$  *:0 `$ ǒ % `$   $ ``$    z@ Za8@? cЁ  z@ L`@j  z@ Da@b  z?@ ;`㿘 2?(`# cԀ`9!=8`#/`\"(N @ 6 @@(!=cԡ*  @2@0  $c"" $  `#ل װ  @Ք װ@6  $cÅ(` z?@ a؁ z?@ b z?@ ْa㿘 2?(`# c؀`9!=8`#/`\"(N @} 6 @@ƒ!=cء*  @2@ΐ  $c"" $  `#ل װ  @s װ@Ԓ  $cÅ(` z?@ b` z?@ ~b z?@ wb(㿐`@.? @      (   @  ' (@U`6``Ր 逢㿘% 䀠` @ " `     2`d㿘' ܀`,/ ऀ $(`+S) - aЀ`@ `#@ #``   @L@G$%㿘 c䀤`?@!=* @ @0`  @2  @   & &@@㿘) #`  c# " $@  @`2#㿘 c -'$'`#`!` )@ؤ*  `  2  @  @@΁㻐 # cܦa' ! c2%N% !S!p@-cc@O, $ -`4 `($ ` 4 $ #`!# )p`/ܐ@͒ % !S!p@ذc@*` !p ( c$!pz @ +b0ڔz @ %b0@ !㿘1 #܀` @ S @ p@X  &#ܐ z?@ c㿘1 #䀠`!= @D  &# z?@c0㿘1 #耠`!= @0  &# z?@ch㿘1 #`" @  &# z?@Вc㿘1 #`)ǁ @  &# z?@cЁ㿘% 䀤 @!=* 20 @2@2@Ð  "3{@Nߐ  $$ $ $ $ @$ $@@ڐ3{ @`㿘% 耤 @׊!=*   `@   2` @ "  "" @" $@{@Y`8 㿘 c耠&``  (  4,2! 造! @2&& # `  $# # c@+  {@`X { @`@ `  ꀤ ! 逤`#@!  "" " &m  #쀠`Ҕ @   c"" " &&&㿘`P @?㿘%  JR"* ` @@] "```2@@ڐ  @M &@@M &`@&`$@ @\  @@@ {?@a @ݐ@Mѐ &` {?@a { @{`Ё㿘 c @"*  @\ "   2@3&@&@㿘+ c`8?'O$K)@O* @ '@`"  2  2 , @,l6&,`< &  `-$ @;   @MW  $`$c``$ $ $   $ %  @H {@aHڄ?,& $@@;@9τ  &㳐 - a'  (  1]G*  $1  @2  #@  @"; @D?{ @h Op@͐  S '   @  A< @ @ { @̔@۰?0`@$$ @ $ %@@ #@@E& 2  `@@ $  @?{ @0@U!@{ @ɐ{?@Oa0㿘! #` 1 @!G $#Sb$ {@Ւb0!S@s" 逢  c"@ @?"{ @f@ {?@ b h    T  @dddDD\0X $  H `" ?   ``"` `@ 2,' ()?@ `0(2   @ `0(2   @`0` (@ 0` ((چ (( 0 * % ()? ``0(`0)?* 2`2 @)? 0 ` ((܆ ((  ! ` @㽠 ' `T`I`G` "F, `dK K @!'  ,Y 甖, /, $@狒 d Y)  2 0,! P `|> h  T  { @Ւb0,`d(,  { @ʒb0 a@ { @b@  p(8``/   (8``/2 ݂$`۔`ِ  , 6, | ݖ  1 0`( u(,,, t s(( r a((l Ė   !S!t`!tSx{ xb@c !t    ` { @Tcx0`,t   !S!|`!|S{ c8@: !|   ! d {   @ r  Sa2t! (K  @ڜ  ,˒  @ڔ)!ǐ S  ! ^ :? 4 1, d, ,慐^ , 4,`0I 1  ? Q  2  $ xA| 5 <, { @Ēbh0 2, 3, 7,{"?2JY@!{p"?2iO " @. " )@* !  ` `?`?@а`㾐` ' K)  Y dJ  !@  d ,#`` ` ` d``Pl/   ``>! d  X (` |@B`  T |@0`X Sa   d( ` {@cڂ ` {@cт ,`d ,  |@`8Ƃ ` {@c ` |@` l >  ,t 5  @ ,  ! "  Β! ' ? |@’`x , , 1/P l   l`! //(, , 2p@" &`?  `?`?@U` b`$㿘` @{_@@&㿘aN!Y`!N` x @Ac  ? 㰐 " 㿘"ڰ? ! @  $  $$NaY ``` d,S"@@,$S D` d$  t`d! /  $ `| P <`f  @ 8$$ H$.aH1S!`: ,`t V $.a(!`<`la `(> 4`l`0`$`  `ς``*(`` `P   ```$ ` << $  a)ҕ Ő`t.a(!`"`l  `($|,aYN  /@,@ r  P*8``K @ < ` a  $< `  ` $$      J`$$$  $ / $*`*8``42`  ` $$   ⷐaI  ⲐaQ?c * `0$ *8``2`  `$`  $ $ $  `  ` $$ `  ` ($$  㿘a4N?`!x @?ْc   m "ܐ S a 㿘"ް? t1 @    $$ $```, dSj@,$S, D`b d$,  7`d / $ 0`l ( $ *`t , $ Ⳑ`| P <`    @ 8$ H$$  ` ?Ϟ@`$(`,, $,K`/# P ` <   @$$<K`/ +$`  `$` $ $ $  P* 8``K @ < ` a  $<`  ` ($$    $$  $$ 㿘r   ?㿘n   ?㿘-|)| + 'S@U  @U c` $e 2#| |@`ؔ`А |?@ a |?@a8㿐L'L'P'T'X ' S bSà9 ;Sb` Sb<"|@Ja`@ ""@ @_cȐ @"'b㿐!  H'H'L'P'T'X' @@_ 㿐P'P'T'X ' S bSà; 9S"` Sb<b|@JSa`b@ϒ` ; @J~`H@JEbb@ἐ @_cȐ @ᵒb'"㿘 `?@?1 @>a* 㿘#| @ah g! @Xؒ` $ @Xђc( ꀢ  ` @W @Sbah |?Uax@@''' ','8'X'd'p'|'''''''&)l)l&'')l)l(p(((() ),)8)D)P)\:;>>>;l>><>>>>>=H;l>>=>>>>>>>>>>>>:;;$;4>>;>><>=>==<=T=`=>>X>d  `4`8 3f+ff8?#c@8`8* 2 㿘 $   @h@B: 0 @0(8@ @c@8  2  (     <@ `0`(`(`@  `@`? 㿘| !@IFb@ې ( c` ``D| @ђb@H`#\#`#d#h#l#p#t#x#|###|bp@{jĠ ?c  @(@ (  `,`|@"| b@`@&@@օ 㿈`,` ' @c8  @'[S!@"H1S'@S("H@z!1S"H` "` `* 8`` 2@@ (@` 㿐|@"   2|2#@  ?|*@ #(@2`    |@#8 '@X!|@#P @P'@#P |, b @4 b`3 b b@' 㿘 `(` .`.1|@#X.`.1|@#@b㿐``81~(`DŽ@1|i# }`!؃*`DŽh@|s#|p#}m }j 0 }`s P}b x}_ }\ }Y }V }S }P!}M!(}J!P}G!x}D!}A!}>" `" }} "` `2} }"(@  }"8"`@" @'}*"1}"@ }@"  1}@"1}# }`#0}`#h}#H@ 0 ` } `#} `#@° <1}հ#1~Ұ 1~ϰ 1~̰ 01~ɰ H 1~ `1~` @?cx a' ?c`( b` b  b@-  @\" ~`@G )`(!?~#@@?#@Gw@) X?c~@?c@Ge%4~@@GZ`0  X~@۔@GL X`"4?4( '~@ʔ ?`eaH'eaHW~ J@ ?@?c?#@@G@?ca@G`4f`d`c?`0 `@ @  `H@ @@ )d `0 `8  #@  #@9  #@  #@- #\#@x #`#@! #d#@l #h#@)?#l#~@4X@F?c@i@  a |@!㿘 @  ے `4@r`?`4@`?㿀 @`(` @6`,a @'~@݄!&@``@4d` 4 J `` @? @' ''Ђb@' ((  @( @@(`@8`@ D 9 @@Д!  H `0@B< H `02  `@(  8`0 `8 `82  `@  8`8 `@e`: cI 8@`  0 4` 0! 4   (@@)`,``"   `@G ~~@'`~@̐! ~@Ȑ!`d` #@x  @!# ~@!! ~@"!  @: ~@"  ``#  @ "`~@" ] `P' ~ bX@ @)  %~@! @* ~`,a ``(``@` W~@\"`~b~b b~bSc`~ b~bx`~* `4`~@>  *? -     (`@(`@(`@@(@!}?_`5  @ܲ    ?@ "dSc' '@eǔ  '`,`'@F S c@~ c~ *"@'    (`@(`@(`@@̐@Ő ?@? `Ӑ  @P  "@" ?%?  4V `,`? b` b  b@-  @Y"`,*~ b@ ?c + `a'  - -5 `X5 c* 5  `@Б2 : `d  (@)`(#?c @ː`c $  @  `  j5 `,d  !S#4 \4 `\ H @ǚ  &~`(@LK"`(?c~@@@z `,``  `@o `X `X a |@ !㿘@ D @"㿘@c @o```"`X@:  c@+ `4`  8`80(` А@@t(`" `(ː @Db@ `X``4 `,#`~ b@ @D" /' a' ? /  @i!$ \䀢  b@p@? ~c(@ï ` `'x#ؤ!9?75 / `3(`dž@b,   @>̘# ``b,~c8 , d'x ,`@$ , , ,@@- ] , `"$ ,@7g Ԑb,@5E  ,@_Xb, 2 b,~c`@  @@Ԑ ,Ԃbb,@Œ  8` Va  b,b b,~cb  @ "  @B ~Ӓc `  )8`  ,`h/`%h@ "b,@Bِ [a   @>F#b,n ~c@;  ,` ,b,`R$ ,` ,t` ,q`  ,n`b,   ?@> #J& b,~ܒc ,b,h $ ,   @>8/b,~ʒcb,    @='b,`\#!@ ?`  ,-ab,   @=ߘ# ꀢ `(b,`8@ռP?? ct&`"   !#@ ` VJ,` #  `H$ HJ$ @@ ,`H . @4G   `(@^X 2``x . `` @@Ҡ@@p ! `(`,`` !  @( !  `   `d  @;' k`,` 0(`  @@)`,?c # c`L<@8@#h` h `8 @`\$  ,`8  @,  G`! ,`@ ``\? c@Ș  ,`  ,`\? c@  ,#`L<@8@h` h$ ,#`, d :`耈)`\  @ !S#<(@(@@$#x`,(#4 , , 4  , $ $ `L$ `,` '`L<@8@a0@Đ   (@`\ / '/ /  @X ( @Id!h `h``\  @E  a`h``\  @5  a`h`3`\  @%  a3`\ !?'##`@ a6#?`\#`@  ua #?P|` Pkb! `%c P\@   Pc@c@"(`H# ꀠ`(|@g'|` @"h(` @"ː @<b @8`ΐ @4`` 23`,`! ! \` 0`(`@}Ґ 2 Xb@c9/-,` \ ''@8 \ 2 (@(@ $@  @?  \ ' @G  @`@Hx"'@~ Δ @} `4@ ,@w  @ @ܞ@TTSTSTTDSTSTSTSTSTSTSTSTT8STSTSTSTT,TTS( b$ ' PbX`')X l@[?4 9 X@X@ @d ?2V @(` @N"' X`)@ђ Ѐd*$)@}% l $XX @ b@`|[@!  `x㿘% `F' 0P`)V`x% | `0P`"@* *@Ja `0 P`% |`0@0䀢 @ & % |@0% | @ސ0[@f!   `x㿘 ' b   ?/+7 5;`a9 `& @`&?\` ` n `p`?``A$`X M(@`$X``J"```X -(@`"`X ?_㘄  Z``?$`X ^(@`$X  ? @``Z"```X(@`"`X?`" @L?` `C 0```E`  0```EV2U`` $`$`X $(@`$X ``M`k$`X (@`$X8`?`@B@ ``|[@!  `x 6 ` Y`  `G ` @>Sb`d0```2 @8`?t``U`$`X ^(@`$X``"```X I(@`X"`Xp, 8`` 2X@8@L-@8u`?>  M@ْ?@`H -@В?2 6 ^@Ȓ?0`  ? @@ս? ^@ո? `r I@հ? @暐""@ p62X $@մX80`?p6X M@թX?` -``"```p6`X`X@Ֆ -?2 p6X ^@ՊX?܀`p6fX ^@~X?Ѐ``p6d`X`X@r I?@G5@ `p(8`` 2`X@]?@5> @ڒ`㿘'V`x$|  b0#@ @J @Ga  $|b0  @ b` 4`  @4c(   $|b0 @4ʐ[@G!   `x㿘 @nUb Ѡb# b/-'+)@П? ?` (` ` "@<b@   $`p@І?? ct(``$v @Jo" 0V @C`@1; Ɛ %t$`p % $ %`$`p % $```t`p @ G`x@@㿘`ࠄ ``   ꀢ` `\ a`8 ` @2`㿘`` @ 㿘`` @ 㿘`` @ ``d@d@ d b 2c b ``@ 2 2c㿘```@   `d `  `` * " *  `  (   ;@`   ;@`;@`  &  㿘``!cT#P`5@(@$#P @j`#P`30&a5@㿐@Ftc   @zT /@mc !@#! !@iؒ` !,    @"^, ` @a @쿐#Ёp a' Ԕ @"F!`0a@ 6@쥐# @i`W ,? @ ,b,`7 @a  @숐# a @#㿘!1!?@|㿘 b@`2@   2! !!@{㿘 b@;4 @ɐ㿘````    `x a' ````` Ր  ) `?c   !@6܀ @G h  @i``7 @a? @  a @#㿐! '!@h`   @6g#!쀢"`@\ ` @Ēa @ΐ 㿐 .``Ė '@   @6D `@:  `, ,  `2   @{}  @{w  , `4?`   (@,㿐 .`` '@   @6 `@ `, , ` ` 2$   @{@   ( `4?`   (@(㿘N`0 + )  x c(@P`x2    N`b` @D X  `c``D   `D    !@A #,` `Ѐ`  (`#(@P`(` І`Ѐ`  #(@P` ,8``\2 `" N @DT   ,$ 6&"@z &h a' `Ӓ @z ! '̂  '̔c̀  !/Ӕ !@g``Ӡ!0$ @a怢  @ꛐ! a @# x a' ` @z\ @k @Я!(  @y=ޔ @gt`` @Za? @c!@ a @#0㿘`````6 ``` ` ` @y ` ``   `\ ` a' .` `Đ@ @y  'Ȃ `'̐@C / @g!!  /@C *E   `dfĒa@@Z4䀢  @ϖ`@ `"aP@v @x  ` ``  ` `4 $ @* a @#@` "` `* 8`` 2@@ (@` 㿘`B. `0`  % b6# >`.`"&N@`ѐ ,N@@G ,N@`  * c@P` ` * cP`@/`N@  N@` 4`N@`ʂ㿘 N`2 @r!`  @l!hL b`  b <  b0! b@ <  (@@""N"`o ,N@ ,N"`cN@ْN  N` 4NՄ b` bH >b@Ͽ >㿘` @!paxb @"0"  `t@ `@2 @2@!`2a?cЮb0`b  a V!c`"@2 @@" @2 ` @ @羐@@  `26 `1@簑!㿘  c<b Т (b0V c1k@瞑 " ?@瘐 2㿘` `0  x c(@P`x   c ` `I` @ &H``211!!@T@R!| b@K & 㿀 a'   @x`0a:@"?`O†`" `aȓ*`2`@ ! a @1#P㿀 a'   @wՐ a$@wϐ '@d``0@ݒa׀ "@!= "b (@0b@ `b ' bX`"$`@ؒb"@Ґ ` - -@f`  `@[`a٤ a @Ȑ#`x .``@ a'  @wi  `%, `!, @l /  @7 ? @wh *bp ! @( " @R    @@v" @L)    #@@$ aP@ɐ  a @c#x㿀 a'   @w%0aa:$ @?b  @v7 @ a9?b@\  @1#x a'  'ܐ  /@1܃*` 0` ؀ b@q    `Ԓ  @v#`0aa:& @͔? b`7 @Òa9?b@  @#p a' В  $@v @c`#`0 @a  b`' @a b@  @#p a' Ԕ @!`0@ra b @c|`W ? @ ``7 @Va  b@ a @}#㿘! !@cR``! @8ay? @cx a'   @v `a0a: `@?/b@c(  `Ԁ` `k@(cx   /@0܀`"7 @c`7` @a9? b@B a @#ȁh` a' "̒  (@u @bߒ``0 @Œa6  @݋` @cH cPcP` cX@> a @ِ#؁㿐'``cp` c@$ #cP   @0*`c@ <,@$cP㿐 '  К@0"@  c@ @( `P``c@ @>` ` `p `h@>ݒ` ` `t `l݁aȐ ݁aȐ 㿐 x`  @F (    b` b]  >b@Ґ  >@. 0 x`@fG  @@fA  P@ S R'`'b b ) 7(' ('@ `` h@ d`" B@ p B`" ^`B ` @2` b` b  ^b@x  ^6 ^(`0` " x ` b` b  xb@`  x`3 v1@.6 a ?cP` a'  Ē !   @th '@a)  @waҀ  @=`2N`@ܿ!@I`  @tK?c%> @tBఔ ''@aj 0@Qaր @Z!X)`` ?c ax'  b@܍!p?@Q` n `@` |䀤@퀥` ?! a @I#㿘`  @2 @'0   ?㿘  t? ~a@| 㿘``% @naP ސ?4 a@a  (?c $P㿘"? Fa@D 㿘  !!<` a  $!<``b`"b0@% `b`!#P `4`ǣ,`@@$#P㿘 c8, @@&  2 @`,  p a'  2b@   $@s@ @`i`! 0 @Oa  b ' @Ea b@  @m 㿘@-  Vc a?c @{b? b@  @ @i㿘)``b`c@ cP  cT㿘``c@`cp@q cP  `p a' @-T 1bV c@ӒC 2@c@N @Đ  @i@В  $@r @_`! 0 @a  b@ ' @a b a @ p a' @- <bVc@c c@%  `@% `c@  @i @hВ  $@r8 @_a`! 0 @Ga  b@ ' @;a b a @d 0p a' @, <bVc@)c c@%@  `@%9 ``@  @ @hВ  $@qݐ @_`! 0 @a  b@> ' @a b a @  @㽸 a'   !!@q{%$  @^Ӑ#`0@a  8@q @^Ð`0@a  4 @q@^ `0 @a  @qz@^ `'0@  @qk@^ `0@|a̒  @q\@^ `0@ma  @qM@^w `@_T  $@q?@^i `0 @Pa`?`? `2" "" "   #  @0!b {b@0 0  |2'``" '`?c@"'`@, 8'`R7d`ܔ @P K Z@o֐@b8@ Hl  |@pڐ|@  @]``0@aӀ )`%` `''b ) 7(' ('@ X@q`l  h@/b$   `0@a逢?2   p@/bN &`#`  ` Ѐ` `:  @# 2ئ  @߇   "` , ,@`@/J   0` !  @/3"0`24"@/+ p  B d`> !  @/"h`b "@/#Vch`"@1 !  @/"l`b "@.#Vcl`! @ ! "@. gp"@. at  Ā`@!`a b *`:`@!(`0@Вa؀  V`` b` b b@y aa8 b` b b@g ``" ``"      b) ,`a @ PH a' |!`@ޛ`b,`*`Ւ@!hP``@ވ!a`@ހ"a@` @x" b` b `b@  `````` ``@`y@V"(#̒  (@o @\C`')0 @)!6 6쀦" `@8"8 `@W"H @i   b`'!6@ 6cH@X @"hܒ  ܀, b` b/  b@Ť  b` b" (b@ŗ ( ؔ  b` b ) b@ņ ) b` b `b@y `Z@Ґ"8a<`' ax  bx`@2`@ @ݷ  @( 쀦.` `  @e ``2`bL a@    ,` $`2  "//@nM @[v``0@~\aK @ɀ`Ȃ #\Ȕ! @ך b@[V!ɀ`cb ɀ`Ȃ #\Ȕ! @¸ b@[7!@9"@  a @H h a'   8@mx @m @ 'Ѐ'P'@!#  ?'''''!A'"@!%  2N! 'NЀ % N `:!  V'ФcԢ ' /&`&@ `J`"@"! 'x o ''Ԡ @Z`` @}a耢? @ݪ" a @Ȑ p a' x @mm 4Q  !!@meӔ $ @Z``0@}ra Mc@m['t BN`0N `x 't t t`  c`7c0@ې ch#\Ԙ@ޚ  c ''x 1@ZB 3` @}(a c@z   $@m  @Z-`0 @}a b`' @} a b a @2 㿐`P`` @c!`@LԔ  +c@% " @5c` `2 @6g 2 `2  ``2?2   2 c@M   @% 㿘!  ܀@@E` @   `?$ ܁$ ܁h a'  %`  @U`+?  @ےbC   (#\! @ b @Y!@ۅ ``"DРВ ! @lE @Yn` @k,0H@|Pa" @`1"@S 0 @l&  / / #\! @ "b @Y;!@? HВ ! @l @Y-`  @j`0H@|a%   @`1"@ P ѐ@ hВ ! @kܐ @Y`  @jĐ`0H@{aI  @ӭ`1"8@ x3`@ `@ `@ `@ڐ `@Ӑ `@@̐ `@Ő  @ھ! `h`SВ ! @k @X`  @jg`0H@{aQ  @P`17@ێ!03``.@ @ڎ!0䀢  fa@"[@ځ!@|!@@y!H  fa@"[@l!0@h!@@ݐ  a @w aP#Xx a'  %` !@`+  @}b# `@X3! a@i@'ܒ@-!X` @X!!!0@{a% 6@`1@ !h @jޔ  `|``/a @i`0@za"  @ҩ`12 @j  @!x !@W`b@'ܒ@ߐ!`|@ڐ!``1 a @i`0@za# @s`12 @j @ګ!!`@W `"  '@Yܒ@٧! b` bŐ  b@:  a @ 㿘 ! !@W~``! @zdaz? @a㿘 ``%`! @b @j;J?Ѐ` N#0@zBa 6V @`B @z5az @?"a@z* /V #?`@!0 @z! &6 V `! b,@z    `0@za~  @   @ ?㿐 `p'H`   @$p b@i  @" "c@2  a  cX " NЀ` 8   @3W 2 @ 2|NЀ` 8w `` ! @i @` @hw  @i @` 1!@hg!  @V  @V  ` ` # &@  ` `7  ` @3 20` H` "&`1"LP @2 @  V `@2 $ @  $` ````  m@"I􀤠`@_`  "a@(@ 㿘 4`   `p ?J@`-,`  ' ) `a  $p % l$p  H@``A`?  첐  @V (?  @U (?`a@s    bL  @2i@ 2 $?` ` ``(` `!`@Uϔ ?` `p  `t@@2Db   8 ?` `p`  @@2/b@ ;!쀦 ~ ```2l??ݐ"f?@2@ "` `@` ` ` `@aP4`` 2```"B?`@@`  @1  ``@`@ @fb Ā ` ?` `@`2`@Rb8@?` Ā@` @@% ? ``7)- ``  `p`  `l!0C ```  `d` ꬐#a䀠` ` @U```@w`  @Ϯ`1`` bX`\` ` @T`` `@w` bh@ @N  Ā ? a' @@@LĐ@S@TT   @@g@ D `6(@2@@L@Sޔ @@Sڒ@T4  @@gl@ % `\(@2@@L@S @@S @T a @#`P\ a' "f?`"c?8_?@c X@f Ȭ74,4,`4,`y,` @f \m @e  @(2\ ` '@  @e`ɤ @f@]  @f  @f  @fܰ  ? a @ #p@,@ H`H@0s@ D`D`88 ?  @@ 0`D D 006 4 ?4˞@`D D 6 $ ?$@`D D ((6 , ?,@ Ha`H D`D`88    @@ ?`D D 00   44?͞@`D D    $$?@`D D ((   ,,?@ lllllllllllllll8llll|lllplllllllllllllllll4ll€plX,`P@4llН㿘 < ", @`<&   8`a`2   2  2?,  aH ? '`a'd@' ` a `  'h'l'p't'x'|''' ' < d`L H`."m (l D@4'l p'p x*'x84h`J'h`" @d @d@e%ئ@e!ᠨ`   @a ` $@@R3`  @@R-$`<@@@`@&'&'$ t*'t  2 <`t'''aDa u aL  @#  H@  $  (h{l`Y $ (a^'lP``K$ @x @= @d@dᠨ` z @L'J`҂a '@djh' '|`@$`@Q H`-"w@[ sa2 ap@ `@Z``` h|l' !'"@d@dKp'' "'@d@d?x" '@c@d7at' ''aDa Q aL` l@c۔@d'' @{ @V"㿘a퀠`p @ " @ r a`M'h`K Ϯbbظ)%7@  2<`LH8``NH`."F8L`2M @ $L@@˟6h`׀`: @@ݐ 2<@ˋ`0- `NH`H@"@ %!@0`Ll`L` @Ұ` 0Ɛ @c@ 㿀@:,   @c# " @ `  ;@   alcP '%-/ 975)#@ٔ??π`Gq(`@>@̔?? ct"&`(ap`a ax䀠`"a`pa"p` 䀠`!!80`@8` $!|`1䀠```ad`6` D :,`֒@a;'ad@by# w@ r `@  &l`Ҁ``ada Had`a`䀦  D  `a %!$$aX'ad T  a\ O& 'ad$$aX%! E a B% > p : | 6 3`1 -  %!$$aX'ad # ᨂ  x   %!$$aX'ad  a $aX$'ad%!  a ?$%$aX'ad a $  '    t $ a$aX'ad a    '!h ` & \   % '!h a`aX@bx D@֒!!`< Ha H`  Hc, D@q`h  "| w `aa Hab H` Da\` Ha\b0 Hb Ha\ H2@㿘<M (50 I bb b0``x"```X =(@`"`X @ I  b b0``"```X *(@`"`X  *  @5b bG b0``R"```X @(@`"`X b/ b0``K"```X /(@`"`X  b b0``C"```X |(@`"`X  =  @b |  @b /  @b @  @b`p6`X`X =@ `p6`X`X @@ `p6`X`X /@۰ `p6`X`X |@Ѱ `p6x`X`X *@ǰ 㿘a D2 ap2 @@ސ`Haax <  @ a: ?: @@kB @ِ#@װ @Ӑ#8̰㿘 % % b`$```X ($`X   `  `"`` @M  2 `X@Y  㿘a  @`ap `@a ax ``*`@g&@@c```*` 㿘a  `ap `a@`L'   b+ ?`T ```n$```X (@ `$`X  ,``0` ` `"``;$```X ,(@`$`X`(` `'``/$```X (@`$`X@ ,`(`* 0```-&```X (@`&`X@  @  `p6`X`X@ ,`(`p6`X`X@  3  @xb`X@  `X@ 㿐+ 8`qR+   b  @$Bb `@4b`2@ ```b$```X (@`$`X   @b`2 ``$```X ( $`X@ 쀥`p6`X`X @' ‥b`    @b@  0```$"```X (@`"`Xaap a?@@A#H~ `X@  `X@ 㿘!  `'D@ߐD  b' NG$ ` X(@`$ X  `" `N@  aE b0 XN1$ ` X(@`$ X  `" `N@  `p b0``"```X (@`"`X p 2 X@  p 2 X@|Ͱ DaT b0 XNT$ ` X(@`$ X  `" `N@H `;  b0``X"```X (@`"`X b `?`L2$`X(@`$X  `"`L@   @b@r ?c  T>$  @b  p 2 X@ p 2X@̠ `p6l`X`X@ `p6`X`X@  x a' 8` a5ap2 cXvcP?p.c@0H@a2~ax"|< r("y8 b2 `` %`X (@`%X `aDap2@@ $ @a#  @ϐc`a2 <@"t"p `2 (at (X8ؐ@cV?P@̩#aQa\(kH@ya<( 8`2s$[@]@#?t@u(w@Q b"t` @ 2{  {@Za! ;H  ? 2@I @C#hz ,@=c`k a  :@: @gB @+J @$#8>8 "@#@ q`$]@\X@:#?2@Ĵ@c @Ȑ"  a?@1@#HX@ @"㿐A p!   @m77P `-`!`2 @@+  `8` aRapO ?  b7 - 5 (`@ P @ @@$@`29 `=%`X ( %X`.``7%`X (@`%X ̂P@W?*` / &P$  a?@@Y#H @ @@ ݸ p6XX @ @X@ θ    @RP&P& ? @&$ b㿘 ` "@c@甐 㿘(>  % b+) ?# H2 `a`2 ? `'$ ` X(@`$ X (`8?# Ha`2 ?@ ( p 2 X@ذ @@㿘! a $! #@b @"? n ct" (`)@ %aa`@`@2@ @%! @%  2  , , " @` 2`2@ 㿐   '  @YͰ ?a`@o j @j#㿐    @Y ?@W   @Y ?a`2@E @z  @\@00x<<`P2"`2㿐) !+  %!a(@QG@!%!a ! @Q<$!%!@ H a- / 9  `"`2`2 @" `/! 2 !` a`@Up*` N a ( " ` aa, @@! @a@ua`(a  , @@# ɠ , !`$!@!a`@U4*` 'a @,  $@᠂`%"!! @a @b㻈 a 'X'P'TaP@' '쀠 a ! @ @[p""@g 0$@Y@%0@, h㿐 0& < & @ `p *8 8`` b& 8 & 8 <& < <. @ )& D  & H`p0  4`D   & <!@WƐ"@"@@"@& <@3 & @ <֐@8  < @@& DЂb?& H ?/& Da& H a `pH`  a   & <ӈᐘ  & <Έᐈ& < & @㿘@e f` T@UƐ \ e @YD \$   @@  5`@U$ T ]?$ X*`*`*`*`*`*`*``,*@  `$ (@$  (`$  <$ @   ' $ 07P`2$ P $ 0` Ȑ` @7`  `@O?$ 0 `hٰ? `є@O? `Ŕ( @Ov?@Ot㿘 N`  # @+ R@^ @XJ?`d   J@+#H0㿀@ L` c- / + ) ' cL@/? ?π`<(`Ð@"?? ctᘐ&c`_ a`  a`!`] )  @Q )  @M :  @I )`e @n ǂ ?'7@+'耢 ᘅ,```2 @0  2@`@ @ `@' a;5@ڒ P ꀦ`a`- `D"`H  #a` `0``0`(`􀠀  @א` ɀ  &`0!`D@B "@`H@`2`D᐀@ VW Y'a a` ! ”m P0`"P`"c 20 `H@„  `4} @10`@{&` `0 &`0`@{0 @&`00@  &$@'a 'aЂb@  $ᰂ % %a %ᘂ %! %aʶ  ? @{#(`(` (@  Z怈` @ʐ@ P ꀦ`a`  -xlV 9&`0#X&`42&`0` .`$`< @`(&`$ &`$&`0"aRa@/Ր @  b :@  R )@  @[ `` @ 0ɐ@`"Ð@@  ג`&`0@ /   @  a`b` *@?]!}@V͐J?`d-  % / + ) @ 0 )@  Q@  :@  2 ) `@?  `@7  `@/  `x@' P a' ! @,# #` (=``8@  `)> `@`0``& (^`@@ > . @``@*`81  `# 0҄`)2`. `/"`$`` 2E . ' . @տ``@` 0` 0@@$` ۔0`6c `"- `  .`@Ց `@` 0 @Հ``@`` 0~` 0w``Ԕ`  . @]` 0 `   P 0`[$ P$ 0$ 40U@ߐ Ȗ . @B``@j`r 0Ap aa```` ` #$c c Xa' ''''''' '# T  8_    ) .   $ !! ! !   `! `@ `  )#`  /#@#`Ԑ +ՠ + ֖+ %+  0H`Tc@  T" 4@`2 @@Bp  4`& 4  a 4@? p' ؀`% Ԁ`b  !!!  ` ` ` ` ` ``(`)! 1@#Ѐ [   :@1 k& T' ) $@y  n T' ) %@y  r @ T''''''' :' @x ?n܄#      TaȄ% ! c## c   @P @ $Ԑ ak?#А aa?@P @ $ؐ aS?@@?@a F@3@a 9@ @&@ua ,@ې @?@ha 0`T   ``G  㿀  ?'L''' L @R? 6㿀  ?'''   @R~? 6㿐@   0  @ 2 `2@PQ " @R @@ @  㿘 .@  G  a@P@[ .`  @@.```) `) `) `) `) H a' Ԕ '''''''' @p'0@ca A`A`A"  (  +`  ''''''''''@G0 @c{a6 Ā"ݰ Ȃ`` `2ְ 0Ӱ`@ޟ!@2`$(Ȱ @)?@x aP.p0@?@k aP!0H a' Ԓ @@O#`%0@c5 `' 7@c+ᝀ  @@8`@c  䀈` -h  @ @ !  L@R`E`@R2@@ 2@` `2@ `2@ ``2@!  @RÐ @ @Q0H@bВaI u@ @g``c`vh  0 @ ʐ@Th  H "@´#`' 7@bᝀ 6u@¦#p``7@b Lܰ?@ݾ!0@Q@ax W@ @D@ax J@ @7?@ah =0h  5p0@#@rax )(@ؐ `"?h ?0@ ?@Zah 0  a@'   @, ƒ 8!(@R  @?2a0J@baJ 3aФ` `` !` "`@2` 耠`" ,`,` ."@ `@ё Ȑ `` @@ ``,`  `'', '4 //''''''ܐ̒@P  '܂&`  ` 8s    ) .   $ ,!! ! ! ! ` @ `  )!   /!! 4,`+@5`+`6 .+`7,`+`"@ `@& ,@N aV`H@ "j`,@;@:@ a?pY`@,@{a 20p@ @oa &0b@|!㿘1 !܀`  @= ; 0 `H@ !܆  `8    @  @M @ &!ܐ a(?@߰?@.a 8@Ұ?@!a ؔ@ @(L'P'P'P'P'P( 'P'P'P'P'P'P'P'P'P'P''P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'P'''P'P'P'P'P'''P'P'P'P'P'P''P'h-D-0--,,,,,,,h,T,@,,,|(|)@)d))(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|(|*D*T*d*t******(|+H(JIJIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIJIIIIIIIIIIIIIIIIK@<<K(K<<<<J<<<JJ@<<<J$<<<<<<<<<IDHHHxH`H(HGF<<FFFx<FLF8<EE<EE|    ` ` `  a   a   d(``? `     `)@@? `) `/@  `     `)@@  `) `.$@  ` " @ "Ђb@" "@ "㿘 "Ȕ  @!ǖ@ڕ  a' @ . "`?x  j@Nݐ@N(~x  c`"  8)#(@P`) I` x'x'|'''''''''''''''''''@a'̐/ww@̈ @̄@А @ʒc  @8  @.! " @ 0@ٽ"H㿘c   @  (@@  #@6`耎 @z `"6  ``2 6 6 `  ` "6 6 ` @c@ޢ@6 `ܴ `ٴ (N@R c @`D J|G`@ DD| I`Ȅ#\#`Є#d#h؄#l#p#t#x#|###|bp@?RIJ c @  (@) @#@ a|| @ub@@"` | b @ 2 @e X )   0@ ) ((a' @!?+@@ #    #\2` `+  @Ɛ#ؠ  @B . %@   @6 .  @  '''''''''7? '''''''''7?@إ"P㿐 a!#\! X  @ X ch㻈 a' .WsbͶa% `@ `@ ^A`5 ``E $ `?@D4&@@1@ ` !H`@LŒ$$8 @ 3(  * `2    %@L$$  „ `?@ "X" '$ " @ Ԁ`߰ ?cp  a' !??#c(@Ll@ ܐ) !~@L`Ȓ@ ѐ' ~@LU@ + aR!Ā`""?@D'' WbȔH J ?@L1??#c @ ?ca@ !? a􀠠(a#@LS@   @ " L~@K?@K0@ i! ' b̑ ̕NʁH @ ??c@@VK8@?  b'?;h;`#\!?#`@K@ 1!?@>"h㿘3 @\ @a@   a@^ `?a@}`?㿘 ` (   "  `)@@  2   `,0@   a@+    "  a`"  a"  @@Đ ׂ  dт 㿘   @+aҀ`?㿐@  a   `"g@ 耤@@  (`  -@7%@@VT- 0`  @@/// /ز` 8 @, @А   ,(`@(`@̀# @ ` ` `///(` /((`- @0(`@`@=!@@8!`   a'  !@'*@\i &D@!@ @!h`&ax )  @ʍ . "?@ @\Q @ 2 '''''''''7@ސ!P @"p㿈 `(`!@ϖa a@A?``"@@.? @ @۔ @u @є㿘 ` 9  5b0b  `)@ `@`#`! `)2 `2 `3`#`12@b    `@`ဠ`2@O   x à  #a,a`a` . . . . . . .  @ʝ: %   +@(@d((ad (0, . 1 . ?,a`01 . . `g.  a. . . ?,a` . .   a@H 6    a  a'' a h h  ''  @J & a@Ӑ"X``   a@9 @"P . . . ?. ,a` .   a@Hq  aa` ``& 6    ` ` `   @'' @!   a. (00. . ?. ,a`ф . . . . ?. ,a`Ā=?㿈2  a  '''' @Yc @mŔ bHb ʑH'`' '㿘&@`'@N"1@"_cЪ b (b&```<.`1@1"@+ `(`&1 1@"@ `(`1@J"@    .`.1|@@#   .`.1|@@#XȐP a@' ` *`@"0@ Y@֐"@Ӑ x  (``(`@ɐ! a `8(`@"(0 `*`@#h     ((`@*`@#@  K0 `}`"}@# @# `"܀`@#    ((`@*`@ @@y ؐ }@t"0|@p#0@l X0@h h0@d x0~@` 0z@\ 0v@X 0r@T 0n@   @̖ . @C   @ . @7!0Q@3!@0 x  (``!(`@&! a=  `&@`|`@!0/@;#0b @ z |@2#Y @-#@T @(#O @#"J }@ 0E @!p @ܐ!p @א!` @Ґ!P  @͐!8 @Ȑ!0 @Ð!` @!P @!8 @!0 @"0" @ 0% @ސ#H @    .@ " (`@!0@ҡ":!@aؒ' $ /@r!0 '''''''''7+? '''''''''7?  .@Ӕ 2 7@I!0c@E!0_` a '  ``2 @0! `2+ b`p 0```~"```X (@`"`X`j@E bp  `?bx9 `F$ ` X (@`$ X`& `  @p . "$?@`b@b`" ` @y`4߰  1@ːb'''''''''7 X@p   @Ub`4@"`0@"P+ @"Hx `X@W `@Ѹ"H a' '̢Ē @    a`"  a@"@ P` `a ~@!0ǐ?9 "`4`i/ ᴀaӒ Ɛ~@I"`Uᴀ` b 0```"```X (@! `"`Xᴀa~@Y"0@C"@N!0} / /   ; a`'%'( a-0@v: aI 8@`\  a% a / ᴀ`y`"X   a@_ 1 / # a  a* $a@H2 : aI 8@`4  $a` / ᴀ`N A~@Đ"` `"* `"@#xr@ې"04!0!  @K"zᴂ  (@@) (@@)@"@#ᴀaa'؂ ''''''/ل / '''' '@r#a``@i#`@c#(!   @b! ! '̂@&@Lc08@#8@H"@!`@@̀a`   '̒`@` ~@(" ᴒ`X @! ᴐ @꣔ ''ђ ꕠ b P LJJ?8bR88 b-8b @#H@#` (`ݐ@ސ#Ϭ  뀠@'̀b0 ̦ ` @` OЀ` @D'̐@*;א@̀( 9$  @!ᴀa^`X@ @ `j`  @!%`+ ` @ , `R &=@#Ѐ*` "@ ,@u# @   ?"@ , @g# b)!  b0``"```X )(@`"`X'̀ "@Đ ,@J# @F#ǀ`p6`X`X@ )ᴐ )@ؒ"@3# @-"H%   'aȦ! @#@H`@̒` 'k Ȓ%V%b0ah ah aXaX `?y' c'%%% %%%+ / c4'0'4   %@A? ?`2+(`@4?? ct&     @T? X `) !, @. @  'h'l  :'x'|'''p't h! @#! !`P a!`"8 @BI! a/ @m %!&  'L :'H'X'\'`'d'P'T H@# `!a )@gy 0 @Q!a)@F@f?!`ꀈ~*  a)0('D!!@?|D !`   a`(`@wi  ? ԤЂc  d @@$@  ! @' a` @J'`p  ' ) *@g ?!2C?'H'L'P'T'X'\'`'dX@'XȒ : H@f !aq 2(5 쀠2\ C 4@ |'`쀠  )$$  / $ a ($  @  3 ? @S̒` )$ 3 $ $  @TF `   h@" ` `2`@S @s`@ !DO 䀠9Ȥ!?##`@f~  ; aȒ#`@fu  .Ȃ  )' $@fk   aȖ ) %@fa  & (?@9!  !ؒ@1!  !@c0` ݠ 0! @R ̐ @R !`"В # $aa!$!%1 $غȲ!`Ua``!`?Ȃ '7@ve    D'L $'H'''''P'X'T'\H@Z H7 à" ! !! @!!!@@  @b!`3&a0 a a a  a a!",@  ꀢ  a",H@H@ #Ѐb @|ap `  ,` !p ?@ `@S !",@y ",H@H@",m'0!",@",?8J`H@8b  ;8HV ' %` JH `  '! # `: !", @4", aJ}H@y a( @|x`` b,@ u a " a@*  a a `@ !",   @T#  !!",~ @|Ic8@#"b, @'@v'` b,H@H@ @|.` ,@h L ``2# w L` ``2(`a`4aa`4aa`4aa` 4aa`4aa`@4a a a؄ b, 'l'h : 'x'|'''p't h @  a ``@?!a @Q a` @t  @{Œa aj a b, '4`  a@Z a aT awP ' ) '@dA   aȖ ) (@d8   @Sb䀠`   a!)0a'D a0'DР@+ #  @ "8@ ~c@{i ϐ %0 &0Ȃ  '7@tT  @`@ǐ!@c 0ĐH !a@Ő!0@q`@!@c 0ɐ  !@ `???`?H?P?Xa` @a؀ ( @~ݒ`. @y 2 i ' ) +@c ?! @~Œc $   $'`'`'` '`$ ) .$ $  8 ( @; ꀢ - b %%aȄ  )' &@c|    @~c`? c@cn F @ aX`i'X a@Oڐ  aa` ??@c  aĀ$# 0 @Z Ȃ  ' @    `` a $`cu $` $`$`$`,``4` ) .@c(   @~B`0쀠 ) @c   a쀠 ) @c    @~%`x  +  )@b 3  @~`@s0 @ &@sJV@ !@" ]Ȓ ) @bԘ ?2` @}b@P[a@z! z〦 ", @zaP", @z` @z` @z c", @z`x @z`H@~!`0I@{!@= @3 "`(@y @Pa0@y @$ "`@y  @}b~ @}c( @yڒa @}bH @yӒb @yВa@Pba@yȐ  @}c @}c@ @}b4 @yc @yc @}v`  @}r`P @}o` @}k` @}gbh @}ca( @}_a !$@A 0?'ĒcĔ@b+  @yc@)@Y(YTXYTXYTXhYTXYTW̝㿘!  # b@b @=  bpb@ @U 㿘@ "x a'  @-b b'b' b !) ' ># 8``r" ", `u`d`j`a/a``z'`t'",J@",@ !'$a $@d %"@{ ?&bЀ` 8 ",@'",@?* 耠` ct쀠`  @耢 b@|  .  @j"?`x. @%b @H`+2@`?@ @` ( `.a`L@ @"?" ,@= LHH(`(`@=$@?0"@<?` i(`@ L?L?((`((` @ (`@(?ʂbT $``@q d* * * $` `L?L?}@((@$` L?L?(`(`@ $`2``$` L?L?(`(`@$` 2  L?L?(`(`@$` HH(`(`@;$`@! $" Cc b`2/` a`"' @?)c8"ؒ @''@8?&cX0'@ @{S a %@c``?@` J@`+ `? cp@wݐ `"@z\  @"$@@ @b@N@J J` ` " 㿘  b b+  @x a8@  b4`+a`@@ @0@ @<`@Ǎ㿘@6~  @1"Ґ 㿘@;ߐ  @(㿘@+!+ a$!0`"(@? J` $!0@w +@ a@@ @&@ P@/7@;+a@;`/U?8J?U@F`   bP@6! "P`@.1"8@.."@@.+"Hg@.(!0"P`abP@ "@. @? `@.  bX @H`-`+H`2@@,G 2@@,B  @,=  bP` @,9  + a@ɰ? @@ `@  4@+a` @  @ @0 @_ @@Q    bH` +b`  bP` @0"`@(@;@ @: @ @p @1 ې @T @Ր !̂` ́  @ bl @2  ?㿘`?!bG \b㿘! "L` `!bG @D{"L` "L!bG @Dq"L` "L!bG @Dg"L`" $"L!bG @D]$"L㿘 !bG @DN  !bG @DE  !bG @D<   !bG @D3 bL㿘 bL ?Ɂ+a``G!b!b\b !bG \b!b+aDG\b!bJ`+aDG\b!b|G \b!bxG \b㿘+aĀ`  bL Hq!bt+aDG\b!bpG \b㿘! "P`+a` +!b+aDG@C+b`2 $"P!b+aDG@C$"P㿘+aD!!$"@C"́㿘N` @(``  bH(`` ސ+a`g@Gc 㿘+b` +!b+aDG@CS+a` +!b+aDG@CG+aؠ `#+0 @. aD  F  bP㿘!b@Br 5G@C& 㿀 a' @" ,J`)   bT@ 2)  2  P [$`@98  F$`@8 T$@ T ` @&Hb@U @k a @Z#㿘 !@*bȀ`@A?㿘  !J`0@ @ bȀ` @@㿘 !bȀ`@@㿘\& && &ސ#&`b &㿐#!b /'   "  2A  2; "   20  (& """ " """"# 2 ,  ,  ,b㿐 @Hv`h + aD @# "@t+ aD?# + D  D + ax@# "@Z+ ax$# + x P x㷀 a' @o# fb!!@@%$"Ȁ  $"#(  $"@/j#0+ a#8+ a#@+ ad#H+ a`#P+ alݐ#X+  ap apap+ aX+ a<+ aP+ ah+ at+ a|+ aT+ a b'#`!  bl (b"Yؐ !  b ͐#h!  b #p!  b "h!  b Ē"!  J`2    bHb #x+a`!` ⌀  J`2    bHb #!  J`2    bHxb q#!  J`2 b + a@+ a@#!%!b#\\#bP)" a b#\#s!`p!Ub!#\#!#!Ib##\!#!>⬒,#!  " U!! #Ȁ # $"J`2c$" #Ȥ !b !bJb  @?  @$"`@6ܐ'! bp#ؤ !b !bJb +aD @?̔ @#ܔ"`@6'!~ ! bx#!  | |p H b #蒒 +b +ad`#!$bt $bt!btH@`  ah a @#h b\ a'  + aL +bL@ +# bX`!"@@5; , $bX@<"X^ nd  2H KH "B\F  Ȁ 2U= ?!,2O= aF 8%'A )`$2?1 1b27- b.  8c2*" a pb  0b      0b   ؄ 0b ۂ~'݂`''+ a\+ aH+/ a/ //!b@@4 ,!+"L @w@"L b\ a @#㿘@,e@?"1@  1:#17 @ ? 1, 1) 8 `d@c   @8` @r ?쀢1 X@+# !bЄ `?(@`( @2  @ 2  2  !bЀ " ?+a`2?$8?!bА?` ?d,d0d(3`(` +`  @  ? `c* 80`@8` ` `  `!bЄ (  @!bЀ` d㿘!Ѐ`.d`    @+ @bb@2 а 3!b``b@ibЂ?  "$@+v b,&b@ 㿘   @[ ?2 2 㿘!bЀ`2d`2 @??>d8?8`@@?@Hd!>d8b$8$$(&$0?㿘1!"Ѐ`?w?"$0c8$(!$0!$0@9$(㿘!bЀg+a?`?8 ` 4Z 2@8T > 80 0 @`8 ( @ 5 @@".<( 2)<(@44 @2#!@8-  #!?"& "H`!b!+b@@  <(  @?@`$0  㿘   !b@   4 2  ( 2   #d0;d(㿘1!"Ѐ`%d`""@d>d8"Ѐ +a`3+$8?" 3+ObH` 3+,? ?  c@H` `0````@   H@`@  H@ ?  c@`` 㿘  c` ` !͐" ! `@Ð"1!@!` 2 !"!"ؔ@1H 1!"!(bb" " `" `" `" a" `" `" a!"㿐!b  6`.`. 9 @ +`3`+ @@C@C @ (`8`Є $H`.'' @"P$㿘} @1,2& 2'㿘?!L$㿐%"!"+"A'  @$  `䀠"`!b$㿘@0  @㿐!! "'@0ِ H@` 㿐#"!"%+' x@%$` @$ `H ` !"'`@%$  !" H `!"@ !" 耠@㿘!Hb`  "n `"(@"``㿀"`!bV'G` "@" "` @."`! b1+'% !x @0`8 耠@"`!b " `a" " `  ! Z'쀠` 㿘#"`!b ` ((``!": "``  !2 H`? 㿈"` !)+b'"'!x @0`8 H@` '` 'H` "`!b " `㿐1" H`9' "`+ax@  " H``""@ !"$ @$  ` @$$  H@ ` 㿘"`H@`N 㿘!!@/`"@a"  " ?( 耢" (*w 㿘 bh`3""(```&`@o "1"@ $  *  v 1"0k% 4ǐ :!   "Y3"4i"J"a e 21" J  B`3"`H@`" 3"` 3"3``H@`  0b`3"b`耠@( !H` !R`3"b`耠@w H` 0q `"`k ``H@` 0`V R U `!b!H` !3"x`b`耠@@ H` 0:j`3"b`耠@1 H` 0+! "`H` `3"``H@`  0`H@`  ` 0 &`1"   㿐' @.D%"#" k@#D *Nh`2 N``$$`N`2'<0 hLx ttTL\h4hxxhl@Lt   4hh                                             T"a`@ @ 㿐 `0' @#k㿘@$ ++a ?2 +2+   a(@a5+3+a &a&@ @@&&a㿘"a$`ذa  /"[ a)`@ #        㿘"a  7" a"   .3"a ad a da !a ba !a `a !(a a ڐ!8a !HX"#h̲ c㿘" a㿘@ "a d`@ 5 @ $ ."  { #"a @+a  $a @   @  ` ` @"!P@ @֑㿘@*@!㿘L"a`#D`# `/` ``(" a+`7 `$ "6J"a"a a a @( N`+` ! "( `@#"N`$"($"("!"a !"a$@$!"J aJ aJ  㿘 n  * t" t bx㿘@,P??:L㿘# bx`1 _$bx @#m "a```   g "t2@,@"&"t"t, < `?$bxp+aD"  a 0@8`+'"  e'/+1+3 5"7+-+%"9+;++ " H"$$` @, !8`ؐ? dbt`j5@"?@>0 @    @ Gb, ἀ`@    @ 2b, `78 %@%@&  @ !h L`@  :0 @ "`8` @+ax (@ !p3$8H`}"Ԁ`e,;+`+"bH`aԀe e'a`"/`{`/`v` `0`7o`` aЀ` ` `.@<  d` "ِ!%a<a"a`+N 2+"$`! `+`2+ @`@ `` ``J $a\@e+aL@a+aH@"\` @s!"  $!@')!%"$`2!@  !$`@ @| /+@!g / 1` `Ն! `!`` `%` aǀ`!`*`` `@` aa"a$`7" ` a`7 0"` ` j a݀` /+1+`"/U "/+ "/+'/'@l쀢  ' Na?`c8Z+(`$@ ϔ bW 0 +`+ b` ` `@: % $+a`" "@ qa0  G  +`+ b` ` `@: % $^  ; `   ` <L+a`2 `4 "`2   `( "@ +a0   @ /+1+`   ` <$   @ /+1+`   ` <+a`2: `43"`23  `(/ *"`   ` < ̒ `  `@.: % $+a`2 "@ a0   /+!+@ + a  @  "H`"H+ a"H`  2' bP`d/+ +` a+ a+a`+"@ a0+Xa+ a+^a1 w@@$r/+@1++3 `   ` <`.`"$$ `4 "`  `d"  d a<F/+" @!1+>  `@M/+1+@v/+1+,`+$$@ a/+ 2/+@#M'[!@/+1+/+1+3 쀠`H@쮐 /+  " a   ` <" a O0`0 " b   ` <7/+1+  3 "a  ?`` "a  ?" a   ` < /+1+ _ "[ a @(/+W1+`   ` <@  E/+@7 @{  2 % `4 `  `(aЂb 'S!`   ` <@A  /+`4 `  `(aЂb '/!`   ` <@  "/+o" /+ b,@ y @ @/+@ /+ " $" a$" a(I0 L` /+   bs+a\+aL+aH  /+@~1+   bU+a\+aL+aH  /+@o1+! b( k 0[ +b + b 8+ax0@8`8% $+a9 @@ @(+< +!  +b + b 8+ax0@8`8% $+ ᤂ@ ᤄ +& aa`  ~ ` +b`"8 a8j/+ 1+a`^` !" X  bh`2*  㿐@@&@'   / X-  `  (HHC`2`";   `'`@' (@*H@"", 㘂``" ,(@P`,  $(``$&􀤀   L?` D?,$&$ @(&㿘 ꁒ ? (E` ="I@`25@ "` g7  d` ?" d"(@+ f` 2H`g$ d(``H`"` H`2   *H@`2` d d  ,a  ,ax+a\ a' <+aL8+aH5  ܀ $,, , ``?`( d``d ܂N`o?   " r   a @#㿐 K @%I 'J` ;  㿘H   @ !? A@bX4` , L   @%z$L@,`L@` @L` ,(  H@ `"  (`` @%@% % % 㿘 " 1 @"`㿘 " 1 @"㿘 !"1  ݑ H㿘0@-_?@㿈# b,`&@L耠b,쀠@@]# a   @b,"a@@ @a$a b,+ a+ a 4b?㿘1 ", "",@ ",! ", ",``ٰ @r'@ @ѐ`X @Pa  a M'@  '[@V!@7耤@@/@@+@)s @ǰ @8 '@}'+a` @6  @!  '@ې" y Y @Y Ā   g b0 a" a@! @ $",",+@a  + a4@Ȓx   |+ ax+ a b( "@! @"4+a $"4@@@c +b,`['!@ǒ@ 㿘 @{  @ 㿘#+@h@r     bH`  b,.c? b,/`  b,.c  b,/`D 㿘ϐ@2@=ڐ      ` ? 犑 㿘~؁㿘  @]b,㿘 @<a " 1 @9"i 1! g!0㿘@#qH`/(@c   @I  㿘# c㾈 a' v "=   @I ?"2 !@ '%+  X `   L쀠@@ _  -@쀠@     a @D#Ё㿘 ' %1 ꀠ#%2`(L L?@"`L (8``%`#,2 `"0 "`@ @"@ L ` + ) `,#%2%,@( L`L@ ,L`) 8``%`#",2,b0 " ,@T`$@Ð@" `L@ @,㿘! !``  ֐# $!`c0$!` a`. @:`@ 㿘# @"r  - + MpMbq2*  * ґ:  " 2  L  `, @"M [   Hbp Hbq@!P "%@T , N ,㿘m#X  L`" 3Ҥ 03@|c(@" @"   g`@!!0@@dc(@㿘+a0`N"@1#p C@!ސ@!ې@!ؐ   #4 L`%2 H``s2    @@!@@! . @! ܀ @C @㿐+a䀠`"i +a0`2d >?ې# "\ L@`| ` L@`-2`@!a "J @!v@!s   2 @L@`%2 @@H``s2 @@@!X  , @!P 倥`*@``  b`T`@ΐ@  @L O&&@G!  d 3 d' ```$`@% @@`$@@ $&,,,  @@@ ,Ҡ ,@N` 㿘@    HbpN @ 02H@2#,, HI"q,m@ `@Ӹ " , N`,(Đ@. <@@`?@6(+a` "@   䔐@  %aP@ +@va` <@ @@ b  *p@  a @ߊ@ ah` +a  +a؀` c+aD+a`摞@@+`8` 㿘Ӡ     +aD   @j ? @ @? ?0 +@=?0aĀ`?@ U㿘@  ?2 `@? 㿘+a` t?@n??   d @  㿘߰ @U `B 2 `( 㿘c +aD +a܀`++aD  -++ )+'+% 3+aD @  @V @2!h@? @ @ ڴ @A@+a؀`  N ʴ al `ĸ @_# - ) @s?# !  @א ?74 @:  @4   D @- !@֒ 2al`?  ؀`D` &a@ %!?`   @1 al@ N?+a؀`f+0y㿘@Ķ      9⭑ @r??- + ++aD @ϒ  +a`@ؠ  @S    t @K?? T  뀢 ap@ ap  뀢 ap` ap  넒 ap` ap  2@ ap  a  ` @: `: ( :@ (:` * J  @ "  " 㿘 apap@А  2  0* 0/ :??$ < , $ $  뀦`ap$ $  `$  ap`! 2  ` 㿘 #@ ! ",2~$",    ap 2  @q @o㿘?  ?   겆`F 8b8`F ?  2` 8b@㿘5+#+;+9+7++|z`  @  +Ȁ` a(@8`2 @(   d@Ϙ?ʐD P`|z  0bH`;n  ?2bH`,_ ?`B  ꐒ @@x`F ꂒf?bH` @$?\?@ 6b`3!`0 0B?@ $`b`!`&@:?F? `E E? 0 @ @Ԥ 8+aȀ` B?@d @ * 㿘5 ++;+9+7+?+` +@ ++Ȁ`+(@?  :@ @F  ƬbH`? 20E@A@’ϒbH`@`D @= w??d倦@@0@?  `?`?bH`v ?@ > b`; !`7  8@1d@? @B?@  b`!`bH`EK ?&ἤ  < @b 7 @ @ 6+aȀ`+ B?@z +@ *+a`"` !+"H`@Ϥ??  ?{㿘@@ &"` @Y? =@Q  l 1 @J#@A @=? 0 ^9+* (V9+?+@aD?"  ͚ 7+?  ے@ '@+aD+ a+? a  ? 4``8``  +a`$@ !D@ݒ@ r+a؀`++ a@+aD? ޙ 㿘V + ?0/ +a`.㿘?  @|#?  1 @#@ +2@ aD?+a 㿈@@㿘 1 @Z @@Z ? !+2 !D+aD  Օ!DҔ!D@8?@́㿐@?    +a`++a `8? 2 +a  (? P@ @ +a" aL" aP" aH" aT b< b@"" aX \"(a`  \  b4(@ b8 @("aX` +à`    ~"@?"@@?` b8H@"@ b4@ " X" aH㿘% ' 4(`@ ) "8@  @ $4 @YE  $@ΐ@ $@ɐ%"8$4$  㿘   2F?`(C?F? < "4('+ H` ? b4 b4a`B  @@b4?(@   b4@& a @&??㿘?"<? 7??1 %+# ! 뀦` H`"a  "4a "4B?(@扰  b4(@&2&?? 㿘W  +ah +a< +a|+aX㿘>  +at +aP +aT+ap㿘 9? bh` 8 1".  6:  +1"!L! "8H 2  "8!L@H   "aL  b8H 㿘   "ap*`@U:`@ 㿘   "at. @D:`@  㿐` b<` B @8 +`2`@+b `C+" aL4@'   .+"4?@%+ 9  4 " aL4@'"4拒?"4@  "4 @"G aLb `2 뀦   "b4L@?'l6  +b ` "aP+ax%"/aL a " !Lb4(@ b8"(@P!!L P  " 㿘. I: "@aP# bl  bl?+ax    : 2 N   㿐 ]"+b$""La\ "!P@$  b8`0"     b4 '   ϒ? @&LLb8HP @&P L\? P@b8`04 " aT aT`+ bh"aL b4` #aT b8H@ _2`` s`b<`"o`m@ __` "`  #aT ] +b$``$"`+_b aP"aH"a\ b,   a) @@? ) b0 a@#@$(@@6 (` @   ̐+ax?@@@@A~` K 6`6 bh` 8!. :  +b ` ` .   2   :  @   㿘" "a\!L"aP @ @4@ 5 7+t+  `) ``$* (b8@@(@  @,  - L`ʤ   Q`"OL`` `I* 8``?䬐 `?  b8H!L b8H@b8ۈH@ $%b8ہH@ %b80H@!L@b8H@@p  %!L@@%@"88` !L4 "(8@ (@ "  aL"4 ""!PH #aL H!!P㿘%"L`  "ah, ",` . 8`   +b$` "(a`"8ah bh` ". :   "+aHa "aP+ax0@8`  b4"aL(a"  bh`?"aP@x+a a'   @i+aȀ`4+"aL b4 ( b8? 뀣 ꀣ@8  b@ b@2  `@  b8 @( b8(@"P` P" aL+aԀ` "aL"aP" 6  @ @b   !"b4!L a"@@!L b8`@ (`"\ "!P \"!!P aL"4 (@b8(@\ " aL" aP a @h#㿘i p"  pJ`2a p[ "  tJ` ` t $   b4 $ $ b8 a㿘"Ha` " " " ""ah "aH+a+'"+b ` "  m """aL b4 b8`)?` (K@ ` @" aL"aP+ax& "+a`" " ++a`2 "+b `+ " !Lb4 ( b8(@!!La``" !Lb4 +@ b8) +@)#!L"aL b4(@ b8(@"a`  !"" ax x(( b!  !  ! ! ! 9 "ax  ` ` : 㿘"ax ax@2 @H"" @& @2" @* "   (b b:: : $ $@Ð(b`"ax  ax 4  2 8  2 ( b  @㿘  "  `ax | axax"  @&@2  @* "axc ax ``@f4 )@'   J)+  6"H`@ 2`<`D   2*@%  &)+  "H` 2D?  2@+??+Ԁ` + a Ԑ HbT 㿘!("```d$"@n$"(b` @ ؂?$"㿘+aԀ`?   "  `8ax  axax @&@ @*@ @@0( b"ax"`@b@f4;@9S c( b)+t"H`8 ?2QD  2@4 ;@84D -( b)+"H` K  ?2OD  2@R  㿘@ B3+=  @ 9 ? "  aD& *2@`?@b  (bЈd??8@`@28@(bȚ$@2 ??9   2㿘?`8 ?. .  (b v耠` . .  (bȂ|X  @ 㿈  @ Z > > b,&㿘 'B ' . $+0  ^& b,( bb ` `  `1 ( ܺ+aD b,( bb8` `(@ $" b,( bb 4  )  )1!@ )c)c2; 耠2쀠2  b,+a  b,   㿈ܝ @ݐ耠 쀠  b,(b d8d8d㿘 bH  +@EaD@Fb@+ a㿘 bL  +@Eax@Fb@+ b +b +aD      HbT! + a㿈 *  3N@`@ (bq (bpN`` `N``   @!8 (bp(` (bq(bq bp bq///'!`@ܒ a' ;  y   "a  ) (@8 Ј Ђ`` ) , &@ J`,   ߀ O a,   b, D b08ap@  ,`$*8Vc a} b@ @, @  "@@z@, 8@ "@@l8@ b0 "@@a['0!@W0 a @ِ#㿘   ``Ё  b4@! @ 0@!@!@"@"P@"Z @ @ + aЂ+@㿐 7  >N@`m"+ `s`M`h`=2 + `w+b<`+b<`b@+` bD` c `c `c@@&+a+(b<@['!@Β㿘     bD bP`1X㰑"h 'a' *  P N@̀`.`b@' bL`"`; @(b܀`+". ? b  + bL bL+b '" @@? $  ?(`8``0?(# 'В@a a @#h 'a' *  P N@̀`.`cH@' bH`#P; @ÒcH܀`+#h. ? a + bH bH+a'# @@W? $  ?(`8``0?(#'В@ a @~ `  @ @ (`  ``S`?  `  ch)c@  bP`+!!`?`㿐'#@㿐`  &@ '#@ܐ ?㿘ˤ в` `   *  @` @* (Ѓ8` Ѐ 4?  @Cޒ ?  $* @  * $`2&@㿘ҔJ`-    Ђ``  .  @ . (Ѓ8` Ѐ`$@&@`2 㿘N ` ) *@@# 1)#@7 *1)#㿘)cj㿈'L v (  `@" Ӑ'  82   a"  ǐ' X\``  LH@`"R "O " @  ~  2B  @`?; @  `? 21  *$  &  ے ` x 2 L H`2    @  @ `L@ @  @ `@@ @ ```$ `  @(`@` @'@} ` ̈́ + a``"``2 {`2 㿘N`ч &@" $" @& 2  $ -  2&.  ѐ &@@XR@(@N ސ㿘۹) #@ &Ё㿈 ''D!)# 2   `غD) + - `` `2) @  )#`D $) c9'D06:'D$"D +   (`D-2(`Hn'(`*8``+`?"~Dz'D  +%bD g'DH`+'f%(ઐcD z"P@? z@] 2 ''@Ґ ' ``"``2= *`27 D  / `?+  ?`@  " @H@`D)'DDJ`   'DDH@`2 ) c $ `@ DH^  bT ` $J􀠀 㿘ǐ!   J`   bP bT+b# a a8`" d2   $ $ $ $ $ $ $ $  "   b" $  @  $LbP㿘@ @@2    @  @ 㿘 ֖ d 㿘 d@A&.. @@(`@(`" ;ж: b@  㿘@s֤@%@ @   @ 㿐@㿘#+! @@Ya` 2$##`$##` ϲ  @s`?@s`#ݐ?㿘@    ?G㿀 a' 6 `2 /@,  0? ,@@ ` -?,@ a @ x a'   `/ @ `0? , @E  ` -?,@v a @ x a'   `/ @ʖ `0? , @  ` -?,@D a @] (㿘 c*`  b4`?@W  ?   + a* ` 㿘+0` 0! #*c ##+(@ 4`$#㿘NN  x a'  3`а -L@H@`n``s`d2$L@ @@  L ` ̐@ ` @( @ `L@ ̀ % a @Ґ 0㿘 b4` +a`c@  b4`+a`w F+ax` + aL㿘ϛ>Đ  t#Ϗ9 + b0㿘+, 4` ,+a` +aĀ`qϚ +ap T b4`+a`2 $ ;#V+aX@ ]+ax + a㿐+bH`+ + a b8ψ $8"``ʐ `?㿈`#@ Ͷ@   HI 2  2'` '@ \ @ @)耠`? !''@! @ `?㿘 "&@0. 4; 063 ?.Ѵ 4,  &`$% f ѣ ` і?2 U,@ 2 aN   ' dA d m L} T DH Fh B2 0Ԁ T b P2߰ 0# c2ٰ | m s iT lU f2̰ , s t p2ð 0k x2 0\? D ` B?:(?    %B? D `B? :@>`&B ,0v,0Q 0q`B ig 4 _`]B?O \N0.آ ? I0 B  96 ,*3 (NЪ?? NH` $( Y,  N N`P+`+` b `@ +` c+ax+ap+aX"@"@Ka㿘 bP`+쀠`?И .  c+b<@+ax+ap+aX"@"@+ a4 cKa 㿘ɡ! !+$"<ɜ!X"<$ ɗ!$ ɓ ` cɎ  cɉ! c`2#@+aȀ`#  b8 ꀠ" b@ b@2 `@  퀢;9 퀢4 `@ @2@ (2`@ `@ 2 @ `2  #@+a` +`؀`?  㿘   `@2 @2 2 㿘  @  `?㿘 1+!     2   2 "  4  2: @(:   : `" `  4  2:  (:   :   4   8@+@"!㿘@# +&??8`+8` NaH  NaH 㿘  @$ ց+``+a+ `+Na 㿐`+ `Ű? ;  `@`$ [$ $ '@5! @_ ? #``   @  + `+a`+ ` +a + `㿘 N`2++! ! + a㿐'X`=\`9 #+``X\\X\  X @(`@8`@: \ @(`@8`@9 \@` `  #`#\& \x'TlT  ' +'a+H`񀦿  \ d\`\d28䀠`8 @0` '\ E鞖  E + d`28@Ԁ`$8` @h= 2+` +$`` +$```+`@ (`+ `"` + ܥ`+ +  +#\#`'耢 " +  : :   + ;+``T#\#` 耢 -" #`#\ܘ0`+a`S#`#\Ș@W@U``   8@@M@K ?㿀+`++`   Ā ??      +`? +@ +`耦@  뀦" a(`8F6  뀦2 a   a(`8F4  뀣@ a(@8`2@ @(@   f  4   +(+ (&8`+a #\#` #d= +`耠" @4 @+@++8`+8`㿘 b8+Ma@? ?b@;b8 8b@+a`  0;+  d? "#[ ?2@(? 4 2 @( ђ! aDӀ]㿘+a`!+  ؀  $ +a@ `'+$ ؁ ? "   䘒Q D'+ `؁㿈|耤? ??  㿀`3+J@`-+7` ` "`@"3+#Β ?a`` a` ++؀`+ + `ؔ &?3+a` `u +{ `a` +   8 ˎ1 2/ ˃' b`` 2?  ++ 2 ?a  e`  .   3+ Q 2?aD? B  ? ?"j#8?#\#d#`??  +a`0 ++a+a`2ې 㿘+a+ `㿘+S +1 "؀`?  + `` ` `+ aa ` `+H` H+H` H+H` H㿀'''@'3? "㿘 "  Rb̐ Rb R b 0 ߐ  ܐ   ذ  Ձ㿘+bHM bH# ǐ f     @4>@kޒ  RbV * + a!+1+!xǏ!D!x@!D@`0`+8 a' + a +b`Å 㿐#+bL ? Or O` ?/2bL㿘| @א!h+  L  L@@Z<ZV@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@VV@V@V@V@YV@V@VV@V@V@VV@YdV@YLY@V@V@V@V@V@V@V@V@V@V@V@YXXXV@V@XV@XtV@V@X`V@V@WV@V@WWWHV@V@VTYܝ㿘 ` "@`@ 㿐@. "  @`2 ``<`  `? P @`  ` `?@'`  @  `   d`@ՠ  2`ː  `&` @ ǀ‚ P &@㿘$'H@ʽHh?'+bP@Ӕ [ Z2@? @  *#+@c  `    )+#+5+bST'Ը`t؂ &#`D   o,`4` R` `a` b @,`C % `#`%#`! @I[$ ?@"@3 @3 @2 X@%ΐ" `$ @"? <#` !+` `@f""@`" @T"0 `4` ''` `_''ܐab@y *% @Jh $'%`''' %` #\ @  %% `2#@Lb [@T?!#`2#@-"|# @ @?M%# `K@&b[@T!% ab @j @!R# +b0`&`&`&` +&`P&`D @ "  @@c $X @<bX :@(   @Sߐ! @Sِ!Ё %#` }&` @9a@ @ ( a' + c' '  X`8@KScP%خcX9 7@O?" ?΀`F(`*,   @#䀢'`'@OŔ?? ct&(`@ @@m " j W@H # @d`-Vc@8 ,   @#䀢^'`'`',   @#䀢E'`',!'#耠`@R( ǂ`@ @ π ɀ  ` @@j'`@f',    @X䀢 @Gǐ '` T'hP'`L' `G ,    @9䀢'@7' 4   ' . `,   @#䀢+ c,   @#䀢'@',   @#䀢'`' `   ` ` }'  `UL?W  ' P `%R@I@'A' @> ; `O  2 @@-'+'@'$'h '`' `1   `}'  0'Ђ@''''܂`'  ` @''@'' @7gb @7cbH, @7^bp, @7Yc , @7Tb, @7Oc8, @7Jb, @7Eb, @7@c, @7;bV @:b@- @+[a@: 㿐Vc`A@j "L`"`n"@L  @  = ",@``LV`"HV@ 2  @ @ @QV; `"&@`&@ "' (&`o2°   @c " @y@ c&@c@6  @&@b`"2&@W`@6 cVcVc@6 㿐@'  c`@ @:I @@㿘 @Ѫ@ 㻐 a'  @ ? $@l "  @<@    a @#Ё㿘`2@2 @? @6Ac㿘`2 @] @65c㿘 ` `2  @6%c 㿘$+[#@8@I " "@ $ @ 㿘 +$@#0#$@@) "@ & @ & @ g0g0g0g0g0g0g0g0g0g0kkkkkkkgggkhthhhjkkhkkkkki kkji kkkkkkkkkkiDiPi`kipikiikkjkj$j4kjDi jTkk jdjtjikkkkkkjkk k㿘 ` "@` @ 㿈,c8`,` -a\`, - a\-c<T@ `!-!d*`` T@*`$!d`-H` F-a`L-ax`I%-N `^`?``H`$`?-al%-#,@?dc<`@`@m, $c<d(` `b -al```b``b &@#`#\#d#@@1,%-#,dc<@<`, $dc<(`@Gc<d(`(@,<` <㿘 `j"@ @ @F`㿈 `- aH`f `g`e -l` l-x` xc '  c    %) -` Ѐ`S(`XX@ ,Ѐ` , c,c,33̀@>,,(`(`@,Ђ@ , (,@? ,*H`Βa " `A", c(, ,  (, ,@! , H`a ,a c(, c,-l-` l- ax-x-`  x--` x - al-` - ap-  aP- a-L` L "a0 @ a  v%  -r ah -n aX@ ,-``@3-,-` %_`@B ,-" " U  -Q at,@` @ -I a- a-  aP-A ap -= a| ,9 c0 -5 aP -1 a ,- 4 -)  ,% 8,@א!H % @ϐ!P  @ǐ!`  ah @3 - $ ct@   @Jఀ? ct &(`@ , @-a+ /c(`@3  [`  @ 2Jb` 0``@_@ `[a@7/ @S@_`2@     @ -@Z?-al`-,@` @x`,@` @x` -a`!, va!,#<@S$- a#<@M - a !- +,,`@@ "`!d!@c@,`@(@ " `!!,@ #H@,"[#Ha@3 <@!d-a`  @aO"  -aL` -a`  - at-@ aL`  @ @??2`?@, c, c,  ,c c ` , c@@㿘0 㿘0@R  -  㿘@Ő "    $  < @$  ,$$ `,  @, ,(`@ ?` "` `* 8`` 2@M@ (@` 㿘-at`    @b-a|`- "  b` ϐ @M] } @e"-ah` "  b`  @MD l @e  b` @M-∀   −"@@  b`  @M 㿘@C  @5a㿘@Ȓ  @5b`㿘@ X @5b@h  Ғc( `c(` -a`w'̒[@f)!q'w  , ``,Tc'c(,? c$?-''' a`  ?'̮)-9,-,',3-5,'؄@C ?; 'Ѐ ԂH` Ԃ'!``'Ѐ`- @1_ch\ `J > -!,,@ @(`` @ C ?@ ?-a ` ` ??, @ 2,8`0쀐2 І`2@0 ,#<  0`c ,4` `?  !`  ``_!` @0 -!X`;0 -!P`60)`a`,#($ ,`"%!`@]"X,#(%!` &a*0%$` u : 0 m -!`%!`0` -\` [#(`  $`%$̈'̀`-p` -!P`,c(`A-aX`--at`g@d"@d!@-ap̀@ `-@].-a` ̀ @]# %-aX`!-ap`-a` ``2̀`"-aP`2̒@c̐#́`- 0)́㿘  @R(  # ``` 0 @ϖ`@0 V@P 2<@\K` c@3@/@㿘 "c@:@ې 㿘$'H@=H㿘  #-a @h  @ . "  *a@Z   a@ "  *@G    a@= . 0ԁ 㿘 WN``nW @/b"&N - a  @z ,   @o  b " .    @@e , 2*. $`o-   a @3' 㿘 b   0 @   -`-a@ a`?㿐 @[ 3`/   &耦``@,ꀢ 2 @e `@ 2 @U ` X @c"؁ a' А@d- @qڒH P<@ @I 00А  "ox    )W @## -a!-!@' #@  2 `B!2ڰ .''''7 /`` @ '@'Ă?''D'̤@a b@O̠ ~@??$''D '@' #\ ^t"h@ "O @`p0  (  ! 2   @I 0А   2n @H 0t@6 @ "&.@  @.` u-c @a Xr!-[ @b!0V @  @0M@}# :@  ސ@. : . @"0:㿐 @Z ),`,` Xb(  Z@Q  "ߐ   @1 㿘@ZI ^`;-/ '--+-)@D? ?`1(`@D?? ct&@: 6`-a b"5W`0, @  @  2 `@  'a`W,, %%a "--kא#̀` @-mb@/@㿈 @"  ?// 7'0@’c@&]?  @1a 㿘 ` "@a(@}5 㻀 a' P'`@D#؀?쀢 ob,@@D ? o ct&(`@@''`@b?  p@"@J@G b䀠 b|@\.!`@:@9  b耢  b@\!" `@\#@x b|@\!` 㿐 H'H'L'P'T'X'@xv 㿐 H'H'L'P'T'X'㿐 H'H'L'P'T'X'㿘@T@1 (H/ !X%@k:" G@k3  -<)' @`?@>   @k `>0@j @@@[#X"@TƐ#8`%@[#H㿐 H'H'L'P'T'X'@"@w 㿘  % 퀠` @1    @ `$㿈.'H в'DD.'P a&`. a' ` @ @ x`ƀ S` &``@  HЀ` 8 Ƃ Ѐ` ‚ (H (.aЀ``@ϔ 2@L`"` @`2`T 0$`*$` $`$@` $``$`` &`` ` 2 0v t @I 2@A#@o `"C'|D`..aЀcp@Z   @Z 2 @8 2.H`W+ b`Z PUP "  'c`E '@ZzK  '"@;c00  P@ ''Ő $ $ $ $ $`$ ` $`E`#x@Aoc 'Hb@4`D ``0/ @?.Ѐ 2 [ X 2  3 ` k ` `" @``` @զ @` `8 @.a$@`@'$`. @ $ % 2b4@b.a" `"`2Pd N'@@0@:`@8`@6$ % Ԁb%bPD .'``` @Y쀠`-.؀ `*X "``@^``x@U `   $ u@@הb @@㺠 a' ` 2 g  @5b. @v`@ @~  @ @@6$?2@ @  @h$ @$̒@a@ @u@@㿘 # `! "@a`"@a0@u  ` "@ܒ`0㿘  [a @] 6 @Y   㿐 H@c@bB@  @@ @H`"  @%Nap@@Ԕ  @H`2  (` ?0c (` ? 0`@"  @%*a @%'a@Z= &  @%aP[ @(ޒa㿘 @٦b  `@aa`?  )ؐ@;? m!]@;? m ct,`4`"& "!@S& `-[@t@"S", @!!@ΐΐ 怤 - !`H@p&`֢  @$à`K@t@@8888888888888888㿘 . >@5 a@(M @gbb@(> @ @2 ?@A* >) #( G6b"%6  ,` @(` 6b|;6a耠`2,@h a'6 @a#(℃(`,  a耠`@W @#(a耠`  @5) @W"` Wb@y  @3m @( @!. !p"!@0 @’8` @-@@Ր,@@+x@ `d* "+@0D# x@+60b*  0` :@: @B6b| @J 6b;6 a耠`2jh`(a 96`>a耠`Y`}6a耠n`X0#(ta`h'6ad- *@ a耠`Kt @`6 a耠`A`MbH@#s "d*@-  a耠   @V W @c Abx@#T @4R `@V֐"h`adℓ*@ a耠`"t@Vǐt@4: `@V#`Xb(@& b8@& b@& b@&  @#b(! @4" " ``2" ``2` ``24`@Ē !@'{  @8;  3`@C3` + @(  @ڐ Đ@eǒ: @@WY#@֐@  @=#XĀ@@Ԑ)6" @ ?(| ?ca €`U `[ ?ca`?X`2 @a @ @ ` @a  ``` "@#!6  b 66 b` 6 a'6$| 80`@?~&@"@ $`$   `c@?@`?`2 @a @ c@?@ n߄ @̀     @U "`8`@@U P@U h|`@U &@ @<Ő#X0< @<#X07@V#p@ 0/@<#@  0' @<#80! @Vn"@ 0 #@Vd @@0  @V["(0##s㿘   b @@q 㿈iaH'6#; - /6+6)6@8?"! ?`_(`@8??! #t&`#t)6(`@@%!`!6$!`%6$+6#6a耠j!⌒a8@ X6 b!g   @9!6 ! @{6a쀠<b! @" " @  2b @%a %@b,%( %a %"@b,'c,b,$@M@20_@< @-a0 4 6 b@T!@!@T!P@T!`@T!p@p#t  ' '' #6a @ݚ ?-`8a#a0g%b@a ˄  @ a @Ea( #a8R%b@pא ! @$b( @ ֒a @$aT @$c@@ $0<H,,,,,,,,,,,,,,,,,,,,,,P,,,,,,,,,,,,,,pìhXPP˰ʠʐɼ$4DDl`XP0(ڀ8t8\p(H`|H4t8xhllllllllllllllllll `(((((((((((((((T(((((((((H((<((0(<7< ` <# (&* ?c8#?* ?  "` 8!`)!` (H`8 @)!` ?(@ ?c(* ?ߐ ݂? ?ؐ ւ? ?ӂ? @@@*@H` @ H`@ @ *@7b<( `  @  @@:  ( @  `@ @@((@`" @ `8(`b mck`ccccc`㿐   @# `7<*`  <8a ` ! ((<*`  <8a8 ` ! ((`@z 㿐`+(` @p` m7 7bt"80 @!"&  7"̀`  7h !"̖   ?@N$&@7 7bx"80 @!"ޘ 7bh` 7"̄ `   ?@,&@`P@" p    @18&!  ''Ԃ '''''Ԓ  @ߚ ?! @`h @!`㿘 "7*" "* @l  7<d < @ߒ`㿘@@@* n``h Ј ``  (8`Ѐ ) (   Ђ`` (``( 8`) ( .@(  ``(8`Ҙɀ`2ψ ͈ +` К㿐!7"Ā" @`   7< ` <  @xB"Ā)  8`?    (a`a``(` `$`$`:` $`  @᧔ ?c8@.`? 8 !!`!`)!`(? (@        `?`@. 㾈  a' '"   @ѐ" #@G'@P   !@a @P! @b@P  @l" 㿘 c0 7 q @)"t 2 a@㿘b`` @`2@   2!6 ""@ޔ㿀 a' `"9 @a  7  Q<` <    @B @ `8``  (` ۂ  (@@(ӂ `2  `2  `2   `2  f`@ ``  '''' @  c@k"(8a( @P`8 7Ĩa' 7  " `7<Ă  < @4a . n 7a `,`,@@%cȀ ! !   28  ۰8a8 `,@,`@cȀ 倦  !!, a@ 7͢a8ɢa`7Ţb7 b@ \`  \ ʐ n @גaP@S 2 1@ /  ,  ' '''''''5f@@` 2c'`g` @@& ``]`"j ` `  2 ג0| @ar,@v  $,@o 2& ` @ b @2 a2&  @U$`S ,@P 7bd @2   +`< @@ aP@E  ` ````"4` $`@jِ"@```2`@{ 8 a\"ax@ a0@ Ô  a@ 㿘  @5! `! "@UaЖ" "@" ?@j 㿘 8@2a?@@Mz@[@Oc!@G `f ѐ  @bP㿘n a#7? 8`@J`-*ِ ?`(`@?  !88a4@ ?"@`@ڰ?נ ՠ  $bР  㿘`L (`! 8`5>@`B" `T < S& (@`&(`8 8"`1 0& (@`&(`8 "8`Є  b24 1&  >(@`&(`8` 4`@5l 8 2@5u@5\  2@5g@5N > 6@5\ >㿘+ `) "`f  0```l"```X (@`"`X@b@M"`b c"`T 0``W `X (@` X   "2 : "  ` ``  ( `   ". @ @MJ` ```` , "`  @4גb@bb.  b@4ΐ `X@4ސ 0b@4ڐ 㿘@M"p 0# % b8@M" $b8  i㿘8@ א!8@M" `1@4$"@    l (` 0` @      "`" " ` ```` (@ @ ``2  @ @L#(  !7 "@ }$"@L#@$"` ````@L#p @ e@L# "  @C @ Y@L# 3 ,@L|#@Ly# b P@) ``@Ll#@E# (@Lc  0 4`@? @LYL 8 V 0`@? ( @LKL7b E H@L@ 0 b  bD 0```A&```X (@`&`Xj. "NM JH`2F `2A@ =;@  1@3/#@3-" @ $& 8@ ɐ@K#XU`b@3 `X@3 x !7" a'  ` @3"  ``? ` `@Kʐ @@KƐ ` ``C(` @K!   @K!   "" ` 8v 0 ( 4@?@?Ԃ`L ?#\ L@K!@q0 (`[@K!@K ` ``8 (`n  @Ku  `"7`"7@Kk @( 0 @Kd p @2 " @KY   @KR    "  @KH    "  0a@K: 0@K7 0@gN"H@2 $& 8㿐@C97" "Д"X@ ' a   ' c  ' g 77bhbh<`(```` 7816"a -  X -%%=(=0=8=@=H=P%$5- %&"% -S57b<X-78 !8 `6\!87@ژ#(-7 `2Q7<`77 ! ` !@ڄ `C7<`78 !` ` !`@q `7<`77 " `Ѥ "@^ `7<`77 "@ ` "@@K `7<` 77 ! ` !@8 ` 7`!``@} `*`!`@o `-``Y`!87@_#(-7 `"788!8a` 7ݒa7גa7Ғap7̒ax7ƒa7a7a7 7"@ '`O 7< (7` < E)"@7b ? @JC!@J>!㿈7b'@M`g8a(@,В nb  ( /#7)77 5? 7`@J@`-b<``  E? 4`7bd2 8a\7`7bȀ" 7 a%%7@A`3@A`$Ā`2"ML`"M``  `` @ؖ@A"M M`gY@Ay7b%``c@H#`L``.` c8`7cH`c`@W@H h@   Ĕm` 7@ * b<  @c?"@`@  8\`K \?"Ā`` @b(>  7: ̂ 86 03 ! %"ĺ@ , `谆?"Ā`!쀠``@ ?"Ā`! &찆?"@`%@? `@   ?@􀢠2@/ "Ā`! &?"@`@ 9@?"y@`@ڰ??"q@`@ & @?f `@ ǰ?7d` d?X `@ ?7Ȃ` Ȱ?J `@ ??A"Ā`!j`@ ?  %"  `  %"  `谆?"+@`<@?  %"  `  $%" } `{"Ā`!1 u&s @G# 〦`7bĀ 7a@9'@G#0@$ @ `@L  N& @b@c  @b @b @ޒbh @ڒbP @֒b @Ғb @Βbx  '܂ '''''ܢ   @֖ & @Ԁ    @փ  :@8@ΐ @UcpX @Qb@ @Mc㷈 'a'  #0? `@J`-D  "   " ?\@' ? '  @"#8?Q$a(  @ ?E8a4a(8a, 7 b x@c9 à   8 @ޖᨀ?8 @c$ca(@V (? @?[`"a( @c@ '@sR@Fa( @ϒc @˒bp7b +8a(@* n b !7? &;8`@J`- ?`(`@@? `@   ?@֚􀢠2@? ߨ ;8a ' 'Ԃ '''''Ԥ   @Ք   #7b `2  `Ȳ -79877``'b @(`0@8`@͍ !$"Ă $"Ă $"Ă $"İ?"@`@@ 2?@ @v``2V@`l"@`Ā@2@ `@2@ "` @2@`!,`2@&` .`a@6`a(@#A@(`0a`b `Q``G@@@E ` ``@@E@> @` @>ؐ X7bĀ"j @`@E c @ 1  @ۚ #L@  @b @b@֒ @O(` @cp@F\ @Ee 0H @`0X @b@㿘 @(98o'!`;8/-8+7)7'7%7@(? ?`"(` @ %" @(?? @ sct7@( aܡ,`%7$ >& 5 "C7bB  @  8 a(a(?P8a4 3!  @ ? 3 @9cЂ %b $ $ 'a,F, %4 3, @PnL$@aI˒@aE  @  8 a(`O?@a:$g@a4 @a2 5@a-  @bthl|hT@,7b  "`!  6⨂ Q(⨘  ``O")? " 0` )  .`)  )   )? ` ``ch` `   `}a<(`0``8(`"` (`( @`2"`X"`T"`P"`L"`H"`D"`㿘  ! 162 ##@Ԍ16#Ұ#@Ԅ 㿘  `"  ``"@U@6!#@gЁp      ' 'ܤa'''''' `Z @4  `     "l +@   `` @`"`c``"|`S``t`"m`P +@ `    (@```䀠` 耠``Ȁ>7b؀@ #\ؔ! @(ƚ 2A!6!##@ݔ ;2 2+@ @ @+@ ` ```2`2` @*L 7 ` `ވ ܈ ڈ `׈ h@ӣ!  @_""㿐`" @`2` 7b  @`c& 16!@ߐ##@  "  #  ) #\6 6 6  16 `#@_!0@Ce !٘ @6  6 16 #@O!0ԗ6 !16#@F##`6 6 6  16 `#\# @7!0㿘      !" "6#!@0y㿐7b@?``#\16!# @'ޚ #bh@!#㿐'D  c7b"DD'@6!#@F @   .@@   7@`  ,@ D6x  آa@' 2) !6  !, !6!#@Ҫ@#@ _}#c@!#!7!@  ., @`  `@!0''''''' ؒ@њ  /؀`/[00n 0 " !6 @##``````/'/@]ɐ"```p a@' Єc$   @"(`@A(@ @]"㿘 `!p!@An#hj @Ah#h1@Ab!H^!@A\#hX@AV#h 1@AP!H㿘 ``!""``47b"11@A6#h `!`" 뀦`!P@A%߀````ꀎ 2 "  ``ဎ 1[@A!㿘 @A!X`b  ?9"0@@!`(`@@!"11@@! 2@@ڐ!p`8(`} @@Α!1@@ˑ!@@Ȑ!x@@Đ!h@@!`@@!@@!@@!@@!@@!@@!k@@ 㿘`% `` `&1[7b..16@@!` 1[@@x!17 "@@r?     ! bX`"`"@b8`"b(`"b`"x Z !;  c c@#\HcP#`#dXc`#h#lhc#p#t #@@7b O bF 0```J&```X (@`&`XcP#\Xc`#`#dhcp#h#lc(8#@"@?cHb#\b☚b @?ې"`7b    3  @'lb @?Ȓc `X@'x ! "܀`) l @Ё 4 `Ġ + ` ` ` @ O "܂`$"ܝP @ `a' "   ;`" #@ #@ ` `` `7b7  7 bH`s   `      `r    c < (@?)# 4`KҐ#@? a # b`2I 0 0 b0 `! `@?R L X(@`! X  @%@?#7b  b܀``@> b`) 0```<"```X (@`"`X  @Y`  0z@>ڐ## b`" 0 0 `b@? ?@&l L   @&fb0c7b@? p* 8`` 2 X @&hb `X@&c 0K@ZŐ#x  '' ''''耦 ' آ  @  "O@  @Ԛ @@7 @`2  (`0`@`2Ԑ8@̐    '' ''''ܐ   @͚ ?; @7u     @z 4  @| ?1@7Z P `0 ` U`(`8@@6`* @?`( @;cp @8  @4` @0`@@]@J  c@``" ?Ђ`@?` `7!? ((`88 c@``" ?Ђ`@?` `7"?Б* : 㿐P'P'T'X'  @  Ł`    XYc\ 㿘a0@   @a8  @a@  @j9aH@  㿘 ; @G@ʹ   c ` ' @ aP`+`% ,@2,@M` @`D",@H` ` @`D",@] ,@,@ `L` ,&㿘N?  c @`` 2# ?2  @!x   % L`` c``D"  N ``D`? ` "` `* 8`` 2@$@ (@` 㽐 a' '?C'a@J ' a @a8   @a0 `  @a@   3'  @ /a@ / J`2*@ D' 2'! ' J ` 2 2"@#''0@X  @J?`/'0@? '` H@` 2ܐ"(2'`z'@ɐ'`bX@ϐ  @ua8  ` @ja0  ``L@` "H` /(@ / "J`2*@ @ "8'L`"4',@ : 'J`@#8"'@S *{ aX'@ؐ *@r?b @, :@`  * J`@ * ' " L@ @ ' "@ ̒???HC8bF`Ā` &@!'`"b` Pb @K"'''B@"Ā  `@< '`8?@4 3'@/b '5C?&&#C@Fc`@ <' a@< '-B+C' A#C@<@? @@c$ '%C?$$#C@c`@@ŝ 'b ' a@۱< -B'+C' G#C '@<@? @9#@ٺ ?$ `"c `"`cp  #`@ #`8`@F@ @@(cp`@و Bb`;Cc `6Cc 4 C .`,`Cc`8` 4 2 @  b`CcpƐ # cp@g # b`Ccp Ccp@Z C@cp` !@8?<@_ Cb?"B`2BCc c`@ BBb`" ?Ccp@e!?b`@\  @ @!'?'!@?@0 @0ܤ @@@@ a @Sk `p a' 'D'''C@ث#(  Cc` @ ` @ǒa @Ò`x@ǟ" M@` @@ǖ"( M` `tb b cx :(`@w Cԃ(`@m 2 @ub8 @{a8  А @{a@  8 a? @{a0 ` А ?j0f  /@= :@9 @@5 6 43 / *, @ @#  @@  `@Ӑ0`N@` ԃ(`"`"  N@`[@ ]  "*J `:. *` & :@ݐ /@ِ@ `` * ``@,@  :@    `N@`ـ .CN` C@9 / 2*  Cc`  @  `''؀` 'L@`" ''  Bbp C c$ bpC c$@$CcB bp `@I 2 "p@0@ Bb `  N` @~b@  L`  @~b   N` ` ''' @nCch`L L`BҐ"a  g  @ J 0;b` `Ccp@hb` ]$@%X'܂aH' '!B"@'$"@ @ $"@Ѐ '' @uDc8`c`@쀦 `'CD@SCc` ? @2  a @Qj h㿘@ !C#p@"@q#pB @־"㿘@ !C#p@"@b#pB @֯"㿘!C#p@#H#p@T!F "E@E$  @֚ 㿘   b@֨c  Cd`  d9a; c@d`; dc@9aC&@Bb`  @!`. `B  b!E!  4@ġa @ĝ  !D!#@ėa@ē EF`0 &!<&!@BL B&!DaD"ta<a@ L&!HaHA8!"t&!LaL A"0 8&!PaPC!"0&!TaT D# &!XaXC# !##`0&!\a\!D #x @!`#xa`@ !A !@!q!aq@ CX!C&!a#x X$@!#xa@$!B$"@~%e$@z" @ 쀠` Ā 㿘 /@7I 2,Xb sb@y   /,`@5K#x !8$@J!!@"!`  .*( 1d2 .Ccp@#  ., 8``9  0@H , 8``02 ?N?`.? 1.?.??`ؒ 8a㿘@Ð  ` 㿘@ !CB#p b  b@ܐ#@/#pE @| l` "` `* 8`` 2@@ (@` 㿘@  b`Cpߐ Cp@u C@cpE,B` , E b @D 㿘@o  b`Cp Cp@U C@cp  ` E @$ 㿘@,PCc c``@i @,?"pDcBbD' a' # 'bb@Ԡ  @4h#@b? $b@bـ`$b 'В  @}   @4N# b@ a @Og x㻈 a'  $@  'D'@ϒa Ab@    -D9E'+C;F%  Ŧ "?@ 0   0 @ 0` `  @ 0` ` @@4`0 D` @Ԓ  D  c@ Bb` !!C#p@Ő @#p!D  c2`B 4D* 5)``&`Bx`!`D`" ``2    Bcpbg@b `cp`@T` ?Ѐ`  (`(`@Ђ@% `` " d` ?Ѐ` ( dd  ) B?  - - ` (" ` - 2% "쀤,@  0 :B`4   5`Bx`` `Pcp0@cp@scp` $8$E@2  "&` 1,A b8 @ӻDca! @ 6 b쀠`"?a  "?П ?` a @N xF`' a' "E@[ @ `E`,`?D c@   @sc`$  @j  b`F`P`@A2` @`  !F@2 !F  @`@  b`E`0P`@A`0 7'`  b`P@A܂ '7  @  ܀ E@2 E`,`?D c@ ܀`1 "`P`@@ܒ@@ʔ$ "$ Dcb(  @  a @Mp 㿘#F``!  $# c# `2  # #@@@j` $# `  c $c㿘 c`@u&  c㿘# c !F  cH@@]$c @B c ` $c ` 㿘# c`! #` @t c#"@$#ց@t $#㿐!F'T 'H'L'P'X9 ` '"@  ?D c  @ma  H@' @ @ A  b8@>`Ȁy`?"쀠``@ @J 㿀'!'D''H'L@# Ѐ   Cc```'BbL 5BAb4`  Dc`  5Bt@"@  耢 Ccp@T _ Cc`tCcp@F!(S ?D c@@m A!@nb@ E@  2=  @`DL'!g\!X  @ِ * @  $ H`'G!X 2 ! " `$"  @Ѻ   CHcpL$"@aH@Ѭ D  b@`Ѐ Ccd` !Acd`!A!A"8``CHg!X a0 Ccd!Aѐ`?"8`2!A`2!AHg!X " !A "8`BӐ 0>"8`C̐ Ccd`?"8`*C b`E`0P`@?`0 '7  @$ E@0 E`,`?D c@ T R Ccd`{ y E`,`?D c@ 㽰Dc a'  '`  ```@!`5EaPA b@ BbD`˔ D@c  @ =    b@0C"  ``E 0+Bb|`"`CcP``?!B"H$"Dc$"$` Ccp@!  1 C cP)  ,Dc$` Ccp@~! !  #Bb`CO! cp!Ȁ } @l`耢 2; `Dc$`   Ccp"@~ d! #\#`Xb8\`@d 2C @ [_gc(`() @@ @(%  5O-@-a Dc$` 8 CcpƐ"   # 7``#\d#`#d#h#lbX@\ N`Y`V`2TC @E [_gc(`() @(@  @-%5y #\d#`h#dl#hp#lt#px#t|#x#|########bЖX@s\ CcpX"P```" CcpJ! @[_gckows{-(`+`+ @ @@ %(**` E`X ( `* +) ,  `,` ` * 5L.P@e nDc$`'Ccp!#\c@   OOOO"Ccp# E @z`45@&i`P#Bb` @1"?$b$"BH bD@.#X+ # Pb@  `,  bE Pش D @Dc!C#`26 # b耢?" @  @ _  $b@.f" $##`2 ? c@‘  6 >#0``#E  b  ' @j  E#Pb  )' @\  E#x@.,E# Pb@( 6b   '@0 6b @.! 0@T  C@. #C`~@ʔ ـ``2- 'Bb|`"& CcP`2! ؂`@ ` #\!@^ 2 # I C cP `` @  ```  #\*#  ```````` ` ` ` ` ` ``  #h#l#p#\#`#d#t#x#|########В   C   *@ "    `! b  ' @ᡘ  6 @-r#  ! @"?$" C c y a @H 'H'Cc`''8`a?C C c cC??8bCc 'D'HAa''L@`Ѐ`?''L'P`#'XBb`C cdH``CHH@`-CHcp@{`L`CLcp@{`(Ccd` ܀`HDYL''Dc'` ܀@ 'E@b l !A& "8` ! "耢 @j?$"䀠`@s 耠`H@l HLC c A7 a@bc'a@] X'耠`H@9a hHH@`|cH@˒  QC@$_`@$Y` H@,#x@3 @0 ?D cH@.l / 2,HXbs bH@⛒   /, Cc`C@$'` CH@-! Cc`@$` 0c` H'HH`܀` BBbt` @ W 0bLBbt@"L@ N L@8 C8b E@̟ l H܀`L b" L7 8 LDg-!X [(!耢 0~#('``X.H@}a  b'A3 aHH@`| @̉ 'Hg @(0`'`CH[`! `" A acH@qP'` H#x@+#Ha' b`P`@:&@P `#>$'#>`̀@X!>@ @ $ X@+"@$`$`X<@ @C `" A aL@ E?cBbt`" ~`|  bb`" b`P`@9 b @ዔ H@+Z#xHC c LA* a@# 9C" 5 1>/>-B+C#7C'CO%CE `P`@9 Ȕ@@ ?@"` `@@$@`>#@?`C`'?#c `` `` #p0p@ #`@ 8`@ ?#@ @@0p`P`@9_ @9N̺ @   B@"'DBb`@`Cc `CCb`6`Cc 4 C .``+`Cc`8` 4 2 @  b`Ccp # cp@T # b`Ccp Ccp@G C@cp` D`  ?@y@ H??C8c " `&{DH@ h~ bb #C @r . ! @ ?  b`` 0```@!`?`@" "d? @rX  6#C@!`H@*7#xHH@f#xHC LA` @# \ Ԃ`'Zb` #$#p0#p@ #@F#p`@ 8`@ ?`# `b`cc@& c@b@bc@@ А В@!>`B fbcHȺcXa@?c8%Bb)CX `` ``#\! @ : @!`"`#p@v``@` 5``@   @Y``5``` ``#\! @  "@!@'|@6@@1?"``Ȁ 6 `[@'i!Ȅ?D@hj cn ``E`4@$`@h^'D'Ȓc@)KĀ 6 @'L Q?` '̒  @i  6@':#@̒c(!Eg$ 0`@Ɛ 03F`&` B@ Z!X 0b`CcpBb@uahې  0 "`@` "?@y? '?!c@' BbD@ c  a @B 㿘 ` "a  @u @BZ 㿘@@ Cc`!F`  b`R @59@ f !F@1 $ ! "耢  C@ [ @F"?$"C c Cc`F`  b`R @5@ @ !F@  $ C cD  c@N"㿘@F C @#(㻈 'Da' DU`x Ba @"HB  J`Ba B  bB b@B bpA aB bC c C$ c`B b|C%B#B$D$b'A cP$<@ΐ"X , L`( @ʒb`  $D@’b` $D$b@bh $<V@c` $b$D@ W"p `@b  A b<@"C  TJ`!Ab T!A"<` CcTH@`@ 1"$"<@x# " L`" @tc " @mc " @fc`? b` "0P`@4G"0@jC  cl B b b bC cpR @42@U    b7B!شc8-F/C`X;B)B+B'B @   C c "&% o EQB a 6B  A 4 < < C0: a ? Pi V%"`z0zF o s k",", m imBm b@4 ngBg bpe s t pB r\",F U vV V%" S c$P%bD CL c$J b|   @oŘ# > c",1#?C5 c ",L`%%p, @~a `?%Ā` %p $%bD",D c  @o#B bx",@ :0 'bHD@lP?Z g DctA b8C  cdD'D  cC@ c @ 2  @@3   $@ِ c@  @mbD`,`@:@  D~ @@5 a @?Ր A aK@`?`$`?aDcxAa2`@ 6 @ (H@ "(` ( J`  (?!Н(  @``$2 @Ccx 2$\2$(J"@ J0$(J@ " Iυ*  ` H`2*@  (`@I`2*>I` J > >(aЖaBψb`[`\`$2*I I  ` * I `$[ I σ(`@ Ѐ` S 02 *H`a `"mI  ( 2#@O1`$) K`Ѐ` $ 0 *H` (`@ `" ܆ ( 2#@ *` K@ @@ ` ,]Ā\*`  2 K `  K``]`\; Ccp@rw#p`,v `]". q Ѐ` $ 0 *H` (`@ `" ܆ ( 2#@* I`1 >*HaЀĂaЁI`2 J`2 I㿘`a#  DcaDBb`"`Ccp@r#`K#Ȁ  Dcb&C ch C ch㿘#Cc`2 !F ?@}? $ $c b㿘@  b`Ccp``"`@   C@ (@`"@cp@  C@"cpBF  b@m 㻐 a'  ` &````@` `?De cB`Dc`2C `c``N@` c`` `"`C  `8+@(S+@ ` +@(`8`퀠&Cb`%C && @2 Bb@`? !  b b@  CcX`"0  a @= ȁx '@a' F' `Ȅ B'' b@$$ 2 @cА @ߒc'F@¯ g`# `-C!Bcb%C`"$"`d@' bp@p d ' 0 d@\ 2N@@¦ B b a @=! Ё bb``g``h 㿘B  Bbt+`"  c  `21@ 2DHcc 8 ې H BB btB b㿘 ! C@cp@p`P c b Рb0``cp@pv@`cp@px"@ ? c CcpD`h@p`D c@{ "  ``Ccp@pM`?D c  J` 8 ~ H D @^# B bLB bt aH a 㿈''? @ի 㿐@ b`CcpP`@/cp@`h? P`2D@ c"Bb a'  @ Aaa` @Ј?b@''C cVaVJ? H?x ?x@|x ?@ `b Ц`XC  b @$cXL` #\?p@V;`p#p ʖ d@Z;h X Cc 4 V 2Z `(W VaYCb &K  b@C4D 2@ 8> @ @ b !@?hh ʒ. ʑH'@0@Z.@ d@j$ <@f <@0@  b`CpP`@.p@3@̐  a @;j ؁p a' ?!A @!! !b @ a؂a `@8aА@ Cc `Cb bCc@C  d5`-`- @ 3`+ +`@@C3`+ +`@@ @̐C8 8` @d dBb8`?` B@ B@ja cBb`' c`$@  b   $ !b  b #\#`"(@d `"@[@ DcĤ @@@䦒 d@""@b $#\H@>!Xab 4 < @```,@ca(H@` ` `"` #\""@@@aa`"Жb@@@aЀ aЀ2A`@A@ aa `@ 8aA @ !  Aaa`"<'Іb@'' V a  ʙH9?L.'@ @" @ @ .@" @ @.@/@ <@"$@ <@/s}Cc 4 V 2`(Va;Cb4 @ @""@ $ @""@ @bJ b @K` !@E?؁ ʒ. ʑH'@㠐 @" @ @= .@x" @ @2.@/@j <@"$@{ <@.0@ b`CcpP`@,cp@J@  @c 'C%C  b`Ccp``"`@   ! @ (@`"@cp@ ! # C@$#C@ncp a @9R 㿐! # @$# `w@  ?#@`?㿘@ Cc  Ò @"㷐 a' $@@s@wsb % @ 2 O @ސ#@ `/2 @@`  Hw/`?`? a @8 hBb` Ȓ  0@@, @< Ȁ` @@֐#h@= @h@ $@ @ޒ @0 㻐Bb a' Bb`2@: a  @y&b`2@`"   "  `2y@ߐ#ؠ yL`yc@5H `/@ @lW ?@{#x $@D@H`/ /`($"@6c@( @)#xl @B` B ` g`bcfbCcd`?g ﯚ   Dc8`c`E`&`BCcdސ`?B bB b@c c(&@`2 Ccp@k# c&!@$@`!耢 2!@y4~&@_a, a @7ڐ!  a a' `ZCc$`U !!@ox !@k@p  !@@ `!@]x! @1`@U  p@s@ " p p@k>@k9 P@`7  @_$*?O`@7`` `0 %Cb0a``@`X`p```H `x U `x'CF  @:   2`@`- 2 `C "  @4$ ` ΐCcd` ?C c  a @7 !㿘Cc`ACcpBb@j`?D cb<DBbc 4`CcT "J` @9``h Ab<`C`Ő Bb` CCcpCcT@jraC  cB"P@a(B bA"@a8C cB"@bC c\D#@}b` C cD#@taHBbpB btB bL`  B?b bz!@ $E "3E @tɐ`Ġ 2 L?`Ē @t²  CL?`.D? ,CcpEaH@jĀ 2,E ah@^  Ccd` D cA b4 "%BCcpD`h@iBcd`AD c b4 BE a@] BCcp@i!B b㿐B?b b! `E @td  @eޔ H@ c@``"?B" ?!C#pE@i #p@  ??B b HDBc? ِ!耢 b c`E` L``" LL``2  @]|a Ccp@ix! , 2,  0, #\#`#E`@b8  ,@R'''''x'Ȃ?@E'Ԁ? `" Ccp`@i6bXB ` ?!C#pE@i5 #p@ B? bD c@ @`&  `  " 8  (@@ " `` 2  ` ``  (?`   ` ``  (   - " _(H@@* 㿘 %@d f @ @`  㿘 $ " (@P ( @J  0``@D 4a @? p a' #@s;`耢 a  @ ?@ В  $@z` @0 @a?@Q`2@!@!( @ '@!@0 @ma?2@!(  aP@?`` `` @d  @q!x@@ ` @S   @`! a @4f"x㿐@? "X @H!X@Џ"?@?!``@.!! #@ #@ #@ #@ݣ@ݡa ' ?7@݊? @`@ `@  㿘  F@`! # 7`@!F `cH``"`@"`@k@$ '$`\2 . \.@?.  ? `@*@ F.`@"b㿘N b(  .1' ,L`.`.` ??*㘄 `  㘄 ` _ - _  @\  Ѐ .  㿐  N.Ђ`` ( 2NN` " @Yp   㿘.` 4 0  @ސ 0 4C`(n`("`1`h``  ` `P`8Z 0`2V 0V ` `6P `)`02J 0$f`1`=`-`/`,1`*/ 0[: 0* `M`764 `5 `36/ 0 K`I`B2<1   .``@ 07`@@Ő" "& 0r 2  .` @"p" 2 @".`@`4@3 `0 #`2#@## 㿘c`# ؀`     c@2 ?! @#(! #?@a #@^ #@[ @#?$#㿘@X`   @ZM` 2L`=  @ې##@`2@3 ! @f  f #0@\ f` ` f` f `#` @f@@ @$` f@` c@7#XL`$ ``@+@ ` f@@@@5`@@㿈@Z ` `b ` f'@'  #@ʲ  #@ '@ɐ@#㿀`('' '@'`$  @' @' @hD@' '@`0@`'@Y  `@e @I@E(0@A `(@=@9 `$@5 @1 @,, `0@&@ `4`0@"``@㿈 @=' @('@  @4' @@`@Ȓ㿈@YO  ` '  @' @1 @ ''@ 쀢`@<#` @6  @o  a'  P`@Ԓ@`0`8`8J`(`<@Ő`8' @8 @̐#@@4̀`"0`( @@`@ba`2!`( @ @H#@@@H`"`( @@c`P@`(9b`$p2`hl- E0?- @h`" *>4` `: - @3`` @G4@0e( 4@`@50@`@@- -@` 4 `" !W "    @ΐ !``x`  `/Hh`H }@˔` a @0C"㿐#`  d f` &`` &@ $&` f`` @ ` f@_t $` f@`` @  ` !f# ` b qa `X@ϒa?@ b ``(@Vb Yap ,`%f`@ܐ!@c!0 ,@c!@`@caP  @r@Mah@c| (@cua $\@cnaX0"4, @  @-@c[@@      #\ !f#` l#d @cDa@@       #\  #`l#d @c1a@?      #\  #`l#d @cb @c&"@ @xx` )fah!f `2 @C! @xb @Z`  ` @ @  @ݐ@Ғ 2?   ` @ !f1@x7  b` P`@"g 1f@#  @_ b` P`@"T @㿘@/(0  @Ð"H (0@  `" @@ 0$ $ 2F"p!  $`HaЀ$`a@`2!aHd`"a@ A $`$)"  @@``d`$(`@`$ 2 a`$@{"@ `$$`$aЀ`!a@` H``@ΐ  $`("@a   @3``((`㷐  /(@6#`   8@0% !`! '''m '''m''@A?` a$` @O#   e a+!,   (8 @(9 `(: (`; ( < 0`@ 0`B `D `H `L `P ` T@Ғ`㷐  /(@ؐ!   8@Ҕ%` ' ''' `!!'' ``2 "%% @   ''` l  `2 `"`! #@ `h@? ` a$`"@ː#0  e a+ !,   (8 @(9 `(: (`; ( < 0`@ 0`B  `8" D  @Q D `H `L `P` ` T@A`㷐  /(@G!   8@A%`' ''  '  %@   '' e` l  `2 `"`! #@ `h@6? ` a$`1@C#`1  e a+!,   #(8` @(9` `(: (`;@ $ < 0`@ 0`B `D `H `L `P` ` T@ƒ`㿐#`c`'@ǭ` @#`'@  㿀! @@# `j# `Je` `9 `@@i@#]#` @#s !` `  ` @#`@h"@` @`@ `0 @] @@ 0C ` # @` `"` @ @ @@ "#` @`'@* 8 p`   `bc@ `㿐!`  0c"@ @$ 4^`"@ ! 4@ 2  4@m*`$ 41# `)4"@ @`2 @Z@4 @8`$4` " 0c 4@@? `! 4?c@  0`@?0@% #@c0,``'@ƭ ``4 @ x`'@   3`4cb@ 㿘! _@  `<c `(  @    c `0 `4sx`  a'  c 0#@2`b @ ! 0" 4`@$ 48 ! @̐ M    ``b ! 4@$` 2  4@㴓*`$ 4%` `4b @ 2 @ 44`@8`$ 4 ``c4@  @ 4 @" ` ` ` ?` c@$?'`  C7 / /`"'`'` `2?,c?0@0@`'@А @Ґ 'ܐ@  ` `4c`@ 2 a @+"㿘#` @` < (` a   a @ `  ` c@ c `0 `4   㿘`  `" ``` 1@~ ! @ @   ف㿘@#` `" `, $ ǁ@B$ (` @`   c@Z ` c 0` `4́㿀` ` `aaa` @` #```  #` `#` @ ` `  `  `` @`@``  @@`@` @c"@!`  @e 㿘@h `  `*L `!  `   >a$@` % ` ` b  ` c@!  `  c    k    @c     `0  `4 < (haa`a@aP` ``l` @`21@!``(`` `H`2  @~  N 2  @lŐ 21@_!x``,@&`,#`` b 0` @O% @J@? "&@` `&@`  `` `2@ @2 @c432@c 㿀` `` ``` @n !1@!x @y ` `!̀ *@`$ `$  `` c  ``;  <  `"`" @B"$ 0@8`$ ` `"`" @3"  $ 080`8@8`$  `c@  `@ c  `@  `@ c  ` @  ` @c K㿘 ` "@\a@)B 㿈 ` @ה @ː  a) !' % #", q c d $c u $  $%#@? l ct&`   \@! $ @!Ȑ @&  ` @!ؐ @b,  `@!,` @  cc a@E?@l" c@8#@PX#  c@ ,c ,  C34 `?$ @u `@$X` @  2$`?@ ``@[0@p .@qU`@@ ""8@ `1 b(3"b '`@n  $ T` "Hb@[!  @6  ? c @"X@Ґ"p @"x@2쀢?@"! @d#" `@ ?#@ߐ"@a#g@R`f  `#@ѐ"! @D  @礔 ?$#@Ð"#< ' @̘ ?@"@@#?2X@# X@"?2 @! @»?2 @#( @ ?2@#8@!?~@#(@! [`@r! `T``  `0@  a'  @O[' 㬔(@? @`  ` "c`` 2 r`2 ``P ِ@  @ cH' ' @̒p  @ƒcĐ@ ) @  @  @@   `  @  @@ n  2V``Pb @ [ ``U` 5cXP %`PI `'cx``  `T9 @`$`T`T`"1 `  `+ `( ``P2! c" p=@# p @>@ @ϐ@  a @&"0DXl HHHHHHHH8HHL(T 0HHHHH\|H|@H|㿀 a' `'b(@  #@\  @ @ǐ  $@  ," ;   (@ U@ a @& "ȁ㿐 `@ !$ !!?* @ , @@M ! !, @2,  X2  x@ @  ,"ϐ ; (@ @ 㿐@ T>`$! @ s > `@+ @@# @ 8` :2"@ Y :02@ P@J  А@) @ â @_x a' @ 2! !" !"?! `,@c  2,L!H`  ܤشͪπ`X"%`l`IC`L`B2uP`S2aJ`l `s`bg`f2pS`t2$^"@ ؒ!#!`@͐ d a!x@ I0@ @Ӓ $( !@ 3@ϐ?@m`@ !!@ !6 ;ܔ @ ޔ @ !ܔ @Ԗ Д @ !ܐ @Ɩ &@ v! !!? !@ `;"O?0@La   @La  /ؒ @La耢 "/ؐ@La /ؐ!@ I"0`M@`3`A@ 5M@`A ; ,' ;z"8,@@ $ @ T"P @&@? a @$R"㿐@ >`8N(`t@`,@H&`,@ !<"x``@b "8@ h"0/`@ -@@'&`(@"&`$@&`@&` @ &``0"@ 9@Ր@  ;@ / (@ːh @  {@ !"@@ (0 2@ Ȑ# @(0 ,.` (@& ,@ _ ? }1@ #r@ w ```  `  @L @H@ = "`$@` `  `   `3` & ` @ !c @ Ȕ @  @@  ` @m ` @ @` ` @㿘 @ >`%8(`@`ϓl! ː? * @ h! ? *  ! ? *   ! ? *   `@с`!!" @ $@! # @! @`3b `3b@@`3b`3b`3b`3b`3b`@b $@ @ #8@  @  ;@ "8@ 㿐@ w!"x`@a   @ h { "@ @ @ 4? }@ ِ#P8@ K㿘! @ j##@Mc( @ < ?! "@ ?#x@ T0 @c㿘! @ J#  b  b <  b  b  b!,  b   b   b$   b c  ba (  @c( @@ (@  @ @@ (@  (@   @ @@(@  @ @@ (@  @ @@ (@ @M# @ ?"@ @cI`D`? f a` ` `` ` `p a'   @ᯔ ?@ ΐ#Ԕ  @ @0 @a?2@1 a @!"H a'   @ၔ ?@ #ؠԔ  @Z @0@ka?@ #`A`A'%`H` ( @; @e0 @La6?2  H``@ڰ  @ְ  a @!e#p a'   @& ?@ E#آԔ  @ @)0@a?`A`A7 @a?@ʚ?  @ʖ  @ʒ  a @!!# @ a' Ґ@ ?&#@`@T @ϐ `L` L`E   `H` L`$ ``@ 0  '  '@@z a @ Ր#8㿐@N "@ X'3`p`2/@`@_  2(@` `  4 P ((@   @H `D`2@@͐! 2`@`@u  `D@`2```D``@y#h@@`@N^㿈``` `+`#1'f`; c```@X` T`"$ Xu `@J``?@H9c $@$`4(( @@(````(`@'`c`(' '77@Ʉ ?@`#`@``@ ```T` (`"$```2$$㿀 #`<@8(@(4 q` `<`  @ @< `84^ < @u  <@ @N <`H < < `<@`4  < @ < #'`<@`4    `<( `<`< `< @% ' <`@ #` `e`#\`8@ڐ` ''8'`'耠# ``,@ٔ   @` '''Ȃ '0@扔 ? @! a @(#@㿐#` '`(  `, @ ?@!  @ ?`@!0`X  @!?`@!P` `0` a'  apa 2@a @  !@s`"`@ɐ`  `D@bl    `@! a @#P㿀 ! '$`( `(bq@z @!`2`#@!#``(! @a"p `@" `"y`(@V `@w"P``(bf@J쀢 `@k"` 8`@ 8$ 4`4``8@["` D `<` `@ `4`' c' `D(! @!"g  @B" ` `8 <'c'c! <`"w`(@ `@)"``(bv@ @# 㿘`  !$!8@Ӑc0@ !`;  a,!*4!( @2,!* `"%5! @֐`* !7& `` -- @ @$@@``ئ!7 ?- ΰ?㿘`@cec`a@:(`@@ (@#8 `@@#x @{#``H@`t( @#@ `(`2 @` @`@/$&. `@ђ@ 2@q@`@@&@.$`@@@  h` :@#`  @r T  (@!$ @qc0 # !(h$Ѐ ``"@`  W  @` dK @` @`` `8`a@`~`, 8`(`saP` @@w@@  @@f@ 0b  `b(`@@t  @p@e " @f@A @[@   `, `(Ȕ @KĀ  `@  " @ (bp`X` `<`(@"  h 'Ta' . @g `. `@?`, ?a   x; 2 ,. @ r`X*`X`f`I"a `L`A#`BVXL`SPRJ`f `s`bE`eEH =`t5`l=?c `,5 . `@@ f``  H`& x t?,,  :-,- ? @  L`  . `@@!((6& . &@!P @ŕ@ . &@{!hf fa}b[@b( -7 8`9 `b `b`s`Ie`L`B*`@n`S*`0~x`s`t`f`l*`0\`x2*`@T`9@ ".4  `#H``"`@" `@֔@& '$`\2 . \.@.   `@*@T"e. ". _.@4'@Ő̔@} u&Q`@@"@6f?b&>`@* :@* 2@6Q?M&)`N@@t6C?~9&`@`aa@|*&`:`@!@&   : . &'L`@. $ @& fa@{"b a @#``X@㿘 b` `& @\a @`"@\6Ѐ`2 Ѐ 2?ah  0! <`   a(ah !P `0(`0(@!!㿘)'1 !? #?# `2! # "?ꀢ "!0+ `@ `, a?`@m! \,   " , %0a(@ ԁ! -Ѐ` -6 (aئa1 `@  `, ]` x" ? ?#``D2 ,@ % a, %%@!a(@ ԁ!UR #`K(aبa `@!  `,? - _?㘂``@ % a?" ! 㘂``D2,! , %%@Ԑ!a(@ Ԓcx " @&!쀢   `@ `,(( aԁe?%@!W㿘'̀`%#@`,!3$!&a@!Ȁ$`< `4`,a$@$`,&a$!Ȁ a&á㿘!̀ a`@@`0 `4a#`@#! `,`0 `4 a&㿘  Q#a@ʐ  Q!!h@Đ !@%  a a a a a a a `, `@ `0 `< `4 `8 `D㿘@["a耠`%`N`m@LƐ@U? :&@`(. N`.`#'T'X$c'H'L'P`8`@c!$#@&HH#'$@K(c ![c@孒!;`4!@娐 9 ,P  cX@垖 ^ c`% c@B'`4 ''Ԑ'!!@8' ,'''`P  ' `'c` ' ' @Ą  `D 㿐!#$'H'L'P'Tl'XH#'!$@JՐ# [#@Za c` @##@٘  a@ٓ  㿐!#$'H'L'P'TB'XH#'!$@J# [#@0a c` @Ր##@n  a@i  㿐!'X#$'H'L'P'TH#'!$@J# [#@a; c`" @##@D  a@? c` @`"@6 㿀@ a' @@ `  '?@ ( `  '@_  a @ 㿀@ a' @@ `  '?0 ( `  '@1  a @ 㿈 `'# ch'@ 쒒 ##cx @yI1#㿘@  @l``?? c  "*   @(`@?c8"?c(@㿈 @א@Ӕ  . . 㿈 `  @  @˔ ` ```@ @ @ @(7@ @`&@㿘#c`(`$c ?c@" 7耤 `e&@ _|#&R$c쀦& ! #c```$c7؀ `@&ؐ@ :W#$c-&`` X6`T P#c䀤 `$c?c(@!#`$#@e +#$#$c?@6?x<(@\(@@'܂ //݂7ނ ܒ  /''777@!?#, 7@@ `&@(`7 D7772 @,7@ @`&@3f f g** #3f f g** #㿐 '@Œ㿐 '@  +g+fSf#  +g+ff#㿐 @㿐 @㿘N@`-   L@`02 L``x`` д  ` 8  L@```@ ɀ`/!x` ! @L@`߶ (@  (@  # Ҁa b !a b  !a b " M`" ` " `21 .=K `  `2 1..6`6D)"P㿐` "F"p  ! 2! `@ 䀤   p"  `   .ȁc 㿘  } {  ?  ;  2    ?㿐!f"@:!\"@:'l8 /N"!F#@: /;#0!3#`@:v!(#@:k :#c!#@:zX : #P!   ;A0 @:a? ; "8Y    (` ``?,`,`(?`29 0`@8` (( @?(( @@(`(`  㿘 ! !% !    .` .@ .@ .`p 80`  :ʘ     ;^ (㿘 Ѡ ; O"8 㿐’! @ `ܐ  ސ㿐! * Ű @C1 ΐ Ð @. 㿘`@  8@ @ ` ``?@N`@H`#?1 㿘   @ @      @@:|!@`#" @`" k!0@~@~΁0㿘  @(W!@ @@ @& 㿘 @  C!P@} $@~9!P$ @ a' i `3`쀢` ` 8!`V  @ !`` `@a  !H:ː@~` Ē @(0h;!`(0$  @@ ؐ!`` `@+  2ː!H @@ !`` `@   2!Hߔ @ !`` `@  !HÒa`aH @x $@$@ 2f @` $@]@`@Đ'#'@}@}@}`" @}  "* `5!`! ' '' 2&!P   ! a @ ؁@$@3L1\1\1\1\1\1\1\3D1\381\33㿘`H 耠`~b  "@Ea@L ` ` ' J+`-%`Hb?9U @PD   %`H̠aȢ,    -@? ?` m(`@?? ct@D  '")@"  @v ? @  @ # @b(?_?@P?Y F!@&"0?@?"0@ ?@1  @.@+  Ȑ @\̔` '@ b(gU!`a@@ޘ @? @ `H` } { y@- `H`?`2 ?0```2?o?Ĕ '@ݐ ?@ ?M@ߐ R@ڐ ? @ ?  @͐?@ ?2 @`2 0@"h@8 @֐ ?b" @^ 0B@R @į I`H`  @ߔ "`2 @a3@x`@"PӒ @0 "U@Ő  @ܒb@3W@!  @v? @s? @p?I @Ēa@"H."0@"@0$@Ȇ@t a@ϐU @`@D [a@  @ķb@@㿘 # + @X @ڐ   a' ؆ ) 0'%#taP%آ@׺?#t oD,@׮? o#t&(` '@ 3쀊, '?W'"@ #@ c - c ` @@D`8@ @'@s  V @<b㿐Vc`A@В "L`"`n"@L  @NQ = ",@``LV`"HV@7 2  @ @ @QV; `"&@`&@ "' (&`o2°   @T" @<@ c&@c@  @&@2`"2&@W`@ cVcVc@ 㿐@>Ӑ'  c`@zː @Ñ @s@ $`(@ $(@ (`4㿘`t @P @ǐ!@㿘1 t @P   @KO!?@ `& t@! `p `x `| 㿘`X  2   `X?@n x㿘 a!   a!@p`@dא!? @Qn` `t   0  @K !?@L @V 㿘  "0@a  `X X ` (@`a2(@㿘 a( aPaĂ8`  !,&& `\#a(#!,4 9   !,4 #a(`X #!,& a, a(  aP1 !\``@A !\` @  a,㿘!"t&" `& "t` $"t㿘 @ @Ju {@!X0:N` 2 &c, ) p`#`t @;5  @JW  @J`t% p8`x`t @U @"!?? @J>8`x @ @y| x<$ x<`@ @ < x 㿘`X|   p x @ x`@" `t9 x@9j 6 @J  T ' 0 ?# aP`$aP"% 4@@} aP@I{@4!XaP`A$aP! !\``@ !\`"4 @  $0$4`$aP! !\``@s !\`@ ! `t!4 @  @I !@ `x!4 : @ 8`x. 㿘73(@ 'a4  &ᄀ4 &ᄀ aᐴ aa ! @ (`  `#!㿘! !P#`$!P aa a a@x a!P$a`$!P! !\``@ !\`@e 㿘'a`@ :# aP%`b$aP@|ۓ,  aP@I0{@s!XaP`.$aP! !\``@ǐ !\`# @7?$ጂ$`$aP! !\``@ !\`@"  a!(` `!! ?㿐'H  a@K;a a@r ?@v9 b0)5 a; ' % / -'"t  "%@HH  ?`` 5` @8@  '!H`  &? !  !@J 0t!@Ja8   Q<!@@k?@ ea8`<P`$P"<@@|! P@Hv{@!XP`H$P! !\``@  !\`">?@} :?'a8$<`$P\``@ \`"@i <@Ք<%@  &@   "t@ &H@` U?㿘#aH@  ?@]!X@h 3aH@$a!!$+!)  !`` {    @`?@2@  @aЀ ?` "` `* 8`` 2@R@ (@` 㿘 n @!xi  bx`@$@?Y y`PN0R`L0N` \Đ \N@ N``@IА  `"2M4M` 2  02 @ 0`  8:  0 8: @ސ 0`  0` @А 0` @Ȓ   baa% + a b` bb  b@֪  ``^(8` \`㿘-   + 0;)9' / b``$@Lː 0@`%0@LRaȄ <!P`$P"!@@z P@F{@6!XP`q$P! !\``@ !\`"d?@ ?'aȂ%!`$P\``@v \`!@ !,`(@  '!`  x!` x(9!b` 0``@@ `bV@F x@!b` 0 0 @5ِ0 a?` 4 @5̐j a(@a a?㿘a (`8`` "  @@P ?%a) %!@-% P"`$P"' D@@y 2 P@FH{@!XP$P%!@$D`$P# a\``@ڐ a\`@J % aD@}D? @`(?;1 ) -  aH` !@@R!  ,aD!P`%!P"aD@@y 2 !P@E{@9!X!PI%!P&!@%aD`%!P\``@ \`aD@ aDa@@}eaD @@  aD @`() !@@ # aP`$aP"' D@@yY aP@E{@!XaP$aP`F ! !\``@D !\`"; @  %!@$D`$aP! !\``@/ !\` @  aD.% 㿘@Ԍ` 6 @Eo ?@!2N@ 㿘'| %#0  Ē@  `` a`2  *  ʐ &?`@?㿘N`! g@?` @!@4 2@E!!ؒ (?N`!@Ӑ2 @JC2  "  @E!@J?aX`jcb  @<" &`㿘+ / # '- .; #aP"`$aP"ᔠ@@x} eaP%ᜂ$ᔀ`$aP\``@n \`@ސ ᔅ,@( 'ab` `% @Jf @`%@J; b` ` @ b` `@@  +a ? # aP`$aP"'ᔠ@@x aP@Do{@!XaP`\$aP! !\``@ !\`?@v %a$ᔀ`$aP! !\``@ !\` @a   a(@" b` 0``@䖐@ ` @D, ?@n" a (   aa(@a`a` ??㿘%aĶ bt  ! ;:/ a`t$!P  $"t @h !P!P`m$!P! !\``@| !\`?@ !P`$!P\``@i \`"@ِ ̐ !P`D@`?     a`"(a` a"@ @;?ba  a` `? `  a a aH a a?`?㿘N`!!Ғ#(@z  @\@2P#( 2@C\"XO &?N`!@2 @H2  "  @CD"p@?aX`jcb  @:ѐ"bt @aԈ a؀@   $ aԝ㿘 N`\`? 㿐@ㇰ? \ (@( \ `h@ ( bt򀠠 bx@j"㿘 ad` @ \? (@) \"@@$?㿘@Q aP`  \? (@@ \ݐ@@"!' ?c"㿘 aT`N`!@D`  @Dޒ /  " 㿘  c`@``?ΐ"(`a`2 Ԃ`  㿘a` a aaaЀaĀ ? x㾐 a'  ad`   \#aĄ? (@)$ \!g"   bl`J@`/ @g   @:b aĐ  @ 㿘@ aP`  \? (@@ \@"㿘' |`9 # aP% `b$aP@u aP@A{8!XaP`;$aP! !\`` !\`"1  - $|$` $aP! !\``w !\`    N`\b ((`   2N( 㿘@vǐ  2  @A{!X  9 ! 㿘? c @``" . a؄|O?ΐ"㿘 ?Đ xaĐ`4 #F `$bt  @@ ?㿘% P `$P@Ք 'P`C$P! !\`` !\`8Y ?Đ`4 R?Oa`$`$P @@$ bt $P a! !\`` !\` ' ? 㿘aaĠ4 a `? P` PaQ @b  aĔ 4  @W  P`[ P! !\``j !\`Pڐ ?ؐa ѐΐʐǐ@$@ `$ @$$a aЂ` @ bta` @ aP  aP a! !\``  !\`  ? 㿘!!!a bt @@6 $@ `  # -/G+ `$aP aP t&  @” aP`4$aP! !\``א !\`) G?aP %᠀`$aPa\`` a\`"2 aPt *  ?㿘aĐ`4  ;% ) >/ Ȑ `P @-"P`$P b&""@@s 2 P@?{!XPo$P'`P%"`$P\``j \`"ڐ " @wF Ä) P-# aP`$aP"% @@sH 2 aP@?{!XaP5$aP% P$`$aP! !\``/ !\`!  ! " ,(`! ="! !P?`#$!P$bt bt @ !P!P$!P`&! !\`` !\`p ? $!P` ! !\`` !\` Z ? 㿘 bt;/'% -) a` q ᤂH`   b` 0 0 @.R0` N`" (`8`` $ᴠ   PN`.PN ` DP`$Ps `btbt$` @f  P`( P! !\``y !\` ?P %`$P!\``b !\`"aҐ a? 㿐 aT'`"-  a % `' 1 !P`&!P"# b@@r1 D!P$$b`&!P! !\``  !\`   b7  ! (+;9/ # - h;`%∄#aaP`$aP""@@q aP%∂%"`$aP\`` \`aY a"@)a(`8``\%a)%aʠ,∠#aaP"`$aP""@@q zaP%∂%"`$aP\`` \`"a a"@`(a`H``!=!@∄#aaP`$aP""@@q DaP%∂%"`$aP\``y \`a a"`)?a!̂@  YaNh`"?0@vU∄B'aP`$aP""@@qF aP@={ސ!XaP$aP`~! !\``2 !\`t ?%∂%"`$aP\`` \`"  " (@'a%aaH` `!)"p/ 1 !P`&!P"#a@@p 2 !P@=D{!X!P&!P%"p$a`&!P! !\``֐ !\` F  !b!@t! a(L`!`%`?`??㿐H@` : c`aH@` ` 2#a""~  t J`! = ja'@ a`% " 0X% `; ! !P# b`b$!P@pm !P@<{!X!P`=$!P! !\``Y !\`"Ұ ɐ  $$b`$!P! !\``D !\`"   b'*'#aaH@ `@*Ұ  b 㿘 5bt%)`" ?İ   ,Ā bt9 !`` ܖ   @  btـ`?#?㿘bt c`aL #ca )+'; 9 `󀠠 2#a aH .j . 9 '"` , $"`` %  0 ,# +# ? 0?`0US ^ ;2m`#$aaJ  ` 2$a) 8`Ѐ` + @,̔ ! - ^ 8` ` - ^ ?Q@, (I# `D$a+ 8``.2!bt`:@  /%`? 6aHz v$a'$aH$a m ?`ᬄ`$a$ᬃ+ 8``; bt!Z'aЀ ?aĀ@  x??㿘bt a1 aР a!!Є$$a$!H@,`;2 ;&!$t a`4 ` aЀ@?a a?`  ?㿘  !J@` ? @c`` 2!!#`$a,8``ia`i:`r`W"fH!`e`H"F`Q`E" `G`!`=X` 2`V`P`e `g`c"i4`a5 `gYa-`r`v`m" `p`k"sbt`p4`nV`v `x`tr!`x& H`z H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 F aa`@<abt f  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aa`@ aaЀ &J?bt  btÒ (  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aa`@ aaЀ at`@` ta` aX`?a`HY c@``S ˈ  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 x aaY  &?@ ?Q &? 6L?`" L`! !h@_a L` HahahT &?@  a ? c c`H c@``[ \ J `!#H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aJ`"   @_!h .!h0a`K#a  /? G g`?`?  V`?'  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  a ` B a`|  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 2 aa`S  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 [ a L  @` L Hbb "@0&aaЀ`}  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aa`@ a?ے  @  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aa`@ aaЀ r a ``$a  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  a aГ, T:`@ btn ӆ  H@npl2 `` ᴔ ᴂ` ᴀ a(8  aaabt? ?'#JaЀ a`"aЀ aĀ@&$ᨀ$a#ذ  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 4 aa`@ g bt S  H@npl2 `` ᴔ ᴂ` ᴀ a(8  aaabt #  H@npl2 `` ᴔ ᴂ` ᴀ a(8  aaaa ` H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  abh`  b, bh bha `bH@npl2 ` ᴀ a(8 v aa` aX` q??J` c `@``a`a a   H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 . aa` @  HahahL`!@\$ L` Hahaha &R?PaĀL  a c!' % !J`g"  `p` ".`(`Ѐ` $` `r`  `$! `$!`$!@'  U# ,$$☂$`" `` !H@` 2! b`# ` baH` " ! H` 2! !X)?!P``$!P b`"! @* 2! !P`$!P! !\``l !\`"ʰ?ܐ 0"  @@d"  $" bp P` P! !\``J !\`` `   "@b a` `  ` `  `  !H`n`p`l2`✄`!!`!! ✄`!!`!bt G  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aa` @ b b @b{ bt $?)!!!Ѐ a`2!*#aĀ@6$!  x%!  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  aa`@ij, a`f  H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8 n a@e ?`q`Q ? aaH@  c@``#hw xa` aĀ` a aa  &{? H@npl2 ``  ᴰ  ᴂ`  ᴀ a(8  a HahahL`!@Z L`  HahahV"ȃ,8``Wfbg`aa aĀ `% aX`!,`8``q?a` H@npl2 ` ᴀ a a(8  bt ` au  a ς`` @$Ҕ c! # $"t0$"t  H@npl2 `` ᴔ ᴂ` ᴀ a(8 q aa at@@t@  !H@npl2`` "! "!` "!!a(8 @ aa`aaj@D#a`#P U  !H@npl2`` "! "!` "!!a(8  aZ#8 a@A a@h  aX`6 @5bt ` a  '?aД  ?/ ( ?('D'H@kL 8H bl@k   H@H`r`? aT`X# `@' %بb!  x p ,$h $aX@*0 H @ bl@*s"@ DH@?〢 sH#t(@'HD @'DD`" H@H@`- D `$aX$#tH`'HD'D @B3  &a`@i <@@   @    &a`@2" @A "א @{`ؐ @{`X @{  @{a@{"@    `@*bﳐ hJ k  dD`'H@H@`!H@ H @  a``'H@H@`!"$ H @ @X !h D`   x@)ޒbH@H@` q" a`` 漐  b b`x?b ?P`` 9 aL` ;a@)9;/- +)"h @)@> ?2a᠀`+X`(@)0  a``  aL`bx@)xp  b` 4 @!? a_ 0H` !  b` ?4 @ ?L%a   `"h"t "h + +  a@)8ѐ   a``  aL`bx@)0 aL`a@) @) a``R` aL`bx@( C`J`^b?J`]$  2 J . :=2 H` `(8``   J`] ( J`]` ހ`[`]@? 㿘a`\ NÐ 2  ؀` 2 R 0]N@` 怠`[1 a#в&`?! # aP`$aP"5 Ԡ@@d aP@0{-!XaP`4$aP! !\`` !\`"*   &#Ђ&Ԁ`$aP! !\``l !\`! ܐ ! ##a@hG#.a`$a 5  㿘H  1!X  H` @ 1 #؀`2#ؐ!#؁j  c؀   bp`@1 #@e    c@0v{!X 01 #  bp@1 "##ؖ!' @@_#&#ذ 㿘b/+# - `&<`\@` ∂&@"aP`$aP"b@@c aP%∂%b` $aP\``ѐ \`  @= b (  @~ J∨ M`0F `9DЀ@@(`@@` &@"aP`$aP"b@@c 8aP%∂%b` $aP\``퇐 \`  @ b (  @4  $,baP`$aP"b@@ca 2 aP@/{!XaP>$aP%∂%b`$aP\``I \`b칐 b ( "ℂ%@&BM% ?! !P`$!P"#b@@c$ !P@/y{켐!X!P$!P`(! !\`` !\` 쀰?$$b`$!P! !\`` !\`k b(@?㽰'L'P ,#a`"`` 㼖 `' @՘ L   9/) ; `PA$"@@"!Pb`%!P"†@@b A!P'"% `%!Pa\``점 a\` `$ o —@@fr  ɴA "@@$,!Pb`%!P"†@@bq 2 !P@.{ !X!P[%!P'"% `%!Pa\``Y a\`ɐ `‐ ( —@@f* L``   @2  iP'∂ @@ @`7 P`&P"#b@@b P@.l{믐!XP&P`2P?! !\`` !\`"E?r ?$∂$b`&P! !\`` !\``] ` $ L`y!(?a`! ⬖ !"@@e" @(@@(`  ?㿘bt'D bt  79) W; "t $"tD f`"I`"t엒 ^!P"`%!P j `tt$` @]  P`B P! !\``p !\`"8? ?!P`%!Pa\``[ a\`tː t` @@ %t``#?`   6 ?㿘 !!!H`%x+`H8`r1"`!!꽐#" $#aP`$aP"⌰@@a  }aP%|$⌀`$aP\`` \`l (@$) 8``   H`) $C?) 8``\:⌆($(`8`` / Ḁ`,0 ` 5 @c b !H` b  +` 8`% /b0# '- 79; H@@|'| $?# aP`$aP"%@@` aP@,{(!XaP`,$aP! !\``| !\`^  $|$`$aP# a\``g a\`א  b(⌁ 㿘&@&#aH@ a b? "aH@  $a`$aa ς``(@| c( &@?Ő# &@ 8``g  $a $㿘' ) #(( @@@  @2@@[@$bta $ c c㿘 c쀠bta c! ?{!H#耠`  aI  #P `Q P+`+` @````"<+`49#@ @#``*@ @#@`"@ @#@` `#@` @#@` #`` @#`` `#+`+` ` `# c. . ) @#@@@@cNc# (( @ @@ ` `c 0@8`? (( @a` 6 aP # aP bt!# a! !\``/ !\` 蟰  㿘! % ## @  c`d*`$#*`@_ @ $$c(( @"c(`(`$|$ c(`(`$s$ c`$(`(` @@@+I {茐!X@Zc$c$#@˞@HÄÄÄ8ÄÄÄ(ÄÄÄÄÄÄÄÄÄÄÄÄÄÄÄÄÄÄÄÄ ÄÄÄÄÄÄÄÄÄ`<  "  @`<`` ` ?``?㿘 /@ՙ J ` (J0 J`/? `/ ?(J (@ P/ ` b @ 3<`">7``"B`8`v`$@L@"`/ c`L?`/ /, ,$@c)@!h@Z  2<@`@` ̀` @"H@l0@h 0@R%,@ᔒ?B<`fD@"  <  @?@@"9c(f@@ {y "9$@"`@,v o$L@@T?<`` D& < @`2b"l`q@a D[a@   T<@@5b2pD`-D@\`0(00*2`@`? 2 0@2x @!D<` @Ȕ 0`? -@`? 2 0`j@`? 2 0@! @ 0<@@@ ["a@  @{!0@ "  @  @c㾸 @RJb -%b   /;+'@? ?`*V(`@@?? ct& ⼀`d`@ , @@ b@˿ ? b@˺. ! #@N$##@aȐ$i $@I?v@ɔ`y[ ?@}?"5⼒ 5@B@ %⼂ 'b@8S $%b %b$⬂ %         `"  `?  @ ``2@`2@@@ <@@2 `" @  .`( ($@"j⼀`"   @bX @b <@@ a@ b@ِ 㿘# `! "@ %b`"@ b@ 㿘  1 @|#  @`# @/#0㿘  o& !$" $@#"$  (#$  ,@ $ ! @# d`"  @@ `"`/ @۠@ `/#@ȹ`2" L@ʶ@ `2 @I#@ `…`@Ȣ`##P@ޢ  ` q& @ч#@ `Ւ#@ϐ#`@ȉ `" L@#@ `@|`-# L` @г#p##@@Э `㿘`3 @Hc c  @:c b   c@А# ` @Ј# 㿘`3 @!c c @c b   c#@i 9  @`#㻐  a@' #@?+({`3 c@9 b @ @ېc c@2# @,#  D0 @## @E!X㾸)"`+-` `@tR ?``D!"`9 b9# "c@Ҕ#+ b`)! "0 `'" "0@`$"0"0# y?yb` `$ b0@` $b0yY@Z #$@t #@  " < @@`?@@+ V "b@? Q"@8@ `?8`[#@ϓ!耤<  9  @  @O Q!"`"` ` lb@@ F#["@@ Ȱ Ԅ< @x ?N8`? 9 # @s&2}#[@7!@ð `[@.!@@ @Ȑ#"`2[ @!@+1 @[g@ )% @^@` @sL ?`[ @!8 a@ ̒ 2} |"@+ @[@@ %"X @/b@@ tb o@r*@ k[#!@ΰ 0d@+"0@+"0ޤ@@p(㿘b`" * 耠` ``@^ bX"@w" 0 ` "b "b@j@ 㿐c `13 #@ebc`@n fWb H@n? "c ?@@cD`1 3"@-c@㿈bȀ`b쀠`  #`@'b@Ƅ#Ȁ ` F쀠`$@ * J ` 2@ 0* @@2#d@m@Wb H@i? #`#'#\@b  @ 8b" @ b9"@C 8bЁ쀠` #@͒bbbbВd@@mnDWb H@mg?  '#\@֚㿘`0`@@ϣ   `@'= 2?` `L@` 㿘ߐ  @J$@``8@'  a . @'`@ 2.? r. 㿘 b` Pb @"@4 > "@Gc b` 0 `" @*S 0@` 0@*(0# % b0` `$ @*: b0@`$b0@* ? y`?㿈 b`c `c`" @ 8@׺ a@m@& "@`@ Hs&@מ "L@ XL`"  @ƴ " @ h $'@#(',#@''@Ɛ @ِ x㿘 @ 㿐 @0 2  c2  `2  ?cc a' @  @p  b쀠`Y?[@̕!T b`@3%  b쀠`  2/b쀠` @@?1  Ҕc( @  b쀠`[@[!@ c`O`@1 / * @[$@IE$ bc  `V?b`@u ( ?ch@ڕ b< `? & @   &@pM &b쀠`[@!  @  @o"b쀠`3 [@!.?c@ 〤 b쀠`@Ê``@Ã@@ @z` ``? cؖ @    b쀠`[@א! ` b` ?c؂`" ' (' ' $' , R @  4 b쀠`/[@s!* ) b耠`?c؄` (   b쀠`?c؄    " @  a @_#p ` a' '܄? cH`g  '%#$$b@$a 2 L $ $b 'Ԁ`u2 L `n2܂ '܂ $b$@$a " 'Ԑx@$` גa'c @G@Zk!0 ,'@[ F~ت` @p  'ܠ   ܤ@U*` 0܅,  $@@p'܀`2 `2 @ #759'!ؤ-;`$@ (`@@  ``c# n S", a 1&  9$??Ѐ L N d < a b V2  8 c ' Q n r g"> h fz 4bu lt 7k r t o< qi D?U vc Wa'Ԓ@GY \@!8W",@w H@`"M", @Òa``E'b @G= @c`%$c 7'# 5&3&",@G+$#* ax@ %$'H@`.'܂ ./", $ @G",'c '# `$c` $q `& D(`X @[0?H d ct(` @ @TR  @҈ a "` b`2 $abc @ @@ a c`? @+  a  bbbb  `V`x @  `L`-2 `` >`  @@@Mx a' ` N@`r`w N``  @ |"!@Q ` v L$@ P$`0$@$`4$`8$`$`$`$` $@$`H  @  T$@@ X,@(`8``w `? @@ `L@MhP $`@$`"L@`w8$@@ (`  `?(`/7 / /?/ /7 /7 / // /''`P $@'@V $@ '@ @zdB?2 S "    8   a @ᶐ h㿘?6  @?`(?`(@ (V@@2 ?c@?`@@c* @![          @@?@@@ @ @ @ @ @@@@@@@@Ϻ@X##@R&1?aa6I/`          @@@@@ @ @ @ @ @@@@@@@@8 @@2 !?@##@/`@㿘 ?@d-!? # @@##6`6 @#@&$8$c…8&?c8&.  `'  `x   8(@@ b 0@ )  ! @  c`㿘 c`1"㿘`Y  c`8;b@``(``@(0`(``0`(``0`(``0`(``0`(``0`(`0`ƛ6 "8b@6 `(``8 2` ``㿘 $  2㾘8;n c ' x$ (`ߒܒ.ʐ.6>@`, , 4`< @,,,,,,,,(xd $    ,,T  $  " " 8" " " " 0 L l P  ( , 0 8 <  ?   $ ` < `   8" < (@@ (@ " 8 ?㿘9?N`15?@2 0? (`& & 0b& ( ,`2 (b& , ( 0  @0 ?`& $"` >``"``("`$ ,@ 0?& $"`4  b̒ 㿘  $` ,``4`" 0@ 0 , 0@ $& $ ?  $   `" "`0 ? @ `  `?   ( !㿐 "K?$"G?`2<`??` <8$< ($$8 8*8<0`$8$<<` $hhh @$@<$h`?  << $   ? $  `   <`?㿘 \`'?`$ W`(S`,` `0 ?0 G 4`  $`(`0 *@  `0`,@  @@Q3 @Qa0 L%0* la,8 l P  @e0$`P$`L l%0 @e0@$`l $ 4 @Q˕*$`4$$ ?㿘 $ 4`  $ ( 0  *@$ 4 >  (`2  $ $ 0(@$ ,$ ( (&@@ *  0 4@Q"@  ($ 0"@   4@"@@Q@"  0 4"@@Q ($ 0$ ,  (@@$ 0$ 0 , ( @ $ ,㿘 "8?`$ "4? `` -?` 2`     ?` " ( $?  4@@QG"@  ($ ,"@Q?$ , $  㿀 'H $`? `"`2@ `2@` 2  $@  ' `8`<؄`l`p`T`Xa( e0'b'''@`8?(`h@8?``  "1&  @?(@` 4  * @Z  &  $@`2& `$4 ` & (@ $` y $` & 8 @? `` $@"&  @?(@` 4,4 ?# (`$`& 8  $@ ` `  & & & &$`<$`8$  C $`& 8 $@H"& ``  4 "&  @?(@` $`4`" * ``20& a.$`L $`T $`Xஂ $`P  $@0Q   4"&  @?(@` ?4# @2a&  $`@$@  `@`"Y   h@P*`@% @@$`@%"\&  @?(@`  4 a4 $``$`d$`\a4'8%&  $`h$@";&  @?(@` (($`h 0p4`h`\  `h(`$`h@0`p`h($`l$`L $`T  @Z 2&  $`h$@`L (@ (`` ` "&  @?(@`) 0`` ) "&  @?(@`  4$`h$+ @]0`p0`` "&  @?(@` 4 9$+ `n@ 4-``   "&  @?(@` 4$0```"&  @?(@` 4$0```  @ ( &  $@`(`$`h@0`p2`h`h`d`` *p`T@`( $`l$`L``$`T @ 2B& `l``$`P`d $`X*` `p@@ 21&  $@`L`T * (`  `  ":&  @?(@` "#(`2 (`(` 0* 0@ @ (`  `  "&  @?(@`$ 4 (`0`$`@ `$4 `  `@ 2& `$`H $@`H   "&  @?(@` `@`H $( 4@$`@ $@`P`X * (`    "&  @?(@` ``2 (@ 0* 0@ @ (`    "&  @?(@`$ 4 `$@4(0`$`D$`H $@`H  `,"&  @?(@` `D`H $( 4@$`D`,`D @8Z&  $@p&`D@(`@`0 @`4`(  @ `@@%`@% @$`@ @(``@`+ "C& `@-" `` 4 "5&  @?(@`  & @> ``@ $`` % $`& 84`4 ?# (`, & $@   $@ & & && `($`8` $`<@`8  "   "  $@7?   "&@@> C > ``@ $` " ` `"@?$`& 8`@`<` @ (`?(`& 4H` `"??X 'H'T0@`` 20@  H@ (`0(T @؃*`@``*`@  @0` (`(`(@`(0`$T  ؃+`@`ښ``+`ڂ (`@ 2`$7 `7@0  H@(@`0(7@ )     ?an a.  a!}a}@ @  `? (@   ? & @  @  `(`@ & (2 ( $(`.(`0`` (@20 @@.@(`  2 W H(`.@@0 `" &@ ص(@@ ( &` `(` * (@;. (@,@(`@&8`0  @ @2   @2 (`.(`0` (@20" @@ ‣`*@$T#@ ? #   b,(@Ia 㿘@ @I @@ @LL||||||||||||||||||||||||||||||||||㿘c % c#% ahՖaX! "@ ƒc#c`@b c% cc! "@ cc`"@ ` 0㿐N`?@:     ?@@􀢠 `X@6 㿐N`?@< "    ?@!􀢠 `2?`h@ 㿀 @<b  `-I '`o`?%I `g`? I +`m`?$I  `f`?%c`x    @Ք?# ?`0(`W@@ĺ ??  ` ct) @H-".Hct&`  `Z `?  @c(`+'Ђ``@"@) @֠`IH@@?' '%'       `2`" :@m "*# '< '@_ [aϢ `@ (`<` 8c(``@ ` @c`' "`D`@q `@@  2`<@l` @cc``ƀ``c `@F "``c``f`@䀠@ ```@ ` @0T`c0`c`@~G  8'?'p'@Ђ``P@ " @y c@`H@v? 'Q'?`L@ L`D L@! L`D`@qfL Kl`@}䀠@ @b `D@]`}2ctH`ct?#ct?9''@ 7? ''@p .?  'C ?'?'- '@ ""@\ @'  @]` @X` @S` @``@I `@  @U@@c4@ ,`<80` @b@42 1  ` `) `` $"` 8 `J```/` /  2HH`?@䀢 㿘@@-  J@- * `" @-`J@"   @- * ` @   2@ 㿘!# @2$#㿘@   `$ `$@ E$ c8F\aT9 p4 `- @Hߔ `4 ` @HҔ `4" .  @4` @-0 ` 2 @̐ @f  (ȑ8`@-J`@-J`@@I" " @- @- @-,J`(@ F`2 Te\" p  @@АFe\T"" p" Fe\T"" t" @@,ؐ`2 @,Ԑ `2 ` ' cP'/'''''''''''@'@ kP a@' c4 `  a@ H( @(  ' b'/''''''''''''@gc8`F\aT   `FaT"@(0 0 @( ( 0&&@>@    $@,@2`F%\aT  P 3+ 83@(@3@8 4 F 8 FaTӃ,@`p"~   "y @0 8 sF`e\TL,@`p/`D@8`p`F\aTW: ,@8`p`F%\aTG 0 8`@ < `F\aT"600 9 9 @C< `F\aT"/`@`p G0\ `" `Fe\T3/`@`p,8p`Fe\T#/`@ `p `t`F%\aT 0 8`` < `F\aT"00 9 9 @c< ``8@,m  " & cF` 80FaT"  P D +@3`8+0@+@@ F20@(0FaT"  <DL @(0 0 @( ( 0& & @G!,@`(   0 0"@Fؐ``0ƒ `l @F˔"```0 ` @F ```0"` -` \FaT/`@`p "0 `>   @F` @"8 pb"u@   @- @ R F` 80FaT"  P D +@3`8+0@+@@ F20(0FaT"  <DL ,@`(/`D@ `(/`@`(ޑ8 h8` $ h 8`@C< ,@ `( h8` $ h 8`@c< /`@ `(/`@`(, (/`@`(w8@+ݐ "` 㿘 @G- ` ``   `@ 4 ` $4 ` @*h , , ` @E㿘    @&    $@*Q  , 㿘 @*.`R <`@L cC<@@`?``@!^  @%1V"@@ "``1"`2@+g! "HaȀ`@+[!  @ "`" @6@܁ ` @ 3 @ s`@: @!( "X a' ''''''''''''''@c8<@@`? ``@ !@- 2`HaȀ"`Fe\T"   @ , 2~@*!0 "% '㴀`(@x !   '/ al''@ < $㴀`!p@ @!  @R<@@@ 1@ !@*! "  `㴐  $ `  "{@+ %c|/''@)C `*`:`@);2 @c@)5J` @ k"0 @  @2! '㴀`0c4 "/ @l)   ?@,?@  0 ,@@l@㴂 #,@E! )w"(@ "!@`) ` | f$ -  "Tb"W@!`R @ !0W@(ΐ   2 O @*!X "? ##` #`@ `@2 @( `2 @Ԑ"P @s"h@( `2 ` @ߐ 0@! @j  @d2 @ `$@Ȑ 㴝㻐 a' @!p@h@ $@(`c4@@" @3@)$ <@@@`?``@y"0@(!   b㿘cT (4@x_ , `P4  ' "Y`$``I`,;  ` $`, @c !/<`,  : X`,`9 `$0a @= $`,c<`@)ےb@`   6  * 2  `  ` `8`,0$`0Ā`@)b@7`, " 6 . .  .  * ``,b@$`,<`㽐 N 4a@' `g 0`" c8  (4@w@ߔ *<` @ c> @  aaC ; 8 0 @ (8 0 + @ +` 3`& & @I!0& ,& )   "   @BՐ & @  , @BÐ" , - @" `   `8 0c ( 㿘%`#ca(@ @:R?a@(@:L@:Ja$a$㿘!#( "$#(@:>$#(㿘@)"@6 @&J`4 `@&ݐJ@"`@&Ґ *@&̐ *㿘c@ǐa*  " @  @2@a#㿘 c}`8` u@ c8 8@4h?@;`9 8D [ V8`@N 8(@v: @R@ D@8`C\D@8`C4`@^b؀+@#P @Rĕ8`@8`B@vj/@@: D @#h(b؀? 8 @# c8쀦`jc@喠k(@`@R: D   b؀˒@# ` @#ې`}㿘  2  @    c4&  㿘  @@  ` `@AD 㿘'( c$  cЀ ȁcT8%< H c%\FaT"4 c @wL!@$#*   ` @> $(@,#$#Ա4 c @w,!@¦$#*   㿘c8F%\aT"   0: ? : @OX@` n   @>b c@Da* `$"$ b$ $ $ $ e\FaT"  $ $ ` P`` FaT  9    `e\@2`p (8`9    `` #e\FaT<F < e\aT"@ \ F< e\aT"B ` < #%c܀@1c!( @$c` (*``  $ !`d@@ 2V`@X F e\"<`  `߀N 4`2`D  @!T$@8!H@"G!p 2֢`  Fe\T"  `: @!  c j$@@ ˚K "`Y$@8 P$2`(` (| z`.`.`  `t@@ \FT@"`  `2  $@<(`" [@Ɛ! @`?@"z "  e\FaT,`  , t =b@#%/`@R!8`y: ,`  ,  @'䀊 ؀ 㺀`$ a@' &`$&`0c8F\aT"``>`@<%\ (FaT"``%(8` ِ  Ӏ@ `FaT"9`h``"ʐ @;!? 0 @ :: @JCF aT''` ?%\@%<"%@8`@ T LC @8`  ; &`(e\"@`  N`4`   Ң`F`8T&`(%\@" 0(`(` 8f8`paHH @+@`  "*N`4@"@@>@  J ``A t@L8`%\ d@٢ @@ ܀@N`4`2` @$@@  2A`Fe\T"  `: @^! - c 0`   yaT,@:ǔ -?`8&`(e\2X@`?2ZN`4"@N`4` >@~ "Q  `@ 8`&E ` @[$@?!H@ N!p 26 `\@(0@o%: ' ' @!    + 8 3@ (@@`2 @8`2I(Fd`0@n: ' ' @Ƶ!@`p: ` '%c|/'''''''''''''\cTF\aT!@:.a|@  *#(@9#( @:aj@  *#(@9#(㿘^ +5`"@}!c(@8c(cTF\aT'!@9a@Z  *6@! #<@@`?``g@o!X7 5 @9ƒa@4  *`kjjjjjjjjjjkjjjjjjjjk|kHk8jk0jjjjjjjkjjjjjjjjjjk(5 a@' 6@Y ؀`b@?] U  h (ጀ`c8@Ԁ``HaȀ"@"@@͐"`@'`!@"`@ "`@ "`"@q+dc`8c(@J8@B#\@#-d@3`5+`-@ + @3`C+ +`@@ @E C<  3 -@2`*`- C* +  @`@0((@; 3`@ @DD @H ;`#\#8@#؀`y)c4c( ` b p=c(b؀e)   ,8`@9  ;`@I`@B8b 8`@D8  4@nא?c: e@ D8 88`@I DD D8bԀ`)@͐#bԀ  c @” 2 @3 )!`@#!  ` @ 2 @  c%! /㤀`2àu)N `r#,`k  -+@ @`,`E @$Z)8`@I&@8`B@l̐-@d: @ D 3`8+0@+@ظ@`!@!!!?"!@m?$!!"쀢? @m?$" a@  @IΒaHu`"W'''"@W@ "@ J )#`JH@Z%`,  Ѕ, @`@/ `,@/{!#@/x$$#@/tcL@/r@/oa㤀``"%#`Hጀ`@# 0@  !X@x͐" `D@İ  (a@/!0@  #@"@ #"`F@"@ "`D@"0?@"0)`@!@Q @"0@말 $$4: $$0 .   @#p@А P0@͐" @#@ä!H㿐@@H@`@Z h㿘@]# ,c`` Ķ`@)'%9 -/;@Ô?K?`+(` `@5!@` , mՖ aX0d' @> ݐ,c؂`%,,c c %̒@  ,,c  b'b@  # ,0`-# 0-# `,0 ct  @H&  :@H`b26 5@Hc  ,  @@@q    `c؀@ @T*  @Hva @ 㿘 (Z 2  (2 -a;+7), 4`@ J `8@ `#" @=" (@ @*  0`& 0`D ,   0 `& 0 Жc8`C ?c8 !@b"J @!6` @3Ð  "9c$: " c@ @2 @" 0@" %c@2%c 0%c&Ԅ@" 8 @3  c@! @! @u[!@b apfc0`C 8c0 !x2Q (` (N ( Hc8``,`$T`4```  /ꀣ@8``,`E @$A`4```8`@F -@@jQ`: @B@8`B``8`@B׀  㜃* 2`@  ` `(@@ B +@ 8``,`E @4``4`dH@@k?@: BȀ@' /c8` ` (' , c@'''''''''''' b d,i   @ic8`@F-8` @8`'B@iҐ.@@ : Db@$8U%\@  `tHaȀ"o`@bUԀ0`IDЅ.`'  `c8`,``F 4 R d@@ "l'㜃, 4`@  ` `(@@ D +㜃, 4`@  ` `(@@ D +․@     @  + 3`@; Ѕ.`' @@0E .' 'b ) F aT  @P8e\< FUaG p@ߐ *E@#c8`` ฀ *t,"q,@h z$ w , 4 @0[  | `c8M`@ c80\(8`0`(@@"``"``0@*@`<"&``0: ? : @Bq@ D? ``>?`;]Z(\ **`(p@@ `     `2@@  " b؀+ @`t@"hb؀ "`` @"P@L"@  *@W! *@*8e\!@3aN"```8 `t``pb؀˒"`` @"0 ( 0@oa0 "X`X@"@! 8e\!@3Ba0@ c8`\2`*`: * @B?2`` `@<b@ 2В` @4b Ȓ@```@0 `x8@2`` @a` @`` `@04@*\@"@  c8`\2``ݠ @*`   t@h` `r-`-``XК@@   ```^ 2@@ "`b؀-`@`@ې" @2a"("``(8`@` "`h`` `@0(@  ` t '@g`y  @2Ta0@ c(@@8c(`2 `@(`0``|@ *@5 *  c8 c< 0 4'Gc8` 4@f: '%\"`h`: @"`h`@ "`"@"S8e\8" F" 2&bn`2v``@0(@t,c8`\@J48" " ?a4@+ @`(` $@2ΐ8e\"(```' K@ *0u(;'㜃, 4`@  ` `(@@ D +@ -`@`X` ݆ ۆ 48" " @ !@?#8 "0z2i_8``"` @.  a a"-" @Ԑ *" h@ "@! @[!@ sb @ #(@ @ #@ 㿘cT,@ec@@2X: &6 `8b'  / c''''''''''''' H/  c%d ,$+%d   '` $L K @c'J`  ` @  ,``%d㿘cT,@ewcL@1p: &6 㿘 ( = +a#  2 cH 2   cc c @c @c cH`@< 8`c%cHc cH?̤D 4<@`  @c ?   `8 0X a@' @ː  `(`@Ő J@ x !@ #@! @   o2@2@  ;*5a !@30#aHa''( 8+ cP9 #'̂`'''''''''''/%cT' d c 8FaT0cT`%cT `"N`aɢ @0!7`e\  ?   ( `e\" $ ; `    @ 8` ( `e\"i  ;` @   ' 'ؤcTa#%cTa*' d``@cT`%cT  "` `"`  ` $ w@< 2 `8@a(`@@' d@   ` ` " $ 8@#  a@ "#@ 녒"$  @ V `e\B  :  @0B!7`e\J  I? $@ HaȀE  p@ "#b`F a~$ b2  @Ő!  R`e\  G: @ w`@\  `2 @W  2   $ 8I@ga H@ "#b`" @I  @ t#@! )o   徔!퀢 @ ݐ#@ `#@o# 2 @.[!@ ͒b _ @` 2 'a@W! c0@!X㿘cTP@/`ȱ: &6 㿘cTP@/Q耢 @/ 㶀  0a'  >  e#sꗒa@ ' b//@!` ```@,`&7@.?70$`$0@  2 @/@4@  s0 $T`  0L`.$04@!`@ɐ"p`  w@b 2  ,a $ @  "  ` a( ,@  ";004|   '//+!@`0`` ``& 740`$0@ 0@. 4 2`` 2$`0`$0  8 `c0`$f @E$ @?$"@ b"B@"$d apFc8T ;91"?$`Sb8@!`}7@,@;  " 0s@2b "`d@!Ђ?$`㿘-c/ %c$%d(@8H%d+; )@J`"`@89%dcX`%cX` ``@J`` `  @&``Ӡ   `@J`#`椐  cݐ@cX%d$`$`@zc 2 ` " $`@p@m` ,㿘cX@,ɔ : &6 @㿘 ( `E-)/>`F 雔  2 . 6`@H`8@`"Ԁ" %@"@2 @28"@#a%"Ԁ 2Т  (@(,@=28"@#H%"Ԁ 2`c8' %c|'''''''''''''/5 &c&d`,%`c`FPaT@` '/Х- `C@_  '@ `(`@J@m#@"%1 Т`@$" @냐e\"E   @  3 Т`@4Ġ  `,@$6&d` @yR `"2 @" 2В  @ &d㿘c\@+X: &6 T`?bpc8` '  ?c" @+ à4 X? %L" `@Ɛ#?b@#@%$` c@6%L`4%L`4 %%$ %P     `(9`8`08` 8`4 80`@8`< @_ 0 -* !"`"@#%$ %P     `(9`8`08`%D 80`@88`08 @^۠ L,` *  % ?#8b+ @ #@%L` @bU$%P?80`@ 8`؂Ԇ ? "?#  %%P T?!"?b#@ @!? # @@+ ,`,`4,`l#@ @ ` `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4$8 8B? ; B  ;   @ h  ` , cd,b8! d ,?ؘ#@@#@#`U㸄@܂@ @48?Ԇ ?"? b!#`@ @@:8`  8`@ B?b@@?c@(@^+ @  @ : D"@}@"  Ԁ@?"@  ?b@@8`@:[$8@FA <$<?c@@?$  ,@k 4%$%$`$$@_o 8$p$$$$ ($ $(,`䀠@6$,$,$0%\FT@"4x ($x$x 0`$t4$0$4&&& &&&&@ސ ?"@* %L"$?"Кb@@+`: ?c@@@]   < "Т`@(? @ Q `8 (`&`$ $ <`@ ` (@@) "Т`@4ޠ ?#  ;`@ ` (@@) ``$ 4 8܀%$`$@?lhp  7`    `) `2``%$@ (  ` ) `p  ` ?%$@ ( ` ?b܂@@```?c$?@ 8`@ ?"ܘ; @ 8`@ ;   @ 8`@; @8`@9??#L(@ C Q??"  ? @(! b+` ?b@@?`" ,`?C @g8 #`d%L?b@@%%P##?c @  Q a@@  @ 㜃* 2`@  ` `(@@ B +㜃* 2`@  ` `(@@ B +•@ \<`@('%$ 8 +؀ (  ` (@@) 8 B `c*2@K@ 8@`2:`@`,$@$@$$8 8?`08` `  @ 9 :@ @  8@: D4@2%$(%$@`$%$$ 8 8@]l:   (@@( 8`Ɉ$,$0%\FT@2#404+$x 6($4$0$4&&& &&&&@&\ ?"@(7 %L%#$(î$(b@@@) ?HaȀL?Ԁ@?@ ??Ԇ@ ``Ȁ ?@@ ?"@  "+ @ 4؆@ A`@ ? $`#8$ `$ `  $ ) \"   ԪԀ@@@@(?, " (@@" q@8@`2  ?c@@[5@@@-   ?b@@ʀ?" nئ جԀ<@>@@@(?, " (@@" 1@8@`2  ?c@@Z@@@@   ?b@@2Ȃ`@Ƃ`Â\\Ђ\w\p؄p@ `h  ?@&  ") \\8Ue\ $T ,  $X%P@Z * $\ \ ?8"0`@8`!$` 80`@?8` $d%$`$h%$`(`$l ` 880`@8`$dd? @b@#@@U$ ??" #@ J@ѐ  *c@ `@   =#<<<- - #8+ %$`!"`I?b@ @@ ># "  X%%$  8?(   X4%$%L@#%%$㜃* 2`@  ` `(@@ B ~+l@  a$\\e\^@ #Ȁ "%L"`"%$@!p@ې#p"`2%%$?㿘c`d@&: &6   `` \  `X `` `T㿘@Ð  @eb㿘`"@!  "@ @e{b㿘  @"~  @ekb(㿘 /@  $!,@@#h /$,@#h@!b`#h$@#h( /@  @g <@@"L `r  @%ʐ @Ԑ㿘  `X  `\ ``@ߐ"@I@I `X ``|@ϐ!`@Iہ@rB  `\  ``@" `@#@* ``|@!` 㿐 H'H'L'P'T'X'@ 㿐 H'H'L'P'T'X'㿐 H'H'L'P'T'X'㿘@9@1 (H/ !X%T@ې" G@Ԓ  -<)' @`?@:   @ `>0T@ @@@6#X"@g#8`%T@"#H㿐 H'H'L'P'T'X'@&`"@ 㿘!#he@4`e   @@U!ؐ!㿈 @[?? ??``* 8`Ѐ` 8֒ѐLЀ`  "fb 5!h(:@ f @$%h "   (`2  &4 ` ` (4&8@X'&04& (@Jݢ&|@Jؒ >8 04& ,& 8& c@JƐ@JÐ@@W$P80`@'?8`&.''-`?&`?8``(&@"(`&@YG@YC@W&@W@Y;&@J@J@&d&, 8``&d  `880`@8`@8`4 @W< *  #`!>`8`&&(a@ x!h r!8 ?* 8`Ѐ` ! ( c  @X(D&4㿘 b1R!1|@!`J!㿘5耠!@a7FUaT/8+@? c@X`ᐥ8`@  `%\@耠@"?`>8'` ,`ʐ F%\aT"  h 0@@4  4@&80`@8`@&%@3(8` d  @X[*@$8`@.$耠`>8`\FaT*  48` 0`$ <8` 8`( D8` @` L8` H` 8` ` 8` ` 8` `̃8  (a @< #耠@2b#쀠@"|`?]  +a 7a8`8@ 3 F`\aTZUaV  a@VW@VR@4W h a b b0 aȁ a ےbX`),8`@2r<@8`B@V,h: @ !D@ j`` @" b؀} b      ,, 00 44 88 HH LL PP TT `` dd hh tt xx  ഀ ฀ ༀ%\\@2F@["` h@~b  `$ @:` @8m㹨 a@' ?(a 9!"'!c  @$ '!@”$ l!@aڒ K<@@ D#0@S! !3b`Hc0}b?' @Ð#hb`|?c8?8c8a8a c ) ! /` '`@'`@``4  1!  (  ,` 98`b؀``р" ` Yb`` d89#`,@T` c4 0 t*8 *$@1: @1<@E@ E@1  @B`(  <!8@ː!` "`` <`c8  @(`@$ H!` b2@!` ` H 0 @!`0  Hb2@  ` L 4 @n!`4  Lb2@  ` P 0 (@ @W" `@ 0?$ Pb`2@j  ` T 4 (@ @?"H`@~ 4?$ Tb`2@R  `%,`%0V##`8e0b2@9  `%\%(FT@` < < "%8#8` e(b2@  `%8 H88`2@ #h`H8 <8` 8b2@  `%@ L88`֐#`L8 D8` @b2{@  }`%@ L%$  %P     `(9`8`08` 8`4 80`@8`< @S,` * =`D=  ˆ @#` e$`eP` ```(9`8`08`eD 80`@88`08 @St`L,*  $`b`2@  `%\Ua 00 x@UQ#` `xb23@g  5`%\ 0Ua00 t@6#` `tb2 @L   H `"`b耠"`` @& $#L`#L":   0`8   *@ $4@Ȗ "``` 0 #L 8@R$H d@: B !2`8*0@*@֬@p!$@ q!b! !Q#x@@k @e#  1"耠`b`"(   @!   bb`2@k @>#P@$ "i@3#0c@S  !7 "İ @# "  a܀  8&"耢 " `4@2 0@2 " ^ rg@w ` 0 ^ c `C ; 8 0 @ 0(8@ `C ; 0 @ 0(@ +`@< 6 c` @4`, ; b` cc#䀠^ @# c! @$# a +#c@  0 a@`eE  >(a#X@I@ݗ @#@S!, "  H`@ `!p@!` "`2`%\x0@7m%\%$2ђ %@: @  (aȂ <`/` @!b"` /` ( @!b"=`  /` !;) @t!b"` /` ( @f!b"Q` /` O( @X!b"+` /` )( @J!b"N`  /` !L) @<!b"` /` ( @.!b`  /` !) %@ L@!b"X` /` V( @!b"/` /` -( @!b  /` !) @!b"`᠂ ( /` %\ 0 ```/` `h@a "@a`@ P @ְ 4 !```, x@*` #*`@  @  c*`@y ߐ @!x`+D   ! ``E @D@P-@<@-좄@  ",@D"`#\#cؔ  H @8`h @r[!b U`@`?  |"py""@ p a' @ `d` $@  |@" # @1,!h  `h@'Є a ''''@ a'Д ''@@@Q]0@"㿘c4 cT@C bУ* @_@ p@`* @ 㿘@b@@{  @-A  @-> @W"㻐# a@' $@-@j@i    c@-! @ @"`# `l`J` J`@ ach# X@ Xb '$`l/' '''''''''''.#'䀦,#'a'''K' $`l? ?,$@"@$@ /,??  耦܀al'''  $`l$`l`?'ݐ㿘<#(0 b؀ @ @!P 㿘c8` c @0 @?`?8bb `` `(` $ $ 0@P( (  ?$ ?$  ` $ $ $,  <@ (`@`0 @ @  $ $ ڨ $k!h㿘by@a @g`?  /Hc0ab쀠^M `R {Hc0 ' I % Ȫb"00@Y@`j `i$ 0@`$0`Ff`  `9$ 0@` 8$0 0````@ *`y`@@ `(a  @!@!(a q!@ `y`Y`n`N@gn `y`Y(a  '  @笐@ʐ -   㿘 $`* N 4``!`[$!b"@!؂ & $    ի,!耢  & $  & $ 㿘b"! @g o"(㿘 U#c8`@*2  @@ M@f<Ȑ"H@@ &5@c"P ( c)c@fɐc 8`< D@ @@h#@O28@@?#߲@@f   c"@"@}"H@@; 6㿘N` ` `"``@Ncb b@j"`@`.` &`qc8@"` `0 /*@ $V``0``8cL@M2dH`d@: B 2`8*0@*@ܠ@㿐 ' @})"쀠`c8`F\aT #@"c8HaT%"!""@ c`  "쀤@ "x @ @`@ c  ``рb2w#  ` (`"-` Pb؀5!!@M?"@M$!%" @ '㘐8`@$8@"P`b2"" ""㘐8`@#<8b -` "c, , * @N@#(!4 `#< $`D (`L ` ` ` ` `ӂ`S(X"`@ S"!@Mu!?$! @ d  @ǐ"㿘 @*ؐ 㿘8`@(  @> m@  U#H@>ٖ &m @@#P = + bܒ@bܖ .8`= E@@>cܐ%"@(>< <@#CD @Mn: @@z#`bܨɲ@@d @MW8@@c#`"@#H@>o 6 "@ 㿘cT d .68.@0@.@@" b`  K& & >@㿘; b`c8`8 c:@ c -"   > H@ 82 8`I`8  sI8@`2m8`@Lʒ< @': ` `@`8`B@K.-`8@bD@bU" Ԁ@! @`@ bU (@(8  (@@(    (@ : `: @ (@( "< @ 9"8@"$ @$$ z @ :`r @  $`-` 0_㿘c``2cT d .@6`80@.@ @  .@ "` @ 2  @ 2 `    !  ` $ `$  $`$ ` 2   `2 Ր#㿘 8 /``t@.``-(`b(L ?`0@` @@>`" / @ @ @& () @2@&8(@) ܴ 8 "  * @ ``?2@ @  * `?*2@ @  +` (@ `?*2@ @  +` (@ `? 8   **@ 2@ @ *)*@*2@ @  ((@)*@ *2@ @  ((@)*@  8   ?*@ *2@ @ *@*@*2@ @  ((@@*@ *2@ @  ((@@*@  8```* @ `?2@ @ 8@``*2@ @  +`(@ `?*2@ @  +`(@ `?@N@㿘0 @   2  A  2 =? `H cT b|A`Ac0`(   `c` (2 @#  c㿘 @ \  " @ V@ T   @ N@ L @ J㿘@  2  @2  !@+#Ѐ &@ 1 #Р @+$   㿀cD' 'D'  @ @Y 㿘 `@  3b @x 'H'L'P'T'X@=cԖH'@ 㿐c ' ' @  @} @hא#㿈c ''D'D' ' @  D@|`@J 㿘c "  @ "  @|@3     @!  c   @|Ѱ @  0㿈 ' ' '  @_ ?2 @|?@u P㿐'DD@ ' '   D@> ? @|D@R x㿘@TI @8 @&ʐ ` `@㿐H'H'L'P'T'X' (@@|d "(@&@`'㿈'XH''H'L'P'T''' 耠?'`?(`'@; @`'  㿐 H''H'L'P'T@l'X@l㿘  "`@ @  `@ g@jGaX? @Sb   &  Ԑ @  "& ``"!   @ @β` &   k  &  !@  &   㿘 `6`2`.@i , @ , &&  jb0@iP?2 @SJb   & ( c& $& $$ ( 㿘c (2  `':a #  @W`  ( 2 ' `& E& `"  `  G&  1  ` @& 0~@I Ő@I `2 ( ` @&  ( 2 1@#㿘 c`"`(`(`2`A cB b 0K 2@It `@IK@c㿐 H''H'L'P'T@km'X@ka@7$ 㿐@^(?  !P '@ @7 6 ! @r@  @͐!@%+ 㿈@.  ` @%j耢? @]?`!Ё  q@G@e  @G?@GO`1` $` "0`@Gx` @'(!?@z`@z`@z`  f@_Ia@@GY00 @_Ab@GQ@GO@6 `$ `$`4 ``9!@6 `` b@6  '@q `@@``@@"0@$ ?㿘!#`, .   @  `&  $` ( `($# ( $ $J?2& ? `H @n &  㿘@e c` (2 "`@”  c!@~7??2 $#@y`B$#@6   @;??##`@y`  @y` 2 Bb 2"XBb 㿘  `  c`2 (ސ ? `H @& &  ( 2  !  @??" Q !   㿘@"@5 @& ? "@^?"j@#Ȑ 㿈 c ` @}$  ( 2 @dY #`"@" 1 @7Ȑ"(?4@\?. 2& ' ''@8  @8 "0 @U !g"(` !`U@"a@!`"(`"@#} @~ `0`#c3 `` ` `@}U??2 $c@y`% $c@5 ? @Y ?cc`@y` ?@x `   2"X `@81B"  ` `i@ `c@p@[ 4  @ ' ''@8  @8 -"0 ``b؂ 'Ua@ 'Ԓ'! "(@ '#g@~4a`a`"@" g#a``(? @  ?@4 DBc`ga`b(?@Ӕ ? 2? @xz`"?!#(`67@| ?` `=`( ?'@S0` #ga`(Bb 0`Bb   `"U`@ ?ā@ ߀`΀0㷀 a' $%g@m`$'U@gHU m @[: 'z"0 '@   ''#@NPcР@}#`H''@}}```@4  O   8? @1  ? B `¦`?@# ? 2 @w`"  hB'b `  @{  `ܐ? ``2삈`" €`  n @3  @! Acl a @#X@R  @א ”a @Ν"0 @D  !(@Οb@4   @gː" @4 62!@@NL!` 6)!h€fs$   $` a# a! Bb @a? ct@ !  >ߐ   #d#`#\     >Ґ     #`#\  <ǐ#  = X #\ #l #p #t #|  #  #d#x '#`##h   @  ''' @69  @65 @C @C @C   `0l@I@  (`` *(2 㿐Vc` @} "L@`"`n L``o` @l = " , @  "  `(V @ @  VcVcV;cȀ (&   c@J=  "$&@`" &@@vl" @ِ@  c2&@@vZ`"2&@W`@J 㿐@'    @MΒ o`@ |      P              d    P   0    x    `  p 㿘a 耠` "a"b@@ 㿐H'H'L'P'T'X' @IӒ   ` @f@ @fA @f50@d`@ 㿘aĀ`66 e@`g #@~1ˑ#㿘`e`e@ !!Ȁ Ă`@oZ İ !#@}# !H ` a' 'H'LW@c`    a a a@v ’#a``â`WbúaĶ`h ` a'aP ;a0`&L(`D@ 0 a!",    @T a\T` !'",L 8 'b,!@!?!4  ؀ b,"b, Pb, a!",  @@ߚTT 񀠠 ad",Ò h!",   T@̘#T 񀠠 ah",Ò Ӑ!",   T@Ƕ#T a",Ò !", " @@ǤTT 񀠠 a`",Òِ !",   T@Ǒ#T 񀠠 ax",ÒƐ !",   T@~#T 񀠠 a|",Ò!!",   T@k#Ty a",!",    c@ZTT 񀠠h al",a`",3Z",@C    p M t@7`x  ap B atÒ!hl<  7 ab,@;H? H`4؀`L`b,Qb, c ``` H`  b,@ "   @^ؔ?? `  cta& @`a`( @? 0?(@@{ a,``@4@@  +W@շb &`$@ ȔȠ`%Ò$Y&@@ @y_ؘ$Y@ ਒@yUÔa@KU a`%i@Ո` ` @ є! 7'''' 77"' @'$7' ?/l?a`T?  @X 6 X@s@ X\@sȒ  2 j@s@!j#P @ "# "j` @  r`,`@,  \ @& \\_\a'\jcPêb\a`!!Ȁ "@l 2`!B#`?w   @  6 @s)@x- @Kb  @s@i a`2!<@@Ò"(@@Ò@as"@ @Ա?"J? `?Ђ `$ ?Ѐ` (Ò"h$M `  (:@@`  @ 2 ` *Õ:Ґ" ` `  Mɐ" !`!@ `( 9!"H!!@! !@W@>@  8 :  : Â?*@ : @  ( @  ((@@*@ @ )@`# 8 :  : Á*@ : @  ( @  ((@)*@ @ )(`#㿘 8`>``%> >`@`@( @( (@@*@`? @_#؁㿘a "  4 *@52 !$@,,@ `2`" @"㿘a`a,`  @a`a܇.` 6`. @@Ôc@H $㿘a`6`a,`  @@a؇.` . @j[Ĕ`@H^ "㿘%#  d@8` aԸa@bUĮ3 0`Ĭ  ( H Ԁ@# ``88`@ 3 `88`@FА 8`2Ā@8 Đ p@^  a@``bU`@ْ ܒ ! ac@8c! !` ac@8c!`  a\`t#!@bUTT)!Ԑ d@ @B8`*`@ $@ a@bU!Ԑ d@ @.8`*` `Ԑ d@ڒ X@!8`%P@8`*`@ aP/ d@Ē@8`8` @@8` @@8` @D@=@8`*`@ 7@ #a 0O 4?@= a 8 @ @ aԖ`8d 8@C8d!a$`8@ @ $a!`8@ @(`@`4U `4Ђ  (@ @ # `:@0(@ @# ` @+!Ԙ `8 a  d@?8` jaЁ㿘  (@@     Đ @C2`㿘 a\`@J& l@F& Pa%  d@8` c@bU" Đ )@C `0 \@bU6`\@`' (@@+@  d@8` ad@8da ,@:Ð@ Ĕ`@BԐ @-༤8`@ @8`B@:,@D @Jvx@-%`d*@@D 0  a\` Ԑ@J_`x* @  @JV`x* @!@۰a`0a㾘! @ܐa7> ?(?@Y? @-' ' 7 w!!!' : '`4ڰ   !?h L%@ @C @8` 3 + '3` @'@N d 4ya" 㾘 @!a''`'?h@ 7a@Ye7@-'h'l a\ 7 񀠠# !* : 7''`4 `'  L%@ @C @8` a3` + @ '` d 4+.: ג 㿈aԃ>  ''? @0   @9ؐ. d : ?`F@@ސBaa 8`@!a@ D$8 a2 `@:Đ (@Aʒ`@9 @"'   4 @;,?! !a @'!Ѓ>` !@bU ! ` !` t``x(`@!Ђ xF!Ѐ"@@( "@  a\`0a,0`0  ` `t0 `t `xЂ Ta T`(`@! XaX`(`@ \aЂ \a!\`80`@8`@ `a!``80`@8`@ da!d` $`Đ %@A1a @"  @ bU \ ;`\@ ` (@@+К` ` p#m@  bU c7 `8@`@:mq` \`K@TT`d`@:U-* `$@ `d`@:H-*   X  d@:=-@8%P* @eP` ``d@-`@@8`@:&@8`@@8@:`* `4`8#aԐ`8@ -Є$(4` 4a@`8U @ ` ? `@  (@@+@и $` $Ц@-bU/`9 @`@9ѐՐ` !\`K@TT`d`@9,* `$@ `d`@9,*   X  d@9,@8%P* @eP` ``d@,`@@8`@9@7`@@7@9`* `5`8`8 @$( (`@`4 `4@bU ` <`@  (@@+@!Ц$` $!&!!Б. `@@ %`0@&!`!!@Ғ@ !``0`x@(`@ae\@@Р?$l@ˠ?$`Pa F)aT ! @ҕ8`  @ 8`B@7x. d:  @D!a! a\`8!Ԭ`8)*(` @@`$ l !x@@8`@8`B@7K.d: @ D@<@RD0}@ !`8!`x```@88  a'  @/'t a'T  'X @%@  aib`@a`& `0(`   ( @kU " a@B#\   ?@7? a@F|  a\ a aa Ā  a@# #ac$ aah #@>ܚ?a!; !a8 0 @ (8  0 @ d!Ԃ  L ax! d !a|  ad@  Đ  aa`@ aĔ a @>:4   @   Ė a @> @Đ b  ĖbH @>#Đ bxa `0 a`a `4a0  Ha4  La`H888e8a`L888e@a% 0$ Pa! 4$ Ta0T8@ 8a 8   0 48`3 b @>L;  $ `a 48`2 : $ da d@a<$8aԆ  480`@8` ! |a `Xa ePa `ae` \!\`2aaԄ 8ca00` ta00` x!\`2aa e(a? < (aԂ  , ! `!Ԃ? !d8 `$! `@!Ԃ < D!Ԃ  ! `! cX  ,aԄ @8ca00` ta00` xaԂ x (%Ԅ c`4`8@C8`: @ @ C?8@< B@ @$``4`8#@70@?@@7+`@5$` Ԩ 8@  0(`(` 89%0 0 t : @֕:%0  @ <%0 t @ʕ:%0  @ <%0 t%0 @:@B<%0a! T8`$  x@5[$8:   2 x ( x$< x$ !`x````8`@6ѓ8@ ?@6̐@5>$`!@& !Ԓ``x@6?@6@@5+$`!`x````8`@68@ ?@6@5$`!@& !Ԓ``x@6?@6@@5 $`!Զ $P `(9`8`08` 8`04 80`@8`< @4 ,*  4 @x&@W" ahcaԖd8@ $8` `$ 5 5; <Ԓ8@ ``x@6=?@69@@4$`ah58@ < 4082$ 8*8$P  `(<`8`08  08`4 80`@8`< @4z - * 8' @$Ԓ``x@5?@5@@4`$`` ah@@W#(`$8 8`: @@ B$ ,x`8@5˓8@ ?@5Ɛ@488: 2 ( 8Đ cH@ c cad@` 8d@aԆ8` 9$0a\`ad0 ` ad@ `(adH `ac `ac `ad `ad `a` a$8@  4ea0 d (( J@?hha? #\#`@n}#ae  4' 8 , *a0( J@4W?hh ?@nd  'x '| x'  @ Œ`` 8    'a? , = @:  a| @ h8`$8 `  F`- C a(04`( , B ,`@@@ B2**@ ` @B@+ B3`3  `C + 3`@ 3`+`@ 3 + @ B 8 2  @a\2 * 2`@, 44Ŗ@U  x a\` @? 2  '4b` %\FaT  e`$%\ _@2!!80`@8` 8`R a\!Ԁ`FaTUa \ a`@fې  a` @&    U@(b a̐ x@q`h?z`@#  P@s  Pa`0c(@@( !!@# $aŐ &`!@( aaԸ@ެ   ; 1C&!Ð!`2:!Ԑ`````d :@ @< B@1-@: @ @ D  d@Ȁ c c? @ @J [@m! @?"F!Ԫ`,a`@J{ a`  a` @g a\`TX\ŀ a !c `!c `!d `!d ` Œa @9KaԦ80`@8` 8`d +$H d T<: @@ *B 0$@4aQ !`0 t ( Ԡ `8`4@1  t@m;?@m7, t( a`0 a @!ȁ# a@' @e/aԒ `,aapŐ@(@C@Iܐ @e"@ @{!Ё@@ ` a ` ` a ` a b ` ` ax d cH d cH cH cH cH cH cH cH cH cH cH cH cH cH cH cH cH cH c cH c cH cH c cH cH cH cH cH cH cH cH d㿘 ` Ő"@a`@ 㿘Ţ a% &@Ɓ ?:J?`/"( `/ (8H@nْ / 2 L`." L   ސ`" ``.2 L `2 ``  $` @S xa @' a <(@@" @"Ւ  I @ lŁ! Ŕa@y"@ؐ"1 "`U! "0 `S" "0@`$"0"05 `y?"` `$ 0@` &0`y`Y`?`?İ@>〢 @\߀ @d"` 2 @>tO`  ~`@<  @;ϒ ! #\Ő"a@ 0@"0@2"0@c!H㿘@ ) @Hf4 @H ߐ  ֦ a' ``#<    @Ł` ``Ű @R!0?@> "`[@kא!@0d  a@N 0ِ!@  ?@;Ē( 2 @(@,`@ 0@cs  "٠ @א!P@@@S?"͠ d*$@ B`8 ^ @Fl   @! `8 H @FV   @! `8 2 @F@ @/@ݰ 0hŔb@: ([Ŭa+<)%'/; - @>L @$a耠`)3`4@kԐ "耠`@b`ے@k" $ װ `@QI $E "@@-Ӏ 0̝㿘#a耠`a􀠠  @Xh [Ua%`/@V ' <(`0` <(`a耠`" 0`%i`` @kn  a耠`  @j @V$ 2 <@bu`p@S `@-  a耠`" @ba`2 0`a耠`  @ @P $a耠`   D @RÔ  $  @ ϖ`@5 a | y ` `0 `   DV@j  ra`  D j <v(` @9  @9c㿘 @Vb )U%!b0 '%+@L? ?`"#(` @L?? ct&(+@` @Щ  a@a@ $$ $$ %aƬ  %!@laa耠0Ђ@@㿘 b` Ő"b8 Ő"bP@@J ` "` `* 8`` 2@P}@ (@` 㿘 N`2 @h!` `@h!hR`PN`L b`  bǐ <  b0! b@P7 <  (@@""N"` ,N@P# ,N"`N@PN  N` 4NՄ b` b >b@O >㿘 bV(`1ų>`@hO"x(`8`"V @hD"V "V  z" b` bZ  b@O͐   @h("  1@h#"㿘a1@" Ő @8Rb"  bca@@㿈@@jݒ /  @ b U@ra     c  #x@^!Ť cx `  t b,@K8? f ct b(`@ &``@   0`@ :  Ő @7cb䀠` b '@o a`2Ŕc(= @b 2  bp  @?u b 6 @`*`"B  b`"[@ha!7 `/ 7@  'H@` Ő c@@3 '=耢   b䀠`[a@7 ϔ`@7y  @@W@㿘 ` Ő"@c@ (Xb;   'I "M  c  '쀠c 'H@L`\2M   'I  c  '쀠c 'H@L`2M '   @ <@[$@( 8( @"@   @ (`    ) (` 8``\L  ` ) (` ! ä)@@̒*% ` ( )>(`"L`6` H@Ƙ@ap` ``2s  , `2o:` ' % %  [   'I  c   c 'J@ % '쀢 J'   'L  ' c '  @.c .`&`\2/, \, )y (`"M Ɛ @aM  @a ' ' $`$@$`?$`  c% 䀢 2J 1"  'J􀠿 (`8`g(gp9;1߀ 2A @ ?@4$@Ҡ w"9 8`Jǐ @’` '䀤 2ؐ $@ "  @/@  %  Ǧ @`x07M @ݐ % ` P'Ɛ @bK쀢 'I "  'J "c2 ) `"/8`` /`  ('H`(@l$``؀a䀡 'I  c'L c2 H`;|' q$`,"@@S@%b8`Ҁ M Ɛ @b2'ƔUbm% & @!?% @Wd@ϐ @` @b  58` & @Ҕ!?$` @WF@ϐ @`Ơ @c$@@! (@`a2(@L`  (H `% @ߐ@ݐ`Y'L@U cL`'LGc@(`"$ǐ @` @c$@@cƐ @c01) Ɛ @cp|'Ɛ @a @|`0@z;                                l T        H      8㿐#`8`o/Ā``8&  @|) "`U8 0```@҂` ϰ(` V0`x'3%"`,`8 `9" @`"&`8@`8`l` m&`l "%$8$@ $8@VL@@ "``8@S`8`8@hu @V8@ $@c˄%l J'c( Vb0x) @ /$`8"``8 `" @`".`8@`8l` "$l 2$"$`8`$@`8@% %ā @U`@6@ "  `ā @h?/@U``  @ϐ @o`D@U㿘@  " l @"  l㿘@  " " "h @ h㿐`- k`@7 )#/9'd` d`&``h%`O`@c( x% d`h `&dd`'  d@c w`h d@#$`h%dJȤ`!@'􀢠(K@ `H` `h%dz$`h` ")** $ `'`H`#2@H`n2@   d @ `h' ` $`&d* Ȅ`$`$ǔ a@@e X`hw&@@h&@'h"&@`h@U`@Wϐ @``h%`$@ !@(Ȁ2L`#2L `n2 `܁ $`h*Ȃ`$@( 8@&@&㿘ca  b-%+)'@?q?+?`0 (`ǒ !H e @@xl @@VȐ %,  ,  %`ِ % ؂ $ ctЇ(@ ` ΐ     @`@  @" @x& @Td@ǔa@ 0 0㿐L'X''L'P'Tǒ !Д ; @;b?` `ǐb@\a@ؐbb@Bϐ @w 㿘@Q @T%@t[aǐ 㿘@豐 @T@a[a 㿘!@ p  @ ِ$ p@ ѐ p X 4  P (   | l 8 x P㿘 `)`s" @N `w`{ ??@ p ?& @2N  ? ?@ ` 2  ?  @S @! ?& @Ss`@  ? 㿘  `@@8 "&  @@ˉ & (d& && ?c +`a@' : Ҩb?(c   -`` @`@%` @@2``@  ` @ @]^ @`@ߢ`  b! 0``` %` `@ Ɓ@R` @8ǔa  @R"@ @R@v? (h5 `ȴ b0 , &'c1& ""y```a"` @H` D?` ` 8`` @   `  '` )$ &  `?" Â``>8(`f `" 2& ܀`` `2]    @4Ԁ`&& & `" [@Y! &  tt`"It  t   `  @ '`` @"@+&6`@YC"!' ఀ@ ) ,`,`$$  ` `  @$ $v`2r "n?'Ԉ ) Ԃ'[t` `t`t   &#&& &`t t ` ` ` `9`25?" @6N")@Q @ϐ (`` ^' ༀ 7H` D? @ `9 ``@   w` ' @  `䀤``y` @t`(`8`"?` E80`8 0``w `  'ఀ@ ) ,` ,`$$  ` `  @)$ $܀`` @t)  pL `.'   b' -  p@(9 ?9 ? H9  \`w``&```X(@`&`X` L` `j ``&```X $(@`&`X`d ```&```X (@`&`X`^ `d0```"6@P`t @ǔa2 '`  ttt`  + Ґ 2 ܀`2s `2n    @Je `2`  @=܀`"\  J&`1` ` #` @H` D?` `8`༒ @>  ` '܀`2 W "`Ā@ `"@"` x$"`Āh@ `q``` @H` D?` `8`༒ @  v` 'G؀` " ```&```X \(@`&`XL@i"  ```"&`` ǀ"8I`X`(@`&`X"!`Ɣ`6 @ }Ɣ`( ܀j@ h`Ă ''_  Ȃ@`?XȂ@`?݂`Ȁ8f& ݄ @O# w =I`Ɣ`   `2  a ``2  ݒa @>! \L@"  ``@Vu"d ǒbb8" K@@> `Y 'Ȃ@`?`p6S`X`X@>  \SL`p 2b`X@=`9 ༀ`2  a ``  @Ӗ0`Ɣ` 耠" `  @`  80` e@8 0`` `쀣`% ` H` D? @ ` 9   @  ` `B'@ ">`   6`Wq`Ɣ` 䀣&`M    `` &"`& &"`"`&"` #`# `   # `  &  `@2" @N/`@~ϐ В` ' @j8(`8`瀠` ??     8 0`  A `  `L@``&(``\"H @````@:V` ,` L@``@: ,8`0`?  @L@`P    "`@@:R @`@  (8Ѐ` J`8`\`&`````@ ` $c##  `ༀ`2ހ  (a؀ "L@` {    "`@@  $7``"`"` #``(` @(@b`"``  @<6b`"`d @M "@  *`*` @  % (`J$  *`*`*`  % `  @+ @M``"w`@8e$ݒ   ! ! /"``p 29`X@<9``p6D`X`X@; $D`@ b''Ђ @&@䠐# "F @% p aj tta b & @H!?/$@L @ ϐ ]`#`X@; # `Nb`0 Ea+  @P@ƒ`h  <`" <% p>!( % p@!?$ <@Lr`@ϐ `/@o@"㿘 %@`ʀ`ʀ2`    @ c@Q# &@㿘 "&@  &㿘@   @&`&  @&@  @Pc8@㿘 ??`@4` ʀ "&$ `2$@ ֓ @Pߒc8 ь ь ь ь ь ь ь ь ь ь ь ь Ը ь ь ь ь ь Ԥ ь ь Ԕ ь ь ь ь Ԁ ь ь ь ь ь ь ь ь ь ь ь x ь ь h ь ь X ь ь ь D ь 8 ь ,  ь ь X  < ܸ ܘ <  ߼ ߴ ߀ x p 㿘%cX  @t? l. m ?2 @s ? l (` =@ِ "*@` @,?  2  =ʦ   @,/ Т =㿐!! @sɔ ? !(`@}@ `~ L@`2 @O# @ J`2bT " `"m  @& ` (@2'@   "% (`@@(% @OƐ#΂ @s{ ?8@ 0` <7  `3  +///%% @\2" `:@Ԕ @N@ϔ Hb@  `?@O#` @O#  ?//   @c 〦  " @[  @O1cn @20ȝ㿘  HbW!"@? `@q`$""$ 㿈  J`-"D +`a  @r?! l s ?  @X   ˢ @O$ 0@r٦ ?倢 l@ a􀠠l`j) ː @~+`  @O  (` ) 8` `@`ː@  "  @bX "j      y`3  @ s (`ϰ@ˢ `@u M?&Z @Mߒ2  J  L`%@V  2 ) ˂Nj (`@a `@N} 2 @ux Y`'(@`@Ne @Ns @IX @@Ni@’2 Q. ˢ @NY 0(HbW  a4 Т`0$ @N.  @N' 0 ''  $   @<@$ ' @3 &2   q @pe 0㿐`a+ @ #\#`˰@ #\#`˰@ȁ㿘@cxb@L@M ؄ # a@q ? a(`@`? @@St   2 L` ˒@S` 㿘)`  !@qg?! n" " p ?' l@qV ? n! (`@ @@Q  2   z"Ң?ѐΤ  @Q@ 㿐     @E\   `?  @MW! 㿐ˤa'bĬ @q? d"? t ?@ a@p ? d (`@ @b0@Ȑ@# " `2$ $  @b0@Ð `2 $" ~$x$$㿐- `$ n˦abĸ '   @p?? `@? 9 +* a (`@@`"H@-+2 H```bĂ`? "@`@`"@L!  Ĵ ¶   '``?  `8'@  =  $@@u`@`?H@" @ ``2 "(`%!`2a `V "P@s;b0$ `$` +$$`@ +`$$``@ 7`"4ˀ`6#`@x  +H1@ H =(@` @@n  @K Ī`$a4 @52  $pb0`˰ @Kː!h`˒`@xƐ!`ɒ`0@xː =0@ `ˤa`/   2``@x  +H@%H =(@`%@@ne @K@ @x`` @mE1D"0@x =0㿈H@`r`t`e˦ a'5` n`$`      '@o-??`9(` ?``" @o +?'@rA " '@r8 "x ```!(` `H@-+"H``?c瀈˃(@ @,P ,P@ @ b"(@耠``"(`4@`˶غaȨ 8@@4 }p@"  `@Ҕ 2@˨ @Jِ! ` `h? R -`\ Y?$V;  'Q?cM`"I=E `cB@c>`c9 `c4~ `'˦ a  '~$`'H``Q`M%h @@  \,`=b`,aˬaؤ@/`   `-"`-h @u  `T`m  @J;!@J!b [`bxp˲b`@@ ``22b 1 @I `-"0@I"@  "@0 ` @ @" @,쀠 ` ˒bh@Iǐ0` ``Ҁ @I `-`@͐@I"0@bp@lw0@I2cˀ2\ˀ2Uˀ2N2E  2< @242,2$2 @I|!m@@ j`T_  q@Id"X@I`"P@I\"H@IX"@@IS"8@IN"0@IJ"(@IF" @IB"@I>"@I:0R㿘H`wˢ`?`bˤb+   a@l?a p" q v ?x V@l ? pa`î  2 (@@  aop` `  S ZX @@`?`"C``" @@ ;`7  [` 4(@HĐ!-(@H` `@H `2`"" `T`g˪ `Ϣ @2Ӓɤ  @`Հ`@H" ` ˀ`b@H~";@kH ```@Hq"`2Eˀ`2>ˀ`"0@Hd#(```ˀc8@HU#H 2- [@HM!`@? =?; @H?"0Ī @H;# @H7#`"@H0#@H,"@H("@H$#``2 ˀ`b@H#h ۞@㿀H@eJ#co `  a@k͠?t?`68(`@ L`  @F 6˰ @G#ۨ ٨ ? @F1 6Ԑ˰ @G#ʨ ?Ȩ  ĨHbWj    J`-  (   WE!`@(" 8n􀠠e`@(  J`-   (  b `''X ''䀤  L    @i8`  \" L* L  z *ݐ   @c    `f7 `f`r`a\ &`b`04`\Մ \` \?*ϐ ˄ `r `t`n  \* *  `v *  `c ?*  *  *  Ђ``   (?Ѓ8`aР  ) (8`ЂЄV@+`(8` Є@* *    * Fb `"5 "  `@& 6$`@A`@`뀤 @` ` @K0@H  @L ˤ*5 * "h  ` "h@?(a` a,`@ @@Ba `$!(`a$a(`(`ޤ㿘'HbVˤcȐ@j-? L P ?2 @j ? L(`  @FU#pݠ bL@ *` @   @F&! @g  @F!b` @A @_@F!#0@p֢㿀b@L!cȢ!@i˔?"L L P ?2 @i ? LL` !˰ @E#ު @ , @  " ` @Eؐ#p/L@`2̰ @E̐ `@t "@А@͐@@ɐ5 `t⨬@צ @ס⨐@@ך $`''[$''̢@H @ '@ .`⨒@o`@n@퀢 @En `g` @@L@@E\!`@/  J@`2OL`/2; `K 5 @p=@| 6`J `@ 8@3 `3  /5@גa  @! `'  /s5@p  ̰ @E  @D!ʀ`@> @oϐ ̰ @D (̰ @D P t H`f`? 㿘+aa@hw  ?" m  a@D!̰ @D!ȁ@! 5@@K@hV?〢 ma(`@߰@ `,`@2``` "&!@As @eR  @Af̰ @Dm!  H@p ဤ @e#ߦ 㿘#b` ) b@ !bb.  P@ $L@ L`2  $ ` P"  @   bb `  x @@eҐ'ܤb(@gڔ? ? p :2@DH" `(@D?!܀`"!`( '@`ܤ`(@ $ (`@ ``" &@`(㿐` / @ c#\@rb0 <@  <@W` @ ےc#\#`@r̒b@b Ӹb X @)V@  ?@  `5!&$$!$!$`$ @/ђd V` @)9ؒH@  ?@   HL  ?$`'Ж"? 'PT  ?!'耡 '쀦 ,`܄  ?؀`$!5"X  ؖ d   \"h   T"p @n̰ !5̐ b` ؖ C     ;bx    3b @n   Јb???/'a' ??/'a'  H@@(ؒH@ N ?@ K ' `а`?/'ae'?/'aq''؂b@v'܄"@'Z''b@>' 2 P @ #`'~  Ƙ   `% @ ?`   `    㿘%b @f4? f8 v ? @f# ? f(`@ @ @ [d@ @ @ "  @-h    `@B7"0ȝ㿐 b: @iΔ - `%`?+`!    @i$  $8`(`$`ɐ $` "` HbW c c#㿐!! @e ?N!(` K@h͒ D $Pb! (`0`8  (`0` 8`2?`02 "`"`3`̘#b @AY H@b@ @]    ' ̖ b@AE  @A!P㿐!! @e; ?! (`  @hG . aXH@r!"` @]( @]@E "  $" b2!!(`0``8   X̐ @@bx a' %`X @d? ?: S@dۦ ? ?(`  (`,?Ђ``  )  8`* ?Ђ``Ѓ) `2@= 0 @# $,` "8@@#0  ǁ@=֐ @=Ԡ̶8c z6c| I6'ܧ,`2 <Ӑ8" I,` <@f  g,  g a o( u,` @ " I@M# T ,`< ` @B `` 8 (`@Ȩ ƨ "  ,`< ` @<`-#`=`+"@< `,~̰   ܰ ߰ ܰ ٰ -  @-@-@@@X#k @^"`,`@=C @=A*̒b8̆ b  ( = (  (@@")   ,)  ( @@!07̰ @@"01㿘!!  @cϔ ?8!(`@ @@}6 0  @}/   !@|  ̰a@$ c ` @?@b  @?ϐ2  ?̰ @?ې#P@ ڠ N`-2N `2а 㿘#a  @c} ?' @OM`a(`@" HW`c  X@\6 `0p'c`   @cR?9 r"  s ? p @=͒ 6@?#  u L`ݸ  @>o 6֐˰ @?h#@c ?̀ r(`@@@> @p@ ?  ,@@  [`@>!耥 #b `'' ' 5?'c   @`ʺ耤` "P"M ! $ @`$ `" h $`@y   @$@nԄ  @`Ԩ - @``9` Sd` , `2,耤2 ," , (`#",@qdPN@`2E @ 2@jI ` `\` ̀˂ `(`" ,耠@ `2,,ij N`$`i @H "d  @M b @M W U Q`    @\ @j@@>c"0?̂ch&@i2-`?%` 8`?b `'' '؂' "h ` "h@6ۀ`@=ـ 㿐!! @aݔ ? !(`@ @@Dڒ  `&  @D͒  `" 0㿐!! @a ?- !(``' a4 @'. ,! (`` b@!` ``@[X @8@@=   aX@=  @㿐b# a@a] ? a(`  @5 ` @ +`    @ $ $    @$ @=x#p  @=r"        L x   h     @ x     P     D    $ D l             `b  @N˞@㿘ǀ`cȲ`N`!N@`(8`N@`N`@2`@Ɛ 2`@``?怠`` 㿘   ``?`(` .`Ȃa@@`?  `&  㿘`  @  2`2,  @  2-`2E   @*8  @ a @  2M `"A  ?Ͱ @’`?@|` @    Ͱ @PS  2  @   @ 0 @  @ @  @  Ͱ @ ?Ͱ @ ?Ͱ @h㿘[` @ @     @ 㿘@?@ @    @ 㿘 `  @  "  ``?͐П@ (@- b`@Mi  <@I??㾨 "`$ .`  ͟@ @MD  @M>x 2 0  @M0x  @M* 2 0  N`!`?@`7 zb@H@ '`?'>xԐ`?@Mxΐ`?2x Ȑ < @@`?$x  <@@`?x  <@@`?@px  <(@@`?x  <@@`?x  <0@@z`?ޒx t <@@l`?Вx f @``?Ēx Z 0` V`NR@ NN`? @2ז 2 `A&@Lqx ; @Lk 5 x0| @+`?`z@aO 0"`m@aG `?@c2 @^:  @ 0`qx  0` `gx  b`? `?Tx  `* `8 @ac 22'`&8x ΐ 0` ʐ` Đ`?{ `?2 `Ղ `@@ @`?@' @2/ "[䀠`8(`x쀠  쀠  쀠  쀠z x @r@ @l`?'iA@  *`@@  @`` "c0 `"[c0!xc($''c,<'''   , @2 @}c,  = '䀤 G'ࠄ? 1 E @ "&'ࠄ?,#'@  1 퀤   @ @ C' @ 2ࠄ?'?, @@@7a @9! ܐ  @ HbW@a "'  @ `?ݐ`? @@ ܄`̐ `?Ő`?㿈 @耎``c @٠8`@9!@  c2 2 @9!0㿀͐aH@! ##?  @0   2@(`2@8!X9 @ڑ8` @Ȓ2?2?@D @3`" @3 @ @8ϐ! @8ʐ!p㿘'L`Ȃ H, S a+ +     ` `@ #))  )%  @\\?a S"  a ?J H@\K ? Sa(` aͰ @8!"ܬ ې@Z& aa@\,?2S"a?H"` `" J 2  `9 ܔ 逥`֔Ͱ @8a̔aa`a͠a@8 ` ` ` !,@ Ȱ Ԑ!,  a  % J`## E    +@ ` (8`` `?` I`#2+@  "      H` b 2H ??, #( H`  #(  " #* @ "㿘 @"x@`6 b ƀ  &ƀƀ   &@@N@1 @+  @2N` ƀ? 㿐&'@c ?`(@(`8``'`" `` `=`:?I?`\"@c(`(8`'"`=:!8`$@(`(8`'"` = :" 8``\ 4  N@] c ``V @P ``M͈? &@yt "$ æ&b`    @%P b㿘 /@8[ 2 ɢaȠL . @b.  2 @Z P a'  T`Z(#`p`p     ''''''ĠȔ ,@aT $`pb܂~w''Ԃ ?/& & & & & ///@ `p`9? `3? `-? `'? `!? `?@ޔ    b @˔T0@ 0& & & & & $`p@Q!㿘 N? ` x` p$ x?`(@$ p N? 2 x `@_ N?``x`p"`x(@`"`pc``㿘  f    @,`@ Ȑ$`@ Ӑ  а@'@@H/ (`8``/2'``* ,``@`!  @ , < , ,, @    @`@m  < , ۡ, a 㿐# @S  @,` b` @n   @Sݐ 뀦 ?㿐 ! `4b8!! - b@`h %`"` !   `#   @} @{}`  #  @} @{n㿘m b@HH`" H@q] `?@!㿘?  `p`p ` ` ` ` `  !@lb `   a @      `@`   㿘(`   :  (`    aa  0 a( , a4  aT(  (a (#a  (@   (`8^2+@ J> ?  +@(@   (`+@ߐ?a(  l   `㿘'T`a0,aH`  Nw  44 $T㿘 c(aa @͢ L ` ` ", ^,L`  ?`@,, @ò8L, `,㿘/?y%8@Ɛ +-a0 ')D!@@ %@@$@$DD?"@`^ H aTa0@j%a0 aa@ :4#a,@$ & !@D@a00D@ a,@  !@a,4 a0a0 @? <a0 @? *@k? 4@f ??4!!(  ?@=N!(@*? %8@O 0 H aT+$Da0@ %a0 a,4 #b@?; !@$D a؀"qDba@?2jD@@㿘a(aH!<3` @ 8`!#!< a0 a0a@: T΁㿘  #%aD@!a8 aD@́#%$aD@aD! !D   2aDaD`$aD$!D㿘#*  a<0  :  *  a<㿘  㿘  q a, ( a,㿐#a %,$ @"@'R a $,( a0 (  ѐ x  bhbd  8! ah@㿘 ?   @` US ^  ? @M1"㿘`  }  㿘%<*  #a4 0@ < đ:  *  a4㿘    㿘a(, 5 Lc "*"L "I  `_$ +`  2    +`8`߂`2 _" 퀠$ Ұ 㿘a0H ! a(!($!(H!( O$!(!(8H㿘a(, !!L   X ` L  " (`8 @`_$ LW8"  @`"  8*T(@P`* "Ӕ (`8?㘚 @` U _1 $ U8㘂@`"   8*c) @P`*  2  u$!L 㘂@`"  8*T) @P`Ҁ U"  @`" 8*c(@P` 0aT CaT LaT U㿘l a( 7 l  㿘1!(a  a,HbH ` H!(H!(H!(}H!(((  հ H!(lH@!(iH!(@(@(* : !(  㿘a  㿘a, 㿘a(,@ L& LL ѐ  㿘a(  L& LL    㿘a( 7 Lc ??* "?J? ? `_$ ) ? 2??   ?) 8`߂`2?_"?퀠$x"L A 㿘 㿘) a(e㿘̐a  0 a, ( a4  aT(?R 㿘?L 㿘b4b䀦# a  ada$"@a @ a0 a(# aT$a,a,a,㿘aPb4ʰ bhaL(*  "㿘aLd*  㿘adL *  㿘b 㿘b4  ? Ѐ(`8`` Ёc8 Ђ^@㿘?Ѐ  , , @ܠ?Ѐ ,   Y  aL  P áo   L P 㿘%')+!0# $a,>a(!ʬ"t$a(%!0$ @/%$$%a,$ $$%!0%a,$a(@?v  㿘a(La ,2  "  "H"L  񀠀 "LA 㿘#a$a,@!!("@@!(@!(a,@@$!($a,  ?ߞ@㿘@!'!(<Ӱ?  aT!(1!4`?#$a8<"!4  $a8!( ?N!(@*? 㿘b aP_ (``8`` ` `"`'  (``8` !L`4 '!!L`" `' 8 (`8`` ` 8` ` `"`'2 (`8`4!!LN`0`" `'  N`` ` n.. @+?@:8@ (`8`  "'# ? (`8`  "8``'E 񀠠"'8`? (`8` 2󀠠 01 0 0ۃ(`㿘a`  !!!p(` !!a(  al!!!p(` !!&"ؐ? 㿐 !!L $!L//!L$!L  ϰ @㿘a(%@S1!(`p@ ! ! `(`@>"$@&!㿘)!,',@ %&$(ِ$@ (%!, a0  4 aT+@ alŰ 㿘 X !l )!(`X !!l`P,!( @ ,   N@ܲ`@$@M!(#&$a8a@D %   O   H `@ $a8! T!( N@!(@  2߰  c`!!l0㿀!a,! a(" " #\#` p좒 "+ ! >@ { @` `L . @ @Ր  Ӱ    㿘#al a( @ H $al &̐ 0㿘`c`Ԁ #a$a"? #a(`p @a(֐" aă( 2 $aĀ" ( $a 㿘a ,aP a( LL!   L6L LL!<  հ 㿘N Β 㿘ְ ǒ 㿘a,( L& LL   < a, baP@㿘a(  1!L&&!L!LI !L   㿀'a, a(" " #\#`Y찒 =` A' R @ `?@(  @M @L @H`/ ސ  T `G0㿘   㿘   㿘   㿘   㿘   㿘  x 㿘  q 㿘N@`^ @W2? 2"`@D@nA` 㿘%b4d`?(` 0 ֒ &?3@a N@`^mD?7 b$d?0 0㶈 a@' d/cDd?/ 5 <m @x//逦 A > @ 2  7@@:@B@V:, /, s (O$`^B? #/ x@ 3  ΀@ ?0_   @@,L #?ݐ0 0@E!㿘!!,a((a !,!!L $!L`"@ !L@ !L r  㿘Ȅ b9'@ (( @@@0% x     4 @5 2a\  Ēa " " " ` @t & @' x&`& ` `! @&#㷈 'X'P'T'LaP@' '쀦!L '쀠` '쀡   ( '@ ' @E!㿘! $!\   #d "    !L   "   "X   #l $!\㿈  aX!?  ah@ @b` 28 (bF `x`x `  s"X+   ma    ga;   b `c    <Y!@-   S !   C L##   cF    # ?!    8!Ē    1!    *!!   $!T !T   =!   #d#d   #     b    b   h b    d"'   ̒   B !   L ##   l     >ِ!$)   Ӑ!(   ͐"ܒ   ǐ#    #Ę    *#p%   D   C D/   f     g db      !В   ? !   ? !    !p!   y!L!L  t    n",!   . g! !  a _   [#    T#    N!   H#D    A#T   ; #   5`   A /`!   U (# #  " u!   "D"D      #   y   Ԓ   [ A `   [ B ̒   [ C D   [ D a`   O A ̒   O B D   O Cٚ a   O DҚ    [ H ː    [ F Đ!(   O H      O F!(!   0 !̒   1 !̒   2 !̒   3 !̒   4 !̒   5 !̒   6 !̒   7 !̒   8 !̐!̒   9y  A 5#`!(#d#\   [ 1m ; B #`#\#d   [ 1b ; C#`#\#d   [ 1W ; D#\#dc#`   [ 1L ;@ےc8 DŽ  㿘 ` `N @##P G1Ͱ#X@#B  `1@##@㿘"     @  3@{a `|㷐aX @' J" b⬀ `" `2 @# 2 @ ȁ+ ([@耦`r N@`& `x2 `ް @U  0Ͱ @##`0`x˰ o 0/ ȴ b9_  "@/ 2 `x2.` .@ f..Ȇ b@ & 0`x20 ` @ K&   0{`x20 @ 2 0if͒xͰ @##@0_@Ay!Ͱ @# #0W㷈 a  $ a0 , a( 4 ' . +`b#b ' aT$@ ad l@21b@ 1)&!D a 8%!؀@ @~&@&!D!D @!$!H <@2 !H`@!!h bhb4!#@8`) ?$!h)'?;/%!$L'a`  75 < &v L(w`O(w!Ȁ`&x'!Ȃ@ `z Y Q 2A͆ `"'a`@'a`̀` a,  a@@  %ȁ`z@`̀ "  n  aЀ`#a&!D C$!H;%!@@a!  @ @ @ @ @ @ @ @ 8 @   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 8 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @  |  T D < $ h ` x x x㿘 @~; <$@@ @($Φb8`, ` @($8,`L@``@~  耤   (, $(` (,ޠ @㾸@^G@  @ /N`/`$@B ,@N`/@}Ғ / "ߐ * @Dd "O, sb@ ^ `@ @@3 7J `.  J ``."gJ N`. @G @ $@@B@ܔ&@ @3T 2J @`$@ @ @ `@B~"+@ϐ&@j`2-,@l` `" a' $@@I$&`N @˒ ހ   @ L`/ % &㿘`@բ 2*`@` @  `&$@`b&< , , &`&@@&` H&$@@&&@8`>`&@(`5@D㿘`{@|j  2J ^$@`@[&$@`%@ (` 8` `3   (``' ݀܀ `Ӑ"& ;D(`9 `2H`{<`}]`,:܀ 8``2Ҩ  M`{ `} `,2ɨ "ŚĨ U`b$@< -, , %`&%@%`$@`%@2b`$@.@)@@$,Zb㿘'#` @.bh" "$bh@1W ! @גb$bh͐`b@'܀ 'Hnb@H`2@H `2@H`2@b `''͜ ''('Ԃ@    'x 'p't'|'7  @@s$- ``"_, (`c@ `R `߂ (``?֪` M  ֬`@? @@`' ` `  ``   M A p'p0N`  (``@ p@'p  xExܢ   $ @`$  " 7` `@M ) '`p``  (`b```,?߀`]8(`c@  [+ ,`e  `,, *'(`쀠` `''̝ ''N  (`8`/ (`8`/` 8`: @?l  `*L@`" `( @`)(`8``"% ,|@ `'| `2,, ` " @ {@` @,zG |N  `',tpP@ 'p` `%P `%Ӏ`#`=`?ttS``@[ ϒ`@{   '@y ,9 `%`#k (`8  '' (`c@` `@@''9 8`9  * @@y [   J `*'`@2J `]a`= @d @g,`c@`@b@K`` `)p 'pt``"'t0@t$3`3`#`3` `%"`#`=π`?)      ( $,,,N` @>] *N ``   *N` )`*`*@ Ȥ > $ (,,N` @>2 *N ``   *N` )`*@  N` N ` ,&"@@m2H]H"[@H@:@L $@H` @ ( `'@ ' '' }'|$  @ @i" H@`@:e`$@H`   'x)?+@K' 'xϮ `Ȁ` 6 @`@.H$@H` @$ H 'x@Lt`@" c  p'p  $@< ʉ, H, #`#@#`$@< z, H, #`#@`#`}`'N `w@H`q``'k't `'t݀`  (`db``G @````?'7  ,`c@`@p` M`?`+`=b`-``?2^]b#`@*ڐ "" @Tbh`Ɛ '$bhW`"> @ @LĔ @   @ @  2@c@ @" 7'܀  @w 'xI " '' /  @@w  @eJ`  @<  *L `   *L`   ֶ @Y  (` J ` @wf [  < J `*ހ`@"J < `*`@@bg@e ` @@ `?@H` "@@`g @cC@`` 8@c<݀`  (`b T`@]@`E #`" @ b$< , O, @cy$  2$ `;H`@` `-   @p  @?Lb0' `'@AT$ ۢ @ c8/H`Ã8@_ @c9ˠ* $b< , , $' H@ @`?7@M#X@J#8 @[%@B# 㿈!" Ē` ''' @``"z`㿈#b ƨ` ''' @ 8`` `" ɒbV`bQ`㿈`-#b |` ''쀢%' @`'    􀠀 b ' @ j  b c'''b < , X, ''' | L h T L L t   <  0 (  X㿘    @c @&  `  @9㿈 (  @G @&   `   @O   `''' D@9k     ''' D@9Z 㿘.`[@H㿘 .``ΰ@H(?@(  @5 `<   ? 򀦠`&@ I ?㿈2&@s[ / ^@b `''h '`6' :@sC 覒 ;쀤$$@8D@ / ,@ @83@o L` @s  : @mŦ-"@h  㿐b@Ob0@O   H@/ $@O 2 ı$$㿘N `= `* `+ N`=`*!  @O@P"  " "" 㿘b   @O  T 2  @Pg " " "㿘@O~b\ /@ry   `# i` Ca4   C`a@<b0& b8``&"@O@ `V`T`O` K Y`0 `u``a  Ŗ `@]/"@`y `Ȓ    aa ` ` ` ba  ` &", ` 8`  `2  `0`2Z``0`0`i "@O3 b``"  @x  " `20 && `& ͆ `} @\"@`  `% D l& @O|"Ă "   &&wb0[&T& L& 㿘 , d$@Nx ֐` b2``` @T" $ $V`$  @R$`2`@N^`? `"cb\ 㿘@'$%#$` @EӐ   !$"@67! @@@&`$"$$㿘@N@Nw" "@Ձΐ @8cρ @  `   `耠`c  c  㿀?'D' v'H!"  @@ ' '쀠B  @ '`:bh '@0e" @  KH`@AD@/ @D?Nb @#`D!" "$"h@&R$!ϐ @Ғ` b$"h @@0`a ?@@f* @`쀠`&@D@/ bh@۔? ΰ?@c@ۈ?@`@fϐ @w`0'D'H'D''L` ڂH`H`.@/ݐ bRDP@T H{'HD `'#b @Q $ b ` @ @D` gD` ab@϶cHĮa-`M $@? ~` ''' ''M #a'̀'Ȁ], M `by!@ `i` * T@` ?4@ @ `@  ^`@` `2D@`(` @. XH`Z`HaL`@` @P !HbG,L@`-"L``@? @` İ @`%ς '` aX``o@ @ x"  `w |o"M `k&`@VfM @Zl@]  @U @ PO; @\`2y  @Cٔr@Y4@i```e`` {Ȁ@_``@eW`DP@DLH?@E {DP@#DP@b0@#P X<@ @2&. `p#b@O DP@ DD c D a ` *`z:`'HdiHbcQ@L@Y H@],!  [ @ABa@8  ` Фb0   @A1& `<DH` a: D`'DDP@DLH- a'0@= @"D  @>('Lϐ @`X  Đ @T@ @dϐ @x`" @y `hݠb@ @cϐ @]`pʂ @cz`DLH`ޒ a'0} @b 0 @  b```6@ #b @` 4b @` 4 @ݐ ’ #b $  $  @  @X b 0H 'HDHb@ b01D`@\'@L@,DD`@b@ $`AD@X @\2  gL@`L@`2 ga`   @$   @>@@  @cO@E DLH` K`'0DLH\ '0DD`'0D ''Ȃb''b'''0DL`"!`?'HLa'H  0DL`!'DP@ ``?DL`!'0H#`b'HH 'H@ 4b @` 4 DP@ @ @' D`H @j` @ @H`'HD'DDP`!"  @P`"L`  0DH@J`@H`YH` "U'0SDLH``'0KDLH@'0Cb 0b @ߐ  `?` '0+D`'D!` DL`Hv a'0D $`D`'DD` DP@D`'@  @  @6 l`'`D`'DD`0߂ /D`<D ,`b' 0b @o  q` ?` '0$a @, D˥ ΐ @Rݔϐ @x` @+ @,@, bǐ`DL`H a'0@2 @d=@$b @&  `$ $ 8$ a4 ז 2jL@gla`'0DLH`Ȓ a'D!`” DP@ ` `?0X'DP@ \ɦch[`ج c@` `` @W@ZRJ`@V@ZH@ c  @V@Z9J`@S_   *   '0/D@V`@XV DLH`Y a'0@D@V` @`'@X?DLH`B a'@0@ @a.@%  @ @* @+1@ 㿈'H'Pb@H`'􀠠'TH` `2{`wb̲b(H{+Ȥ  @`<aH`8H` "H` "H`  @0Z @2c p" ?  M`͐  =a(`@@  'HH``" H`H@2 @\H`H` `H@`2` @Ф`0 @`H  $``;@=n `=  @Z4 `" c .`"j  )M #`2 @Uߐ@Y) [a@=? `ɖ ਒@=3 `2Ȑ@9Đ a' 'HH`Ϯ o`EP ` 'Pb` `2 ( " @YԐ ?@W  {p `  @Yǘ  .`2 `FH`H``@``+P`- @[F B``H@H`H@_`ϐ @ Ma ~'0H'0H @ c '0H@ H`H ` @* @G o `'H "'H@"&!"b ` ? `!"` H@"@H# 'HH0(#@b'Hb " 0"@  HH b(c}@#@Hfd F @(Ӑ ϐ @ Ӓa0KHbY@i /   @ `X '0:'H0+@Z c  }`b@L (P`H P2"T""  ?" @" '0@ a  '0(@a4` aX'0 @ tch '0@( @)H@`@^ @ aa '0'H H`pH@^`ϐ @ La8 ~'0H@H{ @H HH @J`Ho @HTP`  a R aX`"  ` "" 0` 4` 8` <` @` D` H " @XF H @U` 0mH` @ a '0@vP` L `^@GN!P @GJ!p0U@ g! @ ah '0n @(o aXb@㿈  a' `1 @(9 `  (`9 "`?`!`6   0*`ʂap@@h `?  `& ``?; 耠`   ``(K@2 `(Ξဢ ΐ @*  \ Ѥ Ѽ D d d ` ܬ ܘ h X H 8 (   H 8  , ۀ ܬ ܘ h X (   $ `㿘!" X`"" ""`" " * 㿐. ` ϐ @ ;`@'͐ .`$ϐ @ .b0 '4 π&#( `ϐ @ b(0ϐ @ b@0ϐ @ bX0ϐ @ b0π(b)(Ʌ(`І ݐ @//@VA 㿘 `(N`.`@.`ɂ`Е.` "ɂ`Е.` "㿘  (`9 ? c `2 =& `"9&  (`9 ? &  (c"-ɀ _T #"R @^L (`2 [z `"2 <& @@" && &  т (& &  `܂ +(`8``S` 2 @,, @@@P 2 @ & #b$@3@RZb& `( &&  @(`8`_ `(`2 @#" @'$@@3& }"    `   @UV ` '& &  )& & @O> ͐В ̒ x 'L/'''@&'b'D @Ғ  ( @& 4L`) 䀠`(# ' @@(䀠`(Db @UL@SSD @%ܰ @T  @ C n''@&Q v 㿘N``@@b X @Tϒ "@ @& @@@T&@  @ (&@& `F 㿘ʒ`  `" b  @T"& @S  " 㿘`3  ?߄`?`  !L "\`" " 뀤 G #T `?ڀ`k c`(ɒ?`ɣ, `Ѓ,  @@``8F  E W? >   F?耠`( Ѐ " 8 @ - @b$ @T?`, ,  @@`  ؔǒ   @`? (@ 2&  ` `$ Q `  $  ` `$ < ` @              @ `"`  `%`n ` $  u$  @I p @ k @3 f  @`@   [ Y   U  Q  M  I8  E(  A   = `3  `O ,$ @R/:` $  $   $  3 8"  & 9 `?"  `$ϐ   M ϐ    x"''ܔ&@   | 0   Pb(b4 ! 8` ( ( b(㿘!" @͒ @O" $" 㿘  @4` @ 㿈-@.y0 @d! 2*#b "&#"##@m b    @+b$@O @b  #\  @ ? b$ .@#5b4!"(`@: $bɒ04"(`:  "4(8 $b!"4$@) "4`@ %b$> b ?//> > // @/b @ @毐b   @W b %b$@ #㿘 +c4  /;b0@``?(`(@` @ (`@ (`@ (`@`ހb4@ ? @$@8` φ ̀$(`@ 40@- $@& &   HbJ '    Ɂ9 b0'"4%@N8"@Q $,@-sb0$,L+)7 3@"$@ :, ," @Ӕ! @%b @b @S b   @ %"$``b  #\  @ ?հ ` `"$m    ``?("耣` +` 耠 P ?1 `?* &2?  ,b$ϐ@7&@g! d  $$@唔7b @͡@ @ , N"$@Bt,    `2   "4"$@gb @˾ b   @ *$"$*b b 0!@ܒ @Ɛ@d,@ Đ "$0@#"㿘!"4` !' bQb0$"4? b㿘b0!", 1@b2  "  "4ځ@-",&" b$b0b4 "4$", b "4Á㿘 '耦)%"4. "@8` (`40$$4%""@@xX4㿘b@Ib4  $ 8`@?@?㿘b4$@?8`@% (6. @@" .`@K &@@&@ @3 @&8`ݰ?㿘b4@  @@ڐ# 㿐@+ "N ) b4!(b4`D=ϐ`? 5b4 ": ? &/'4* @`&5b4 " :  ?k 4'䀠@#@ݐ @}# Ð@v#(Ґ 㿘!"b4  '4# ` "b0"4$"$` )'!@` 4J *` 4`   `!@!"h@! $"h4 `  `@  ,?Hbd>5c't cd      @'Ȕ??Ѐ`C8(`@Ґ@`a 5@'??(`9t`@# @#X  @4ߐ#x` `@Ґb @,ː'tb@Ut`π"@@`뀠``c造@ @ Œ g ` `?Ѐ`ax Ҁ@`? `.5+@?`a9`;"4b`":@2}  @@2u@_  @2km@@.f @A#pa XπU L`2F  "@`@`倥2 L  A`8@&@#b `''̐ '' @1  )耦`2'$ @# G D`@_ = b@)ޒ`$`*`w"40@ؐ# $@ @$@$@@@ `В  ޔ  Ԑ Đ `?2 b  @@   z@`? `@?a`@1O@@3#?e @I֐ @K t#`bht@ $bh  @4T "l` @Րx  `b4'( '''"@2 :"`$@ @ @#":02``@ ; r`? @@TS@ 85 & `$@2,@$'$0)@T@@ @2 @ x Ђ``'t  Ҡ@ @T&@  b@(ڒ`m0@ @$$@#@$T0? bb ` ` ` `  b `b ?Ђ`"@㿘bl$p@ @\ ,"  " " А@2@u  @3 $`b$`$@&ޤ`㿘  @3  @3   @3  b8㿘 b  &bb`  @?& b & @ ? b  & @?& 㿘b  @?$ 㿘b  b`@@?$ 㿘!" @"?$"㿘@ @㿘(`8Ѐ N `"8`p`N `` Ё?/ @϶        `?Ѐ `aa &@? `?Ђ`&(@  < @@  㿐b8'H'L'P'T'X H!'@- @,; 㿘 >1"h# `b@]< 2 ߀`b@ ڀ` ր`b@`Τ  `0 "@ @+    @`2`0  &@ ` &@ 㿐 @bT NC) N`@  $` "@ "@ a` `@  `瀦  b$ "@ bȐ   b 2   @ `@ )"@   @ Ƀ(`ϰ  㿘b@ Hb@8H`H`  " 2@ &      `" 쀠&Ѐ bb Ѐ b b  а "2 `"ؘ Жb"  㿘 `& & b@M`"``b'` !2  @X☀`2 `" @6  "   & " ?@7&   @&  9& & M`% b` ` t!"d@' |"d `"q  & 4 `"@  @ٔT `"U  4M`` `";  ( a$ ,a$ `  a $a `` M`` `!  @&I  `M```’  d"@djaT 4 ƀ " (* @`" (@7 ({& @ & h h&  <` & @dF@O@LА c| 㿐 @Ob "Β``c`2``0  b0Ш  cH`!    `$ $  ` 2   @% 2$`  `5` `2`!"``e``$`H@" H` `"'``  b`2N`  @  @  #(` `߀``@3  ـ`@``!$`"`  n' #@bd r  @ @K ##@d`0w$`` <' h7`@ `` < @ `h2`h@u @K#P @z Ƀ(`ϰ u  Z @% V`h @l`<"``Z`h` @`TÒ @YT"``bd@2b@KА cx㿐 @2b &@ 4 b쀠' В @ `  @&@b@ b쀢   @2 `2ݒ  ? @ @ `آ?(`Ʉ 0Ν㿐 @ߒbbD  А c  @Ұ } `2   c  @ð } @ 㿘 0  0  "@ϒ  ?㿐 @b "0  ``@   @ ǒ 6 @e @Ju `@ɒ   @b Ƀ(`Ϡ ] 0  0`" `2" 4X`b Xc 㿐 @:bbD`  @- 㿐`la @bl` @@ l$@$`$``t$` !"D`<"D @ < 0`@;P@  '@`#JI ⤀`E@@,  `? $` b@L` `` $@ղ` b``  `@` ` @z b@=*`_  @   `X @ ؐ hhw l hb@   @)@"2$`  $$,$($$$ $ $b$ ` $$0$8 < bD_ d 0ֆ`@? b0G@ bv$` b `b` $8` ` `0NL ` 'ѐ@&]`0  Ѣb @&S 2 @$" @"˰ ub0bѐ `  b@` I@bDQ @ @L`"L` HL``:Y` bP `, @:,@3J a*` `@+ L`2  @2!P  @2!pb2ؐ @: 蠒 "ѐ L @~ʐ@ِ LQ bܨ? *  @1?2L㿘b@N "?N N `\' $`1 ɲba@ *  @1А@2@``3!#"8bd@ @\ "@d"8 bd `"8$bd""``"L" 3@`@aT. b`ɲba@(`@ `  @2@N `@:2` @1 `@@:  1 "`aP ' $`ɲba@ *  @1j@2@N `0֐ Ӓa@"'#@$`$bd :``'  @1L#0 @' @" bd@ @H6є` ]$`@@H+єa {&b`P @@Hєa  "8&b`l$bd@¤ @Hє` 8$"`㿘b@ d b@#' ( b쀠2 ``2 `".L   &  `   9  ݆ @ U8b쀠"! L`2,@  `"L`282 с ` @]b @L L@ǒ  #b@'㿘 Pb b bT@U  ) bʐ#@0b b@L `,   @&ٔ L  b\L `!bܤ? (`@` @0n `?2L ` L `@8 , s@-@b쀠@2`2  bX@"?@iѺb@d?751?@  ?@U@ʐ0 2  " @2(,dh$($, ?/$(a$,! $($, $lp$ $$ ?/$ $$! $ $$@ H$ ```  $  0  `&24$ ``"$ `(@$O``>~? `O``".O` `("  `"P``22 \@% \ @b\2 O` `bxO``G?C? `?HV?$$P`1&P2<0@  H)? $ 20 Ӓah? u$ ?$ Ђb@\$$?$(Ђb@=$,``$ `8@""8"u "m e$` ba1? gO` 8 8 4 6$ 4 4 4 4 4 4 4 4 4 4 4 4 : : : : : : : : 4 4 4 4 4 4 4 4 :` :, 4 4 : 4 4 4 9 4 4 4 4 4 4 4 4 4 4 4 9 4 9 9H 4 4 4 98 9$ 9 4 4 4 7l 4 4 78 7$ 4 4 6 4 6 4 6 4 6| 4 6X 4 7 7 7 7 8 8 B< A A @ @ @ @ @t @ \ \ ] ] ]8 Q QX P QX P M J O N N N P P Nd N( O O@ Mh a@' ( 8 N `  (`8`:   `) "_: @ Z : `\"hL@: `!"+L@:  w`t`" 2 "` (: `܀22&  Ɂ``!א !bh }@$ @` @&$ &@ё(  o Ƒ(: ` #` !` \@  : `?`\ L@  @@H`߂``V(`̆,   `xJp%x(@`%p`ђ$@d@Ѐ` Ѐ@&$&@ {(А@ $ " 2  2@ g( d(  H `I` 2  @S(@ǔ܀ @N`@`@ N@耥 x․   (bh`"В$}@0b/р $`@/а` //Ф  @^` @ $@rL0P`$}@ߔ0{$@6PАВ .@N` 2r*0p /Ѥ`l/Р@87@ ِ`$@0^ /Ѥ`Z/Ф`Вa8@r$0R@8@ `$@͔P0Eb`$@r0>` //Ф8 @9 @<@9y 8@<@Xb@Nm ˒@9j 8@<@Nb 2 ~/Ѥ`/ʒ "p@NF`   @N@  $@qȐА@N7 2*0bh`M/Ф`  \/Ѥ`//Ф` @9/ @`  <`? `?˪`ɀ  ,#"@?`q$bb!`H 2 * a` A@Ҕ"  I!``S R!@&e!`I!@&a` B!`>h`2( 6<1!<`" (.  " " "h" <b%h`  "@I ` [h$` [ ! [ *p`V \,@10   [,, }A | ( * @ + ? !h '  \ ". \ , ` @   %@ \ 'ր "2!, %@  ,ؠ ( )"`,Ϡ }Ȁ *@@ ,, " \@͒@ , 'o ,, )K ( '``%` )l |8 ( *  ,, ` @ %@ "= \2,hH ဢ \r $",Ā \ " ",  \,, ` \2,hH  \T $", $ \ ""1` U, \,O`8 `( ̈! '"%``2n,@S@,4 " \` %` ("` ) " '2` %`t`&t``%`H ^ \    !9?Ѐ` y -? #`/()p` ߀ ۀ ـ ,@l`@ԀhH 怢 \(` "$ 2=,N`5L`1 (`+ " Ւ`L "hH U \Rp`O 1 & >J &t`S   |P$ B$$$ $u!v b? # `#hH  \p` (  ,, ` @  %@cT ( r 'c \ ,t ` @r&t  %@JhH  \p` :, ,4H  \p` ( { (``J`   X,,p` (`   $@@  *hH 䀢 \ (`  X,@,`,``` ` @ʒ %@ ,%`@H`x" `􀠀2`h~hH 4 \2p`/ `$"!,`\`"t $@  `h ,, ,  \ ,  , ,S ~Ӣz (` {hH 倢 \n ( ` @  %@%` $%`, f ,a ^``%`,@(@N ,  F%@``q%`@N@ ,t4&t ,@2@ت  %`#``r , ,! a@ Ɂ ` @" %@ ,t` &t`)%`hH % \"p` ) `@$ @\Y ,@ (,   %`%`%@  @ ސ  , X( ((((*'  p` Kp`H $K ,!p` p` ( `  @ђ %`%@ %`  ,r]  ,, ` @2S , ,h H` `\p` 9,  ` @ b ,@hH`8, ̈!, : `#  (``ڤ `פ ` , Ҥ  (` , ,@5: hH y`  :"~, # %#`  @~  %@ (` , :  [2,@4$ ,@$`J` @   * L`  ` 2E, (` ; | hH ߀ \ |• &  ` ",>  `V , \f` c%` \p` : , ,hH  \p`{  #v %`  @  %@z`8%`t&t3`0%` &V h` &tp`  thH 2 \F $  ,,$J`  @ M  ,  (L`$`*h`",,"` %``%`6yM&,@/( 4* @`@H@!~h `(@" "h" " <%h  $,,KÐt&th )〢 );a@o @ ` '$``t`&tb!`''ΐ!''`$` $ hH * \'p`$`& " ` "h (`8@  @ ,hH ڤk`߀ (` `` -  `"@``%`Ժ`@8@ ! > ehH  \p``  `>  @G ,hH 倢 \` 逤`  $,@. ,mHbZ2 hH D \Ap`> (J!$?"`? (3  v "4* @TP3Ȑު#p`   U  !tt&t@A ȢĀ ( ;F |f &` +!/!(`@"pa`@  G  a `}@bb` h `($" " "h" <z%hl@8"Ɛ"Hch! `" >' $hH  \] -` $ ,F!M $p`  $$^$$b'`h, : ` `\ p` r"8! * @?`$ b('x %0` ` 00$x@ ]0 C0b@/<; @A : , `\9?@x[ @Xe @A % 2N?M`"$ " "" @ϐ 2$ @@ $ x$ $x̢$ x$$x@A ? ܒ.ذ (b| !"0` "0"0"0@ $` $`@ $ < @@2$ $` (@+# "`"!"""@"bx C!"`تѢb'<%   " $ @c 2$ @@ $  2 Ā @&$  @, @-   "Ņ @*m $ $ @,K" `|㿘 !    "쀠2@L  2 㿘b  @  㿘%`` "` P` @` @2Pْ`$` ``2`  `㿘!"`@" `@" 㿘#b `"  ` " @1 "  ` "P.`P`"`亐``  P` ` @ǰb`$b` @D  T`#HbJ^&# ` aX    @@aX@b82 ,   !@@@ 瀦 㿘#b D`22 I b$ $ b$ @$ $b㿘 2HbG!"(`0` 8` (@`n2  ` " c "@(  "! `!@  !`2 L " !@!" @ !㿈'D'HD`$HJ' '  H@ bh'' 쀠` bb @ߐ  `   hєb #b@b!`H%D`<"KN 쀠`RD@t 3V@`2N `LN `H'AnD  N `"D`$"V@ K $XV@` 쀠`"`2$"b`@ D`<N `$D$` $쀠`D 0`"`L  D $"  `D$ $H`: X h(@a( `쀠``# HbID` `D  DD  `Q E T bh֐ А 㿘b `" " " 㿀 'D' @Z 0'H''L'P _?qb'' b @  L` ` ` " `" ` 7 єb L `L `H 7 `'D ` @ `$  ` `  ` ` (@a` 2` P`aX A''0a[㿘 /@ 2 @>b  @>b耢 @>b @>b`?p@u#+b0K%b  D@tÐC7/@/N%9@.@@b0 @"Ēb0 @!b0 @{"@b0 @@t"b  b`o   b@  b@`c   %cА $ @” 2Вb0@)(#@* b b@U,,@>a@  1 , тc$  @ a  ,!  `  @-8   @ b 8    @-&" #@( @,.J`/ @ -J@`[ `@*S @%@(ɐ#@*ݒ@(Ġ @*Dbp `̆` ` `@#$b@(# ` b€`V` @a!8bр`(Ԃ`8'$@(" `b`@b , , @g rL`րL`"Q  `,D тcH"    @< . $` @Ji  @ʒЀ <@@"L L,`-@ L `%`  b !$  ,,H`2L L `2L `2^L`"#L ђ #  t@ "kߐ#  ,, `"L  ,L `S , ְ `@'#@+E# J`ڒ  Ė 0@+9@<ْ # bL`2 @+.@b( Vᤔ @)\@NbS @3@.K K, #  L`2ђ #   Lc@ð  @'#X@* Ƀ,`, 0 w`. @"`"  . `:  %b6. TH@`2ߒch@ J@`2 U@4`02  `02  `k1 #x !x ! ! ! @Ґ!1Ҳ!!㿘҂b(``@ʒ @?,@Ӓ  " * " " " "㿘      $ ` &@$$ 㿘 5@)$`$@" " @q5 `㿘  @    @ܰ  ?㿘 @ `@ `#@Ԑ @"㿘` @G   L`"  &@G"` @Pڦ$,@Pϲ$,㿘b `j `@ɐ " @``<  @)@$ $ `'Ҥ a؀  @  @ @ƀ@  @ \2 b`ǀ Ҕa @@ m Հ@㿘(```(`a2  I `(`1[!`Ҡ a造``@&`H`(@&`@ (`` ;``' 2`H`H `N@ `0 (``;`  1$ ݰ ݑ 㿘 Π b@` (```)`|6 `@9z @@8 ??2  퀠 ꀠ0㿘VΪ b   @/`2   *!  ? [) ]1  |4 )`G`??〦@ @98  2) `  @8`?Ȱ `" `  "  ۦ   `  ۤ ``! ``]"`  ` ``װ` ``  㿘` @,| (`9 -]&`` `u?+2s&`X,- " <`?-&``:*`;(`,&`#$@8 "NJ  :d ;b , #,,L `(`"Y&`&`N`:7`` `"*b  < ۜa` ` ?  ?ސ H`-"- ?``9 `-&@@ `@&`ږa  &`?&` ?.`&`H`ߨ``&@&`&`Ъ?,L&&`&`@8RaH "&`&` ;"?&`N`:@`` `"9b   =b` `  ?`&`&@&`,@&`&` (`&`&`&@@8aH ~&`|&`˖a .`&`u :a@㿘ɢcL   %. @ @7 2 ? c0 㿘 1// @ ``  @8`?````?"Y`B`*`[` *`JA`8 `n? @@ *@ & "    2? * 0ʹ00 `? @ %? @ b " Z Q  @մ0y s?@ ot  0  & `@:0P`N` `! `[|`;`[   `@" @ " @ ``[ ` ހ ڀچ (`]  0 `:ˆ [` :b? @6  ` `l  %@ 2`L`"``@  `-" `"-  @̚   `: [@@`@ `2 " 2t  `[+`] `:   Š ]π  ҂ 2ς ΀@`!NK Z 0Ӭ  `]t ` H 0P a@' !`"  @lq@ln  2&`@@5`? @ 0b`@#8㿐 @$N`H@   |c&@  㿘  "؁㿘   @l @Y-h a' cL@ (@ H``H `"+@`%(b+@В` @ #@㿘.`@`b@H@ۀa `Ұ@ ה(aҰ@ Δ(㿐b@I)     & 9 ` ) ) ) )`&b8) $〦@@'@2 b@A2) HH'L`פ`bܒ L Ҫb@X' ?,쀤 A0``` ol ?h` s `%H2`P@"`s`%ڐ Ұ?bp예`$L܃+`"LH-`? 2H+2LH`L  `b@H`2`(`(`#`'L    ܃(`@ L N` ʐ@Ò J`ʒ̐#?䀢 z M@@{(@P`@ s䀠@?m` h'gҢ "8׍ ',`@ "`@j,@ ~ ~'``%,`   Ԛ A (@WaP@j! *Ґ"@Wb0@j""ɐcP(H` ``,@`"* 2H,@*`bJ`-  @` /  J `-`?(bL * L`, @`   %2L  ` ܒ (@ @(`@``"@ ܐ*@ ܃.  . @ '܀` Ұ?"`㿘` `*@: +`8`.`/`?K8  `/ `=`." H  /) (8`` +`8`/퀠`+``/")/.݀ H` 2? @ ۅ+`@օ+` .)  +``/2 怢 ?: @I`/2? @߆ ) ) /) ) ) @  Ж㿘`N@`/i`.l "z 2?L   "N`z`$N'L'@h2H/  // @i@  @ސ@h "&@ c`:a H@ 1`: @   G&   ̰ ' Ǩ `(`8`."`8/`?`?    (`2˄Ј  s`@h$@@gH/t /`p,@L`/k b   㻐 ' ` [@(`< `/" 7@2; / \$`7`=<  /. @ @ 6@gr,#@ 4@({O/&@ 2@ *ʁ< `.̂ /`.ł /N`. /(崔?N`/2޴@)`2ڰ հ@hE@ x㿈@h=`'' ''h  쀢  /* "@* 㿘 (@h @#b@f `bz`b 0$bb@fے    ԰` 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 p       L @ @ D @ @ @ @ @ @ < @ 4 ( @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 㿘`  `" $`  (&@` 8 @`&` &`  @ `0@?`$"㿘 `U . Y-   @ 0`@ $* @ 6$@` @& & $*& ?` & & & `" & &  *&s*&Ӕ`H@Fߔ ?@& `"Ԥ?d@d@2Ϥ?   ,*`      @ @ @(& & & & & & @΄? $"㿘]`c @C&@@ex@ &&` 2`G ??@ @`J  5` @ 6$@=`` h@3&&&$ς?@e6@  &&Ӑ ```6Ӑ `x$@e @&&@澐$@$@㿘 @fy?㿐@4Ӏ?@@""`` `./1` @   6` @`@"` @&@&`$?`&`(@`&` Ҟ`̀? Ҙ`@@Ͳ?`$" ?`?㿈 a@' `  c N@ @ %` n & (@``& N@ @h2? a@ \ʁ   @,```L/` `(`J8@Ђ (``+ @+` (`8+`@`@Ђ8 8` @Ֆ`&̸(`Ƥ Ĥ"@@  )`N@@ 8 `8` ` ``(U(`/ "& ' @b@  @@?`0,`    &  (  &  `L 2 @=,` 8`& (@`? &  2 ͒?2 '@( ``  4@(` / "'Ӵ@d   @  0 ,@  2,`8``ŭ%` -%,҆ @4  ,%@?` `X, 0(% `04  ,%`0 0%, (`: +R-P N0" = 0`[ &  (& ? `  (`8``x( 0 `"5*  &  (& ?` 0,`8`  & (@`  &  2  2 '@ +%>, `Ђ: ҦvJ/% %*,ڐ 0?㿐L'L'P'T'X'㿘@" ??``"4` '"`*&`&@(` `&` z`@@&`@ن` `&`*&` &@u ?``@`0㿘& `+ ,. & & s  & @\`2 `"  ` @& &a?, ?h@2& & & $& ?@) $"?㿘  & @`&  a ?? 2 ?㿘>`#  (@9 " $@ ` @a  @& &&@`.`".2X?"  2. Ӑ ϡa0`4  㿘3`&  3? @a  @& && @&@a`k h` Ӑ aaH̀`㿘   `&  & (@`&  ,~ n㿘 ` @) &? & & & ?& 㿘 `  @ &?b d2 , }Ӱ ,}Ͱ㿘 `Ӑ ax4!"`&, &&&?&(&&& &&&$& 耦ӂB`B`}Ҵ&&&?&(&&& &&&$& " 0`}ɶ @ @ ?` 'H'L'P'T'X B H'-S`'P'T 'X`ӠĒ P'9Ӑ aΎĝ㿘`+`+"`?Ӏ     ($ ra & @?f@& & & && & & `& $`ٴ` @\     ̀``Ƞ` @K  Aa ````㿘`"``*`"Ӏ >1#& b `& & ,& & & & & ` & & (&`& $ @   aހ  @      "Ͳ`̀`b`|d& ²``#b0`|۲b 0" 㿘""0`0!"|˒`"`"" ,0" (&&@uo  `  ` @Ĕ @ ` )`@ !,|e  # # "`" h!# #` c  c  ` 㿘b |~`22 " " " " " " 㿘" " " 㿘!#`c! $#@`:`@b܆ ! $@`  @$# cb$< |U, $`, @  㿘!#`9` $# A߮B? c!2 ``! `? `$#"Z.``@`:!`@ @`&@1`9`2`A`UJ ޤ c!҆ Ha`͆@ b$< {, &``, @ ` `@ @`&@! `? ( `?Ѱ bʤ @)a`? ) `?ap@@ I`bʤ @)a`?`! ` " ~bb`쀠ʀaʐab @ `k㿐 R   c c `,b5 ` `@  2P`.//s"H+h `ذ bܒ  @p`"Hbܒ @T"H ` @ҐE" 㿘``& ! c c  @8`@(` 㿘` c  y cn 㿘#c`-c@  !"$c ``!Ӓ""& H``2 a䀠 ԁ "&  ?$c!@  c`& Ӑ"p㿘@ *#c %``|`?`$@       $ c`   |`?`$ $c 㿘%  '/ d`%#!!   _!  b `2Ґ $$$ +` & ! ;7 " `;`  %`  $     `h2Ҁ`π``ˀ`$`2<`ˠ 2݄ $z  Ȫ㿘 !k y  #& !#` c$#!! $# & R ` $ $ & X  2& DH , c㿘`c ! { }?  .  c!! 㿐(    X9" y`"'`y @" @'''`yy @+c` @~'/%c!=!! `!ϐ! @ ߐ  & & ͨ  ,` $?`` ``"y `& V``"y`"x`U!?!!׀!<"  ''a`''`%c''Q  m!Ѐ! {!( ("    (Z ) ,y/%〤!" `x%c" x`"x`  V%cbh5" @ %;`V 耠c@ @``(@ $a@!ǀ! (^ "xw` `%```%c ! $ &  & ! 5 쀤;$"  ' @ x & Ā#%b"@x & ,` "`xu*`!& b%< xl, , %b"@xa & "$< , xW, '''_"?! K"! &I! @   @(!'@!  "`X!`& " @x`c` c!u ;  %cI& &   { }a  v  !'ܐ& W! c` c! {J }c' `d-|" @w֒`Q c`k% ( %c@ $@c` |%! @ "$@< wē, ܡ, $@c`* |% .%c$@"`"@w  %  ) % `"%@! "!% &c`2  %% %"$@< , w}, ˢ %'[ & ̨  ϐ bh" 쀤%c"ʒ`@א! $'!; 䀤b܆ $' ڤ      ̤ s " " w`$ * (`  !  bܒ @   ڂ$D%` ,``( `7%c%``3 ``84N N`bN``b@ ߦ )Ā "%< , vܡ, '%@$b "6  ``bN `զ쀠p ' `%``~ ) ) @ %#!@ "$@`c`2  %$@< , v,   ;$@`BF"$@"`"@vx 0\ R% u%x! b$< , ve, '''"$< , vV, '''" < , vH, '''"u`" 8, v6,  %c @@% °Ӏ! bӒb0"@#b` M"@#bh F"@#c b="㿘@J  `(`@0 = -ӂ`(`@& =%ӆH O " 2 bh`" % ``70` & `0Ӓؐ" {   c' & `u  $ ``u $@  ` (  :@( `( `  u` $  @   㿘 c c `a!$#  h 1``?#`&#c  #`#"#֐   $# c c㿘%pb0@_ ```p`T `" @@ `" "T  " `2T J `   J) ` "`"` "  `@`  ` 㿘 b `t*   `  ` ` @@ 2  @4 8`*`ٔ$@ a`㿘 % ` (` N@( N @ "@" `㿘  t.`` ( @& .` @"& >& $5 "3`@"-,`@`"`@`bJ`  * `(`" "??`" `@& tt ΢`㿘 9Ӭcx` @(` N@,@ "`N @ @@ 2N `` ,}`@" ꀤ@`m  @XJ@s "" @"  " " @W" `%`$@"" " " H@a `b@  `a$  ` " H`  b@2  㿘  ϲ``& ``@?``@&   ěc `π`&  & & 㿈  !  ` )`"2 HbJ0 "&  " & c< @ݒ'& '' @~° @~c  & ` ``@`& ֐؀  "`4 㿘a! !!`    !0``   㿘a$   `02` `  aaa aԒaP`4 )㿘ذa a\܈a  @ @ ! !  " `!!ӂc&$$&$( T t! 4"``& T&"@& t&!"& 4 #( ` `  ӄ c&    @3c )N8 / |N* & ((`8``}  } $N`{" (`8`   N   { 㿘 `  @? : $ ? @ ` @? : $ ?㿘Ӣa `   N? `  (`@(`` (`` (`` ߠ  ܰ `  ֠?N?@ ` 2ˠ?` 㿘 "oe@R㿘   oY 2V2   爒 %` " ?o@ %  " $@̒ $@ `$@ t` " ?o# %  " $@ $@ `$@ =` " ?o `-  n $@"`" ``" ` " `" ` ~$ ` w$ ` $ `2ْ$ r% % n %% Y %x %%㿘 bԺN  %Ň(``:8(`ӒN  % *  : Ē  *  ّ: 켒  *  2: N d+O  *  "N: 줒  *  2: N옶N(`0`(`Ԑx@ `"N@ [`@@  @[  a ```@ 2 "N` zN b| `  (`O ) J | LE A ( (`8``} 6 }  $1L`{" (`8` Ϡ 'L ɠ !L    "   "    $ ( ( *   :   *  :  )  )  L`"```$2  \ޒ ܒ Ր $ (Ғ *  "ݠ : ̒  *  ӑ: Ē  *  : ʠ L ] @Na 8`;0뤐 N 뜒`  떒?  $N 댒?2 N`6א #  -?*? @z {N v ;В `" @m  ` i @@ @H2oN@P8Ӏ`XӘcPԐX@u @n`@gH@ Ԡ `h@\@ Ԑp@R @JxT` "`@> Ԣ@4 @,Ԑ`@%@ b @`(Ԭ`Ԩ``Ȑ@ `"` @? ?@ |2 `@``Ԑ@+ `@Ԡ`` ``@Ӕ @Δ ` @Ɣ@ 2TԐ@ 8Ӏ` Ӗ`@ @(Ԑ`y0`@8@@ ԐP@ TԀ`XԔh@} Ԑp@u ԐH@k  A"Ԣ@[  "4Ԣ@I  Ԑ@@<`~ Ԑ@4@.Ԓ`@(lԐ @"0@^ `Ĕ@?'P'T'X @P 'E㿐P'P'T'X'㿘    4 2 p  @ 0饒 ,  " IapԴ`ˁ GԐ 05Ղ 0ԐԐԐ@rԐԐPz 6`` 㿘! " @?$"㿘! " @?$" 3|&aP!h  @c   @ $" 1!  @  6"` @%aT`@@&aP@9 Ԕa  @% ֐ @%  2А3԰ a@@ Ԕb р`@@Ԕb0 @"?$"    ,  \ d , ,       ,  ,  t `         D                  0 !$ "\ " " # #4 #L #d # # $ !H !, !` ! ! ! 'D 'l '< '< '< ' ' '< '< '< '< '< '< '< 'J`" (` J ` (`2 `뀠 (`8`[ `]"?H`(`8`[ 2H㿘ƒ J`?㿘 J`"J  `=`? J`  `] `[J``  2J"㿘 (` N`(``2 `[͐ 㿘 @M& ``=&   @03@1 2  i @:    ~$`$`$`$`$@$$`@:    ~$ $ $ $ $2 `㿘 [@> b"㠕 b@@㿘%#T  `  㿘  * 1"l hb0&"l!!4 1hܒ"0aH"0$!4 Ғ ۆ!  `=#T ! Ե 㿘25 -`"  a@a &`2@& !@a&` h``h  @```h & ׂ!@h 㿘    @L@L   &`h@K&  =,  $& @KȐ  hV㿐@LՐ0 `"& b `hv@0 "^N@@@:`J? c @: `J?``2?`"@ 4 @ #@@@(c@Ԁb` #\ ꜐@2Ql(``  8``c`"  8)#(@P`)  (``8`@ c`2 ` @` @`N@@`@G) `WN @(``ӈ  8``c`"  8) T(@P`)  (``8`J@J @@@r #\bp  x@8``02``N@`0"``㿐 .@ѐJ`[  %.@?ڐ` `gN$@͔   c &g8`"x㿐#b`A (c@ b4 ` `$ 4 `"` `T``+y "`Tb&b"  &  & ``& a&f 2㿐!"`_ (`. `"#`c4$ $  , C$c4 `(` +` +  `(`8+ @@ @ 6; c4d$c4"`  3 T 2 }`.`n& Ma&$$c4L&$c4߂`(`$$c4+ c4@ c4`-Ұ<aX$ $$c4$ b8$  $ ΰ$ 4} 4Ր (  * ~@m&a"? ha&g6!8`@|,@S     ޽ b 88@ 0#bl eݒb0$bl@SJ`/ʠ@p  Ő@ߒ <@@3b0$bl#a4 !e"0@0%"0$a4ܐ @' `L ` ~@R&@$ da&~@&ga&@@y~@&ma&~@&@  a&~@&xa&@ΐ@㿘d b  qb ]  b,`  > e3& &` ="% `a&  be`.  ˠ `a&ސ耤 o& `&@I|@8  Ԕ b0  㿘 d`$ ` Y} @ ``Ԓm"㿘b" & `a&b"4 4" " @ "  T㿘 ?`(`~&chΒ a&`0&&~&ba&~ &b@?* ~&b@F?* @ cd"㿘 "   &@ ? V 󀎠D  (`  I  c; c % () ۂд`  0`Դ `6`ʹɅ6ɀ@| L` -܀#` ``$   (`;`0    `2 &@` (`; " xX @0      (`  2    (`; `0     㿐a?`"  & & ba&n  c&h a' V `   @ TԀԪc> =@$    /@5 ,@n>   #,@`  ,@|ؒ ,0&0 ڒ0Ǡbۑ`0 -,@!㿘/!cI``!     "` `  < T 2 8 &@&@< , c6, &@`&@c, TP "T"Tb( &@Ʋ`&@< , c, .y&_ 倥㿐 `?H"㿘  (`8`[8`=b$HbY h6`.@쀦Ԓ"3 `.@4bbL`< 8p@@b8 `y "u b``   @` $ `$ `2$ 2b  2" 󀤠" b6  4& `"  @HbYx @cȀ ѐ@c 2ϒ X ` 󀈠` Z ` @cX KhϦ  b2@`"!@$ $ e  b#` $"  a 2     @@~$ `    $2 $ $ݬ  Ԁ2$ au  @"?`$ (` 0}(`y  2  Dž(`㿘%Tb0휔 a؀ aآ`TZ6@` " " `㿘#b T   ,  " a < ` 0 b 4b ` 8 ` < `  @ ` D ` H `a0ba`/ `נ ޲ ڲ㿘#b Xa&``" b``"`$ b`$   $ L.$ P * b`$ Tb `$ bh$  C < < < < < < < < < < < < < < < < < < < < < < < < < < < C, C@ < < < < < < D < < < < < < < < < < < < < < D < < < < < < < < < = >` < < < < < < < < < < < < < >` < < ? < < < < < < ? < < < @ < < @ >` < C < < < < < < < < < < < >` < < A < < < < B [ X W W Z W W [ W `0 W `d W [ W W W W W ` W W X W W W W W W W cP W W W W W W ` `0 W `d W X W W W W W W W W W W W W W [ W X b b W c d W W [p W [ W W W W \ W \ W _ XP W \8 W W \t Z, W W X W W ] W ^ W Z8 Z8 W W [\ W Xx `0 `d W W \ W c| W ] ` W a a W a Z8 W W W W _8 wd n n n n w w n n w| s n n s n n n n n n n n n n w n n v nT n q l p mh mh mh l` o m ʂb@` (``    .     @ [ `[`(`{  `}?`]"?  `)?cȒ .`, c c? #H` @2? (`?,  (`   2ސ??,  ??`((`8`` @`"? 㿘@?``t?(` (3 #` 2`  #` &`$ c ?, `H` 2?H` 2 ?    2䰆? #  c ?    H` @2  6?H` @2? ܰ? ) 8` %L`,`8` L@  y`<,``%`<`<@ \  @' \ )` p `2)l`R L`0 @ 8`   %@  "L4@8`6)%@`@ `%@ %@R M)` 2  -)` , C  +` <S@`d  H7   Ƅ 㿘`\(X`P@@? yl yj w `@  <(``㿘! 0`  0`Zob0$ 0$`$`㿘yK yׁ㿘 3b0Z\b0ZZ㿘Hb`  2   ^ y.y, @y*y # 㿘 `` @=` `@$ $$ ё㿘% Za0 Z]0 $` @=   $`$` $`$@㿀 +! ",`ycc )%c)#Ȅ```  #\#`t l#%c  D b,#`  c . @ @>ds  c` ' `$   `( `  $ `$   `(? `  #Ȑ @ `$   `(  ``Vc%c$",%?㿀   #\#` s  xpt  ?㿀  +! ",``cc '%c'Ȁ``` @?#\ ?#` sR `B耠`G.`@@=  %c `r 쀎`  b,H/    tS`$   `( `I t@   b,`?ò.` sɐ  .  @s@   c 'M  $",`uc %c$",^?Z?ws% 㿘`?`$@$to " #c@=! & &   @%c `  `#cP  `  ԰?c㿘 '@ʢb  @W?`0!?``y(``c  ʄ b @0`ٰ`  cȔ  ` $ `$  `(   `Hbb? ``$?#` cܦ ) 8` 00 u?) `?8``N+`) ($ ׀ Hc c^` ? nb%@ ;! 0! 0r?2`,  @@@n K`,(T  j``( `s %`,r`0 r?`,r   r?r?Ѐ` #ct`cp@k cp$ctcx(O# cx9 $ I%`,`,`"#`,`%`,rc`0 (%`,`,``#ct%`,dc  `2&؀@ rG`0?Ѐ` x#ct(`(`@Ђ@r8$ct`0 *  `?  p~}axЀ@  #cԀ ,   #؀&؆(c`(  `  $ `  b,`,` @ y`, % #p K܀'k  ܈# )b@K` ` `` ucȂ M +@ -)   EȀ C`` c (@ Ȑ f q`0 cx#ct  %`,#) cx%`,c 5  l  qy`0D@@cD  ( ?π`k pcxc+@O# cx ނ %`,%`,` l`0|0`# e0#ct `, Fc耢   `H耠`s`c`CZc쀢  qy`0 `D/?n4ڐ q i`0$ "# x?π`q$ct?Є $ctp%`,X`0? p p%`,Q`0cp((Єp cpG`0 pV pT p?` @ 8f` p @@ Ր o  cx # cx)R%`,c܀`Kc` #%`,^p%`, `0*$ct``,؀ c   @  @@  /# xc ,%`,`,` 2`,! ` `@5"t l"tD `,K%`,  O0K`` VcȂ ^  @+@) ܀`Ȃ #   ` $ $`$` pD`0 %`,  ^%`,  #%`,  `,( (@"\#q   ` ` py`0, a@6m2  b,` Ђ a )#  1?  `, ?`o%`,K`0@H!`Ȓ  `, `,P `,c`؀ c` ?e   `" &` `"@גc     x%`,o`0 `     " @@@ c   @ ؀N !# c܂c''% %Ƞ?  @4?$%    4%of`0` n(X ` ` /"#h C j `,lhT`, @!#M Kc耠`s`c`C8h 8    " @Ec `!  S c# @@㿘@FI 㿘 ` Ր"@`@ 㿐! @$J" "  @DΒb@? ct&, , @ @(`8``. : g`''@[b * +Ѐ` 8. . В `@hٰ@. (`8. В `@hؐ"Ȱ @` }x`a : @g8?В @@h`@@* : `"<`Ѐ` y@* tN@``Ѐ` (N@0<` @0`'@b@㿘# `! Ր"@p`0`"@k`P@  㿈'D@'H PD@ ?:`0``2@ PD@} ?1`0`` Ր `x@ Ր `x@ Ր `@ Ր `@ Ր `x@D Ր `@< H!#\U xaX@ҖX x[@+!@E/ !՚  UՒaX@–X 㿈 @G[ A&@GU! @ ; @ s#a` +'aa@_ 8တ@qa[@!@ d@gu@gs H@/2$a %a@ $a[@Ґ! @# s@da `+H q@gK\@R 2R@m"L@l 9 $'@g#(',#@g''@Xe #@g% [@! [@!@g @ 0@#  @y  @t!p0@-`-2L`" Ւ@e!` @`!P0@"laՒ@Q!8[@L!0_@G! s&㸰 a@' @uA /a@XR  aJaS@   @ Ű@`@ ! [@!  <@@@u  <@@@@ ` < @@S0@X  c@")+ @W  @6 @sْO`  ~`@qo @q4 Ś#\ "a@+ b`a! "0 `_" "0@`$"0"0'  y? yb` `<$ 0@` $0 ya Y2e ^@L〢 @. )@qi u@ 2o@!H E0C@[!> @d5k@ @x @A @!- @"0@4"0  a' U%#@? f1 i, @? f ct&( 2@  a. @~ <@@" @}$a$ $$a[$@#  @loaL0@0ƐM?`/ / , ?? լa /@ J ` (J0 J`/?`/ ?(J @0@c  @ @a 2 @@"@ ` ` P ` ` ` ` ` ` ` `  ` ` T ` ` ` ` ` ` ` ` L `2   "@ ) ;``-`? ;`  ) ;`` 2 "@  (;`() ;``ЂЀ` (  㿘Ր @kƒb㿐`  }@#b? & & @ow 㿐`   @& $$ 㿘` `? H` ۰  `?㿘`@&u@&s @&q㿘@,B  " " "@o/ 㿘@,5   @P $  $ @o 㿘@ 1`  L`L ``=L ` `<#`>&`!  aʐ  a a1@" ""   a  a  a㿘!!``  @!`    a*` a' )!` Ib Ā0Ѐ`H ( mQO@a!` +t `@`9 +  @O 䀠`7 (&@a!` ٰ Ձ/à!@c[a@j @&"㿘%        " ``  @N & ِ@b;`& @c & Ր @jJb(Ր @jFb@㿘%` @&     {   `@& Ր @jb(㿐Ԥ ""a'ᜀ        [ V  , @@ fdnҰ YW `İ KIS ><Fڤ 1/9@$`?",ؐ֐ , `@Rt 82   y`@Rg ?@0`k`@RY @ ^`@RL :  @0`P`@R> 2 ؐ֐D`@R2 ˤ`?ɐӐ7㿘'#a`    a` a㿘#a` r  a` ~a㿘 @b  ``@bX `  aa``  j@^#:@@ 0@&@㿘 ` Ր"@bX@ ` "` `* 8`` 2@@ (@` hդ b ! N",",@~? M8  ' &'  ' @+W Հ b @)C' Ր @hlb@, ' 0'  @+; `Ւb@l Ȓ@+ Ԁ6'̤ @[ a  b;+ @"@ (8``>2/  + 8``<(# (`"  ` `? @?# O造`b`* Z:   * @::  @ `Ԁ&ł@ b` b?  b@   @@㿘 ` Ր"@=b@ސ 㾐 a' Т X@~ǔ? s" @~? s ct&, , @` @,@S) @ !@B `@j0@ . 2*0 @kecՐ @kac㼐  'La'   d   D@ @`@` @??,0`b0   `a@@a >@ 8/@Ҕ!@``(`%` @`(` 2@@ &} @ w`@ @%@@+@0 ` '@ @ &] %@L"O0@ F 0b0զcX`< %0/`    ?Ѐ` ((8``.2"䀠@ @`@m! ߢ@h ˂@g b<0`  bD  a @X#(㻈 a' !ڐ"Lb@N @s ?!@fߐF @ШO耠`2; Ք @ch4 `f2'`0$@@'R@   @ @ @!p` ؐ@!h @f  ``"  L@`Ҁ`b  a @#8p a' !ڐ"Lb@N @  ?@f^! @AO耠`2uՐՔ @chn`f2a`Y` Y`?0)  @   0 $@*0$@*0ܐ$#\$@* @&@ %  @@ 6@ ؐ` @@ А "` 2"& 22 & @e  ``" L@``b cպcբ cpըجc a @H#H㿘`(`` І```(N (N@ 2 N . N`.N   㿐 @φ (@`` 2(@?` .` .` @y 㿘 `$ `  &  &  ` @&@$&@@$@ `&@`2@㿐ڐ"Lb!@Mz ! "@` Ґ 0@Ғc($"@ ?cpfbX/ ct+b@@?   bD H` 'c8@@(G-J`#@ # 2*@ፒ נ * @ۈ   @ہ @@  c  ' '`@@ 􀠀@$ $ct @@$  L` `  bЂbа `#f@EbX 2bX*    $ @1 " $(@``H@뀠 $ p"' bDbb ` `6@㿘! "@   bD`@Q$"@㿘! "@ ֐ 0@c($"@@5 bD㿘bР ` `  0@  @  @@  2 㿘 ̢0@@۾  @۷     2 h a' ڐ"Lb!Ж @LE!$"'̀'P (`  ` q 'ܒ@$  @܀ 2P P`?`?$"к@(( '܂ 'ȅ- @ bb0'ЄЮ ' b@b@/ cq@Ѱ @ &% ܀ "  @&@Ӓ @Ӌ @ӄ @* 0`- 0`."@,0``2@Ȁ2P0` cl@:?@r$ & Ȑ " ܢ@%@@' @'' q  `@Ӓ '܀` %P#@D$ &  " @'ܢ@ q  8 @܂'܀2@- 0`` `<`:ܐ@ڭ  բ@ %c9cq @@ &| ]܀ "w Ѐ@ cl@h%@`?a@'B ['В@u  բ@ %c@?M? 2F@- 0``А@& 䀠` 耠` ?@"/@  b@' '`@q@ ' Ȁ Ԃ``'@&@̞ܢ@@'Є'и??@ЀЀ(#b%@&`b@&͐ܠ q   @܄@$b'qِ bD  bD  a @#؁㻀 a' !ڐ"Lb@J{ @ ?2ߔ ``?`?*`2  ```22 ` ` ?c"   ` `      @( /@ @! "?ِ  bD +֢ `@    #\@%$ @"@2@%  ؀ְ֐$@7`H@ O耠` +ct  b@;D/Ք @ch`f2:`3@"d@ 2  @m@  y @{ `@w& & @ˆ%b@ ' @"'bD &  & 'bD``   L@``b a @#㿐!ڐ"Lb@I @  ?` `?     @a D /"  bА ` `@ . 2L@@b 2L@Ѐ` B @H3H`.93@מct ! V bD!@y#pb #p bІct b@b@& &  ``p'ٔy bDЂ`` (Ȅ.) Ä) 8`?I c ``D :@ :  ::H'H`.013@H#t ! &bD #p@#!#t#p b@Ђb@&bD  `  `D҆:"H."H @ʏO`  (Ք @ch `f2@!9@  @@ N@R%t L`ـ`b㿘!ڐ"Lb@H @  ?2`    @'`T   '' '' ```@(`)  @("*@@..6 6@.6@..6 6@. 6@@ @` @     `@ ` `(`@``(`@`(`@`(000(/`@@( 0 0@0(@@ @ *@  '@ @+ + 3 3 @+ 3 @+`+`3` 3`@+` 3`@@@@    @"@@ %@@%@%@ @ @ @ 㿘? @ D+`0`?* @ @  P@@"x @, @C @&> @@@"h @.@C > @ @`@@> @? P@"Q @.@C > @㿘 @ D+`0`?"?(P`8`?Q 8"  `PQ @"@#; `P  8@#2 `@ P @#, 8?. P`@`D0`,`0`,`0`(`,`3`(`,`3`(`,`3`,`,`,``P㿘 @!  @# 㿘   ֐@!aT P @" & @& D b  `@ p`O ``I```"C??   ?@t#*``%0@`"/?`+?X` X`Д  @"@?@K쀦 ``0`  ?/c 㿘` @ @!m  & `@"w ` (@` & @& ( ` `@!Y@㿘`"@? &` ` a' '&Ģ 2; Y  5@ԋ #  ? 'ܒO ܐĔ  ܂``2`ܰ  &?܀ " @D   a @Y!x㿈!ڐ"Lb@E @x@ ?` bD@o ?  /@;;ِP bD`$`` ``#\#`@#d  @"@   ِ@n bD@  `2 ` `2&``@@  `ǐ `2        bD bD@>?@:㻐 a' !ڐ"Lb@Eu @ ?" bD`@$$ J;`."*;0$@!/$ ِ? bDV a @!?c a' ? # @!A@? ?t#p !}  `u ?c?cd@ #@@Θ @ b @4 ] `?`? ?c@!  F?t -` @0 ??#l̈!h!??cx|@ @ d @ʄ C ?@ > ?@i@f @c ,`* 4` `2 ?cl@@`-0`1 )@X$  @˾  ?| @   ?  ? #|@   2-0```y@ӻ  ?ch@@ @[c?h %֖@ܿj2 -2`-0`` ?@< 䀠` ?耠` #x?@ ?#x ?@ < ?cp@@ @-0```  2'  ) '` ?c|@ @`?``?|@ ?#x  ?#x!  ??c|@@`??cx@@`) ??p` ??cp ?`#t ?ccp@`@^?c` bD  bD  a @!?b a' !?# @@ #@$`$`$` $`$`$`$` ? ?#  !?J?`2?`2?`2}?`2y?2u?`"`""q?`8m? (@`d?@L ``?` "c`a2``" ```@F?@?c`?`22?ccp@ `? $ c@@ ?@ !? ##p @@ @ #֠#@a @@ `"  "  `"  2  "   `" " 2     `"ڨ  2Ԩ  "$`2  `2$ ` `2$ @?&` @i͔  @`2 ?@S\?c@@    `"   ?  }&`"y @ϩu  o ~ j  ` ` ?#@ %  ?#K@ h&?,@c@@ 4/``2,L`# `2` ` ` ```@ 2$    ?@Ě`( @?2@  ?`" ``" `?㰂``??`? ?a#p?$ #P##"@##@ @ ??"c ? ?Ј#0#?#@ ?c$@@@?`#$``? #$?#$     `"s? `m? 2 2% ` !?c$@@``2% !ڐ"Lb@Ad ??c@ @ސ >`@? ??U`@?#"!@  ?c H`2 ?b@@Ւch@ n @A*#? ? #? `f?9֒  @%  @!  @@@  ?@@ 2@? bD`-`/`5 ?$#@ ?`` `$$ $cЄ  2'`" ?c@@`'``'`` `'`  $$  $$  $@$@y@wk?!ڐ"Lb@@ ?c @ @ @:!ـ?$"D@" $"D d?H`2`. H`.`? 2al@ yal? 0` ?  4ubD  ?#! 2 ``= `b9 `L ,  4Y@Q`=ق H#bDD` ``2 `  ? ``2 `` bf` ?ѐ# ?#  ?  4? bD  `   bD 6 @Đ@ ? Ġ  ?& `?#Ђ ` ```  2$ @@Ґ 0@Ac(  @ ?ccc0c   $```??b@@@є dL`#@ cX f*@bX  * ` `"f@bX , @  ?N`䀠` ǚb @ &??c@@  ??$ "  ?@̣? 2? ?#``@?# ?##?c@@`4`2 ?K@``b@?6#` ?#] R   ? &`bD`?`H`F?`?``?#$ ?#$#?c$@@@`U?c``? "?c?c `  ?c` ?@!?  $ @`?? a  @)!Hc";jc" &.`"  `v" " " 0a" @ a@'  @@@@ (`0`ܬĂ @@(`0`Ⱥ@@@(`0`̶@@(`0`'@@@(`0`'@@(`0`'@@@(`0`@@(`0`'h@ @(`0`'@ 'H@@(`0` @ @ 'ԙ(`0`@@ @h'(`0`'x'X'$@@ (`0`'H@ $@@(`0`'4 @@ (`0`'4x@@ (`0`@@@(`0`'' Xh@@(`0`$'@H@@(`0`' h@ @(`0`'4Ԃ@ H@ (`0`@'l@@ (`0`'L@lx@Ԃ@(`0` 'LX@@(`0` '$@ x@(`0` '@ X@ (`0`'|4@ $@ (`0`@'\|l@@ (`0`'(@@@(`0`'L\4 (@@(`0` '8Ȃ@ @(`0` '8@ @ (`0`'|@ Ȃ@ (`0`@' \l@@ (`0`@' (L@@(`0`' @@(`0`'l 8؂@ L@(`0` 'p@ @ (`0`'Pp|@ ؂@ (`0`@'P \@@ (`0`@'(@|@(`0` '@\@(`0`' @ @(`0`'`8( p@ @ (`0`',`P@ 8@ (`0`@', @@ (`0`@'<̂@@(`0` '<@ @(`0` '@ ̂@(`0`'' @ @ (`0`'`p',P@ @ (`0`@''@p@ (`0`@''<܂@P@(`0` 't'@@(`0` 'Tt'Ă@ ܂@(`0`' 'Ȃ @ @ (`0`'`'̆T  ('d@ @ (`0`,''Є@ <  d(@'0000@@t(`0`'d''''0'܂ @@(`0`    ''T 0@   Ђ@  @ '+`'<@'DD(`'ĉ) (`'@ ''0 !(@@@ @ 3` @@+@@ @3@(@0 @ ,`4`@+3 @@ ,  4 @,`4`@@ @@ , 4@, 4  @@ , 4@,4@@- @@ @5 @,@4 @@ -`5`@- 5  @@ /  7 @-`5`-@@ @@  5@@ / 7  @@ .6@@ -5@@* 2 @@.@6 @@ +3@@2 * @  @@ , 4 @3+@@ @ @@ * 2 @4 , @@ @ @@ *2@2 *  @ @ + 3@2* @@ -@@ @5@@3+@@/` 7`@h-5@@ @@ @6@ز@. z@#@ /`7`@@ @.`6`@H@ .6 @*2@@@ .`6` @ , 4 @Ԓ2*@ @*`2`@4 , @@@@ +3@x2`*`@ @* 2 @X3+@  @*`2`@$@2 * @  @ +3@2`*`@  @,`4`@43+@@ @@* 2 @4`,`@ @, 4 @@2 * @  @(0@@4 , @  @+3@(0Ȓ@@ @ @, 4 @3+@@ @ @* 2 @4 , @  @+3@l2 * @  @L*`2`@3+@@  @ , 4 @@2`*`@ + @3 @4 ,  @ 2*@3 + ,@#܂ @  @@, 4 @|2* @@ @*2@\4 , @ @  @@+@3@*@2( @ @ @, 4 @3+ @  @ @* 2 @84 , @ @  @ @+3@2 *  @ @ @*`2`@3+ @ @ @ @@* @2 @ @2`*` @ @ @+3@̒2 *  @  @ @*`2`@3+@ @ @ @ @ @, 4 @2`*` @ @ @* 2 @p4 ,  @  @@+@P3@@2 * @ @ @ @, 4 @3+ @  @ @+`3`@ܔ4 , @ @ @ @ @ @*2@+`3`@ @ @ @, @4 @@2* @ @@,`4`@`@4 ,  @ @@ @@+3@,`4`@  @ @4 , 3+ 2@!ւ@ @ @<,`4`@4 , @  @* 2 @@4`,`@  @+3@2 * @  @*`2`@3+@@ @@ * 2 @Р2`*`@ @, 4 @2 * @  @*`2`@@4 , @  @ +3@t2`*`@  @, 4 @T3+@@ @@* 2 @ 4 , @ @+3@2 * @  @*`2`@@3+@  @ * 2 @2`*`@  @, 4 @d2 * @@ @@*`2`@4 , 0*`@ @ +3@2`@  @D, 4 @@@3+0 @'@+` 3`@4 , 3  @ 'Ĉ( 0@+`3`@3 @ @ '@@) 1 @@&  @ @(0@ #@ @ !'@&@''!@  @#`㿘 .( @> 0@?`?  @ @@w@`?`@ @`?@   &@c@㿈  a'  8 @#7*,  2 ֐c” cp    a @#x㿘̐  @8(`0( `@* 㿘!" @߹$"㿘1"@7"@7㿘1" "@ə Ґ#@Xc(&"@ 㿘@6"    b@6"?cH 㿐 @zʠ# h@ bX#b@ݒ$ 2(' b`b` 0``@z{b@ ` b`` 0```@z`?`~@z "@M b` @߽ `@ ?b@  &@: b@&@ @i @"bH@`2b? &2b`"b&  #"H`, `('  ` `  " '(' "`''@z! " 㿘@6 "    > bȀ`@6 "` @㿘 "@y א '@y@y"㿘@5"    bȀ`@5֐"` @㿘 "@y א '@y@y"㿘  "@5bc' #@5 㿘  "@5bc' #@5 㿘!  "@5b'  c@5#@5"b`z      2 @5h"A` 㿘1@5\"!"  c @$"@5R"㿘!@5K" c"@5G c  Aa 㿘@y41  ֖ #@u  &"!֒ #  @k &"@y "1"Ѐ` #a@i  &"Ё 㿐bؒ @ V@S&.@(```&.@(```@  @  @ & .@(```& .@(```& .@(```&  .@(```$@  " @  '  㿀'@4"b؀`i - b܀@c 3 /@e'' 'x " 7؀@2 c `  @&؀ 2'@4u"Ԁ`?㿐'b$ 2'㿈@4["b؀` `  2 @/' '$c(# 2 @45"ԁ` a' '@4("b؀ 2 b܀@c@1  1@/Ђ 'ȂВ'ĐĖ # #b؀2 c `  @$b؀ 2'@3"Ԁ `?a @A#㿐'b$ 2'?Bc" " " " " " 㿘`I@ 98@o@S@w  " 㿐 c`N``2  # @ 􀠀! 4  & H:", 2 c`2,  ,  ۰  㿘Ő $N@` `  c`N@ `2`@^a  @ @w@? "㿘!## " 㺀 a' Ґ#c(@Ŕ? 7&H` '䀢8@ (z(z @͒  @۲  @ @ۥ@v? " a @O#ȁ㻀 a' Ґ#c(@E? 8'H` '쀢8 @ ϐ ({({Q @Ӕ   @b  @ē @U@v? " a @#؁㿈      #\"H#`#d @f ! !' ؒ !''L'P'T'X''@ 'x'@7D`''|L'''@x @      㼈 0 a'      `2 ? @&` c`2  %&&  `4@k 2@c``2 @% l @ g6` e:  G [ E:  9 A 0, %U *g "F??I D?` [ c Or Xw L怤?R` c8  a݀?  p" t j"` n h> ì?P  n8Ph lÀ?8@< t x q5 s?  C z1 u?;h   `4@ 뀥@ && Ud@@`h2|``y``l2v``s`qao`@,@j@ `h  } "@@@ ``^@ ` (@`a2(@ # @ -*` -  ]2 @ ]& -(`bB b?  @ : d2@``(@`0@2 `@2a` @`  <   c@``2`   `b@5 7b+  `& &@% (c``2  8@, D@" d   @&@@ -`$@@&$[&  @~ "?d "&`@& 4 @Ր "`2JӀH~`2 `2> & ,&  `4 @ٯ "2 @H~`2 ,"?d #  `&  &4@ق 2@c``" +  & ,&  `4@_  $@c``" $@,Ǭ8!T@+ 7@9i;@`9`X`8:2- `0" 8&- `+7`-[48`X`a`Q$ *M`f `xG' ??׆,P?˂c! ׆,P .?c*?ˆ $?  @4 `@?ߨ c  ,@& ```&@ڐ @2" 耤@( @ x X$@$,@(@   @~8 2 2  @8@2 !2   @ 0@( 8!t7P@9@@;/<+ @`9`E`0?뀠`-`.`+1 `e2+ %?c ?ۆ  @? @ ,@& ```&@C @2$@" @@@@83 @ e E@  @@$而 ,@@~}   @~ 8@@}^  @$x@ ? a @ 㿘# b`@bnFb`@bh . . . . . . . . . . - . . .< .\ . . . . . . . . . . . . % -\ -\ % -\ -\ -\ % -\ -\ % % -\ % &$ -\ % ' ' ' ' ' ' ' ' ' -\ -\ -\ -\ -\ -\ -\ )d -\ -\ ' )d )d )d -\ -\ -\ -\ 't -\ -\ + -\ -\ -\ -\ -\ + -\ -\ + -\ -\ -\ -\ -\ -\ -\ -\ )d -\ ' ' )d )d )d '| ' -\ -\ ' -\ ) + +D ' -\ +t ' + -\ -\ + -\ ' 2` E E 2x E E E 2 E E 2H 3x E 3p 3 E 4 4 4 4 4 4 4 4 4 4 E E E E E E E 7 E E 5 9 2@ 9 E E E E 5d E E >h E E E E E @ E E B E E E E E E E E 7 E 5 5 9 2@ 9 5l 5 5 E 5 E < >l ? 5 E @( 5 @ E E 2T E 5㿐@@-(`@6@@(@`#\   ?@>S&?#@@o   ?@>B?@@@V>@&@  @ $@ &@? a'  '`  @ 'dh @  33 `̠  d`/`/`%   Ȑ\@ h \ N `Z8ꀠ(`H0@  ;'@,,@5@LЀ (􀤀$(`8``*   0 '@,,@@LЀ 􀤀$`Y&d (@K&d (@  Ѐ` (N (('@N@Ѐ`  $`N`h2`@ hN`l2` ` }b{d]``@b`& d(@[ `d` `& ``&߄ `@`֒&ф h`Ȓ&Ä  `& & ` `& & ` ``& `@`z&u b`l&g d`^&Y @`P&K  `C&> 8&3 `,&' ` & `@b`&  d`& ` `& ``& `@`ؒ&ӄ h`ʒ&ń  `& &   H `Ģ 08@HKP#\  *` & ?@;&?N?H@`85(`@@@? P'`@7 H`@/ @ `@' 8`<@@` @@ 0`<@`d @o? "d 耢 @S a @X P㿘``&` @ &`&` 0 '<a'  "  `2 ?  ` `2 @~ "  @n?'@ H"`` 5 V `0 !'''@Ð    ,7|<''p$7~'''''xp  '@@ϐ |?'@|`@  `@6  '''T'P'L @ <'@'D'` + `% ?aȐ@ ܀ @c @@%% T @'TP``'P]L  @@'@  // 'l?/ȸ̪O@``Z8(`H@/O `O瀠`2O@C ̀@&@,`,`@@ LЀ 33$̀ <'̔̀,`'l'l , 'l 'll6O@ T 'l +/@(`8``*` B ̀@>&@,`,`@8@ LЀ 33$̀ <'̔:̀,`  ,  &g?fO@`̀ (&@(@@O@`Ѐ 33$RN 33̀((&@O@@Ѐ` `$2;'l̀`5<'̔.O@+O@`h2'@`$!O@`l2` ̀,  / ̀ @8 ̀,F  @' > ̀ @̀), ̀, (` (`8`̀, (` (` 8`,  8`    -/` a  X x p//O'h/x P'h/O`80`@̀,   @ ?h?#\@ ,   @ ?h?#\@Кت b'`Ю @c"g/f؀/O/O & `@ ̀,   @_ O?(`?`Ԙ@Ъ 21'`0 ,   @A O?(Д`??#\@ت @l '` " c2'`c''`؀`Ԃ -/cM@`N2 ++׀``+ת`/瀤``+ת` 'd  @g'\GO %\ @8 /O8`G "\O(`A/  - + /v@  0 ,@@8  0,v(*O(8``e`E 0/ 0( 'T1'd` "'X@'X 'd ̀,  @ J@6̀@̀,  @0@̀,  @(@̀,  @ @̀̚,  @ 8 ,  @ @ ̀ @ ̀,@  x@  x8 ̀"@̚  ̀,`  ̀, `   ",     ̀,     x/ 'h̀ ,  `+ת`  @ِ 2 " /@ / ̀ p@ p̀,@  h@x h8 ̀"@̚  ̀,`  ̀, `   ",    c ׂ`x'h ̀ `@- `̀,@  X@ X8 ̀"@̚  ̀,`  ̀, `   ,     2/ /瀥6 `N䀠` ` 䀠`8+'d`S % ``0-@, 4`4 "2䀠`0. 0+-@ @ Ɩ `0 , @  `0` `0,h `-@4`, 4 @ @`d 'd@RT//'d d@OOဠ@23OlL @  +O% % T `'TP``'PZ ? bp%% T @'TP``'PDL  O瀠`O% % T `'TP``'P-L  Oဠ`` 0/% % T `'TP``'PL k `5dl   / % % T `'TP``'P O?Lb` %% T @'TP``'PߒL 6 d   .% % T `'TP``'Pƒ ?Lb` %% T @'TP``'PL  2D%% T@`O@& ,'DO(`Ԁ`d b`% % T `'TP``'PL ٨ DD %% T `'TP``'PiL  Ԡ  4 % % T `'TP``'PP ?Lb` %% T @'TP``'P7L  j @X4 X%% T @'TP``'PL r X88`   4 .X% % T `'TP``'P V?Lb` %% T @'TP``'PL = X@D %% T `'TP``'P̒L # Р @4 8%% T @'TP``'PL   88` %  % % T `'TP``'P ?Lb` %% T@'TP `'P~`4 @Z  @D/ /% % T`'TP``'PhL  ` \ T@'TP``'PTL  \% 4 :T   T`'TP``'P; ?Lb`  T@'TP`'P `%% T `'TP`'P` TL m T  TT@'TP`'P` L X 2llL   +% % T `'TP``'P ;? bp%% T@'TP``'PϒL 2' l@c @!T`'@L 2 'P- T`" 'PL 2 'P `@ `?'@@f?'@ "`@̀  Ȁ"  @K/    @a @Ґ h㿘# b`@V9~b`@V3`   ?"J@ @ J@@ Ta h a' ג   @ 7Ȫ@|ϔ!,!,+OЀ`@A  2 !''''''''@(@\ >Ԑ@$t?!,@JÐ!,@| !,O@2ː @X 㹀 a' @ "Dג @c!`?<$`'T'X'\@@ 'T :g'XT'\0@ `w?!e`@ `e z`@2,`8`@x`i(`ׄN"  sׁ@2r@|L `<@  `" װ @T!x0@ `` $jp@_P@ ?`$@깐@?@ :h a ,:h@ @e_` `@} *:g@ې ` [@m!0` @S!0@2 0`" [ @mw!0@ @mq!㿘@!͠ `a@ W?? @A; @A8@A5   @1㿀@e  "b @ƿ / $!@E# # @c &Ґc(@Ƨ / @? *$'@' @a!`?''' '` `' ''0@ `w?ˀ@1@d? "@d`?@d`!$# j@P## @ @# a#\$c jؖP@o#c @ ԰@d ?"@d| ?"㿈  ' ''   @? 6㿘@  "N  `. 0Ђ``  ` 0 㻐 a' @]#@d4 ?"זb@T  zׁג@" 9?@!@@[,; Zsb׬b@{ 7 @ǐ @’ -@K$#(6@c ?" @T]0@l֐ @9{ @c`גb@@TD 0@Z'0@c`גb( @T4ޒw0גbX@T& 0@!㿈!Ґ"@c( CjaP׸"bx @ ,?H` .(@A # 2*L`@  @ "! @S@W 쀤@%@@  @c,@_ "ޠL`0ۖה˒bp Ԗѐ Β @E `@ 2 ϔ@3b 㿘) < c ) < ` `2  <+`?-JMi.?Ѐ`? ^`      /`=Ѐ`8 5`-`- +`@ `3`+ @@C@C  ) < .?Ѐ`? ߄`` `8:<F >@    ? )   ) 5--+`@ 3`+ @@C@ǬC @b? "`2     ɪ  @  @ ~<  c ׄbI `@(`P@" N   2I @ba? ""N   `@`) ׂb@?#@S - @H  @ 4` `  @1   @  D>@Ӓ@b? ""㿐> @b Q: 8 0 @(0 8 @ cCׄ b( Bׅ(b}@@ @ @2`*`* *@ 2*@BB:80  0 @ (8 @ `  &q` F  @a? """ 2(   A D &J`F ׂbH@ װ @r(連 ?`c〣 ?.?ׂbH@#\ #` װ @S@r   ה b@楰  ׀`b F?   F?  a' ג #@   @9xX  @. ׁȔ @D  @DВ!@D@k@Eה!,!,@8ɐ0@x#㿈  ' ''   @? 6  J@ "0 H@   㿈'HN/NN  􀦠`&@ L `" `@ @`@ @ L@2  l$ @ @8L `\ H ` "[`T `H @Z `J `@@ @, 0H.`8` , (@+ #H+`( .  8`8 8@"/ +  +` +@rHH ǀ`' '`?`??  'Rc( *9 `ր$ 9 "@"@22++  +  +`+@ư ކ㿈 c ///@\  @@6$@`@&@㿘c @[ :@ 㿐c @[|? " a' '$ @aߠ 2@#8 "L`/o@z#X q$@'lאc@@$'lp J`` `:2 * J` ` `:"  8   L``/O'@_<l`?`쀢 @4?` Gׁ`$@䨐@i : 뀦J `2* 倦`ۀ`$ @䏔$'l@ 8  J`)ג#h@$'l@\? 0–$]#h@ X#('l#h@#0) rD p` p` p` p` p` p| p` p` p p` p` p` rp q@ p` p` p` p` p` p` p` p` p` p` r$ p` p` p` r p` q p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` p` q( p` p` p` p` q p` p` p` p` q p` p` p` q㿘 /+[c8-c(d @c(97N``% @,@N``c(@$@ ׁۂ``M ׁc(`@N  q"`"t@ פ  "뀤 ꀥ @,@`  @  c@@Ǡ@+ d 0 d,@@w`@@+  0,@`@@w  0,@ע```ִ``<0` @(`|$ y@+o  * @vpN$l N  h@ %,@b``"c㿘 5) : Ѐ` 0 : `."B : `* 0Qƀ:  )    (`0`` (ׇ8cP@0: @+# 1؟ƀN""  (`: (`) @: @Ѐ Ѕ(`(`@: `.ŀ`* ) : Ѐ` :  ) : Ѐ` ( ?Р@: `* @)` ) 㿐? '' 8`1 뀠)  (`  @1 )?(h@(`) 1    @ @7`(1 /`7     ?7`(6 /`  @(@'@`7`(6 /`@08@0`: :;(`@@?()@ڂ ؂ă7`  @ϲ@(`1 )  @H(@䀠l8 ȁˈ ?x 㿘/  &'  &F`  &&ƀ`&9  @  `2 @H    @`   ` 8   @`   ` 9 ǀ?c$? c   `$1@2)  *   `~?8z`     . 26* 6  #C `  ## `#9  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @* ?. J (G ?D 㿐 '/$`'@`L H`'@H``@L LH㿘/ᄠ @   Ā @` Ā  ` <?cP? c   `$62L. @CA @    @ @` @  `@ <`  Ā @` Ā  ` <    d@ ,@ @ * 24@@4,    !A`  !!`!8: @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @  @a0@ (0 @ `㿐/`?@ @ ?@ `㿐/` ?@ H`@ 7"ʑH'' $`@H`@L 7*ʑH '  H'' `@H`@H`@L   H' 㿘/>  @ $@D@`@  $@$@@`$@9 ?cR? c   `$62L. @E C    @    @`   ` 8   @`   ` 9      ,@  24@* 6  #C `  ## `#9  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @* ?.  ( ?   @  2@ *:    : :  㿐 @/,?fc8 ' `'@`  JH(' g?' `x@'` 瑢 JJH㿐/8  &%Q   @`   ` < ` <@? "`??cV? c   `$1@2P) IG`ܦ<@2 @n   ƀ @` ƀ  ` >   @`   ` < `u`?n`    f . @ * 2 6 @4 ,    !A`  !!`!8: @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @  `G a0@ ( 0 @><@` `  @  * 2@*@     *@  㿐'/đ ` '@`  JHJH  @  2@ *2     2  㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @@#@#$6 bX@$; bX@$ bX@㿘 (`  .(cxcx(`@ː?J?`/(`/$*H#<  H`/" `c !#x@,(`8``/倠*߀`/ /``(xx(@Wf ?" ` " (0 (`0" " #`@"    `  0 "! H P """  """㿠   @" &  g @ؐ `aؔ 㿀''?'$0@`  @U? 6'@W "$8 bX@㿘" >@" "  8`   *``   ` ` ` ?  `   .?2  ```. `0`@  *`  ` ``.?`0`@    *`` `? @( ` ` `  `*  ` " ?0 ` "  0`  *`㿀  a@'     ?@ /؁4 @_* 0".`(     '" ''' "  "  " """ " ϰ @yo 㿘 v @ .. . . . . . . 㿘  `" ?`` `, *` @@ `, `(``$@  ) 3" `" *  " (`(`(`(`(`(`(` $    p ؀  a* e؂a0`bbbbbXb0baa߂a܂aقa`ւa@% bX@㿐 #\#` @:`  ( 0 0 0 0 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 h`\ \l \/` `` (m*` ` v2u `i`*@` \)  ` M)  ` c`  - ^`)`@ a) + ` `  `  €`()`  ` c`)`\: * `Ղ `*}`?{`[y`#wˀ `@`2)et`?`[`#@ ``0 `)  \0 `0`00) )) *@) Đ  \ s ))  \ r ))  \ f ))  \ v ))  \ n ))  \ t ))  \ b ))  \ a ))  \ 0)) Ђ`` ) )   -)  ) ? ) 2U㿘@*`` `N@:`@*``2`".㿘L L`2L@N@ "*2N@"*㿈'L`'D '')  8@``\43`N@”" @`) 8`L`2.DM@`"&`L@L@"`D&` ``*D`?B`[@`#> c`2&.`` `` 쀢` ".`"N@`(.`  ` c`"N@.8`\  `   . 耣`2ˀ$ bX@㿘!#x @ $#x(!#x #@  c@j  Ā< @@c@SL  O"@c($#x@ 㻈 a' '3VcUX+)|cXȶccx#x@G$  f@bX !Ҕ@(! $|J`#!@ !$`@ !$`@ $` $`$` !@     @#쀠`$`! @     @#쀠`$`` $@"%V@ 0@۔ cx@  @ w@ y@ x@} w@x ݐ cx؄#x$`@Ò$ 2f @ e؁%h@X f$|J`#bX@ X$`@ $` V@H Rcx$` @AW c i`$`X @z ?   @+#쀠`4$`hbX@g ,   @#쀠`"$` cX$` cx X$`U$`؂c$`@u"㿘  c|  @ 㿘 ! #| #|@ؒ 㿘cx  c|   0 ".  (` 9 " (`8``   (` 9 `" (`8`@ 2*? "" ӂ 0hc 㿘`< ;@J? 46`$`?A,@ @S@.@M  @ ,,@ `,* `@@ @Qy? " 6В̢@ ?( (  ,`@ @@.@* ,`@@`4`@ې  @*`  А ͤ$ bX@㿘@1  (@7>! $-&/(# %~/` "-@ "qK"e `.`i# @2`@ (`(@ @2`@`(`@ݳ.`/` ^"}2Ϻ`2̺`@`(`怠H2` @6@(0@@"`'@ γ(݀܂@`  (```@(`"``) @    (@  .@@x`2u` (`@( j`(@@2c`(8`@@\`Z`@(`{@Q`@L`㿘  0@ N *   +  @ N@ "[  ` "  `  ` ?`* c `_㘀  c 2 _"  㘆`0`_-`{`(82`2E@C``  , ` 0` `` Ӏ ΂{_̀`  zŖ`"z ,բ `{ 㿘W)>c;"-/$O `  " 8.`@`? ̶*@?`@Д`) @@.`@@" `) ^~ y "*6q /N &( 8`E!qd;~ &(`8/9 㿘@0c7> % $/"'! )?~`.`  "." A"  € ``@2`_H "2` @/`@` (2ܲ``@/`@2`{2Ʋ` @'@/@(``((`"`&@޺ր F&q(2` 2` @`@/ɺ`N``.@   (@ `@(` (``w` @@/`̀ "`k`2h` @/`(` [`@`("x`O`2K`) 8`@ "`D`A` @@/g` "`6``(`0`㿐'Xc%>/ ;$   `. @Y8C " 8݀  @Xz @ . ` \&@ i @ @M b-@@"8$&2 . @? @(` @`"6  &.k[(2  @" (# (`8`   8`_"  @: N?"   2_"   2o "   @" ( N` 2  `" .@"  @(ٰ N?` " Ӱ  "n  N?` t:Ű N? _" : N (`N8`2 v ..@2U.ՀF>  ,@&(` `8$\X#\ΐ { x< `Z a `2n $.`"U c ` `2 . `2N!> @@#$'"\X#\. p*@@"1 @@ .@@" X(@O @\X @#\% f JXg'XȖ  >,@(`&8 \X#\H  8`\X#\8  @;X (@ `1'X`dӂ`f'\('X2] ʰ Ȱ2İ Ð㿐'Xc%>/ ;$   `. @Y8C " 8݀  @Xz @ . ` \&@ i @ @^ b-@@"8$&2 . @? @(` @`"6  &.k[(2  @" (# (`8`   8`_"  @: N?"   2_"   2o "   @" ( N` 2  `" .@"  @(ٰ N?` " Ӱ  "n  N?` t:Ű N? _" : N (`N8`2 v ..@2U.ՀF>  ,@&(` `8$\X#\ΐ { x< `Z a `2n $.`"U c ` `2 . `2N!> @@#$'"\X#\. p*@@"1 @@ .@@" X(@O @\X @#\% f JXg'XȖ  >,@(`&8 \X#\H  8`\X#\8  @;X (@ `1'X`dӂ`f'\('X2] ʰ Ȱ2İ Ð㿘  (@ 4 0 N `@᧐ ,  /  @ N@ "\  _ "   ?* 㘈 `_㘀  ? 㘄 2 _"  㘆`?_<{`GL@`2 @A @`  ,   `  0 ``@`@ |`v Ā? { _` e `"f  , `g  0㿘W)>c;"-/$O `  " 8.`@`? ̶*@̐Ř?`@`) @@.`@@" `) ^~ y "*6qxm /N &( 8`E!qd;~ &(`8/9 P'P<bec @4bE]`(`Y`` 2 `` ``$@? P @@@^ `<B@|%L?O@2 `@4 @ 2 2*'ā `` ``$@? Դ @@@/ `< @M%?O@2 `@4 @ 2  '''''''''''(@7 Ѐ@ L E Ԁ@ L@{` |`@Ġ E yĀ    #? `* 㘈 ```_㘀  㘄 2 _" ` `㘆` `_ ?{`((2` '؀`ے؀ `H`c`'ؐ ؀"u`HȀ``D ȃ+`??8@@8```D@`H`-`L ܀` ?F A#\ ؀؈$ P9  P8 ` 8@P   >`> D*??>> '''''''` @* '䀢  ' ' '' (`'' ('' @c 耤@ L `@V , `@8'Ԁ@ L@`@A "'` `Ġ ȸ Ā   ? `-  㘈 ``㘀`_"` ?  㘄 2 _" ` ` 㘆`  `_ ?{`(N`'H`2 `H`T`'ؐ ؀"3`HȀ`[`D ȃ+`??8@@8```D@`H`2`LĀd:`L ܀`C ?x s#\ ؀Ȁ "@%܀ "@@ `> `, = ``< `0  4``@|`@I`@D` \? W?{ _U` M``" `, ` `0@+O@``   , ` 0  ``ۢ` 〤 ނ?{_܀`  ĔՖ`" ,Ƞ ` @ܢ/@؈$ P9  P8 ` D8@P   >`>6 D*??>>d2`Lؐꀢ Ȁ "@C܀ % @=`؈$ P9  P8 ` 8@̀ ``؈$ P9  P8 ` 8@ဢ `D @*  '@ @ב* '`L`ƀ @0`D @Ǒ*  \'0@ @@@ظ* '`L`v u@0@ְ @܁% bX@$y bX@$Q bX@ $v bX@ ?c  㿈   ''@|耢 "'$΄ bX@㿘@C "@ ?  @D   &?   ?@C`"? " (   TaH"$= bX@$i bX@㿘  @G@C? "$: bX@$) bX@x ''''@? 䀠` '$ bX@@@$S bX@㿐`wy? 6㿐`H  y `(`0` @) 0؄ ?0c    ` (`( Y  `?0`0 0` ` @ @ @ @,, , ,  @  * @ג`0/// (  $؂0` @ (0` @,(@`  (`0@ @* = ).? =*㿘آ c ' N`%   㘆 `` 2N`=W @[  "`  2N`" `N`ဢ ?`+ Ѣ` ͢` 2N`Ǡ @"(`.@"@ @.@ڢ``݄"@8@.@(@ (``τ"@8@.@(@ (` *N $?  ? @2 ?"?`"?(`8````@`? ? @2 H ="?` =H``?2?H㿐   #\# @۔P$ bX@㿘 (`  .(cc(`@?J?`/" `/*HH`/  J`/ @ c!#@غ,< /(cc(`@A ?" $! bX@㿐 #\ @& ǰ % bX@$" bX@$j bX@@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $+ bX@  ` 㿐  ''  @a 8@?$. bX@㿀H'H'L'P'T'X $' `;(c|@؄`88` g4'c(@@"@;c` c  b  `[(@b#; ' ''  @ 'c$7 bX@$ bX@$  bX@$ bX@x > 'Ua@g'܄0'''@N @A?-   @B agf!`r      @Gj @*   ??  @?t@@@@@T@@@@@@\       | D   ? `` `*   * 8`*  c* P* 8`* 8``T* P* 8` `"" c" " 㿘  0 Ѐ` *    ". . (@8`@Ѐ   @  Ѐ`  В ` `0  `` `  @ ` `(@( ` @ `@ *`*@ "    `*` >@@ 㿘  1.&()&H@J`] c "`c @  2 N@`" L  ``  c  ] L㿘 + @*JJ $`[2JJ `.2J  .$  (H`."H- . 8`&   ҂ J$`]$㿘 @  @Ѣ.` "$ $    㿘 `     (!& `0`@:`*`Ԓ@   (!& 㿘  @  ` @" >`4`@@ ߑ< .`  $&(@.`&`&` `.`  (`8`^"i8`]l`-1 ) " :/ @(`9 ]ܘ@ 9 -"H`-`[ (`8``:"‚`=* H`-L,`8`@ ``@(`@` .` *` ``? )  @`O?,@ ` @@"??2#  @`   @@ 2 "y  (`:` (5 @2  '@  ` @  @ @     @  @ @ ` 2Ҡ -&@3 > $@t,  >@  `@ `ρ@ E(` (`8``:D`=@ $N`-ǀ`]Ɛ@ N# J `#`"@ $""`@' 2 L@`"L  `  @ H`:"tHu `]"$l @ $H@`-`]~Ȓ =@` @(`.` c@ H`="=HE H`@ ``@(` .` +``  L`2`@&` "?@ْ@Ա L``@Ԫ@` `@ϥ&` 2`` "&` @:&`    { : /   ܒ wٔ @i` [&Δ `$@`-@(-`-.`@\(`8``]T$V@    @ ˃(  @ڐ@4  @,` ` ` <2 @:   ,@$@&` @ٔ @ `耢 2(2 ?< @` @  .`@` `(@@@`2((`@.``"@` (@( `.`$  (`$@`]@(]`].`@,`H`]  $H`- -$Đ* 88,`8`.@$@`]2Ő$`]2$א* :  @@,@`.`$@`-@(-`-.`G њ<8`㿐 & ^& /  ]///& &㿐 ``8` c` ` 4,` 4`* :  & ]//& /& &㿘  u .`  .@ * @@ @& 㿘 `# r ,  $@` $L ` L ."* @ $㿘zb ` .`  `@`(`6 @޲& "`͔  "  "r"  " h3$ $ "  "V"  M" $ `S "c &3ׁA㿘   H`^"W =  A(`8"rH8`\>&!)F!)G!{ ." } [ *Ӏ`, ٓ:`   $(`8`*" @ $8``\"H $    Ȉ 2DR&(`8`\ơ8@H@`!)&k  !{z!}>π`,  >Ѕ,`H`V`H` `M   H @8 €& <  (` ( 0` 0 . M!(,  `D `D D`  ,`@ `  ` H`\"H \; )`  ,`@ `H  @H`\H`)N&2H,  G  B > `]6 20, В +, ̒ X&I" " =" "   $ `{ $& H`,[E  :E@8 H`\4 H`}0   &  {  w + `)hj` &k  (` ( ,` ,  H`}@ & H`\@&K H     &Ѐ` !@@0 㿘z c   kH|fc܆``X|&J  Tւ``(>`?`{" ( Ѐ` 8  &>`+" `+`?`*"  ,ւ``"(ܒ    X" " L" "  ؚ S ZH`|U0& "   @ " u (`@   |Ѐ` w s   (` ( ,` ,h :@`*`&:` Z  U  `"Ӑ K W  E ː `D `D D  .@ ` A H`)   )  .@ `H,  &(`8``)        (` ( 0` 0  & >`+ " "  C`{2  H`, *dHԒ ђ  &Ѐ` !ѐ 8``?ހ`{2 ( Ѐ` Ԑ  ." "  ""  " $     y  6   "ɬ `}2 H`}&c   *H" p&" 3$&N(`/ . @ ( @!S@D 4  (` @Y'' '@` D&L$$ 4bE&<e7$ $ @Ω֠@''''' @ `(`@2 @! &В &8!&4&&& &&(&,&0&<&@&D@{P&H `& `H'*HҔ 8&$=?&@Y*` & 2( c >3)+-/$";@ @ m@@y@ @@@4o&@ @2@ (`` `` 80`@8```  ` 2߀`4`&4+l ``2" 80`@8` 2  @   2*`ے``@@@@@$&@ `"`@ } (`@ {@y@ (&(   > @ @ @ @ 2"D&(3@N@&@ @      ؒ *HΒ  &@А  &<@` > @  )  * (&@㿘<be"  4bE&  $@  " @  " <@ú < @ô@ò$ bX@$ bX@$ bX@㿐`2&@2&'ڪc@; 3&L` @ @`  @}  ,2@ ,, ``@&@;Ò 2& , `쀦`@@&@㿘 @5 ' ڔc `@ "` :` ,) ``"H` )H `. ` @ 2@) ` /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ bX@$„ bX@㿐ۨ@Ő J`"b "1 #@Ӕ 5%  %&@#@T  " H@2&H` b 42}!עے @"?"b 1 #@ˡ% Ϣ"%&@#Ѐ`M"&Gkmg#aς ے @" ͒Kےː Ԣ$cX#`$$Ä bX@$ bX@$u bX@$  bX@$ bX@㿈 ` `@''''d$b bX@㿈'XX#\#d#h#` @C $ bX@$ bX@$ bX@` a@' - b b > !@!2` !`@.@L@ -  ` 2@>0b b ` f @ 2  2}@0В 2@ʻX0fȠa@@V:!H$9 bX@@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  (8`"  #): ` )` ' &  (8` 8"뀣`  (8``)?\ ) J `"   "(`* J` ` `  (`*)?㿘! ̀  @$ ̐8@ 㿘1 ̀ "@f Ґ H@%c(& ̰@ 㿘1 ̀`%#'  ̐@}Ò Ȁ @Z % (`;`-㘄` $  `;`  (`;```@"` Հ   `" @;`` ̀`#` `;G/`$`J`$`$`$` $`(` GۦaY`Xܮ``h\ܶ`p% ` $`  (` #@|Q  "N @|J  23N .)` `$` (` O`Ȁ`#< `#" $`N`"$` @ *4 J @|  2N  ` `$` @{  2N  ` `$` @{  2N  ` `~$` @{Ԕ  2N  ` `i$` @{  2N  ` ` T$` @{  vO`N `=rO`Ȑ@6 =@B$` N` ` " i$`` `;I/`$`J`B$`J`$`9㿘 @ qp a' @*Ȁ B@u@ =H<@   " f܁ / d.`.@.` e v.`.`.`ܒ    V X''' '  Ă@ @ "0@/ @j@&#P д`@Gs D  @@F @ЀDԀ@&# 0@& 0@& "0@S% x@Ð` @ 0㿘 В`ؔ!붖    !c @/ "3(111111111111112D11111112D1128212D111`I @J`g"H `8`g `o`-M`XB`+"D  C`u a0`    ) @*@ ) @*@`  *@`"  + @@ + @@"   @ J`g `8˙0`"   @˜ `  *@`g" `=`o`u `=*`X`+`-*&* " * +2-4= `*  -*-"  + *2 "  *  @  @ @ (`((?* "  `*  `* 㿈N`7?' @ɔ@0 @0 @  @b  ( (`8<Ѐ`  0` <`gڪ `gˀ`o`a"ͪm<`+`- `= `=@K@. " <`=`   }  <`` .(`<`= "@ -@ $@?@ X:(`<`ƀ`,`+ (`Iʰ ǰ `"b" b `""  $ =@ -@@ z$@?@ =L+L@*N-@# ]$@?@Nװ x Iu <`=" @ -@ ;$@?@<c*`u9<i (`<`g+d8 @ -@ؒ $@?@ X ۪`@a @ H@0Y@@P@- "" ,@L`+ `-`X `# >#  L`+ L  `- `+`X`  (@L`-`+  8@   8 @ # +  -+ # +  ++ "L# +  X+  @X `   =/*@  b8??p a' `'܆`Ȉ 0` @(  ` @ (.`@''''''''  @ A ֲ@PO # a@'  W@ @P3 P a'  ِ A 4_e &fO +$ @CJ 0 4@>g뀧 @,_@,"l 8܁ ؔ d8Ԗ$ @C 4Ր@,n >@,i"0 `8̺@ 0ဧ 0@?耦  @O  00   c 㿐L'L'P'T'X@'㿘 `! |"@Da``ž""@ @Oܐ$\ bX@㿘#b(@@:  b( @ @b(`@㿘%(@Т@ (@wM  (  @wC  2(`@㿐#a`r-fa+Xa@y p H "`c8a@Đ,J ##@i 2*&!@̐ , @| "aJ *` G ` D@{"X S,@! & & & `O *  J"X@*1$@@{Ԓ ">$@*  "9$@ *  "4$@:  ꀢ  'Ґ @yȒc($a   L` `  L` `  @i` 8, ̐@3! & a& & $@㿘!! @$! b(㿘!! " @y( (Ґ @yc(($! (㿈 c(`8`0@ 8`x(`X"'    ? (`8)  5??Ѐ` `?@ D@?$@   ه(`8`.*$ (`8`0Ţ   (`` $ @ 8` (. @`(?㿈  @*  "''   @0 ?`@   @ ? @@4` @*j@*@*e "$ bX@㿐 /'N`+`=)`J@@ `="@@%؀ (`@` @  2ߒ`"@@*(? "㿐N'`=@ `9`J@`=@ `.2`"@@ +%(`` '@  (`@` @o  `נ"@@) ?"% `  `2 `'@∠ ?∀@ %@Ȕ$$$ @ `㿐N`'  `=`J@``="@@Ɛ@$ \  "@`J@`"@`=`'@ #؀ "aa(`@` @ aa, @ )$a(`(8)= = `=  = )(`8`` = )@`((`` ?#a``2 8`-`)@S" a"@ @1%" a' `   㿘!"@?  b"㿘#b% 쀠` ! @"|"  "$( @"  b "b@(@bb 㿘 ! "b@(ְ !Ȑ $N` @(Ű  "2" 2 *`*@ `2' *`*@  *`*`  *`*`  *`*`  *` *` *` *` *` *`  *`*`  ݒ`   " ?` ?`g* ! " "" * 㿐L'L'P'T'X@'㿘@(f!  `|"@|a`` " !  @C"@a@i"@L    ɔ b 㿘 ?ԅ(`(`@1"Ѐ` `$ @nL```1"Ѐ`4  &"Ѐ`! "@"㿘 ?(`(`@1#耠` `$ @7L```1#耠`  &#耦`! #@#؂$] bX@c$`%3 bX@%$ bX@*  bt @㾐 'a'@' 'Pt'PP` '' ($!(|`  ''Ԇ`'Ԅ ' ''''''''''''''''''''''''歐 h'槐 t'桐  '曐 \ 斔P 摔D 挔8 懔, 悔Ȁ`!'P```@=Ҕ  CO` ?` <: )  /) 8`% 㘄 ` ` `8/ c+`@P`/",) 8``8/ T(`@P`/, @=  @&,Ԁ`@ , W                    `  ) !, " :@*ڒ 8  (@@  !  "' a@ ܁ @? @&{` X`  !h?'@X Ȓ'@h ,PԂ'ꀠ`"?/@i ' '''劐 h'儐 t'~  'x \ sP nD i8 d, _@6@ PݐZ  @ Ēa%@%p"n'@%' h"@%' b"@IW  a` h a@' ` Ȕ ,@В`'в``` @% "?@  `0  `0  `0@I!< ׂ bY(0 Ă - ?`*@!X - r( W w( (@`@W`@h`  -( Q - r( P w( $`P`td`  -( J - r( I w( " I t"g"  t( ((w< ? p*@!` -(  -( (@`@ x(  -(  -( $` x(  -(  -( "  x( (( d`t*@ s`p*@h@  s(d  s( S( T( (( S(h   -( (( l`C*@`@*@ c`<*@`9*@$d bX@$K bX@$ bX@%% bX@ o bX@$  bX@$z bX@J`H`2 @((```(@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $Z bX@$' bX@㿘$?@  `?`[`]`:`-@(``0`}3 `*@) `?@@@  `*@@`8@@a – Y `    @(`!4 @`?2A`4  @`@""@@@4 @"  (4 @`ׂ (4 @*``@( `@(`  ݲ`(`@` Բ`Ҧ ` @(`@ `"  ` *@(``   㿘  "  (`  `@@2  @&    ,  @ , @& 㿘` #@@@`#1?!`(1" `  "` @`` @  ``@@` "`@x&`` I?c8д?`, @˒ "```p` :&`(`` 8@@%& Y z@``@(`$@&@`@@(`$@` @@^ ?@*&```@ "```<3&``p&` ?c:@` p@ܠ,  $@`@(`@D p@`@(`@ ```(` $@` @`@(`$``Ą(` $@"?"@Ͱ? \a`@' ) 0`"6`/l-  . 0 ) 0``/``/X0`6 "  % @!а?" /6 6倠6؄ך  @ ܁$   `@(@   `"`/ <@(`$̰ ǰ  / 0) 0`/` E$ "+ `$: ?@!c ? `   @!R6"`آsb@$ `@$@ `@  '| b @" J  % cPJ `.G W6 | @ (N4@ 4@`@D1 @ 2D#\6@Di!GR Ȕ$ 2` `@A,@ 2V<@@2O@ /6G6`.0@ ԰?" /66 `@@04@ @Ő#`  @0@7^À 'L(1 `~? `*`?`[`-@1 *``?N `[7`*'4@`(1 ``?4@`L@@" ` `  = ``@(`"@@ @` @a&` @"4@`Ӊ((4`!(`  [4@4!`?(` a&` 4@`( ] 44@`!s``[ `4(`0`-J0`]"<` 0`[ ``: [ :ܐ (`] `]# ""8` "??" J@  `2 J`k?  `]t` a&` ?`]4Y(`]`44(` #\#` 0 "H@?``!4`` h  ``/(" (( ``/(L`3@! U- 2- (`:4( ""8`4`[`:c `H`6cL  " @ (`` 8`0  (``8` 0(``@80(@ 8 ݀@0bL?`"@@ @? ǀ, ``,`  #@   ` @.Ԙ  @` @`  @``@ɰ d @` ` `ɠ㷘`{"Y  { Z 4@`4@ (``/    /`}2 (` "1 `[`{ (`1 `](`&(`0`]20``怡 (`  Չ(` Ή(``} `/ 3``[" `[J`{`,(  " (`3``[ (`0`]@ `=(`0`]`2: ۈ 0 0(``O  ? `} ߀΄㷈$'''@?Ӑ$?`2 &&`&&~&&& ??c倠c @@0` ` `00`\  `?`\" 0  %0` @ 1?؄? a@a@?  `@`?  `@`  `?`?@?  `@` ?  `@`?  `@`?  `@`?  `@H`?  `@`?  `@`?  `@`?  `@`D @  ?  b  ` " @` @%@@D@$R bX@  @`((``2 @((0$ bX@$_ bX@  bX@"` $/ bX@$a bX@  cX㿘 $`a` `㿘 $@p   @j@h`$` @b@`㿀 $! @w`@wq  ܒ @wk @|!@``@`$a` $     `$ ''  @wu ؐ@#   '@#``@@''Ē `@# " $ $ $ۂ 㿀@`"` ` $ @w9   @$ @v " ' & &  & x @v$ & &  &  a'  (@ `!@ c c\$`$$` Є$ $ $ $` $`$` $ @XX'D'@'P!( 'H'L'T`@v@#/@ ',` $ @]$ $ @˔$@ $` $` ,܁ !h @ ,``@@b@_ 0ܒ !h   @0ܒ   ܖ@{!h@K 0@>! a' !@dԐ?   &@`/ڗ@   cX p   L0@>!($I bX@$ bX@ b b0`` "```X(@`"`X bb`p* 8`` 2`Xb`X b0``"```X(@`"`X`p* 8`` 2`Xb`X$Ƅ bX@S`F"  @a ` ``?㿘ܠ a@?  2㿘 R  ?甐?b؝ a@'  4 @3 4 ?@@ f "?ߒP E  #\   A?"`$? `  ( `(  2? cL @ #@@-@  @Ԑ@` H@`(H@`?((0  ` ?@=!?cL@@`?;? ?cX#D!7%.?L?H?L ?H ??#LcD@@?cH@@ @?Hр h@0K?D@ "C?@"?? (`":?`_P "/? (`"*?@{ <` ` % `"4  `` ?#@!?c@ %`! - 0`25  - 5 ? - ? ` `0 -  -  - -  - - K0@{X 2 `@J?0> #\   1? ͠??L (`(`@@``@  @ݶ @?0?c` Ԗ  @̪ ԁ???caaa `䀤  ހ ?ca ` ؄  @ @@?ca ߀` @  @ D#\'   峘?ĉ@ @?Ǯ@` H@`(H@` ((0  ` @@? cܴ @N \&@`@1 ` `2-@`") @(`"$(`"L`_8_b@zk 2  `` `$ 4 , ? ,  `2 @"` @SQ P䀠< 0L9I  c@@?c@c@@?G@%=@G M @̆I  EC ;߄ @ `̀$a ! ?ĉ@@` @DŽ  @ @+ "@? ?̄$ 㿘&@&@0ʒ 2@0 &; !.`  $@   !)  `@ #@)  `@# ٠㿘/  tc%t =@y "  S ?`,`@ @bߐ 2`@ِQ 뀥U`,`@ /-`@ @ `sQ؀2& "y   ` cp2"N@ `f cxN@`:`  : f cp  N@`:@! cx ?`:ߒ@Ӑ!p  cp N@`:@Đ!P @k}b, cp"  N@`:@! `" cxt%tN@:` ` :؀-@%t b,   cx b,|   cx%t?㿘'D'L'P'Tǰ) #t` ! #0`LH@-" #`+"?0؀` ,?  | 9شb 7   ' ; &㄀ c|?  t$ @?$'c|#t`%#t0`2 #t H@-P#tDs'"0,@ cL`-р` (`` L@xW - ƀ`+ c?<` |" |<``"P `- P`q#t (`@"k H`- e `: @x,L | LPT?T b @!#0@ $#LH@-i# Li'L%#tQ 0c?L_'L$  -28L@L `; ?' | b  + c t$@ @ t?%c$|?؂ , t + c  t cL  :9 cL@` #t`%#t cp  LH`:@q! cx ? M`jP' |  %#t c% ̒t$@ @$t  i c -LL ` L@w P` W"   (`8`:1L@`X#t`%#t(`8`; L `M#tD`E%#t cp  $LH`: W@!( cxLH@:` ` : b,L@`  ,#t` %#t cJ `:#tD`%#t cp   cLH`:Ӓ@ސ!( (`@$LPT (`@ ,b b   b $ bX@%7 bX@$t bX@$ bX@%6 bX@$P bX@$ bX@$3 bX@$ bX@X a'  "@? /" ݁@(9 `0`9 gЀ` dݠb @v" .`.`@@`T(`8` Ѐ` o`,q `/`<?9$?σ(`\  @(`T`(0N Ѐ` ݢ  b@vN" Ʌ. . @@ 6L@`̀Ѐ` (`@~? " 2@ 1"@v. / . @^Ͱ? rp     @g'`e @X? `"@S? (["`/8`.NȂЀ` d N``x`X2U9 J`P`M3 cD"G9 . b ) N`( %#c `@``D``#*`@P`@uǐ" :` , ,N `ܰ `2:9`/@7^!ݐ"(h@. v(` ,`    (`8`88`? $(`&0ݐ"(P@  eݐ"(h@ 㿘 ݐ"@jҒb@㿘 ݐ"@jƒb@㼐 a@'  "@+k?  @ 7݁@ ?@ʔ   `#`0!@V 逤 8ٰ? ְ?@ ђ@l  %. (@6Ð" ``޲@O " @oߠ ```Ζh a' 2  ?@ ݀ c݆ c @ (@ ?`@?  +` `) \g(`\'''''܀`0X`X`̐@ǖ?U@ @ @7@_  s "W " \`!"4`@]ݐ"4`l\@@ :? `?@ "@* ?@ِ *}?@w @6#(`0`"@ Հ:f?!8c?@ܔ `9` `\ ` ?c\ `'\  <8!" \0`\`'\/?@ @*/ 2% #?`p\\'\0 ``_\0@_?㿘 @_@_  2 @`"   @s 2 `  @v&㿘ې3 Ԕb "b㿐@cI ( 0 "`2@2 @-@c( @"@c! @ذ "  'T'X'L'Pa' ؒ !'''@ܐ?b 7@R7'x'  L'''Ґx? x (@@ "'@ @]'@'@ ?" ݁@4#H㿐H'H'L'P'T'X@'㿘 `! |"@ha`  ""@  b  ` "` (@` @H@`* 8`` 2@R@㿘` `,``(`0"``?`&`@ (@`&@ `&``. 8`` 2@@"@}א "`0@ ?"㿘! "` "`@@ڐ㿘`0"``(?`` )&```%@` @&``&`(`&@@ ` `# !@} ? `` &`@}  `@|  @@? "㿘- ` `2 (8``-f`+h `?`2`0/`0 ? ?  Ѐ` < `@`6@?` `7$@. !  "4L`ђ`0` ?Ր?ʪ@O "" ??`4 `2&@L LxX̀`Lc    㿘B? ̻? !X` T ?   ?   `ǰ ϖ"`(( "* * "*  `9* "*  * c$#  c${ bX@  @((` @`2    `"` `c cD# `p   c`|㿐@Z@Cݐ@6X㿐L'L'P'T'X'%4 bX@㿘6`@ @n  "㿘 @'  㿘 " $ 8`   /@ 8`@  $`?   "   " @ @ @ ꉐ@-@("@` 8㿘 $`LÐ@ @, ` & (& 6 @`$` H` & D@ 㿘 @    @@&  ?" @&  " &  "& @&  ( $``D``@% < <@C(   `   " @&`& h& l&& & & & & & & & & $& (& ,& 0& 4& 8& <& @& D& H& L& P& T& X& \& `& d @`ڒ 2&`@ "N`H&`0 `.&`,  &`4N`I`?`H @@ `8`6 , 8` ,20@2&@  ( $` '揰? " `0@G@B""`,@9? "銐0  ? א㿘 @$   @  `  @%  @ ! .@  ` ($ @*` " $  "$ @$ $ 㿀@ `" $ $`Â`?'`? /@d u Y  $ ''$H/@ "8  /(`8 8@ '@ j @  @%6 5 $` 2 `L``."L` `x`  ` (`$ 8$  `$ $耠`" $  4 <$ $ `"''`@% 2 $@̐ "+ $  H"  @  28`H" @ ` 8`H $`"  @쀦".쀠`2 8`2 $` `ꀦ `"v􀦠$s4 `?(` `@ `?/瀠`  ''='"X $"  $ `  2N $ $`w H$  m4 <?(`0``$ * 0``c`c'b @Ԑ  "  $`  $ 8 @$  `5$ $@|O@ 5< $@& $@ ' ?"` H  $ %4 <!4 <`?`@ @ `r` 2 `@ !@ 5< $& $@ '"  ($ @ H" >瀈">@ j%>'`@ c5>'@ $  ''/ '.` '@ G@0     5< $& $'5<'?Ֆ@ `2}' @ #5<'v%㿘` @ @  " @ " $   <` 2` "   @  8`  H@/ $`" s$  $ @$ $ "` ْ$ + ؟ ؛ 㿘    @ *  㿘 2$K  @6 @(0``D <(0``_0  |@W 8`"$ @`"`"ː $ HH //@* (@ $  " ($$$  $$ (`0``(y 6 <* 2  $`s "͔ &  >`6 >`"  >$@" 0 " >`  $ 6 <D 6 <`@ܐ`8`$(@`82@`>$`` @4`<$`2 (W 2$ ( H& $@%@ /  b @ @`& ( 0& & $ $? 3I$`J`$`!` xו` ` 6 <* 2  "$ -6 @` s "3 L&  >`6 > 6 @@  >`& 6 > dž` 2` `N I`" 2|``?& "s`$$@$$ "g`$@$$ @(@ c"$@ ] & 6 < 6 @@ T & 6 <@ L` @ G"㿘 @ ?  " (@ `$ $ $`$ $i$q$* f-  ]?$`8 `  9 (&` `*@.`< H`9&`&`8&` $ 6`<* 2  ހ 6`<6&`%` `ڦ-  $"  0`< $#s@0@  "\@@ @ Ҥ "2 $  $`$ $㿘! "`? ,& &@[@@Y "` 0@R`@y 0 ,?& &@G@@E "` 0@k"`@g@5C(᫤ <@@ @ [  " @ H @w˰А?(@@&  &  8& , ` ,& 8  , ` && & & & (@ s& 0> : & $& @ 㿘  ?" `  lj ?    @   "  㿘 ?  㿈@ '6'' r `n쀦`o6`Ԅ`}`(0 ] Ӏ&$` z T%$@  `"%@$H () %@$ @8  ?$ @,@(`? *ǒC$ ` @2 @ &@&$$@@ "@k@.@(`?@ $Բ$ 7  2 @$%@%@ @ l 뀥?$$ #@Y( )( ު%@2II@%$@ > (,? )!  %@  @,@,` #@  "? #@ @ Ð5y @(,@?` H6`-  $ ǐ $$ ΐ א  3 6 "? 0` ! %@2 !  ?€  6yxu "? : В @ &@&$$@@ "@@.@(`?@ $Բ!  ΢@!  z@ D $ = = $$ 6 6 . ' ޠߪ$ äĪ$$1 bX@㿐 #\#` y 㿘@`0`" @QȐ 2 $8` Ѐ`      ?@Y# Xeb''@   c!@Z̄ 'Ȉ )(``8H`| `:"('Ȁ (ch@G cp@A$” :@Ua  X`& X̪\@bP?"& (v@b̔& 0@cx̔& ,@c̴& 4!ݔ@#  sc6 ݔ@c?" 0& 8@{c?" 4& <U@qcȀ?& ݔ@gc?&  ݐ@c ݐ@c ݐ@c ݐ@cݐc@    6 r a ` $`(8``q</////@*?̒$@"$@? E̒@?<` , ̒@ , `(8``qȢ, 8`6 ݔ c@ 0 \/@ ?( 8`$@`5` aW @& , @Ϧ  ñ̠ , @ ?@ , , м 8=и ,/̒#@? 6 pݰ0ݠݐ0000000݀000`0P0000000000000pݰ0ݠݐ0000000݀000`0P `H `H + 8``0`:  @+`+ 8`+` `+`   +`+ 8߃+ 8`@ : 8@ Ճ+  J`@  ``:Ƀ+  @(``  (`@ (`2 J`|`:`?J``:?`|   㿘 #? )L `0&   @(Ѓ8` Ѓ(8`````ɐ &  L`x `Xְ   Ұ 㿘 =V? @ d * dN@:@2(@(@ ` @@!  &??`` @@ d  dܲ`? @?㿘 =? @g d b dN@`:@``^*@`` @@ޒ t &?`\"N`*@``2N@"@@ɒ d ^ؚ dN`:`"*@``*@``:`"*@Ђ```N@/Ѐ7в`N@(` / 7?Ѓ(``*@ƒ```2 *@`(`@ *@` *@` *@` *@` *@` *@` :*@`? @?㿘1 @g&  `  ` 㿘  1 "& @&  ` @@# @$` `  ?` `@ ` a@' \''X''̀` ?` ! o h#@$ ܰ?Q d   @S3`  (8`` `,@8  $@   @(8`` @(,@L`\,@L`֮``#Ӑ$ π̀`XL`:`L@`:2` `,`@d[ ,`X݄c'Ȑ Ô = eL``: ,?#\k " 耦? ?ނ :H``: '!'H: :( '%$!@$ @@@i $@%$ %@zf@zb@?$ @@K <$W`@f͐В% Ԁ @@  @ ݁ `a 0```W ,@ @`ް?ܰ?`@`F@߰? "$@耢#( H`"%    "'@'` ؟@ ?* (H`c`܄''@Pc(  ͺ`@fW @j@fO@? "@W?``@?,? `@$ ` @` d` @$ߐ#Ѐ`C@2a `@+`/@&@a? Q"@ .F@?G `?@@p @ "8?@N`@   @+ @e0ѐ@?$ @e0L@0H㷀- a@' ;``+``` D`@  @Lc@ `@ t(w` #\   `@O– @`@ ` @ @" a@ ~݁@d$ ?$/1 ` @(8`` $`, @d @@Ԓ 8$` @ $ " (8`` `(#,L?`\?Π`- 0```2?@e7`%`% '@Nc( %?,M` `#`$@8 @O=$'`W @@਀Ղ@ B%0|l @##@@Nc(%` ?7 0_㿘 㿈 #\2 㿘# b` 0`` b0``㿘# b` 0`` b0``$ bX@؁"8㿐 '`v-  * ?*@@#dd #?c8 ?*  @@#dd #c @*  `@#dd ##dd #$$ bX@㿘%`;) `(+#!' . .  @@(`@ "` `@f``(`(`"* @2$ $ༀ @ $` `@ $0`%$    @Ԕ  $0x@  ! '"a'''܄ '''(1  b"`?"@j"``   @js"` #"`  "  B bX@"` $` bX@㿘 @ @: 2 `@ `  @c&㿘!ؒ <ް " 㿘 @c&@  & @& & & b"<㿐@ )fc@Lʪ"X " @L`#`   @@L ?H "q@m # "'`@ߒ` @&&`,@@O  "@J *` F ` C@O ,@`@O  @"@H@`2@ "@& ` Q & `;X"  `?*`@@1$@NФ & * "#$L`` 怠`   L` `  L` `  'Ґ @Lc(&@ i0$ @i*` `(`&` &`$& Ĥ &`@  &`.?.)"㿘!ؐ ̒b<9 " ́㿘@ " @L` @&` Ґ @Lxc(` &@@&` btb<$# bX@$< bX@ ($ bX@$ bX@  a   `?a* $$h bX@ ? π`?  )   "@ `   @  `@  㿘 `)" ?π`  ``(`` @ @ &@@(&@@Ȓ 0ݐ &@&@ ?㿘 `)" ?π`  ``(`` @ @ &@@  ې&@&@?`    `2`(?㿘``? @( '@  `@8'@?X "'@.?' '@I ޴'@㿘``? @ '@@?@( '@) 2'@?' '@㿘@ؐ㿘@В㿘 ``& ((@Ē ?(㿘`? `````(? %?@@B  '@`8?   ,`/` @@/@/`\` ,`` `   ((Rc@ *㿘   @ '`@$ &@ϒ@@&$@` ?$’@@&$@<`, &㿘  ?@ @7`@$@ &@@&@@   @@@$@& ?$|@@&$@<`, `` &" $ $% bX@㿐# b`9 ؀ b @2 <@ 2b`2?"+$b`  @`K @ ?`" @J?@q L@B@j L  @b L㿈'HN@`r 'D`w He  "HH`@ '` 쀢 M bd ?:  `؀`A1  "P` @`9H"`"`@`0bF HH`r"X@`H! ` "`63 ! ؁ b28 ڰ @HH`r3쀢 8DgU!`a@g @Ӕ04 @֐ L0@Ր LH@ϐ`L  "`w! @Ɛ`L@ L@`Ǟ0Ǜ`Ғ ǔDے ǎD```````````h``````````````````````````````````````````````㿘a?h a@' N`a " ?a@ ށ@\  / ''̒G`?8 (`@ `  *`2`#`Ua@` $ *@7$g[!`  's޸bb޺0`@Ԡ @1d%  ''''''  @%  L`" @ "@7 /@( @7@,{`r 0k@#Ƞ @ #`'쀠`  @'@  P"ca8@㿐 'X'P'T'LaP@' '   '`(``#`!L'"@@'` "` @`' @ @Ґ e "?㿐 'X'P'T'LaP@' '    '`(``#`#L'"@@"`` ' @` ' h'@ @  "?㿐 'X'P'T'LaP@' '   '`(``#`"L'"@@'` "` @`' #a@ @G ( "?    (` ;``" (`8`@`" )?"  "c  㿐 H'H'L'P'T'X'B"㿘@Zߒ  `@\ @Zy` @Zt` ``  @bp@ 㿘    @  㿘@@Zm  ?@`  8@ "@   @@`  @@@&@``… ؐ@&@ @; Ӷ ޒ  X   @c”䒊 "2 J "2 J   "2 J  J 㿐H'H'L'P'T'X@'㿘5  `|@NŒa`  ? !  @b@N3@Na  `T* P㿘 (`L# b`?@c "- ( P 0 @@9 f`b <8`@fb`b`"b  @b@8F`1   @ ?  0b :? ?"# 㿘 -? W"` 0$ bX@$  bX@$ bX@ Na'  `L`/f@$ ΀ @$@|/# ``^Fs'|b?> @X / V$@#I@є(w$`@nM@`/ #5 /..O`܀@Xu ր@Xn` - ̐-@@Œ /*  Ǩ"  ?H`/" (0.. L `\ @ sށ ?" W @@M̔$#Ѹ c<@(@|` fݔ# ނ(sO/A -@@x /*  "H`/ # /((@M$#|'|@{z$\$@{t G E @ 0s$b@{d 0  ". Ȩ @{"x@$  `  t" >{"㿘  `   "@$ $@?@    J@ `$ bX@$  bX@㿐L'L'P'T'X'㿘] 5' `-0 " `2?  &5&@@@$@@Z& "`"$V0 @~ @&&`F͠ @ߐ$  㿐 X@p ` (`ńdc! @'(7 ""3 `?(`(@㿐 'H`  `2 (8``-`+ `?`R`0O`0>`Y      `$D '9   #?1  Ѐ` u c `@`n@?` `7$@f`2Ch 8@Ö< @ b ֨ "jM``0 ` `?a#'?# &@ <   @ ˔ ""?  @u "" ? H2?H @ ^ ""?ؐM F MC xX`M    B @F@|$$$$$$$$88888$$$$$$$$$$$$$$$$$$8$$$$$$$$$$0$㿐@` k(`0` `(` ? H0#`'耤 ^'H'''a `-I `0 I/094.   ,@@ И @ 'K/94L ,  *`*`@@ @ 'KЀ/L@      `e`E  S    '3 ?؃, @'H`J?؀Â$@- ؅(b@ J?؂ a4^8`  '' ''؀` @{@{@{@{@{ d " "(`@H``N' H`H "؁)  'H`"'I`0V I `XO`x"N 'H``0"`HD   5' @"' 'N `+`-    'HЀ` 8'쀣`0  'H``0π`O О 'K`/`9!Ј 'H`**`/@`9!`b 2, +L  I  l H@h H@'쀣 H   Ѐ    ,@`@ `,4`*`*`@@w@@- $`  @ @wԐ`@ ``ܐ@v  ` ''''@z@` `*` @xؔ@z '@{ʐ  '   &#@ 6   @  < @  (@  (@@@@4`!&$@` @{ '@{-蠒  @y'耦  @zג '耤@{  `@zǒ  @z '@za ' " @y( &Q@vHb  Xjbؑ*+*+#(",?8(?b  c cL''ᙠ,--' @'??@% @ؑJ?؀" L@y@@y>@y<@y:0bȀ H?-?@s ? bȑN؀`=`9b  bș H-       i`Nc`i`I2'@uNc耢 "''@uDb  `' ''?ea [`0   'H``0π`(  p  ʑH'] b@8(@H?؃(?,' J(?؆  $ c?'p'ea_Hb# `@ru ``f`H耢`@t@xz@yH@rP <$ qH  r ؅- b@ Jc?؆   ?,??'@&' @؆J?؂@c?''؀ %܀`"cb聨 @x$@x"@x @x@x H ''ea͕Hb؁  b 0ض  8؅(b@ ?؀ʶ / @?jނb8@H`?؀؄ k) 0`  $A܀4G' 'VH  ''''܂s'ؠ Ј X ``,, @@  'DH` e''`n2'ސ@sb "'H@("c?''ܶ \'Hh eaJyc @܀@ ؐ?@?@wb@w`@w^@w\@wZ]H-T ? J?؀QH0>܀`?@``@xH  '@v ؀? ?$_'@w@w@w@w@w؀d *`*`@_@ b?܀`2Ӏ Cb@ @ $) % J( J?؀@0t?$VaHs?''܀?$؅-  b@ ?* @@8?0` k? (Ec@&? @'܈@H' @tx`l ''? @0@?'0'܄?(@'o ?(@ '00(0//0(0/㿘`8(`˄h?c& & @& ""& &@& `&& &@3& `((&x  ``'''''ؠ@iY?0@@ `;``#()  8`8@ ` 8 (@;``#()㿘' 㘤` `2 (8``-t`+v `?`<`09`0>??Ö ?\?    Ѐ` @㘂 `@`:@?` `7$@2 $@<   @ ݤ"8L`"Ǯ`0??`  @ "" ??? `` ``2&@ L LxXȀ`L)   #? 㿘?Ib@T) "`V`0 " ` `2` ? `  "6"-`6` `0 = `@&@`@Z, @ @@`0&@ `0 `@&@(``&`" @Y "L` "`?M@!"`"`0?`0`߀ 6` @: `@2`&@@`&`8&`<`@"`0  `B.`B&@ &`"`@ѐ$ ń#`0 @`0$ `B`A`@((*#&@&`6` &``6` $| bX@H;jc"" &. `v" " " " H 'D```(`((@@@'  @`D``'` 5ک'@x'@@(0:1V@ĉ( 0Ȉ ۄ @(0̂@0os@@@(0 Ђ@=_@(0Ԃ*@@( 0؂*  @(0܂@?Q@@@(0 @`&؂@(0"=@@( 0?ֈ @@(0@"W5@@@(0 @"@(0?f@@( 0)P@(0m! @@(0 @=@b@@@(00,@@@( 0 Q@@(0:m@@(0 @5ĺ@]@@@@(0S@@@( 06(y@@@(09Ȃ@@(0 @xs@@@@@(00ւ@@( 0=5C@@(0V@@(0 *x@@@(0?;@@( 0ق@@(0?B@@#J`@@(`0` (0!}b@@(` 0`@gX@a"@@(`0`@?yN` @@(`0` )/bD@@(`0`c@@(` 0`@=Һ@c`@@(`0`@/`p@@@(`0`  &߈bƄ@@@(`0`:Ic@@(` 0`@5;̺@`@@(`0`@"a@@(`0` 6u4`9@@@(`0`9a@@(` 0`@蟺@`@@@(`0`@1+be@@(`0` = HbD1@ʿc. 6 0@*c+ 30@?$`9*@2@ @7@@@@VւaÉ+`3`  1@#3`+ 3  0@?`}* @2 0@@@!aaѻ*`2`@ @7@@bO* 2 1@?9b, @4 0@@@(Pc,` 4`0@a,@4@@7@@@@=߂bD-`5` 7@,4#@/Nb51@- 5 #`  b0@-5@D#`:ᴂc0@@@.`6` @#`㿘 6 .@ + @ 3`@  @ `? @@> ? @ɒ&@?  `@? @ˑ㿈   1 a' ) /1 1 /2@) ) ///22 @/) /2@ @? @`/`@ `  ށ@ "㿘Ɛ & ) ) 0`) ( &`P&`T&@&`&`&` &`&`&`&`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D&`H&`L$ bX@%# bX@㿘# b`V b`V 㿐`2 ,@- .` @ @"@ & >    @d`2  2  2㿘 , .     @ 2  @ 2   2 "  *`" 9 !  , `@{,`  .  ,  , @ ,?㿘# b` b` 0 00㿘&@    %&  @  .&  $    ` @&  "&@ " " } "?2 &@  㿐! "` "`"R 0K 0x   #\ a@' @/ @m@  7 " @ "@ a'  "'" /" @ ɰ0'''''''  3  8( 3  @`(`)    ?? L`?(@?@ 6 ??95@44 `$?~b -,)[ ; `\  @: @N* "   ̀`ΰ  v :*,@%@o i@gʐ 0ƀ,` `2@?@,` % "L @D :*@l<:9  :*@ #%0 bX@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  RSRpRxQS4S4RRQQQR؝㿘    '@% ހc(  8``` @ @) )  .)   8``` @) ) %@$8  耠`׈  : . 㿘@`@@~j ` ԰ .`h  ?Ђ``  (8`Ѐ` +`)     `!@! .`.@`(` 8`+`)   а `` (8`Рɀ`"͚``2ʚ`  )   `!.`   `*   `) ( `T4TPTxT4TT4T4T4U`T4T4T4T4T4T4T4U J` 2(   (H` (* 㿐?0`'@@\ * @zԄPc'ޔ @#@c'ޔ @#P@0`g|7'  @Ð i  *?8* 0;@?c*@? 8`@ '@,?cX J?@0`gz'̲ʲ  'f @!@:@``*`?0`'` `@?(`* N`2@ 2$ .@H@((HN `  H`"߀ @f0`   ݀ N` ׀ ``Ӏ % ̀ `'`ƀ ` ,@;`` ?d` # ?d`  # #DD ?(`   ?(@ 㿈?#\@ cc&^^b@b8ba` )'@@@V?()a H'\ f'!@@˔  c`'?@\\ޔ @#P  '@.@ՠޔ @#@??@ln  6`g"!? |? + @?`'ޝ chޑ JxޝLpVJNL '   ', '     &%' 8״   .? '''@9? z؀}`{r (b@<  b` Ȇ ? b@8@H`? ` ؀ ܀Acܩ H'ޑ c ?0 TJ?@ ?ȑ,--   8 @k: `@@k1@k/@k-,\' ?ih,怦b@?V67a〠  НH'0P,ʁ RΠ ؀ 2 TH ) H?L`9 2? 0. 0 ,  ?   ''1'2  ,@ 4@.@@'`??  ;͘@ Ԭ Y`# 31$&@%`䀠'@l @k @j@lP  耠+䀦 "'쀤`2'?2 '"' `'耠` @`k @`442؀ۀ 4쀠`@ju X * @y@k[  M `'Ԃ@ `/Ӡ '̒@,@i@j 3` ` 0@i@j ̀Ԁ9€` Ԁ9,؀E  @kƔ @ @k  @k ք| '@?'؀ :'8  '䀦$ 'ؐ/'''䑠 L#  '  䀠`"JT) bșT? () '0ȝ΁ $.⸑́ y*+ ́  "n? RRL'0,  S @i~ k׬@kx 0~) Vb?L/ V' 0. ,-c 0, ޕLJȁT#''0, ȑL )T?΁ ?L`0"?     1.  eaeH01  (`9  H()()b@8@H`*+ @o@؀4?? H  8 @j `(`@@hF` i @  @j ڢ`@Œ 0,`` `` ؀@ @iВ  @hA q?L`9y 2? 1.k @h/ Dؐ @jf  2ܤ6'+`%3 6 @jG  Բ@&  @jD ؀7@g D 118@i 0q@i{ 0k@j_ 0e@io 0_1, ````,  ?L`0"? , @iF  8@g :2, 9,p $, 1,ޠ  @iߔ ~02,2,Ϡ 㿐'H `P -```H' `C H@g| : '   @ B@  c @ c @  ` @  `-``2:& `"  & `2&  &        @ D  ` `$ @ `2H:& `& ` & ?? ( ` `@gk@㿘   (@ @g " 㿘 *(``  ((`` `2&@mmmmmmmmmmmmmnnnnnnnnnnnnnnnnnnnn0n0n0n0n0n0n0n0n0n0n0n0nDnTndntnnm`m 3(* b ۂ`@ aL E a a a a ` `  `  `l `l ` ` `  `b 㿘ސc@@Р   a&  aȁ ް?@@cЀ  a$   aȁ`   ?"J@ @ J@@  㿘 ,   @@8&@. . @@&@. @&@޲? T"&@ @@򀠠2  0 뀠 .  (    @@("  @   @ @#@+ @@ (!#@ ܁a@㿘   `((@\? T" `J`2 J` "   ``?㿘`2? "  ")x??  `?(>`@ )@??  @? ? T"  㿘? "`m?"9@`?@8 N@5?) ` -N@``@Ұ? T"?ʂg? 2#&`  2#@ ߂"&&&?```˂  @ @`    @`  ( @` b  㿘 "@2  @  @&@`1@J@`. k? T"  `@J@`    ߢ`@L ` &J ?A?р 20͠ L  ` &@ L `  ` L ` &?? "&@@ &@@@&@@?@&@?㿐 `? " F   @@&@ @ @ `&`I-@ ,,@@`&@` ?@@&@??@ ǐ@@s”צ   ` @, ` h? ?&@@bXbX````? a' ? '' ??'''?7 ''''@q  @0В '''   㿈! !`!  %' ''  @t ?` ,! ?,`,`,`㿘@I p a' = a(߂b  a(߂b @$@t=߀ b   #\#`#d#h@s? c  "ߐ@a8b0  W"Q"x㿘!(a0 H  H ށa 8`,$,,<HX8X8$@Xh,@  *@(``  *@(`` `@ 2  㿈! !'  @sܔ #H㿘 dܐ dؐ d@T dP dL dȐ ' *` ` ` bP`2<`   `<`3 @bP  dڠ?ـ֠ @ a@' (-߬cX'''''' .  (" 8`% `z8퀦(`ކ @ ߁` ``$  6 < <, , ,  <66`H``I#h `` #h(`@`0`'l  ,ߔܐ"ؐ `!``  @'l! !m d .!n! (!n!m @ޒ ?"&`@@@!А !mɒ d  !nÒ! !m!nɢ@ܠ Ţ@`bPB` " `{ 0@ߔt" `` " bP ```  "\`'l   `( [` ` @  (`Q``K#h(`@G```` B#h(`? 'Ę䀠~@&'ܦ` ` H`Ѱ` ?`(Ȱ``2 " `t !`` ߔ"0 ,@pd@ ɐ [@q4(Д ` " }bƐ 8` ' '`'l  m B"(`@`| ' ,8``V`g  E$@A  'h#PҠ m! 㿐@ '`"*͠a'"` *?J 8`* @J 8`* @ JЀ`  , - + JЁJ J`@  2 (`8Ѐ`   (8(Ѐ   (`8Ѐ` (("@㿐  ْ  (( ( @&@J:"  Ɩ ; @(( @&@J`:   < @@&@㿘N`-`+ ƒ  @ &@   㿘N`J?`MЀ`   `&@ !m J`/'` &`  &@`  p J`.2  ` d  J`.2֐ `  X ׀  u`&@ ` M!m̀ 㿘`   d  &`"+`4`  ) ) @(` ?(b  ;Tan!`?`ۀ`(` (` ( ( @ `- -  `p `(` (`  @( ( @S d d7 3  (`(` "* ?,`< <`0`0@8`8  " & @, - -  @@p(` @$ @$`@ + + ( ( @@㿘 !e> 0`@8` d]$88c @@  ` @  @@   㿐  a) ?  @ԅ)  a 'T'a`h#!n <` ' 2 $((, $@'$@$`ޤ   dl  f!`?(`@̐,`,` ( ( @'ޕb#TaHJ'ː-- @(` ( @@*  * ! )  ( @a Ta ?b"?   d  !`?(,?8 " c (`d (` d  !`?(`&  2   dސ ܂ !ؐւ`?   a?+ a? (`@  ) @  `      ``'``@2'&Ò8 2 &'  N$  8&..&y < <&r& i d c! `p&@4  &&(@@&$& G& ` &c @@  ` @  @@   㿘@  $$@K88 $$@@ `` ` ` `@ 0 ,&@l=  Ē <   < ?  Ѐ >ԐL * *  @'''Ъ} x'l ̀`+`h̀    d  !`?(`@`'̒?W 􀤠  8 Đ8`han!      d}  w!`?($@ )'̀ `p   d`  Z!`?(( @@(` $@'̀ ='̐8 i`;9'Ԫ   ``,`87 4`@88`@~''@ p 1쀠'"?@;`$'Аƒ  0Ђglg '%'&?ŀ  ;'`'쀡 @@  5`@`''@  &a@Ma   ,,@@`"  ݸ?@8``&' ,,@@`@@? @'  ~ 2 𤄿 ͢a'㿘 `| a @a) @? @)  a 㷐  ` & ˖`"  && a@na2? ( @  bؖ+`@ ;-`@ ` w #;?<`  ccĐ?-(`(`@@@2 ,`(`(`@@@`? @& f&`   @`?&& `@م,`Ǯa  "? 2 `  `x` 2 `  `x`㿘 ` .`.`@.@.@ @#@@#  @#@#@#@ c@ @4@`??`x a'  aH@eb?  &` 1&`Խ  (`> `:+>   (`> `/'@j #ń@aN? @4; /  @` 1 `؃> `/ݐԒ  ߐ~ ?ؠ H0 ΀ $͐``~`&@{` &`x`$&`u`(@ 2&` `4` $4  242@`2() ?ԇ(+  @ @`, & A`$    `b؀v.@  @@n(  4$J`  c @ $ ` @[` : $ `$ N(`> `:S`/^@3 . 2Z/> ?`$@W `$X@)b$@) .@3q K  2#E `    c @(@  @ c(  a@$ $ @ @ `+ c@` " M`  z` c@` `" M`  `  ` @& L`&`L``%&  (2" `$`L@` C`;b@ `@@) " `\`   &` b(@, `@?   "?`; "? &`@_ 0bL@` 2`a4`?`,@` @ 2` `2``   `24`$`$ c @ @ `  &` (@ ` ?``$4``-@`X   "(`@`?+ `ؔ@@-  @@ `( &` @ `?# + +@@ @ `@ ``# ``  ` ` ` + +@@ @ @ `` ` &` ` % ` hN`< "J`?  >J`>  @hR!'!k 2&@N`X`<x`"J`x`,q' (``z 8``,z`;x``!b@ d(c( @@   @ (( @@ ނ  @ axax```` &@ @ ` ` ` `@ &@ `@ ! `! ` ! ` ! &@ &@ &@&@㤂 㠠`&@ &@ &`&` @&` ` bm! #@T@հ u!`;R 2 0V8`a _ LJ`,H U BJ`>axax```` #&@ @ ` ` ` ` @ #&@ `@ ` `  `# &@  &@ &`&`# &@# `&@ &@#b&@ @h` '  ^X$%% -%-```&``   d  ܒ!`?(`( (!)  ( @@``d]ɮ @#@ #  b@(`(`@@@ @bؚ  (`(`@@ ( ` `@ @ #` ``  #@@Tax````  #@ ` ` ` ` #&@&@&` &`#&@` &`  c 0g >J`>` "-% c-㿘 1Ԑ Ѐ  Ё: 㿘#b`!b!t`  b(&( c&(    @ac $!0`&(`̔㿘 ǰ㿐a'􀤠`"&6"'&P!!(`@`$e?xabaX <Вa$'@$u `&`>&:`   ? 8`(& & ?@b ((*+`@`ـ`'6!"?xaaX <a' c`!& !#  &  )  b @ &(((@&0(`@` X  ,`+`@+`@" &ސ,`+`@+`@ &Ր㿘a   b( ["`c  c  (`(`@``@("@  a  $L@@/   _,@ # c ah @@`@`@eT @. , @` "㿘⠀`!!? ! S  sa  @_c $!w㿘1""㿘@d"Р N#b`@.! ;@d!@ `6$b#a`: L`aa    ㌆ #  `@R"6 # L`:a_ a!!@Q!# @_Kc $a㿘!" a" ? @㿘!{"( t"㿘1"k"vi㿐'DDD'D$ 'D$&?'D$4`㿘'DDxD&hJ㿘!b ,  “ 㿘!b ,  㿘㿘N@`2`@dN` @2N@ 2N? 㿘1ސ"'@`cpe$@$$  ! `X  @cܠ!@2$@@9#  $@"&'a\#㿘. .  ""* @`@  & "" " ? . .   b(@b X$ 0& 0 `!` X! `@c㿘@]  c8" 2  1r# D @ Dn#㿘b@B!a# c8$ ! XV ` #Q6  0&& & & ?& 6 & D  0& & H `` ` @cM!24# x *# D @ D`B!0lPH@(ưưȼpTƠ`ư`Ơ`ƠƠƠ,,Ơ````````````Ơ```hhƠƠƠƠ`ll``ƠƠ`ưlƠ`ư`ƠƠ`l`ƠƠ``ȴ```````p`ƠƠ```````hƠlllL``ư```ư``ư```````lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllxƼƼ8 ! ' ?" . xÒa     '' ܔ @_ ?? ޒcܒ   $''ܒ  @_ ?Β?`Ȓ?ƒ$Ē(  '܂ ''ܒ  @_p ?"?@7D k̕:0'   '܂ 0''ܒ  @_U ?"?Ă  =''  '!b, ț  ͐ Ȕ'" z `uas!q ?nc  ''|   ''v `  gȀ Z?X̂  ''f P d   ''\ (@h ,"@0"`4"`㿘  8@ 8`  *`h  " " ! $! ( $ " ("  " " " "  ! ! X @\ u\``d@\ P`@&Xɒ  ` @$+ * `26 @VI cX$$   &&  ?&&&(&$&\&& &@]&TX '8 'Đ''@"'@"R <@`4&P&@!& $@   !@2 !ǫ$""$ @Vh 0 !Ǡ$""$    !@2 !Ǒ$"" $   '   '@#  ob~&㿈''b`V#\㿘  `  <``@ 8@V@V) <'t  'Ha@' (\'|'p'l'h'd?$'؂ ?7܄,  'x 8ت`'`<$8P`X`0<@H  t @ lp  <@X uހ`|`6 І''dh'''  !# (( @@(` .  @ ?/!@   $, !@ |@   #?+ '\ n G ƛ` ƕ`#" Ə  $0$,ހ` _`ݠƂ "~`A Ј D ?/a |  ` v  (p X`@2j  @![@!  K`@ u, -x`zt @ "r,x'xЄ@' "'|  $0Z$,  V$,!R,t `   $,$0` @ $8:, @ ''$,0 㻈 a@' ڐ"Lb!    @ H@]" 2 " @5c(  @K/ @ & H "'c8@\@({(`㘠`8` 2,  (`8@*F 0!'@ ː @& L (``  (`` 8``@"$(!@J#@*#0ɐ 㻀 a@' !ڐ"LbX  @ &?R$#\#d#`  @| , 2"@ 3 `"!$ـ+"  ْ? bD@ ( $@ ݐ  bD`†ْ? bDْ? bD bD ْ? bDْ? bDU!㷈 a@'  @ x?5`#\($@\$u@ @\?N`.h8@(w! bD㿘!ڐ"Lb @ 4 ?ė'" $D (`v 8``.(d?`2 H`.`? al?0`@b "`"m  =p ^` ?$D` L`L   g I`=JD`#``"` bd`̀`ɀ@ ƀ0 ``2`ߪ`* "l % D ? $Db L ?$D bD$D?㿘ٴ&"Lڔ!Вb @?.@@ )?c.@2 ..  @  @` ` 6`  @  H!ڐ"Lb– @K ?t``od l(@(`(`(`(`(`(`(`(`(` (` @(` 4 H` 0`( @(@`   `~('@ d'K  @$@<@٘ 2.@82 . 0`@3` 0   $@ @  @@  @  @ ` 0 `&? bD?$@` `.` (` @2 `.@2 ` @`/``@2 ```0@`0㿘.`` . 0``* , 02`.`۵6``, 0` ct  2   `b` @(@(`@ @ (`@㿈 ) #pa/7̀@/#@Ya/@X52 c 9;7#@X7că2  a+?5cȒc @ , - 50`*  2   ,`2 *  5c@XҐ#b*  6 *  A  26  f! #t#5#p`@4cʐ@X(4 ! #r 耠`` &?4#r ca#pccʂ` 55#p*`2`8#* V2 #r`* 9;+-#! w7@VȐ($#t 耢 8@n5 @`2@` e     +@ ` 2   ! *@A @+` @ @`2@` /     @??+  @ 2 @??#( @?*@Ք"   @"  c  c㿘! #x  t? $#x |  c 㿘!ڐ"Lb} ٠bPٔ$h"H} . `.  @㻐  a' !@6$ "@@!@`, 4 `* 0`@2@  2   ?䮐" 㻐  a'     &@$ @ې@ؐ`, * 4 2 2`ܰ ڰ ذ?t"8㿘ڐ"Lb!}   ``""   ?` 0 @U@@2    2  `? c   @6@@  2  `   ``" @8Д  2 0Ҁ`В@8ǔ  2 0ɝH a@' !''Hڐ"Lb| @( ? H`0` 2``@@'`  < ''' ! Ԩ'` ܐ' `   ` ``?( (@`x #`ð  #x``' #`3 `cJؒ ` v&c 5$#x:"#x +   J@H#x'̂ '''Ē| H`  7Բ@#x(`ֻ2 bԂ @(`7@Đ* 0`'7԰ (``  @7ԃ(`` @#x0`֘ '?` @p` g'2Ѱ? =L"`Y `3 c   &c $#x c|`d|` `||` #xR   !#|#xH@ H@(@(`(` (` ŐcIJ##x '7Ȑ B $v"#x!'Ԕ g '"`#x '7Ȑ    V`#x0jd#h H  #x``ဠ`߀``  b耈'% "#x``#x#xHؖ n Ho1` k3   &cC R$#x]'` 7ԃ(``  " ܂b &7ԃ(`  @(`7ԃ(`0`b"#xՈ 2 `( #`"Hܺ   H@܀ *8܀ 2 )0` -'`6 ' #`C   ؒH@܀  3 4 ܰ? !@ 8Ѥ ` /3 #`]3   /'7 c c|@"3 ah`2"`s Є ``)΀  2~ z ᯐ"P < g'>? <"9?"㿘    @  ? &@ `O +`$ .) (E? ) ',5.`\2` \)  )?2%?  ?(`@@ *?:? &?(`@@ * ?@ )   `  `@ `  "" ? "0? ?  @`  c* P㿈'H'T@    ``@`2``HT '  ?@"l @B `"\T@.&@`&@.n@g (  ."b\@  "l`>Lg- @''`$,> @ @ .  \"`'n'j``@8@T ?(`@2 @`2`%T@ -H 8- 2$#@? `"`.2Ԫ`r``%`@8i@uT  S HH( @?J`4  .! ``` `Ѐ` `-_` .(` ;` .ဠ.````Ѐ` ꀣ`  J`*"J Þ@`.` c  (`8`    8`\ `?(`8` ߀`] .  (`8`  `. @ (`8`` ߀`](     * @   (`() *`2 *@2 2 *`*@2 *`*`  c* P  ? 0 @??` c㿐ڐ"Lb!x (``b`X`53+ 8`W` "9 ` 5@   ; @ Q &"I>c0 ) 5al* @@$al(`8`%` ˀ` ʀ`  N` Ȁ`  N` À`  @͔  "@Ɣ  `@$`)<@$al@ `d$`@ `h$`@  `@$`@  2``$`㺸 a@' !ڐ"Lbwi ٨bPٔ$h"Hwa  `2q!@  c#(%!`?v "#!P%!T%!`2  % `2  %  ` "%  5- 5  -  % %  %!% <% !l (% @%!h%!lU@@T`@# ''   `% % @ jc( Ք @@>ch/x  @ْ ~8@Q(@ ;`؀ 2*O` @a 2 Oƀ` C` BƐ @aP Oƀ ƀ  @ؒ`耢 Oƀ` c` "b/@ @˒` Oƀ ƀ  @` Oʀ ʀ  @a OȀ` @Ȁ` > @a 2Oǀ` ` 2aa 4% !l ((@@%!lM h` `( h h% P% L( P`  8``.(d`2 X`$@ . $ ($`$K o % %    P@2%!!T@P @QՐ Ȁ   h!@?S h% L' (`8` P d `  `  "    '   (`8` ` ` 8` ꀠ` , @.  @)  c#(%!Ѐ`? 2!Ā` !Ȁ`" @Q!( a8  @ W @i . P !@> hL {  m k(`8``  h!@>ڐ@ a ' *' %f@Xa@*?% % L@`͐X b@ T   $ L@` ` `?,@J` 5 "  ?% /@/`/`/`ƈ  H`5` `RK@`y @`b`fIE(aƒ` @(`8` ` `:` 4  @Ab   @9` h  $ ̀`  `  `, `" H` K@`y @`b`f  (a `` ,  '` ` ", L`",` ` ,  '  (`8`ڐ` נ h!@> @x 2* h% L(`` P d 8`"     (``8`` ` ,   f d(`8``  (` c8` @2)  (`8/L`[q @PM 5  '''''''''0ʖ  `"f  "b@^d8^, Uȃ(`8` "  |8``K` H`;F ,  `?? @2,@` @,  <@В 뀦 ;,@@z j/ @@$!p "'$ `,@(`8`N``;K  㘈`8 2` @(`8`" `;1 ,@@F @ t/ @/ @ @ c!p  c!t c,@ ؂(`8`   (`8`    (`8` x  Ӱ  Т?%   % % R  @䀢 2,@/ /    `    `(`8`6,@`;3   㘈`8 2` @(`8`" `; <`&,@`/H   ? ("  4?(    (@(  @  { @!p$'$h$!tƒ` @(`8` ` k``ʠ  (`8` ` ` ?@ `ڈ h@`  O $?$!t8``" ,`  ` ", L`` ,  '   ]@ " J *`:+O` •8. .@M`8 .`. @M`% ` ` ` @N!  @< אOa4   ` 㿘    @Er@Ep 㿈  '''  @M? 8@?㿈) 9 Ѐ` b c9 `01 9   *?В % ) 9 *?`#`!9 "K D ) @? @  ) 9 `x`Xʢ   ʼn) 9 `.) $ ) 9 Ѐ` ` 9  $ `$8```"$? `` ` &@!``耠쀠` (`((@@c耠`(`ݖ ?c耠쀠`(`(@̖㿐P? 2㿐/aP  (`8`  @ #" @(`(`@2,@ ,@(`8`  .`.@.`.`  . ` ,@㿀 a'  "@ /"? 0'''(`:``:1'?axa`    :` (@#`  ",`@ @ (`@ , "# `@(`:``:̐ 00 $` @ )(?@@L6   :' N@`ӄ Ѓ4`--@   (`  -4`-@(`k!@ .p  k  c   (` 8``" (`8`@?"2 @ @J(`8`` 2  ` @  (` 8`@" (`8``?"㿐 u?  $a @ @  `2  @ !a @ @   `2  @ ! $`?a*㿐% `i@  0@   @" @C 0  0`"V a aV &  I&  3\5 @!KE@H֢ $`% C 2(" & 6 & 2&  "0&  & & `".@! 1? C & 6 & & & @B  3\ܐ0`Ǣ & `@!Y Ң?~% ΢?@H}㿘`c' `S0`2?( @"% @&@J&`@ &,` }&$ @@J&,`ld02,` |  "㿘 @3@P 2 @5  ``@+  2`"   @"  `  @&㿘ې3 ɔcЀ "cЁ㿘 @&@A  & @A& & & a 㿐@ ?)fb@"X " @L`#`   @@ ?H "@! # "'`@F` @I&&`,@@F "@J *` V ` S@9 ϐ,@@D @"@H@`2@ 4@* `0`& & ` ^ X@&  D B* *  =X: "  `?*`@@4$@@` ) * "&$@ *  "!$@:  〢   L` `  L` `  'Ґ"@c(&@ W0p$@ @E*` `(`&` &`$@&  &`@E  &`W?R"㿘!ې#`' "#㿘@ " @` @&` Ґ"@c(` &@@&` aВ`㿘 H@   D@EA? $ H$ D 㿘% `V 0" `;? <@  "M   &@  @&& 6 ` $@ 2!&@ D@H & @& &@` D  4@ "  &@`  0@  2   D@H@@ ђ  @  2  Ps $&@㿐@ ') "^ ! &c)a6 & $))a@& ,6 & & ()0& `  @  ~56 `  "6  㿘 @  b  K6 "@D"㿘# b` 6  6 b (b@֪ (m3 b`;b     h dK)a@"1V 6 @> ؒ ƀ?π 0   @"!@? 0!  & &6 bp `ְ? " т  < @@Є& L6  V   @Ev* 0`ǃ*  <0`8 8 @ @D@`2 L L  8   ƀ?  0&&    @"!@?= 0! 6 b`M @ "H  P2 0   8@D@ EA u+ (%/ @@9 d`  <8`@d0`"_  P 0  ;```K  <;`@ d24 0b`t?  ƀ ?/  0:@B T @ $2r L@(o L$"& &   @"!@> 0! 6 b0{b  0`  @@@Ad 2U 0ڒ  ƀ      @   @& H&8$ L ? "? :`  b4J  (`8``@2? 㿘; c` `2 (8``-`+ `?`>`0;`0 E( | $   c - Ѐ` Wc `@`Q@?` `7$@I $/+z " ޤ"GL`ŀ `0` !#|`¦z̒   "" ?  "" ?`2&@L }LzxX`L y㿐 @1  􀤠  `" ``2 @ 2`@, 4  @  "@={@x  '܂ '''''ܢ   @EH ?@C5   @E8 E 4     :b@`2` `2 ` @@ ` `Ђ` ޒ`+ 0`"@  `ј @   :`" ` `   :`"      @   :`2@ @ `ƅ*`*` @B ̒ @F1   `2 ` 6`2 ` %`@%`  @D (@ %` @@D @` ``%`  耢 А@Dܒ`%@ /`0`"@r `%`%`%` @   8`" ` `2   8`"  @ ` ` )  " %`@  '`  @` @E@@<9䀥8&%& %`@Du@%` @Dn٢@%@R&@< @< @B/@<?㿘@Ej  @Aِ @DGp @D?b1.'"@(@#@@\ 5 H@`2  E`4 )@c,% `   `, '@`?" `     ׀`"рؠ (֠ Ԡ `"ʠ 㿐 'H`  `2 (8``-`+ `?`R`0O`0>`Y SX   O  `$D '9   #?1  Ѐ` u c `@`n@?` `7$@f`2Ch 8@Tc< @ b ֨ "jM``0 ` `?S#'?OK# &@T7 <   @ ˔' ""?  @ "" ? H2?H @  ""?ؐM F MC xX`M    B 㿘x?& & &( a@' %  ` @ -  j@Cސ j  h//@1`xd j? &   ?&  2 0xs&#㿘 2&& "& `  &㿐P'P'T'X@Y'x a' <"`b # #(` 8@` @ 4W#`(@C0P''8(8@  ƀ88` @$$@` 2'` [@C 88` @$` $@`` `  :,` ,) ,[``$ $.? ) ".8`%NmR%퀤  ꀤ . .?)  .@Ò88` @$` ` N ``"E`@@ m?Z` `V "0W8 O >@ g "$@ '`' ''fwo0;"C@@Bv88` 6?$` `  0ܒ $@'' '' fj `w@BKX88` @$$@E`/&`=@B8Â8O`7@?"&`w?&@&`d# ''iؐ@@ w/`7#o͒ 㿘 `8&` ib  a' ؒ '!''@B!`c`ׂ "''?''x77;xx(@ O pF(F(F(FFF(FtEF(FtF(F(F(F(F(F(F(F( `(`@㿘b b %#!c@Ac (`(`ݐ `@#c!@Ac (`(``#㿘ː3 @b㿘1 3"@a㿈 `#!c@AU?c c! @쀠`G(`@AB?"-c @A6 @A/X?X6@F$*`@`?[@A耢?"c!@a  @A 0P@@0?6cc!@W@@ ?@@۔h?ƀ  㿘l3 @b㿐L'L'P'T'XBx'㿀@@'! " '''䀠'`0 `? @"``0㿘 `@ϒ㿘+N`(`" 2H J `  (?H` (@@@  $"@("`,"`㿘  L@ L` ` `      """ "  " "㿘  `  P``@ L@6@6u P`@<Đ   d@< u  `6`&[ $`    $@$`$`$` $`$` $`֐@=`L '`0  'Ȑ''@'Đ@ 2`P``t@6@6 @ * `f6 ``P$`H``@ T@c c$@$ %$   @&  td   $`   @ !$""$  !$""$  !$""$ ?0   @x !$"" $ @6@@6= h'D \'H 'L'P'T'X` L 0$ $ T`` ' bhШȴ $$ L$ $% P H`  q P`H jD@ @ bPL@ \@ gc`  "[ $ L``'''''@W :@ߒ  $ ЁА@@ $ D@ @ 2$ L $D@ ` )  $ $$ (؀` @$ L $2 ~@  $` $ $@  $$ $   $ $ XT@  $`؂ $ $㿘$ n?@? & (& $㿀2 ' #s7  (( @@(`VШb@ sI H P   @ H s#, ,  @@(` `` ?& $?$  6 & (& $?` `"E "A` & (& $?6 "1? & (& $?㿘a` ``<` `(  㿀!! 0 @ <`ؐbЂb& ` & ` c && & & & @ (@͐ @ʐ`& <``"ݐ@ِ@8  Ԑ  $!T|TTTTT ` ` `0`(<(`"`"` "@ "@ "`@`" ` !`"  `" ` "` "@@`"` "`"@ "` "`"@ "@ "` "` "@ "` "@ "@ "@ "@㿘 &`&` @ @` @ܒ` @ג` @ғ`㿘@  @` `@Ò`  @`@`㿘@  @` ``` 7 `@ `H 㿘@w ` !@ `㿘  @b` " ` ````@ @p`  @k`" `c" " " "  " `" " "  `   "  "@ `"  `   " @   `"   "   @@ @ " "   @  @    㿘 @   @@;&   @& 㿘 @   @@;&   @&  ` " @ #d d ( e( f( g( `" # `  "  +d+e+f+gd"@ `" #㾀 a@' `c` G V  ''` ) .`(,.@ '`6ఒ %`  J $@K䀢   "3@ ' '`  `Z  0? ."M Ȃ!'??@;  @p`؂``''7?' o!6 #\a bۡ! #```'''''' #\@ ! `2   b @?"6 p_6 ؂ "b b`@ 㿘@  @` @` @` `   @  `0@(( ,  ( 0  ` @< \ 㿘  ` `?(`@    $ @   & & `  `" ! aؒ  `@:!   #@@   ! ! 㿘   $ @@   $ $    $ 㿘 @`" ,  $  `"?& (& , 㿘` ( ,@ @4&@`& ( ֐ 쀦`  c/`㿘  D`2 $ P  L  @ `?(`&@  X T " @@ &"&@ X T& X &@ &&@ L P@& L& P &@  H 2 \&@  4 H& D& P& L $& T& (& 0@& X& , &@ @4&@ T@&&@ < & T $ 6 X  )& 4& H $@5j  H $ ("@& & (& <& $& ,㿘 @` ( , @ # @9. (&@@& (  ( ,( 怦4 ( @9 ( @& (㿐 @` Ĕ  0& 4 (& 0 㿘  0`   4`& 0ې 2 0  4` , (@`?㿐  @` 0`   4`$ 0 2 0  4`$ 4  " ($ 0  ,`$ 0㿘 " 0`  4` 󀦠 G& @ 0 @$ 0 㿐 0`(, @`8  ˰  &@&@0(` 0 ( 㿘      @8I  @$ @@ $  洦 㿘 @/ @/ $@/㿘@5 ` 0_@5$ 8 /$ W@5$ < 0$ $ & $ $ $$ $ $ ($ X$ $ $ ,$ 0$ D$ P$ @$ T `(& $   H$ 4$ L17   @ Օ     @ Ζ@/    @ Ŗ @/@/㿘   _6 ?`" `"  (? @20 , "@㿘 ߐ? "   @  $   " 0  ( ,  $ $ ($ 0 p a' J`"آr @@8$@ $`a& &&: \X @8x' a '''ܰؤó!㿘 @d! \ >. `?@@%z=`)    ^`  @+.?{  0 /?^ `  -.@I ڲ ײ @@R @%? "@3㿐 !a#\#`   ``㿐 `La0#`#\  aɰ ""㿘?   p@.w  "?㿘?g  )3`@  8`) )  @@ @ @  `@ 0@ 8`) )  @ @ `6 ?@ 0@ 8`) )  @@@ +  0@8`) )  @@ @ `  0@@ 8`) )  @  `6 ? 0@@ 8`) )  @ @@ "qDpppppppppppppppppppppppPpppppppppPppppppppP  K?"wM Ě   k#\kѐ???c?k??@3  "" 㻐 a' ?N`2  @ / 0 laX@6~! p a(8``"(`:`%@( (  (8```:(?L`  (`ރ8`  ?``((`@( (݆@N`@Ҡ @(Ϡ H(`Ơ M`  H`@8( @6!P 2!@b`J@ `0 J@ `2   @ @J(`8`` 2  ` @㿀 ' 㿐`` ` @'   @  &@㿐`` ` @'   @  &@㿘``* ``?` @㿘``* ``?` @㿐`` ` @'   @  &@㿐`` ` @'   @  &@㿐`` ` V@'   @  6@㿐`` ` @'   @  6@㿐`` ` V@'   @  6@㿐`` ` @'   @  6@㿐N@'ɰ  .@㿐@'۰  .@㿐`` `@ @ '   @  @ &@͞@㿘  ` ```? @ ` 2   `   "  `  `P0ߐ `a0ם㿘  @  @ 2 㿐`" ` `@'' @ 2!   @   @       >@`㿐`" ` `@'' @ 2!   @   @       >@`㿐` @` Ւ 􀢀8 `"`   @3ؐ'@*s &@  , @09&@ ,     @ؐ cx?㿘@  `"`Ձ` ``@*0 $ `@/$  !   @F $``㿘V `I# b`A 0`" a a `1  `" @  &? `  0   @" @) 0  D "& @)& D& & 6 b`@)  0@IϠ 0? " `" @` @%@㿘# b` `& `@&b` `& @㿘 0 `?@?   `$ @$ 㿘b@@ &  82! 0dS`6  `X `3  $  @& & (6    @" @)< 0  <`&  8 &?Α 2`@` ?6 ? 6 @" ?(6 ` ` 2 @ & 6 Ʉ?@ 2ۄ? & & 6 @q : " ?`@6  ` `  @@㿐c   " @9   m  `@ Τ 2 `) )a2 ))a" $" ,))a@02 " " ("  "ǐ 㿘N`r&`w `a    " "N `+  `b"N &@`+  &@  &   㿘! @ ( ,  0㿘 ( ! & (6 0  '*! , @,G  1$!! (`&!&!@2  $  ,(`@`D& * @ `D ,& 0& ,@ >*@. !@$ @1@@(%!&!& ?㿘 ?`a?P "㿘!4` !  aa && !(& @!! CИ ?! 0``@!8` `Đ @L  `?? O"$,㿘`  a4`  ? "? @1   &a0㿘!4 @1v H!؀ !!؂&!(`@'!&!@'! "!/!`$! !8 `@'~!@ ! "!@'t! "!@'n!?ex@'f  ?"㿘 @+C  &!؀`&!   @+7.@ `  !؃)) (`@   ni?"㿘 ?u @' 㾸` f @+ !ܢ ?$a$a / Dΐ?[$ l( ap   `" $a aה!?!"@ OĀ `?`` `X$a $` !`$`$`$`    $`$`$`8!@`D@0$$`4`Ē @0  @   "` @&"  " @$` $`%  `2$`4`2$a ` `ဠ " $` "$`d`4  & @c* @   `D(@$` *  `D$`$`@  ``,* $`,!0@`?$`<$`0d$`(@? `,@4$`  `n@/@$a0  a0``$a4? $@, $a$ a"%aD" " !%ah" " %#`x" " ! b" " n"l `X$$a @ $`(@@q$` 0aa/ O``*a  @!(`@2" O``(do C ` `` (`@`D*a8 :$a@/9*ca0@/$a0" " 㿘 s!$`ba  "! `2l!*! ":!$%!((`"   $!(   @/ $! ?`׀ !$$! `$!$!($!(ڇ(!$$! ! ` $!$$!(ˈ !$ (( $!$$!  ` ( @ $!( @/h   0ʄ $!$$! $!($!$$!(?$!$ ? "$!, +`@@  @  ! ```@&@? &`! @& &  㿐   @/ | `- %  %@@"K`` 8@ "@@. "3  @ ``8@ @5 2  - @ e '@ * 2 `0@. 2 -? @  2`")*``*@* - @  " ?,`& @&@   @  " 0㿘  !`  N  "&!,? "&!,㿘  " ! "&!,?!` f`(~ "&!,㿘  p "&!,?|tld\`"  ``0` (%0   @(`  @(`  @(`  @(`  @(`  @(` א@*  @  @(`  @(`ׄՄ ؄ ۄ ބ    㿀` 1# b ''''䀠`#'0 `? @b`  Sx$Đ 200 㿘``\  Z `V@`@9`  `"+@p   CA @+@@& 2@ M` @`"&`$@`ڨ@` Ҫ`@```d $ ,@ $@` @`&` @3    , @ 4Ʀ ?`@6 @+j  @& &@ 2   @D  " ` b`")@(0` H """@@+5  @& &` @`&`$@ `ܨ@`ժ` ( @( @+@@D& "` @ * , @ $ Ҧ@   @@, `*, @'` {   @& @&& & @*ݔ  @& & ?I"㿘V "#  `& @ &  $   , @ @ ?`@6   㿘# b` Аb`ia0㿘 # b` ` b`Ok? "B 1'@ 㿘 c8  T `< X2㿘b@  "42    &  &  &  N "  0 "   @" @! 0   & 6 &`(`6 υ0?bb@1 (V  &$&@(k3 <І`? &$&@(&@ & L( ()a@$(㿐 ` C & && Ɛ@'U @  & && ` 6   C`& 6 & & @{V  2` 㿐@ ' `@% 2#\`2@*Д  "#$ `@*ف   ?_"? "  P $ $\`$ \$ $ $ @* `0@*%㿈@ `\'/;``%,`,` @ `  @ ?<2 # @)' @*e  @?䢄$ @*V@?آ`%` 2'`v '`㿐@e G?) "`D' " #\  `@=#\   ?^?7`5" PO $` $@\$ \ ($ ( @@ ` ` ` @) 2?"`@*@)'@)  " ?"    "  (c0 㿈!"`""  ' ''   @(??2"0b R 㿘V Oϔ?  > P @6 2   (6 㿘 aV   O  T (4 u㿘V ޔ :  P@C> P (6 h! !' @Ȑ8@  {!8  bc` ` @  2  ?㿘 @%  Ḓ `$ḡ<  , @) "@( ?(@$.@ a8$. @0`ā㻈 !a' ?+  yp`$@(P#b?' @%Ɣ@ ?&!! d  @% !?"M? `ဠ "h@ 8` @ ' @ +@+`+`+` `95  <Y @ 8`(@  0`8+0@+@@;?.@  ]? O"X? ?" 6y@(#؀ p  <(@  @*  @ '@@@߰?`  7 ((@@͐ *  @!@㿐!?R "P6@Z6  <P @ 8`(@  0`8+0@+@@v??T L@6@`2 @`"&6@ `ဠ`"D@ 8` $=  @`' *@*`*`*`@` 6@ 6` 6` @f*  @  <(@  @Z*  @@@@`? O"7.@.`@` Ϙ `7 @ *`*`` 㿘!@ @$ .`@$!8 .`@`Đ  U  2!8!8@' 㿘`  (0``(`@`@ $@&& $  `9*`8(  < 0`@8(  (@) @'< 0`@8(  (@) @'㿘 4@```.`  ,  $`D ;@(8+, a8 "@ (`@  @&`(2D (`@<` @6@`ݦD`& $ D '$ |(D, DD&   D (`@x`80`@8(  , (@ @ (`;0`   (`@2 < 08+`@  (@#@ ZI*` $ ,?  D"2H(@`@"'$( @(`0` O  $ (`@8`0p8& $耢'(0``?& 4 <& 4 1 sa`T  "s@  1, @L  ͂`D  `Dކ(D,@ `DD& , Du @&  &` `* ( 3  (`@3 0 0 5` @0㿘`(` @$ , 2 @,`(`0`6$ , 2 @!`,`006$6 4㿘``"$H(``V`T`[@& <?``2`:  -?  ` (`@`f@+ ? `,  8& 8(`@&S 2`?`˒@`@’n'`$4, 2 @$4, 2 @`455 ( 5(`5``.` 8 ( `Z& 8 4 7 `,  8& 8H  @%  ? @% ' ` -`` (`7(0`'`3  7 , @'0$G'2'@(`2 @- `((0`'''ĸ؃,  0`(`0``) @`" 0`(` * ` (`@`܄p~ ` ``,` (0`f(``a-  '2"'' '@2` (`@`܄7@ p`Y ``-`@' K'`_7 *`, 2`2 $ @t@-$@06J0 `+ ` [( 4(`0` 6(0 -`(` ` #\@* ̀`Ȁ``'D` (7'İ? -( 6(0 @3@*`(32`@$ ' Ĩ k ''(Ā`]  Ȱ 㿘`. @(2`U ?- "0`@ .` (`0`?4@`@44`8%`8 -  - "0`@ .`* 22 "  @ @  `01 @  `@@01 `@  a(@"@%a(㿘@   ` (`"&@``2 &@@$ 2  &@` 㿘`     ` (`@@# ,?! @@ &!" `  &!(`#(`!$&! `&!$` ,0`!`@ @# 4` Т?? "@@# &!  @2` !$㿘`. @(`0`" ` `(`0``(`@@#~ 2`?Y(`@- &@ @ &`  !$&! `&!$&!(  (`@@#W &!  &!( `!$&! `&!$ @` @#> „$@(0`@?&` , 0`.`!,`2`2@@!& (`@@#   ` ڔ F? "㿘`     (`` 0``@(`@@" '?! @@ $!F  ` ,0`!`@ @7 4` 0? "㿘 &??! &㿈 'P\耢 ?P{4 * 2 `7P$ @@ ` `()   (`0`0 ) 0003(`2P$$ `(@`P`"$ $  @"X $ 0(```@ 7@`(01@(`3@UP 7`㿘`(`1 @`'Dt /\@$@-,`4 2 @4 0%( 5(`7@```.``(`1 @`D(`0`41 @($0, 2 @W(`44(($05 (7@4D K@(`0`  0```.``(`1 @` 1 (`1 0`'($0`, 2 @(`44(($00(4 4``.` ?"ن 4D   `* (`1 @`㿘` . (0`-`*`@!X  2?`    (0` ` $* *2 2@@   ߐ? 2?.*@2 ?㿘` - (0`"9(`0``,00`2,(`0@`2)0 `, *`2`@  `ΐ H  (`0``ه(0`٤ (`݄@(`0(@`'&`  1 (` (`0`3@ (3` `.``@ 8 & 81 1   &`٘ ?  @ @`2  ?  8 n5@ @`2@` e `    +@ ` 2   ! *@A +@ ` `2` /     @??+  @ 2 @??#( ?*Ք"   @"   (` (@j B`@> @]N`XY!`  `X ((( *L(٪`@ @d > , (2bZ /逦@? "? "R! #`褄?*3r!?`٤ ``  㿘  @? 3a  3a 㿘 s 8` @؜TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT|  (` ` ? 8 㿘 `8``>`@"  (`` ? @8  0@ @ @ `0㿘  (``` 8  6  (&    @      * @*@ Ð  㿐\@, @ @ ''` 5``  8 2` @   @r`  `n @ @ (`@  u`@$=`"@Q'``2N$`?`?` ` @ `? 2>``2ư >`(`@` ,@ k   o$  P&@  @@ C$` '$ ""$` @F  $ $` P $  `  @ @ (`@ &   ݠ `(`@@ l` ``@   u'(`@`0c @0`^`g   ` #b'H'P 'T4'''''` `-'I`0h I'/94   ,@@ И @ 'K/94L ,  *`*`@@ @ 'KЀ/L@      `ez`Ey  ł T܀` `N"KD`i`I2y'@Ȓc耢 o'@b  `' ''P` )`;8 @0`(`@`0'`@' ""܃(`@ ' 'H`2rI܂ '''H`H  쀢"T@@ a'' I' @ 'N `+ `-     ''  'HЀ` 8'`0  'H``0π`a О 'K`/`9!Ј 'H`**`/@`9!`b 2> = ' ' '`?'   '蕠 ?Ѓ, @'H`eaHJ?Ѐ`5US$`P`ւ ԅ.`'؀`a@@ ؂ 5 @Ѕ.`b@ J5 ?И PT#\ ( 쀠`"0-I `X`xP 'H``0"` P@/܀ '쀢 ' '$@~ Ѕ(b@ J?Ђ8` Д@ 耢 '!  '@0''` 48'''b @ݖ ' `` ''''@  ` *@O@ ` ܐ `` *@C @ 䬒 `*  ,"@$@ @#@@ @@ @@@4` $@$ @  p@  k@ $@`@  `@  Y@  Q @  I@ A C`$X @ $ `F &P 2D ۀ`  8(`` :      :" '쀧@4`N W ' (`@`@  `' !5'@ߒb      ' M'쀤  ! ' 'b'??'Ȕ@ w ` @    (`@@ Z`@  '`"  ?@   '@ '@ '@ ''@ Ð@   @ @ @ @ @ L  I  , H@( H@' VH   Ѐ  C 6 ,@`@ ,`,4`*`*`@@9 )'  @(```@''  *  @ ?D' '- D'܁ @@@' $b  @ @ΐb@R b `2 ' @'쀧``  `?   W U " P''`2蠧@ 䀤 @  ' 'P@ @@@@ސ䀠 ``` `@P' T  8`(`@@ ' ? 8  "[ 0@U  ' ڦ bȄ  H'  ?Ȇ  'b mȓH`' ?``2?bȁ  0' @'?j     b`  Ј?@  'Ђ@ J0` |?К(@'Ѓ(` 0`|#@ b@ 9 @H `? `0   'H``0π`(   ? ']b  !#'2@ *  @  '@܆ @''䀠`Kaށ Jb̑!  7@'쁨 .b&܄ `-' "r"  6 `@3@0 @d`eaH  Ѕ(b@ ?Ђ 8`  b  Ј?@  'Ђ@ J0` |?К(@'Ѓ(` 0`|\@ bh 9 @H `O?@ `'''@ u @aܢ'@@y #'' @V', `@@ @q`u`,, @@  'H` Ј  `n4ܠސ@b ,P`#@ 'H`('T@''܄ P `p' ""ܨ  @# '@''䀣`) &  `܂ P P '쀤 2}?Va m?ݸ ?׸ 6E @@ '' *`*`@@ @?``'`00T#\  Tw @`@r(`&@ J(`PT쑢 J#\В ?Ѐ 6Y - !B''쀠?܀KЅ.` b@PT#\ ?Ѐ 5 @@'؂  @\'܂ !'d`` \'"  ?(@@  ! ܆@ `  !'''J'"A"  ?'@M L0 '@B '?,܈ ' ` `+dd0a(@#㿘!"`ۨ` 0.& 0 @0` `2* @`"   @ `@  0   0"  `?  @    `  `2  `耣   # (`Pp  && i `$` 8`` @ a ``   `@ `  @   "E" `(@      "$< @$@, $@"@  $@ @u %%`` 4 "@@ ` `L``L@E} P ""     @< (`@ (2 @9`$@  " &` ```ˀ  && `+ `- "%4"  ?  >@    +`+`@2 5 3 @& $ " `      O @2K @  2@/ "?:`(`@` (   `@   @`$6`@|߰  ""  v   r ì @@@b $" [@ @S"  @ "L p " "$@.`2$, <   "8 @`21   $%@&` b|& ""@ "&@@` @6 @9 `  0<`(`@` ( ! "` `S`Ȁ @, ͂ $$  0`@~  0`?`8`f@`,8` <`` 8`` @ &"     ? @$ ` (` @8 ``& ؒ ע v0 /@ *@ @(```H@8`Z$ " @ " (`:`*``@ `"  @" @8" :`@@) ``@@`` `) (@`0 ( ) ` 㿈@ !@?`  ( ` '(`@' '(` ' 㿘 H   (` @>  " ` "   @4N" N @̰  2  N @Ѐ "   :`  ((```` 0 @ @ (@ ! @0 !! 8``" " @! !@ !  㿐  (``  ` '` '@ѐ  ``#b h@" `" `" ` " `" `" `" $`* (`* )`* *`* +` * ,`!* -`"* .`#! `* /  d`  `l#b" ! d"  " ( ((`` " ? (``  (`` "   @ (`   (0 "? "㿘۪` `0@`8`(`@`  `` (L`0"L`    @2X $< ` 8^ `  } W] @ @: @` w u `  `  (8``0ІL``x``X2Ɇ `` (ņ (`@$ ` ( ` $  $Δ R "@@ ?0@@&@)`?`$L `  `)"``L@``) @,F@`x``XU `` QN& 2 `ۂ`& d& @`  *  㿘1۔  kcx ٔ b3 b8 㿘 `@M  J  $ `?(```  @00`@@@ 3`@ 0`3@`  @ 0 ` @(`@ ?@c0`@3`@0`@3@` 0`   "  ($   @     *` @6@ϐ`  & '0  ?c 0  0 0 02 0   0  ? *  ?<* 0*  *    `@(`@` @  ` ` 㿐 (`` @&@    @ 4@ . ,@?()   ?@ ,@ @2  *?()??@?ۚ  ?ӱ0@?0@ * @*(`` ` @ *(```㿘    # b` (H$ @ 1 1 t (bH@$b  @' t㿘% `  , bH "+  ` & &   t  (,``0`(`@  $" & `"&   t& & p (@p,`&`80`@ (`(` p& & 㿐 ? /?. .0``''`"' / (@$`0@' $`@`$`;΅, &ǡ, $& $`$` ` {͂@& 5 &$`㿘̒ E`L ^  <  `# (*@``  @ ` ` !`    :?  ` !  ?`?`#  ## 㿘  `>`@@ (@  )    !`@ , ``(``  @ (@ ! @0 !`& !@ !@ 㿘 `@Y @   I-` @`8 @, ,`@``@$ @ `    ” @B $@@ $$&?`? &`2&&㿘d   " " 㿘 >`>    @ &D`    - & @ ` 6     * @ n  㿘`2_(>``#!#p`:%  % ``x>``X@ "`">`B 6ݐ>```@ " `ဎ`$$@ "` ~ x#p` `"  ~ x  g"q$#p "cHd >`pPD80$ x㿘В"@ Z  `P a@' u `'@ `''@  ЂaX''Ȑ''@ 'Ж`#'̒ ߐ@ d8@ 'Ԅ a''ؒ 1m uq"` @ '@ @Ȑ#X㿘`    ! @ uJ " #  Н㿘 L  `&@& 8.`  @ ` @+` ) 01  ( @@/@ `?@ `@ @  `2  `"@ @ ` в ""@ @+` ) 01  ( @@Մ@ H# 㿘 `,. 9# ?@ 6`.`0( @@@( @ @"`` @( @ @``` (82 㿐  (`@:S c( (#\   ?AI?)  @ %  `P  +`@@(00( @@@(`! !   `@ +`Y *` 2(   (` %   & @& &  6`(.` @0@ (`#@    & #  H a' -Ȅ  @$ $ $ (D$cxc ';۪`̀``2$`0 ?  ( Xǔ 1 "`N`Ă``> (` $ ``׀` ` $ @  $ ,#\   #?@`?@ &  @ !@ !s"* @& & #\   `@u?& ? y (`@ `D `   , p &8&(%? @   t$  @$ $ $ $$ ($ $ $ $ $ $$ $  |$  y$  $ $$ ($ s$  p$  m$  j$  g$ e$ $ b$  _$  ((`aZ$ (!W$ ( (0`S$ (a 2SN``7`a ue 2X`@   &  b  ` {s4? "@   !X0#h㿘?c@@1 u 8`(6 @ x @ ! cЇ0` `$ mn 0` `$ `_@`8(`(0 c-Ъ  x@ @& x  @% `$(@(`@ | ` (` W 2 | $ |ݪ%@   H( (``|/ ``|`"* ` @(`  `( x@-10`0` '@! c|  `%` `| ` x@& x(@Ѐ@1 ȑ xW$ 2 @ @  M #Н㿘#`e ?@"`  (@`$l$c( 1 ``" ` ! cЇ0``$ ``(| | d` `` @@ U   * ?.0@ 0`( `0s   `*4  1 `D+ @`D(0`"p s    @ 2  `2  @   y `` (``@`$ ` $   V`??c@$ @ ?c@```"A$]`A@  Yg0`1Α!V 1Ƒ 1‘ $ ` $ $?c@ @ " "  В  $ @ \ `㿘q< #! "` Ђa(# 3```&`ˁӐ`"&`@ {q"@ rЂa( "`1 a!8@ c 㿐` , P#?c@@@"x !XC?(8?c@@@x6` @y! cЇ0``$ JK 0``$ `< (@`(`   (`@ |   8@* | "q#\  @(` X@ `O $x @+$x `p `Ń0`0` @ ߁ `4 `5$ $ |x @$x@y #\   ?=?k @ y K @  @  Kq $ #\   ?<ݖ? @ x (7 u!h㿐<!Ȩ  $?8 @   c@@ ? M 2  $`ߒ `"  $$@c `2Y$` @  `ސ!   ,"i '#؄T  (``D "ǐ    ` #`cЇ0``$``  6?6(`@` 6 6(`@` ( @(``(`ރ6   0` 8```82``"[ $ $$"@r Ё@4 @04 (``2      @   `"8( ( 2  `X US@C 0` @; o  " @a" ~ $@ YY`$ @ Ё@   ?`  `0@`0`(``! t    @@  ^$ `L " 4 $ 4 4 4 @ {    3`?(`@0`` ( ` `(@@0 3`D$D ` D`D`@$ @    А@  $$@(@04 $ 4 4 4 ֐!x@O #\   ?;?` , `  `$ `&$ i`#$ `$$  Z㿘n7 `/ `V#`Є ``%`` $nn"@j $8 @< ?c`@R@`@ 2M@h O!?`A $```"K$$%"@ @3#``m͠  "$ "m"& ` {!Xm "  !?@ 値   ֠i y%% @ 8@8??  $R7 +&@R0  @} mk " @" $@w   ##Ւ&@㿘mI# b`5%ЄȀ`T ?c @ !Ѐ !А?+@5! ``,$ 8Ӑ    b$   m"@n%` {c!Xm "@_急  b`` {l  " ?0Ғ >!X0@?㿈l/ `u+`Є؀` ) ` % Β`ٰ` ? $8@@a?X`@@ $@@b $ (4 @# ` ` ` $@ а  % @ ``- "{  b `)   %  `le"@+` ,lW  "{!XlO "ـb@Q0 `?@ @@U ($@'Ȁ`V ' (@L``|`8 (`(` Pʒ 2j`|`$`|x Є &x$` @! `q V N $ ߔ   E z  )Ё);`'@d$#\  ;?`@?P@;Px "#:$ `2$@ $>" @°7$#` " @  2+ $ @$ "`  ``   ` $ @ $#\`  8&? Ȑ  $㿘kg% `$#`Є耠`4 ! ``*$ `` :  $  " `kC"@#`` {!Xk4 "@瀦 а  !Ё㿐ۄ?`' @)  |` 27oE    @ 7o: I `2 `   |0ဒ@2@  0 bX@2"  a' %؀ (` (, !   %'d  'll 'hpd@_    :0` @@  @`) (`  `@ @` ((``(`,  a  !㿘! "` "`@ׁ@0㿘7a ` 2  u㿘' `3`&#ز%` ` ,`@ , ((@ `@`.@  `$ G ``@@0͝㿘! "`U       `@ ` ((`  @ `@ ` ) (`   @ `@ ` ) (`   @ ` " ) (* + @ ``@ `@2, ` (` @. @@@#؝㿘   E4E,㿘/ `/`&-  -  ` -@J ` @`- ,``a(``- @- @EEFHFlFHFHFFFF\FF<F<F<F<F<F<F<F<FF\㿘`@ T` `U ` & `(`iA? "A <`; < &cД <@; Q" c"  " ?c" ‚b,"  " ("  "  " i? "& & 8 n5@ @`2@` e `    +@ ` 2   ! *@A +@ ` `2` /     @??+  @ 2 @??#( ?*Ք"   @"㿘  a (` %`"N"`O    H 2N(`8``=  `@ `'@8`#㿐N'` `=`J@``="@""@`J@`""@`= 'T'X'Pa' `c`"ؒ !'''@ ?"''xP77'''xx(@ ߺ S"(@` J " $2 bX@$O bX@$ʄ bX@㿈'XX#\#d#h#`!L $J bX@%2 bX@%8 bX@  @ 8@`! "!"!"!@`"` `"` !*``"@!"` ` @㿘! +!@(  ` `` 2 `"  " m      @!@2  l 〦`?㿘u  @@?   "a a a &  @$a & @  aa @"a@ `"  ` 2`  ``@  a @  `  7  25 $ $ &, aĄa$ $a $  @ `?ֶ a_-%!  6@(@) "k!0  @`j 2h  "$ $  ,0`@ " $  & a.`&a&   @ & ,0`@ @`(`@ " ՛ "$a  ?" "" " " " ` F$ ` o a`nk$a!`? i, (`@ `a؃1(``a0`( `2 @ "     a a $  @$a $ @aF  k `Ԑ㿠Usage: %s ..., where is one of: instbin%s: %s not compiled in ddmount_cd9660dfmountarchsyncsttylndisklabelpaxtarcpiocatifconfigsysctlrtsolping6datelessmoremount_nfsgrepegrepfgrepumountmount_udffscksha256mknodinstallbootrouteftpdhclientreboothaltmount_ffscpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsmount_mfsrmmtejectmkdirsedkshsh-shsleepmvexprdmesghostname!W !W !W!W !W h@@!W 8!W!X !X # @@!X pconv option disabledunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valuebscbsconvcountfilesibsifobsofskip%s: end of device%s: short write on character device%s: short write on tape devicestdinfiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) skip reached end of inputA.main![8![H!W![X![`![h![x![![![![![usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdate,needsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %lld %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fs@Yprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %ssizemsdos%s%s=%u, %s=%uuidgid%s%s=0%omasknowin95direxecnorripgensextattprocfsversion %dlinux/statfs %s%s on %s type %.*s: %s already mountedmallocexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %swaitpidforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlylocalnoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/sbin/usr/sbinusage: machine [-a] usage: arch [-ks] machineksOpenBSDsparc!m@!mH !mP#8!mX!m`!`!mh!mp!mx!m !m!m !m!m !m "x!m!m!m!m:!o!o!o!o!o!o!o!o!o!o!o !o !o#!p3!p#!p3!p2!p 3!p(3!p0#!p8@!p@@!pH@!pP@!pX!p`!ph!pp!p!p!p!p!p!p!p!p!p!p!p!p!p !p !p@!p@!q!q!q!q!q !q(!q0!q8!q@!qH!qP!qX!q`!qh!qp!qx!q!q!q !q !q!q!q!q!q!q!q!q!r!r!r!r!r !r(!r8!rH!rX!r`!rh!rp!rx@!r@!r@!r@!r !r !r !r !r!r!r!r!s!s!s@!s@!s !s(!s0 !s8 !s@C$!sHC!sPC$!sXC!s`!sp!s!s!s!s!s!s!s!s!s!s!s !s !s!s!t!t!t@!t@!t !t(!t0!t8!t@!tHprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2erasekilllnextminquitreprintstartstatusstopsuspwerasebrkflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeed%ldlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%sallcbreakcolscolumnscookeddeceverythingextproclcasenewnloldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupclhup-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixonflow-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbelecho-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendincrt-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).Ffhnscmplabelduid_parsegetasciilabeleditmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor !b!! !  @!( !0@@ !@ @!P(@!` %-!p@!b ! `N!(@!p_!b!@d!b!wP !x@!x!x!!!!! !(!0!@!H!P!!X!`!h!p!x!!^!!!!" " " " " " " !^!ax!x" " !Z" !" " !^" " !!!!!!!!!!!!!!!!!!!!!!!#M!!!"0!!!!!!!!!\s6㿂;{vtDZq{ "UN{$8;d"@g߿9~4x]u4FsUw-kUyPy=Nϓ>Or؛H Y2Ӊ~Zkӻ4:͍I*I 5er_@"xg4}JdpW4/tq,?RxNU^%Ub[{8W*Y_%:WWIF-/WßQ`)Wɫ?y2s"\a'.WIE̩¡vEE"{(ψ S>CcGuySsSyسs"$'02(%hM}iXSoSffLg:mӦJMiUT߫)4tUfIfd!ҪL6oDD/Ƭ*W1j0ޚ-UF6&ĚafɞDkaBm4MUM4VsY˫JjkJH-[ZX}n ƥ 2fB35.p'PۮUgnmfE6;M.vL׻)Y0g:nû+YmfҔ`vˍ584TT%M^xtR0 @PʪAY!q0px |r0\-Ψ*4y5 F 5pN8\Cީu4SM O+Na) 6 Zn`9˟n9Ν| 9[R{w̫rV9h *qRxA$c'YZ2u`;u {r5آU*J#?JNSzwy|@I||;Jt %_A:F65KVR`uD5-($D*3 80JHTsTCBKjQTd@ V3bckf K ϜZ,d`v7Xz6*QF (zm}-6:<"xΨPA̢p[P =jଓj}('~֚fɯBD!v/^ |Egi p{0[Uop/5D9xrE .G@6hVdv6yF3?x)&z4 u ^WySVw87AM6dF~<;,q^J^0Z,u*9 n׶h:wYҖP,"I,F`1zĤikJVײ`?:&+jEZVnW"pǬr}kb@sP^jܝ}!AO-Ei x 6¹U x@,U.XM ],,GyϩZZ]8 Qwq6(9R׹øa:E_(%oQjPx< 蓘YI4qyHBM\g@MKֿLb'BSZ{BcZ tnjۤg/%v dET>`| -@=~~ <69 ǁz8'aMVbR!ypJQ@Xȣ6[a"$c}D'f-tcX"ЁOAgiK 0UPO aF~T.bs'p?c*c}E35b%p.7aǁt0MCGOKgtaG8 Ou7%QW3 i6@gNnciW3 w\gUAyh?F-g%Og=kwȢEq;!k} ú XE,q !h p]3m-T0'xeBIЀjUM(=JpI?C{X-n5uh8W]˦EU.,=vZKڊ<Yi(Typwx9Y"(ZlL쌅Ӟ@`?4KS? ڽi\cx `b4Q ?'$YaX1 \(L0Nb8Vq?A[ hzWTDTY () 3鶫ŀ((̫O3-HJ5证0w1sY;~ڥ\d,pa`NQw^Ƿȹ4ܜ SUåt <\Zvʡy[_"lơy'4\``*nڂ4vƅ i{vx*h!唠X:gQDVw( I_E w8NQƝC]&19b}ސ X_qHە}ehq!?nFۍ)6\J9~nZ4W!ȍO#vtrJgXVB=#񩀂. `Q„n GB &10k*G6T7V֠fI`ƪ̀i҇Okʿyl>R*Q]+L;A:O2}'!Ck"J0vdX-Fl'j^b@ 4|ge8`;( vEcEa*|.Ɖuv(Ƭ\*Po`E3 g˂ WH8vx&(5(OؓSIlqLFYSY ON/F,®7*=30$%'4#&D[)4(?=`cI+rҶԗת֝"/408& x 8[e]3PdXVofK0Ȇ8xjNp^aқ TCkjܮl2Z:P=yQ^q Pe9OvzG {^."]Ĭ7))J;&=e\EܪŭFzL:%+!^c 4X)\w*.;9ªQ&8šq_G=DFʈA,TeqPmMn0Bag wv SJٮfۀVr)zؕxU\$ js ,4XLIQU;%qb-} !A. fj;\gh<ΓOp.5a1BfM)$j/,tg/c~pŤ?G&Aλ5xs+QYr<l0,#g;2o~8300Jbl’%HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!ǠHY0.$%=:X˜\CȤ`3cF쁧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R׷LJoBy sVLDAL>B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvW_lt8l}tI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=uޯ\ON2~(B."I]zviB ȤPj}pefkí]8Jȓ lw l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !'>'Q3?S:S b* >`L{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}zqIƔ}H?; 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh!p\'[$'XAs'cC Kc`op%v. .;'IYoqG"5j< wE~N LP+΄a%'MY$</XQ4+) TY<;|Z1`)Iz20rcE@;da'*HPfծyŷ ч! 5PII0^/.nܨ-J!\4w*,x7J.p,HQ(]VcW%7%#a ߭aRj5{5l<ɢ("÷5i~c'ڮ7$h..}8OtO#gؕ^Uuti|P9<"*_F>~1:kje7uD怉?_ɅpgGC+D<>q0|֙p=rz|ZWːOyb_Oݗm?z_lK7߄y~0"u.=›W+v3*̝G!hAیn6NMM9^NdTvvO1B#S錄4:Q2?|wd?I1F !K:У)]u< f/=c?8K-x {`/m~ttx+Q)Oˊj6o >`i RLr%$ye 8bWz|M~,}77cA !.Ru;q :(clmkw D^&ݺfLThgQ+&E G= o(Ev|G@p& =67}v.Tl/%FJ589?0%K#I`M]mLum/uBgd\Aҝ x-˧0ꭰL]o4-mv.ܗ| L 9Bˠ_  XZzsC*iAB4wV. *>Y>FJb~,j$BIjgٍh&[NEB a(TVz;5CͲ%wk߭a_Ŏ;2!eb(W8#*Z- 3 Vƈo_9?(A͸ǵT7{&Z 1WTH' 0M#MYRogm ~y ݨF_KUOwvF?\p3YA(Ky}SƤ n{Dg=mٍu rtɋ@hk/kW=˫o?^>=pusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errortypeunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdiskduidline %d: bad %s: %sbytes/sectorsectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s-cVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSADFSNTFSUDFTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. %lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c/dev/%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem size0123456789Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. This architecture requires that partition 'a' start at sector 0. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition (need at least one full cylinder) No space left, you need to shrink a partition partitionThe letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sUnable to obtain file stats %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %swrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %ssummarypingermainusage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromA??zG{%6d usage: %s [-benstuv] [file ...] benstuvsetifxflagssetifchansetifnwidsetifbssidin6_getaddrvlan_statusieee80211_listchansin_getaddrunsetvlandevsetvlantagsetifwpasetifflagssetvlandevinit_current_mediaieee80211_listnodessetifwpagroupciphersetifwpacipherssetifwpaakmssetifwpaprotosieee80211_statusstatussetifnwkeysetifwpakeyin6_aliasin_status#q#q"xq"q"q"q"b"b"b"U8"\$"`"`"a"a"p"p"p"p""T"}"("8p"@p" ["H["`Z"PU\"xV|"`o"hr"po"U"U"U"U" v"v""X"X"W"W"W"W"rW"W" W"(W"0W"8W"HW"PW"XW"r"`q"hq"p q"xq"@q"q"|""#UX|"u,"u,"X TU"mp] i@ivV vU"c\ ixivV0vX " "`""""" ![`"0!#"8#"@#"H#"P$"X$"`$"h$"p%"x%"%"%"&"&"'"'"("(")")"*"*"+"+" ,"(,"8,"@-"H-"X-"`."h."x/"/"0"0"0"0"1"1"2"2"2"3"3"3" 4"04"@4"H5"X5"h6"p6"6"7"7"c"c"d"d"e"He""""" " " " " " (" 0" 8" @" H" P" X" `" h" p" x" " " " " " " " " "!"!( "!0 "!@"!H"!P"!X"!`"!p"! "! "! "!`"!`"!"!"!"!"!"! "!"!"!""""""(""8G""H""8""X"!"!"!""`""`""`!""h#""p""""""""""hmac_sha1pkcs5_pbkdf2randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELmtu %s: %sSIOCSIFMTUprefix %s: %sbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%x%s media mode %smediaopt instance %d"%.*s"%.*s0x vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixlenSIOCGETVLANSIOCSETVLANvlan tag %s: %sSIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYinvalid vlan tag and device specificationSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_PRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types?calloc media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATE%s: no such interface interface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacygrouppowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactiveinvalidkeepalive downusegroupwep40tkipccmpwep104BOdisplayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*u %*qd total %lu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %smalloc failedshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain"="5"="=">!usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%u %uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefused@@mainusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsltget_envget_termraw_modeeditcharbin_fileplinenumopt_xopt_shiftopt_jinttoalinenumtoapostoaless_printfap_linenumap_intap_pos?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcamxndadbutsgpcketicdclcmsousmdmbvbbcho|^llcrsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s_(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%cSHELL%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain![8![H!W![X![`![h![x![![![![!b![!S"[x"["[!`"[ !`@"["[!`!`"[ "[@"[!a!a0!a@!aPusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCMNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportportnfsv2acbin_file"_8invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\)\(($%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-fileshelpmmapline-bufferedafter-contextbefore-contextcontextdevicesextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmain![8![H!W![X![`![h![x![![![![openusage: %s [-o options] special node o:checkfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.strdup failedrealloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d STHE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%smainusage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:%s: devread: lseek%s: devread: readopen: %sstatfs: %s%s: Too many blocks%s: %d block numbers: %s: must be on an FFS filesystemfsync: %sfstat: %ssuperblockNo memory for filesystem block%s: block numbers: %s: block numbers (indirect): indirect blocknlist: %s: symbols not foundnlist: %s: wrong type%s is emptymalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x left onstripped off%s: a.out header %s proto bootblock size %ld room for %d filesystem blocks at %#x usage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:SUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureproto bootblocks too biglseek bootstrapwrite bootstrap_block_table_block_count_block_sizesodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitor""8G""H""8""X"!"!"!""`""`""`!""h#""pnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isripbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %srouting table %ilabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture#%d, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %s (%s)entry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)readgot message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:v/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortDestinationProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:url_getauto_fetch"dataconngetreplyabort_remoteinitconnhookupmaingetitmgetptransferprogressmeterfileindirremglob2ftp_login KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... connectr+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: ://Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.abort%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiAIimageebcdictenexM%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. get_ifnamepriv_script_write_paramssend_requestroutehandlerparse_reject_statementparse_option_declget_rdomaininterface_statusinterface_link_forceupgot_onesend_packetif_register_bpfpretty_print_option""(""0"@"k"H"P"u0"`%""h"x" ")" "&""#Jh"#"!T"v$""""""" " " !"0"8 subnet_numberbroadcast_addr"" """ " "0"8"@"8"P"8"h"8""8""8""8""8""8"# ""dX"# "# " ""0# "@# "P!T@"`!T@""""dX"""" """"dX"!T@"(""@!T@"X!T@"h!T@"""""!T@"" "!T@"""" " !T@"8# "H"8"X"8"h"""8""8"""# ""8""8""" " "0""H""`""x""# ""dX"" "" "# """(""8""H# "X"8"h# "# ""8""8""8""8""8""8""8""8" "8"H# "X""h""x"""""""""""8"""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""""""""""""""""""""""(""8""H""X""h""x""ˆ""˜""¨""¸""""""""""""""(""8""H""X""h""x""È""Ø""è""ø""""""""""""""(""8""H""X""h""x""Ĉ""Ę""Ĩ""ĸ""""""""""""""(""8""H""X""h"x;Zx0Ndispatch_imsgegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %mget_ifnametoo many interfaces in group egressInterface name too long: %mInterface name too longcannot forkchdir("/")%s [priv]poll erroroption_as_string: bad code %ddhcp option too largewarning: hostname %s contains an underscore which violates RFC 952Invalid IP address in option %s: %swarning: Only 1 IP address allowed in %s option; length %d, must be 4Bogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xdaemonscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sfork: %mwait: %mexecve (%s, ...): %munexpected msg type %ureceived corrupted messageip_addressnetwork_numberbroadcast_addressserver_nameno space to %s %sprepend optionappend optionexpiryscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbin-T %dreasonlease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } dhcpoffer: no memory to record lease.Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.options do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTnew_bound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.FAILDHCPDISCOVER on %s to %s port %d interval %dEXPIREold_DHCPREQUEST on %s to %s port %dDHCPNAK with no active lease.BOUNDRENEWREBOOTREBINDbound to %s -- renewal in %d seconds.DHCPOFFERBOOTREPLY%s isn't satisfactory.packet_to_lease failed.usage: %s [-dqu] [-c file] [-l file] interface c:dl:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintf%s: no link ... sleeping got link cannot open %s: %m_dhcpno such user: _dhcppipecan't open and lock %s: %mcan't open %s: %msocket(PF_ROUTE, SOCK_RAW): %msetsockopt(ROUTE_MSGFILTER): %m/var/empty/chrootsetresgidsetgroupssa == NULLinterface address deletedinterface downinterface departureroutehandler: %snew address not one we set/etc/dhclient.confexpecting IP address.no memory for reject list!expecting semicolon.expected option name.%s: unexpected option name.%s: too many options.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpecting identifier after option keyword.no option named %sexpecting string.option data buffer %soption data buffer overflowexpecting number.expecting identifier.truefalseoffexpecting boolean.Bad format %c in parse_option_param.semicolon expected.out of memory allocating option data.expecting interface name (in quotes).wrong interface name. Expecting '%s'.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.expecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!/sbin/dhclient-scriptget_rdomain socket: %mCan't create socketioctl(SIOCGIFFLAGS) on %s: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.getifaddrs failedno space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %msend_packet: %msocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %msetsockopt(SO_RTABLE): %m/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfcScoption %s (%d) larger than buffer.rejecting bogus offer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.Discarding packet with invalid hlen.DHCPNACK%s from %s (%s)%s from %s%s from %s rejected.DHCPACKpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %ceof in string constantnumeric token larger than internal bufferstring constant larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervalleaselink-timeoutmediumprependrebindrenewrequestrequireretryscriptselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ %d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlBpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endBogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dno space for numeric aggregatenumeric aggregate too short.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.expecting a network hardware typeExpecting numeric lease timefilename must be a stringno memory for string %s.buf_read (short read): %mbuf_read: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_add: %mbuf_open: %mcorrupted message receivedreceived unknown message, code %dmainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main![8![H!W![X![`![h![x![![![![!c@!S!["H!b!dusage: mount_ffs [-o options] special node filesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsckmount table full%s on %s: %sreloadhandle_hupcannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp filep unexpected end-of-file& no previous commandinvalid pattern delimiter%d \  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? dodecompressmain"""(T""""8"@"""gz_open      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs" "0" "@"P"`"p""" usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup!!!!! !(!0!@!H!P!!X!`!h!p!x!!^!!!! @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRFILELINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%u CONNECTED. PARENT WAS I=%u NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%lld %s I=%uBAD STATE %d TO BLKERR cannot find inode %d bad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listbad inode number %d to nextinode %d bad inode number %d to ginode cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s PARTIALLY TRUNCATED INODE I=%uDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****-%c flag requires a %s Alternate super block location: %d conversion levelcannot do level %d conversion bad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:BADEXCESSIVE BAD BLKS I=%u (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.cannot alloc %u bytes for inoinfoPARTIALLY ALLOCATED INODE I=%ubad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %ld bad indirect addr: %ld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%u (%ld should be %d) (CORRECTED)UNKNOWN FILE TYPE I=%utoo many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %d/%dphase 1b, inode %d/%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'phase 2, directory %d/%dphase 2, parent directory %d/%dBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%d phase 3, directory %d/%ldZERO LENGTHBAD/DUPphase 4, inode %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%dioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKsuperblock mismatchesoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATECan't open %s: %s Can't stat %s: %s %s is not a character device** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d ** F%sile system is clean; not checking ** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %d out of rangereturning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %lldProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),deadlocked buffer pool single_user  delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't get %s for controlling terminal: %mcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsmainmkfssiginfousage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk label%s: unknown disk typeioctl (GDINFO)insane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s is mounted on %s%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %d out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %u): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countblocksizebsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pcompileflush_appends\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv#0 ˌ#0 #0 ތ!q ޜ#0 #0 #0 #1 \#1 #1 l#1 ޜ#1 D#1( #18 #1H #1X #1` t#1h t! #1p#1xc_umask#3 8#3 #3 #3 p#3 #3 p#3 #3 #3 #3 #3 #3 `#4 #4 #4 #4 #4 #4( #40 #48 #4@ L#4H ,!TX # #I -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$!`#5("D"\#>#5t#5f#6c#6d#6(s#68l#6Pm#6`n"Xpx_modex_search_histkb_addx_bindx_emacs :X" M@#7 ]#7 ]#7 ]#7 [d#8 Z#8  Z#88 Z#8P UL#8h K#8x M$#8 B#8 ]!a [#8 A4#a( Ld#8 T#8 Td#7x Y#8 Xt#8 ]#8 ]p#8 :D#9 X#9 I#9  I #90 K#9H I(#9X ID#9h K#9x AL#9 L#9 B,#9 ;l#9 L#9 Q#9 a#9 O #: _D#: ;T#:0 :#:H K<#:P H#:` N`# H G#:p S#: ]T#: Wp#: G#: G#: G#: M#: A#:dbteste_isa"s#>#3h++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_print3̘#E#E#EdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }#G#>##G"GXgmatchgetoptions#Ja#J#Jc#J"#J#Je#J#J#Ji#Kk#Kl#KX"!m#K C!d@n#K0f#K8#K@#Bxb#KHu#KP#K`#Khp#Kxr!U@!Xxs#Kh#Kv#Ih#K#K#K#K#Kxdo_phys_pathshf_vfprintf!W#N#N#N#N#O #O #N #N #O #O#O "t#P#O("x#O8{#O@}"D#OH#OP#OX#O`#Oh#Op#9 #)#)#)#)#)]]<>!let||&&()str_val"# #6x#S(##S0!#> #S@ !@ !8 #F#SP#S`#Sp#Sx#S#S3̘@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directorybad substitutionCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletprintpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*ld.%02ld%s%s%*ldm%ld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o bad numberaugo=+-rwxugoXsbad masktrap -- bad signal %sprsu,REPLYnothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited %ld unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeoteot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markyankcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $() input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16 %.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrksh/shSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedrestrictedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections forselect%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildofunction{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T! %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --usage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostnamegetnetanswergetnetbynamegetnetbyaddrIN-ADDR.ARPAbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetanswergethostbyaddrgethostby*.getanswer: asked for "%s", got "%s"-_//etc/hosts%x.%x.ip6.arpaB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj gg:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashzeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL#k#k#k#k#l#l#l #l0#l@#lP#lX#lh#lx#l ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbSHA256EndSHA256DataSHA256FileChunk0123456789abcdef/etc/networksreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory __elf_fdnlist#c#r#r#r#r#r#r#s#s#s0#s8#sH#s`#sp#s#s#s#s#s#s#s#t#t#t0#t@#tX#tp#t#t#t#t#t#u#c#r#r#r#r#r#r#s#s#s0#s8#sH#s`#sp#s#s#s#s#s#s#s#t#t#t0#t@#tX#tp#t#t#t#t#t#uHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d ip6_parsenumericgetnameinfoasprintf%h %e %T b0b1nsncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpath<Ҳ؉9I#ը32D=%[όh(doCinityan@??5?55?5MD5Padinet_ntop4inet_ntop%u.%u.%u.%u0123456789abcdefInfinityNaN`??҇coCa?Ɗ(`ȳ?DPy@$@@#{#{#{"ah^[Yy]^[Nn]yes646NONEUTF8#|#|#|#|#|#|#|#|#|#|#|#|#|#}#}#}#} #}(#}0#}8#}@#}H#}P#}X#}`#}h#}p#}x#}#}#}0#}#}#}#}#}#}#}#}#}#}#~#~ #~0SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p__stack_smash_handlerstack overflow in function %sasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt#}#}#} #}(#}0#}8#}@#}H#}P#}X#}`#}h#}p#}x#}#}#}0#}#}#}#}#}#}#}#|#|#|#|#|#|#|#|#|#|#|#|#|#}#~ #~#P#}#}">-0%2d%Y-%m-%d%03d%H:%M%e-%b-%Y%04d%a %b %e %T %YtzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageclntudp_callclntudp_create: out of memory __hostaliasres_queryres_querydomainHOSTALIASES%.*s.%.*s __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_res_init/&ndots:insecure1insecure2edns0/etc/resolv.confLOCALDOMAIN;#inet4lookupsearchnameserversortlistoptionsconfRES_OPTIONSenvinet_pton01234567890123456789ABCDEF0123456789abcdef  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/services,/""h#"#"too smalltoo large ((((( AAAAAABBBBBB connectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dvsnprintf######0#@#h######0#H#h#######0#P#p#RPC: (unknown error code)%s: %s - %s %s: %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %u... RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_sa<xdrrec_create: out of memory perrorlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANG###0#P#`#x######"B#(#@#P#h#x####### #8#X#h#x####sp####0#P#p#######8#P#p######(#P#p######0#H#p######## #H#`#x######(#@#X#x#######0#PUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported#c#r#r#r#r#r#r#s#s#s0#s8#sH#s`#sp#s#s#s#s#s#s#s#t#t#t0#t@#tX#tp#t#t#t#t#t#uxdr_string: out of memory xdr_bytes: out of memory %$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size  !#&(*-/14<V" " " " " " " !΀" " ABCDEFCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ}wrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():arc4_stirsnprintf" !SP!SX!Sh# !Sp6@!SxR!ST<!ST`!Sw!S} !S!S!S!cX!SGp!ST"r`!S!S(!S!ST!SZ!TZ!TM!T_!T _!T(_!T0y!T8L!TH!TPd!TXp!T`8!Tp!TxX!T!T0!T0!T6<"NP:!T!T!T!T!T!T!T!T " h!T X!U X!U V!U dL!U dL!U( kP!U0 n!U8 <!U@ <!UH <!UP z!UX }`!U` !Uh !Up ,!S0unblock and -DNO_CONV?@!c!c!c" !c" !c" !c" !d" !d" !d !d !d(" !d8!d8!d@!d@!dH!dH !dP" !d`!W@!dp" !d!S!d!d" " !d!d!n^!o[!o]!o]!o[0!o Z"fZH!o(^!o8[!n ^X!o@Zd!oH\!oPZ!oX\!n@^0!o`\x!oh\@!op]!ox],!o[0!ap]!o\!o\/tmp/EdDk.aXXXXXXXXXX!!!!!!!!!!!!!!!!!!!! !(!0!@!H!P!!X!`!h!p!x!!^!!!! !f| og{gLSxN!SLX| f{xHLSxN!n|X| |f{sxLSxN!n|{|f{sxLSxN!S(P\lThSxN!(t@\8ThSxN38uO.? ;" ![`" " "!"!"!vVvUvUvUvV@vXvY vXP3."$ހ"$ހ"$(ހ"$8ހ"$Hހ"$X.Ad"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory3p3pa3x"MP"Mx"Mb3@x "M"MB3x"N"N(c3x"NX"N"Nd3Ax"N"Ne3x"N"O"O f3x"O@"OXF3x"Ox"Og3x"O"O"P h3x"PX"Pxi3x "P"P"Pj3 "Q"QJ3!x"Q "Q@K3x"QX"QL3x"Q"Qm3x"Q"Q"Qn3"x"R"R "R8p3H ,P3 "RXq3x"Rh"R"Rr3"x "R"S"S(s3!x"Sh"SS3!x"S"Su3"x$"S"S"TV3 ,w3"x"T("TP"Tx3("T"TX3Ax"T"Uy3x"U("U@z3x"Uh"U"3"U~3!x"U"U?3#3 p"U"V3Ax"V "V03x"VH"Vp3x"V"V"V... (interrupt to abort) (press RETURN)x"@`"@"A444 "]"]"]"]"]A"]B"]C"^D"^E"^F"^(G"^8H"]HU# HV"]`a"^Hb!Wc"^Xe"Ff"^`h"^pi"^L"^l"^n"^q"^q"^r"^s"^v"_w"_x"_ u!d!d"i"j"j"t"u"u"u""u "u(!["u0 !m "u8 "u@ "uH "uP"("u`"x8"uh#P""")"up!"ux"u"u"u"!"u"r"u "!"s""#"u$"u%#(&"u'"x(")"u*"u+"u,"u-"v."v/"v0"v1"v 2"v03"v84"k5!6"vH7" "vX"vp"v"v"v"w"w0"wX"wx"w"w"w"x"x@"x`"x priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP !b"""]H""""#8"" y!" "( 0(EHC P E(  0(EHDHC z(X#p@"аH3" " ... ..."h"p"p"p"p ![8![H!W![X![`![h![x![![![![!c@![!b@@@%s: can't read disk label; disk type must be specified......#X#h#p#x!mP# !m` #####!m##!##{}abcdDgGhHilnNpPqrs tw xy !:#=z@hz@l3x P#G#>#G#G#G"GX#"8#G#H#G#G#H#G#G#G"#HX#Hh#Hx#H#H#H#H#H#H#I#I#I("#I@!S#IH!T!T!S"NP"!T"r`#IP#IX!UX#I`!U!U0!U@#Ih#Ip!U8#Ks#Kt,#Kt\#Kt|#Lt#Lt#Lu #1u<#Lul#hu#L u#L(uzlp _ xx:xx:xx:xx:xx:xx0000000000000000 z#K#d" #K#e0" #K!X" #K#eh" #L!x" #L#e" #L#e" #1#f" #L#fp" #h#f" #L #f" #L(#f" " #f#f#f#f#f#g#g#g#g#g #g(#g8 #g@ #gH #9 #gP #gX #gh #gp #g #g #g#g#g#g#g#g#g#g#g#g#g#g#g"D#h#h#h#h#h #h(#h0#h8#h #h@!#hX"#hh##hx$#h%#h&#h'#h(#h)#h*#h+#i,#i-#i-#i(.#i0.#i@/#j8/#iH0#iP1#iX2#i`3#ih4#ip5#ix6#i7#i8#i9#i:#i;#i<#i=#i>#i?#i@#j[#j \#j0\#j@]#jX^#jh^#j_#j_#j`#j{#j{#j|#j}#j}#k~#k#mh#mx#m#m#m#m#m#n#n "#n0#n@#n`#np#n#n #n#n #n#n #o#o( #o@!X #oP#o`#o#o#o#o#o#o" #p #Ks#Kt,#Kt\#Kt|#Lt#Lt#Lu #1u<#Lul#hu#L u#L(uwwzyx?" !!!!!!!!!!!!!!!!!!!! !(!0!@!H!P!!X!`!h!p!x!!^!!!!#xrkh455#{RuneCT10NONEBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~#{3#K#K#K#K#L#L#L#1#L #h@#L #L(333o,oppqHoxrqtqv#{3(3( 300@{b30@{d 30@{e(3H303Hz@͌ɀɠ8#`#LI@HIIIHR|RDRRRVU|YHXXX\WWXTW\WdWXX\WWX$W\e^d|egh]@f4\P##,zpzR| ْdD - 0ٖD - Hٜ$xD - `٠D - !!Y#_#_#_!!!#_yP.shstrtab.init.text.fini.rodata.data.eh_frame.jcr.pltpad0.pltpad1.gotpad0.got.ctors.dtors.gotpad1.bss.note.openbsd.ident LL``QRR!RRK %3D+3x53:CCCLcUc(Zc$$ ac00hc8qtm v44 . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi [[ -z $(cd /dev && sh MAKEDEV "$_dev" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break : $(( _vl++ )) done _vd= while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while (( (_vi += 1) < 4096 )); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && (( _vl += 1 )) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn (( nifs += 1 )) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" [[ $_haswpa == 1 ]] && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do (( nifs += 1 )) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ -z "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" local _bad_dir=/mnt/usr/X11R6/share/X11/xkb/symbols/srvr_ctrl isin xshare${VERSION}.tgz $_get_sets && [[ -d $_bad_dir ]] && rm -rf $_bad_dir for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && \ SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && \ ftp $FTPOPTS -o /mnt/tmp/xetc$VERSION.tgz \ -m "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && \ SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return set -m ( ftp $FTPOPTS -a -o - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { local _dot # XXX [[ -z $ftppid ]] && return while [[ -n $(jobs $ftppid 2>/dev/null) ]]; do echo -n . # XXX _dot=. # XXX sleep 0.2 # XXX done [[ -n $_dot ]] && echo # XXX } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp $FTPOPTS "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then package_path=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else package_path= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "Please run sysmerge(8) after rebooting to repair your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0 ]] || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp # if aperture was n, do not ask for xdm fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') [ COLUMNS -eq 0 ] && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ELF@41s4 (@@1r8 5P xHP rHP nHP jHeHHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H H  H  H H H H H H H HP EHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 5P HP  rHP  nHP  jH eH HP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H  H  H   H  H   H  H  H  H  H  H  H  H  HP  vHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H 5P  HP rHP nHP jHeHHP ^HP RHP HP RHP NHP JHP FHP BHP >HP :H H H  H  H H H H H H H H H H HP HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > ';8;;;;; ;(;0H )@`  > '!  > ';8!5 > '0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > ' 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP> "`""#t@>= ;x ;"`;" @/@ LҊ@@2 @ 0P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP> "`""#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @t x ``-`܁ @ؐ tx Ӂ )>"@"P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP> "`""#t@;x;;>"" ;`#h#l;;;;@ 4E``htx ;`#h#l;;;;@ 4``htxr )>(#@)>) P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP ;`@;h#t;x;;;;;`@ 1#;`htx, /> -> '+cPۜP -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP ;`@;h#t;x;;;`;;@ 2;`htx偌 -?P @c-@-P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P;x> "`""@;,/,;@ ;`,;h)>>!#p 8% 8H  p@ @ `E < 0x  +?P`-- -?P%-?P0P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P;x> "`""@;,/,;@ ;`,;h)> c##pH  p@  "`@  0@@ `x) `E <P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P> "`""?P * * ;`@;h09P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P> "`""?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@¶`h ?P `*  P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P> "`""?p " ?P "  ;`@;h@ `h ?p " m @/>  @̀-> ' $)> '" %-> '+cP-> ' VP @ H ,@`#> 'a$` (08 @̀;)> '"0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> '%- +cP ;`@;h #t;x;`;;;;@ .;`htx -> '& 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%> ' $!> '!`8 (0 @̀@ @̀  H ,@`#> 'a$` (08@̀㬀29?@ @̀;'> '0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> 'a $`!> '!`8 (0@̀ -> '  @wP-> '"/> d4ɐ  ! H,@` !X (08@HP @̀> 'ℒ `?* `"" * `@"> '⣒  * `@&* *  ֊@* "``@!>% Ԯ$'1@'0@ )>+>%@#'> 'Ħ$$3  > 'b "@%> '$   c d  mt@ >  > '"$"|@t@ >  @@   >  @@ K#>%>C  'bĀ@%  '`@`@ 06  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c`@> '"! *> '""!`> '""H(  /  >  ==> '@H > '"" > l">Ca @ l]"@!> n$#H``> n"c !>& @!>' D$ $ >& \ *> " > " > "!> "!<>#"">#"#>#"#X>#"#>$""4>$""\>$"">$""0>*"!@ @d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%> '> > '"  "> '>@ > ' !>&b# !>&b# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * > ' >@ *> ' >&#@" > '" > '"   > '4``6 > '>:H"(o  (1L`!4"j j ` *@  ( !> n!` (08 2㿠@ '> 'a` Ъ@@>€"Т@: H" H*/  dh> '>'b " `2 `2`2" " ?" ?@>'b" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J?*> 'a>(\` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >) "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@> ? @ 3 > '" c@  Њb@&""""  > F`t@ @> nc ``44: " longjmp botch `&"`㿠>*@>"6 0㿘``@ǐ  (@0`@ ``@  `@ >`,㿘```@  ``@  `@ `` 2`㿘         ``@ [㿘    z  u``@< ```@ 4 ``@. @@` ``` @ ! ``@   ```@  ``@  "` .@` 2``@ @?ݐݬtި0߸0l<ltH,!"!)),((h(''''L'&&&|&H&%%%x$ p p$$$`$D$## "+ p p p p p p+++"`//D/4/4/D/D/D/4/4/4/4/4//D/4/D/D/D/4/4/D/D/D/D/D/D/D/4/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/4/428::d:H::6D59P9098800888x8X7076544$37700000000330000000000000023222210000000005000000005utwdwHw,vvutvvutvutututututututututututututv`v@vuuututuLd,(D`|T >  b(>+\> c> b> b> b> b> b> c> _`0㿘?.`c0@(`0``)` !@.((2 h" `2 @  ", ) @ `0 0@ "Ґ* 2 x(`0``!@׆'(2 `2`Ր !@`` @͐ 2 !` " `(`( $   @  3 "#`(   2  8`  8`( ۖ @ 8`(<?? @ 8` 0`  /`!'`"'``#/`'`+ '`'```` ```````` '('D(`  ?ȅ(`*(`Ą(`#\` 0,`  (@-``0)   (@#` 2* /`. ,  `0 (@ĉ4``0+` @(@#d ! > , @=G`6`5`0`4`.`/`1`2`3`7* ```,```-(D() +**`(`@ @@ #`#\ *+ +`> @P@@=@``````0 ((@*,`,    ` ` ``''Є``''؄``3`2`+`*`  + *  @''`,`0   ````` `!`"`#``'`-`1''`4`5' ' 2  > ( @ @ @0*,`,3`        ((@2`+ +`   * *`@  " >  K2  > D@(`@D@6 DaȀ (`@6 DaȀ (`@6 Da(`@6 (`@6 @(6 (`@6 ">   x"w> ( s 㿈````````0*,`,3`        ((@2`+ +`   * *`@ !? (!` {Ђ``/(x`"<??? ` ` ` (`@7 !Ȉ` ` ` ` ` (`@7 ``/ `/ !Ȁ```(`@7 !````(`@7 ``  ((`@7  @  ) (` @ #`#d #\> @;` ` ` *#\+ +`@ > @;`&`'5> (`@7 `*`+@(7 `*`'`&`+./ @; `"``` `!`#`$`%0*,`,3`        ((@2`+ +`   * *`@ "b?  > @;M6 2V?  P > @;<6 27? ( 1㿀!.`.` @(`@ 8)0( @# !Ȩ h ` `p`@ ?(# `2- - - `%(0``(`% 0``(`(% @@0``(`(% @0`(`(``%(`@5   !@0(`@5 #\ 0 #` !> #d `#h` #l"> @:P3``#\3`0#`  #d 3`#h ` > "@:` `p?ú`(?c  ( t ,,$  0``(` )( + `(` *4`,` `"`!4``@4` `4` `` 4` ` " 4` `@" 4` 0``"4`?4`4`$ (0#\ 0``#` `#d > > @:< @0``(` $ ``,`4`` ``" + ,,$  0``(` ( `(` 4`,`(`@5 * - - - `%(0``(`%㿀!.`.` @(`@ 8)0( @# !Ȩ h ` `p`@ ?(# `2- - - `%(0``(`% 0``(`(% @@0``(`(% @0`(`(``%(`@5   !@0(`@5 #\ 0 #` !> #d `#h` #l"> @9{P3``#\3`0#`  #d 3`#h ` > "@9e` `p?ú`(?c  ( t ,,$  0``(` )( + `(` *4`,` `"`!4``@4` `4` `` 4` ` " 4` `@" 4` 0``"4`?4`4`$ (0#\ 0``#` `#d > > @8 @0``(` $ ``,`4`` ``" + ,,$  0``(` ( `(` 4`,`(`@5 * - - - `%(0``(`%㿀!`` `08(( @$!Ȁh2```$`, `, `, ` $!``  0``(`($ 0``(`($ @0``(`($ (0`(`$` ,` ` !> (`@4``(4` `(`@$3``#\ "#`  #d 3` #h ``> #l@88P"3``#\3`0#` #d3`#h ` > @8!> ?b?èc 5;9a7?8  ,` 0`` $4`l! 4```"`!4``4``,4`` 4`` @@4``@04``0`"4`4`4`$ (0#\ 0``#` `#d @7Ř  @0``(` $ ``,`4``'` `,,$  0``(`! `) ` `(`! `,`!` 0``$4`h! ` ` $` $㿘!`@   c!?@7Z !` ` @!` ?2 * c?  (`2 @@@&&㿘!!`0@?a` I4   S  > ?@7-h`P! ?@  ?`b2@@0 ((` @0@@  E   > ?@6㿘! ` @6ِ !`  @6ѐ !`~@`f (`0`<  `   !@@6 ! `!` @6 ! `!` @6 !` <҃<6  (`6!  @@6 ! ``  `6@6x! ` @6p !` `2! ` @6` !` ?c(86``8`?` f a!2y`xf㾐> !c<' `_D`4!   G `aS1! ?(``  ` > @6"? F``87 ! ˤ  > @6 0`P2!Ā     @ !!``4` ,`  ``<   @ > @5ٔ?> @!  > @5Д?  ېג  Ғ   !`    㿘!Dp($$4 ! 4 4   , ,  k4 !! < !4 < (!Ȁ`" !4  ?(4 !Ȁ@#&!Ȁ22!! 8`   $E!Ȁa25!! (8`( , (@  > @5h@!!8`(  ` 1`@$!Ȅ@&!! > @5I!!8` !Ȁa"!! > @5: !!8`( > @51!!8` !ȝ㿘! V> > c@(`@3 @Io`?D ?``?@c  @  '2!4@, @0b<! ` @?`  (@@"쀦!@`, @〦 _6"T&"8" &"_!` Ho/a``@@4#p"T(`0`8`  ((`0"<(`@|!`_3!``@!`  "T'''''''''(`0``,"``1` `O"V6"V"T&"`7'Ԕ Q ` H("T'''''''''(`0``"`"@3@"X`6"X7`"X"\"@(3@0(6"X 0`"X"\@((06"X7؃0`6"\7֚`07"X7ւ`6"X@`76"V?h`) 2`0(`> 2p@4# ,` &,>+|`(`0`0`@ `` $ 8 &( ` `$` ` #\2 > #`  @3,`&, `$` ` 2 > X@3 , ` &(`$` ` 2   > @3֔,` &, `  > @3Ȕ8,`2$ &,$& `$` ` 2 > @3 , `$` ` 2   > @3 "`$"0 @@`(`)&",`v &, ` `$` 2   > @3 "$"d0 C@`(`)&",`d&, `$` ` 2   > @3b,`B &, > `(> b `  > @3M!`"'Ԁ`2%,'Ԃ b'7'''''''"$7`'  , > `  @3#,` &, `  > @3,`  .F&, `  > @38,` 0 `  > @2`,`% 0$ ` >  bx> b#`#\*+ 23  > @2ߔ,`  0! 0      0 0*` `0  (@`2 ?`@"0*0      `#`0p> !c<' +@>  c+-`@`1 .o/``?  (`> 6@@2v  > >  ^aٮ`6@>  @2_0連``?Ӛ ?Єo@1 5> 6@" (@&"``Հ`!`> > b@`@(`2"` "``> `(0 c ;4`0b<!@?` @ (@@,` @2!`46"T&"8" @&"_;!` H@2@`> !cؠ @?` @ (@@,  @?` @ @10yb<0+  3 @1! `{@``@ǐ"D`> `>  `*З2 > @.>  @10(`> `P0> `0  > @.=@> `ޘ80`> `ؘ0> ` Ә0`> `͘h0@M!0X!.`.` (@ ¤@ (@(@ 8(#@ ! ?`(`#@ !``#@  4!`2$``!4  , , ,,  ) )   @@(` `    ` !Ȁ`@3``#\ !> #` ##d #h ` #l3` > `@1P#3``#\3`0#` #d3`#h ` > @0> ??b?èc / ,`,`!  =@ 4 , 4 4 ! `` ``  !Ā@=  !Ă``:7  h1 !   ( (p@@@  , , #\ 0``#` #d @0`` ` #@  4!`"UW$8!Ě Є ( @$!Ȁ`@a3` %'7''''''''ǒ@@G$`(0``(`+@$0`+@`(`1$`""!0 (()(@&"`u.`?!.` @?(`@@> .` .`9'̂@  @0  D` , , $@ 0`''''''''' 0`?0 ( 7', @'7ҐPЀ@2נ `g""0`@`(`$ ?#&" @@   `  ((  0`0``:7(`"  87` a}4`@7Ԃ@7 @" ` `0`o@7``h4`ԃ(`0`0``#\#` > @/'""0`@(`(`&"$ ! ,`4` 0`??`(`! ' @0T 㿘"0`` (@`<`  (@`p!`2'ԁ i '''''''!7'`(`&p!'Ԃ j'7'''''''!`_W.`$7ր7 7` h'?A? !`_Sڃ(`0`0`()  1 *, *`  4 @ `1 +@  @  3 3 ` 3`2@ 4   + +`@ *0 * @  @  ((@@7ւ`7` '?? !(`ڇ0`* (2 0` ) *  1  1 (    *`  2`2`3`0(( +`  2 + @  0 ((@p!'Ԃ q'7'''''''$77a'' .`7֝p!'Ԃ o'7'''''''&$776'a 7'7ؐ?(`0`` (`, 3` *> 2@. ԁ.`7>+@ > @.`  ֐ > @-`֐ > @-H(`א,  2> @-ݔ`h!'ԇ.` 0''''''''7ԃ.` @(`@.`0@ 7'Ԑ2  > @-X?a .`''؂ 8 77''''''77'Ԁ@@f` ,,'@@` 0"`!Ă@`'7؄ ؅(00'#\#`, 8@7Ԑ 7֨7'''''''> @-\'Ԁ@5`!`'@ @!@$'Ԃ''''''''7ք 977 `  7'Ԁ@ `  ((  0``  ((  0``""0 (()@&"""0)(@&"h!`0!` -` +! 5a2$!'Ԃ 2''''''''7 7  7 7 70'@"'ԁפ ``.''''''''' 677`' 7Ԁ݄ 5'''''''''70`0` ` @700 ` 7Ԁ@> 3``23`2 #\  `@,w 'Ԃ 3''''''''7 7 '7Ԁ@   >  @,Z'Ԃ 1''''''''7 77'Ԁ@zi !`Ѐ` ΀` ͐``'Ԃ S''''''''p7Ԃ``k @"t77ڂ`1   '7777qC'!&"('؂ R'''''''H7Ԃ``C!"p77ڂ`1   '7777G'&" " !&"$'؄ J'''''''7ւ``7Ԃ 7ւ``ւ`7փ(`0` Y" (@&"!$ ''''''''77Ԃ``2 @"t77ڂ`0'77ܐ'!&"('؂ '''''''7Ԃ``!"p77ڂ`0'77Ђ!$ 3!`'>  @+Y 0`"!(&"@"!!`_p!`  !`_qP6!! @ z! _|?Ђ  &!&!Ђ $ (&!&!؂ < @&!&! `_(|!!` H!` H(!` H !q01> 瀠P6`.@䀠_> > .cp 4!`  !` !!`  !` (!`  u!`  !`_PЂ``/$ "!6! @ "!>  @*@``/  &!&!Ђ  &!Ԃ `_&!!``@!0*``)``q d.!Ā +! p> > .c 4!``va )"UD$5>  @*r !`Z` X` "W!!&!&!&!&!`"!@!!``_y @@0 a0#"!@*/ !`  !` @1@* d  c@* !`  a Ҁ !`  2  c` "!@) d??"!!` `_!`  !`M`_L!` H!` H!` H!`_P``!( @,  4 @ 2!!@@ h!!``.!``0 !``@ !!` !!` !!` !!` !``"!@! `@ 0@)q d??"!!` ''''''''7ԸԠ 'ђ@"h!!``@`! aS"!!`_*!``@  '7''''''''!@@&!Ė$6!` `&!&!&!&!̐` Hڂ (6!C <_8!!!` .!` @!` .!I _8'!`$` !ȃ0```_ 5?Ђ``0@ &_?`> ? Hc+ /?  @(ٔ   !`_ ``Z  ("h,@   *"@ ` !Ā@@ 0((`@0@@*"@` $ "p''7ڂ 0'''77Ԅ 4`4   7''''77777@> @( !`@  d.!Ā ! > > .c 4b!!`` ` 2! ̂b! !'Ԃ ?'ؖ7Ԅ??b''77?a7'''''7777ސԀ@2!7b!``"ܟ@#\#`*2>  @(!`ava )H$ >  @(!!`  "!@'ڐ d??2!!` > `!``  @@' d!`!   ! @` !` `   @ @' d!`!   "! B`  !`  !`_!``@@' d!`  ! c@@'w !` "! !``@>  @'y؁@'[ d'!> .> c 4 <.! h! !!6!6!%6!!`! 0!` "!Ђ``/! @`!!``.!! ``   @! @`` @ @X!G !!`  Q*> @' > > .` 4  (.!.!!``v!{$!`` !  `w$!*"&!!Ā*.!~&!> > .c` 4> > .cX 4> .ch 4> .> c 4i!> > .cx 4>+h> > .c^ 4 ̐b $ >  > @&#M!> > .`8 4  <.!.!> > .`0 4  <.!.!> > .`( 4  (.!.!> > .`H 4  <.!.!> > .`@ 4  <.!|.!Đ` ` 2)!!`  2 !;!``@>  @&h> > .c 4``@>  @&V9 !``@>  @&F> h$> #ؒ @&9 !> b$> # @&, !> d$> #Ȓ @&  !> > .c 4 ̂h $ >  > @&#! > @& h <h$.!Ē > @%Pd$ ̐d $ >  > @%#!>  x@%!``0  `( ``/>  H ) 3 @%ʘ-` !`2``Z0@8@ '"h`   (0`+`3 `!Ā@(0`?c(+`83 `%@"p''7ڂ 0'''77Ԅ 4  7''''7777В@~,`0`@"-`!(@&!Ē @> @%W!'Є b@'''''''' `_7!ą67@77`'!`P耠`_@% !` !Ā`2'Ԃ  '7''''''''x2!!`_( !7bw> ! S؀K> . 6!6! %> .6!!`4> b!!!#\#`#d > @$!`";!!!!((`@D@@@!0`!( !(!!( !_!@ !@!!@ !"!> `@$ !2!!`" !!!> x@$ !`_8!  '7''''''''2 !!؀ 6! *> 2@$z,"!(@&" "! ?``  &!  !`` ` w > > .c 42!! P(0``N(0` ?(e`P"H!7ւ 7/c2!Dia2!! `&"``'Ԃ6"V''''''''76"X 7@7e@"X* 2> "@#!``0!@&!776|&!` a@ !a`@ !@ !`" > 0`@@# !!`4> a6!6!6!> .> `4!> `7ւ 4''''''''7Ԑp  'Ԃ '7''''''7'"!>  'Ԃ '''''''7'7ԐȒԀ2> !!@ &!@ &!&!!!@&!Ă 7؝㾸> ` c<@' `+` > p@#: ,` &,@ > (`>+ `$` ` 3`   `> @#!`"/, ! $+`d+` @? ?4 ̈ (0  (`(`  @  " $"3`(@ @@ `(`&",`"&,0 `$` ` 2   > @"ܔX$&` b `$` ` 2  > @"˔,` $&,& `  > @"`,` &, `$` ` 3`   `> @"!`"p, ! $+`d+` @? ?4 ̈ (0  (`(`  @  " $"3`(@ @@ `(`&"B, `$` ` 2   > @"n,`7 5&, `$` ` 2 > @"] $, F`$` ` 2 #\  > @"N (&,.F>  @"E` , `$` ` 2 > @"8 , `$` ` 3` > `@"+ , `$` ` 2 > 8@" ,!`"``h"G `$@ † >   bx#`#\ > @",`̂ &, `$` ` 2 > 8@! , `$` ` 2 > @! , `$` ` 2 > @!ؒ , `$` ` 2 > @!˒ , `$` ` 2 > @! , `$` ` 2 > x@! x, `$` ` 2 > P@! k, `$` ` 2 >  @! ^, `$` ` 2 > @! Q, `$` ` 2 > @!} D, `$` ` 2 > @!p 7, `$` ` 2 > h@!c *, `$` ` 2 > @@!V , `&(`$` ` 2   > @!G,` &, `$` ` 2   > @!6,` &, ` `$` 2   > @!% "$"d0 C@`(`)&",`"&,0 `$` ` 2   > @! "`$"0 @@`(`)&",`2$ &,$&H > @` ڐ2>  > @ޔ``````` `@`2x>  > @ ( `$` ` 2 #\  > @ $a& > `(> b `  > @ !`?`'$ b'(7$','0'4'8'<'@'D@$7<@`$'@D ,`6 4&, `  > @ `, `$` ` 3` > `0@ S ,@=!@,`&(&,2,'$`$` ` 2 #\ >  @ :, @J > @C{` > @<q` > @5g` > @.]` > @'S` > @ I` > @?`x @/ > @ h#`  > @X`  > @H `  > @8`  > @(`  > @` `` ` $> b㿘.`6`@& @&`$&`(` .`F!``@(``"6@>@")5>  @x㿘`Q (`>,4"@>"@n d@'/"@'* > @z@  @  >  @l >  @dȁ > ?@\؁p!`` ` "! '!`` '.`0` @> @@c@(`0``HM(` > @2 !"G"!  @?'` @8@`2%! @?` @`>  cԃ.`@B @`@.`"@&6", `@!,` @`0>,@>"!``!> @Ֆp , 0``*> 2@ƒ  @` "!(@&" !!pa !Ψ '!N }'! y'! u'!> @a뾒 "!(@&" !! pa@!  > @~(M  > @v" @A>"! @'!`b !> @\\끒  @ $ "!(@&"!!> @@Re  @ה  !"(@&"!!!> p @!FF  @  !"(@&"!!!> p @9'  @ ʨ !`_E` "> @  "!(@&"  !p ! " *  @k ?""0 ()(@&" @W !"(@&"!!!> pa @,Œ  @7 h !! !> pa!"(@&"@ꥒ  @ !`"w!`"t!@ !``* 2  "tЀ> @W ""0 (@@`((`&"! _" > @@  > @8  > @0  > @(  > @0 > @h0!!`  > @ H٨  > @(Ѩ `  "d(  ,!) 0`@4"d"{ > @ (`>,|> @֒  > @ϔh  @h?0> @@Ē >  @ > @ dP "> @{ &"8`6"<@|Ґ > @h!{ !h !}:  > @0!{ !w !b(  > @yH!d !ނw㾰> c!!"86"< @?` @<`2 !`@?` @<"V(``s l> @ !4@: ,``!`4"<ۄ"@@2* "@@8!/8Q!"('`b `02!!`[ !!`&",t&","0` ! _8c!!``@!`   &"(&"0>  (, @ " "@@X>" , > < :> !`"('"( > @x!&"(``0 !!`!!` #2! > @!_ !` H(!`_ Ђ``/8!@\ d!!`!` s!`/ !`!` * `!#\@>! > @BЦ&","0`2O!  &"0 @h"l!,` u?``p ?`'  " _'@"!@`_ 쀤 "@)!Ā`  > ``` ``  '``" ```` `2``!@`  > @ܔ @[֔ @!!`@2"l2!!` [h 6!> !  ", @[ @zA,`#\3  > @8>  @`@ '   @*w!Ā` > "" , @`` @, "*6"``` ``  o'  > @_ 1!@!!  `@!G``  &, $""0 @)@`(`&"`"! &,!`_!`#``$#` `c  2.F  >  @a@;Ė,`$ &,  !"``"߀``_ A``$۪@ > @()!c @@;fc @@;` > @@```>  @`X@;````>  @`h@;{`c @@;tK" `!`!!`"&" !6"> `@  @Z @! (@"@2r``}(!"! `$` ` 2 #\  > @ &,!`_8,`2!F` !``%&( !$ d) ) @? 4 ̄ @  "$"d??c1  @@`(`&"``"$,` &,`4 $( @> @4 $`"~, (&,.F$&(" !!```@!Ăo`2 `),`F`!"wF6`` `0`W(`8` $`$` ` #\(2 #`F#h#d,> #l @"(``/ "6"/  ( @Yߔ @  26 > @ՔH!!``!؟@!`_ݸ !`  ! ` > `@ `2$ &, > @H!Ā` 2|$>  @ap@:Dt$k,`` ?@2C&(,"@&(=&(@t!X&,8>   c<' & ,(&  4aă0` `   e& , b@@  > @]  e& ,> @D!h a @?``@   @ > @E  e& ,"     e& , , aoh0! h - `0 > @ -@ 0瀠   @ 08` H 8`b?蛐?c9@ 2)b@b a_C  `?`?   2 6Lb0``8@`  @@Xː  , ,, , 4 @ aa`$b$bb 0(@((`$bЂ   @@X  , , , @ <aa`$b$b@$b @X @ / a`_`  / a`_` `  , a`6$d@?,  4 , #@ ?5@*  2 a " a 5@ a`_ @a85@@۔ 0 > @B  f& ,`_a-4 4?40 4@8`,2 (0a( 0`@, , @/4 4 $a@ g%  & , $H` `$` #\#` 2 > @0aa`$b$b`4b0 ,  4 @ؐ0v },J`f`?"'  `"  4  a]    L/ > @Ȕ  fV& , $A/ >/J` 4  B aa$- d- @? @4@ހ"3  `"/  4  * a 4  % a0> !!xc<@' `0&!x  @@W  )/?  4''/ '777Ȅ'!7 4o@'' @@'`' @'@/v'?''' '/'/''''''''/" 77?8/@8`/!'/ǒ@7X@  @W* @'''''''''7 T7o0`7/7` @07' 蚃oa  C '7c9@,!Ā` +> :@5!x(@&!x :$!>  @ݔ@ *> > ` @ϖ/^Gb @@7m!x(&!x? > ?@0!x(@&!x > ?@0@曐!x!> ?@0ʝ0> !c<'  @V < 74@ a7@  !1 7@  @7@ " a77Ș C 3 7`?7`!x@!0`777&!x! 0@@0'''''''''  47 n7@ 7@ 7&%b77''⫒!x(&!x`   > > ` @3/:!@!0> !c<' #`0 > @!`_   > @! @V  @  )/?/`4' '77'Ԉ ''7 7!Ăo@'' @@'`'' @ g'@-?' ''//!q!/77'@@5Ԕ $P!Ā S  @@U @'''''7'''' T7o0`7/7` @07' 蚃oa  C '7z?@+!Ā` )"!Ā > ?@~0d> c( @@6> c0@6  !Ā` R > '@6 cP0J> b@6 @P> !c<'  > @P`''''''' # 47 07`0`7  @77 !`!q77  'C 3 7@/؂ n'''''''''7 7 7  &%b7'77'h    > `` @!> 'x'|<!@' ''''''' d7x`_W!#7z74 7|` 7~' 7`7'!x@f@&!xxxe!`_8`0@'.(`(? 6S&O  !x(&!x @ >%.`$7z7`0@(.(`(?6&  ˀ7z> ` @W)kƂ?!x(&!x?> @8!'!> c<@' @0`` 0? > #< J> ``` 0```c&@!>  }@ ~`~''X0```X`'(`0`(@`(0`  !U S'  @0``` `7'T''l't ?T' ?P' ? ?t'd ?pl ?h??c 0 1 '\ ?# @+ 3`+`  ' 0((@  ?`  T2`7*`  -/` * @ 2.*4`,`  *, @ 'x '|x4,t ,@l-`d(`\)   -   +? ???І ?' < 9   "[ )  0@@@@ 2 D@ 2 H@ 2 L@ 2 `0  > @@3Z!+> @; ٰ?      ?# `? #\> @@39܃, 0` 7  > @!Ӗ+@֐!`0` ((@`02(`0@%@%`%`%`%`%` %`%`08@8H` 0\800?*)?+??#c  8+`!3 > @, 0` 'z@0```d `0`#`0`?-``03 H 4 03 !> @~h 0 8$ 0\??@ +`@)??#@@Z$ 8 > @d@pd'&@ pd"&@c&@!>  @Q6  > @J9!.+!++ \`8 + #`0)???@@@@#`8 !> @'@O @> c<@' !!> @Ȑ!)> @6 `{B;> p a `Į̴-;`'Ԑ' `3`` `}z!> @3`` ``0ă3```4S'''А@p̅(( @) (`#)  @ (`+ #@+ + ؚ@+ +`@+`@+`@Р #`#\+`  @> @ E ;ʒ@d ;ʚ@b@C50 @ 9b#@```0''`'Ă '7''''''ȴܒH?> < > (Ӑ  Ò  І?@Ѐ@ 0ņ@ ` 8 ;ʀ #耤@( ;ʢ@du ;ʚ@d@C8 " #@ 9c@#  !@]7 !`"] `(`  '?(`@?(@ ' ! "V! ````?'`? _U/'/??c@ @'!`/8' +` > `@!?> ( @8!!` `(#\> @֔x!> @є[ 7 !`  '?(`@?(@ ' !  `!!!(`( ~C`%   2!`"?c"/;`'/3`0( ,`,-`        + +`@ @2@*(@ @ @@*@@  ?0 (@2/3` +`,`,-`  ` (+     **@       ???`0(` '/?@ '/ܘ/ 7/ @ @@ @' !_J~ U ~'` ]' qb7'''''''7Z"(`0`$0`2 > @ @' '!> @ה a?@!`1')  > @ǔx @'ԅ(`!> @HE? > !c<' _`e` ''''' '!Ą R/?67`''''''''''77/'7€ C "4!x!! 0@$!''''''''' 4 T @77@ 7@ 7a ''77۹@% !x(&!x@@&!x.`2`Ԕ0> a @@/ߖ > ` @2(!`@@#ɔ!Ā` > `(`3`ѐ 1 > @Ȑ?> @"aД @@/`.`2`Ŕ0a````(`(@` (`3` > @ @?>, > @  ? > @ ? , 2> @ ڔ`  > @ Д,`z  > @ Ŕ`r?  > @  j? > @ @c?  > @ Z`  > @ S? > @ L?2` #\ > @ h?? > @ @8? > @  1? > @ }*?㿐!@@?x??c !oe.;@+/6$,`0` W 2 !@@  !o  e̐?0,` > @ "X?6,`0`& !oe? 2(`0?*@ 0#\? * > @ Ղ? > @ p͂?㾐> !c<@' !> @ `0 ? > #< > 0``` `` f&!> @  > @ݦ"ax@> @&axpe&a_{  pf&ax (&ax> ` @ -oe`0!@-5 `"   `> @ qax(&ax &?`&7'̖ H`6'4!> @ Px4X   > a 4  @ `   ((`@ @( ` (` )  `  (`(@@@   ` 4  ֈ+`@!(`(`(`@    ax?(-&axpcb`0''(`0'$   (`(@@'+?c@@Ԓ!>  @ / "/ 0``2 `4?@@2 `0ٖ oeF ''''''''' `0? ? ? ? ? ?܉)  ?(` ',+ 3`+` 0  ?(@(    ?2  -  ?*@   -  - *  4`   ,  2` * @+ 4 ,@+`*`,`,@- @ @@@@@?@@"`H,3 `@`H#lԖ3#p!#`#h#x##\#d#t#|> @ Ԑڀ `0`8`?'`0# ?'`8oe2ax4`'Ѐ@'ax(@&ax!eg.̂f&!>  @  > `i!i`> @ ֒!Ж> @ ϒ!(0'0@p '0( @%"*$(`"?c@ @(#\> @  Ђ ڹ8`BԐڀ yoeax!(@.}&ax> @ ר ?`H3`0 ,`,-`  (   + +`@ (2@@ **@ @  @  @@ @0 > @ AX 8 0+?c` ?! 0 5! 8?@`0`8Ԃ`'`0? > '`80@ !'d'|'t'D|''L ?x'\'Tܨ ?t'<7 ?pd ?`\ ?XT ?PL `0?HD 8`+ 3`+`@ 0  ?@(<(  x  ?8t2  -  ?h*@   hd- *-   4`  2`   , LXT D* @4 ,@+ <,+`*`,`(`@@  @@@@@!?`( ) @0" @@2 D@2 H@2 L@2 / "`0) @ 00Ԃ#@8`#`#h#l#d#\ > @ [X]Ԑ > @ SUЀ@!,`L@2`@@2`D@ 08 8?c ?)??@#@) @@ 4$ 8 @ @ 4`@ Ԑ!> @ x0` 0`L@ 2ѐ 20(   **@ ( 0(   ( @ `@  (    +` (   @ `D@ ܘ 7`0 84 0? 4@)?+??#c @+@@@  $ 81 `@"4> Ԑ!> @ 0`$ 0#@#`#`#`#`#` #`#`ʆ@0008@88HԄ 0ԛ+?)?@#+?? c@@@ > 88@!А!@ 0`$ 0c> !ax!-(@&axLЀ` > @p8!> !x@i!'4!.㿘! hS bfd22 ``Հ`2`` `?`>2!> @@> pg>,c8??cc?> $`  -?4`* 0`0&*4` @@)U - 4`a4` ph$2``Ð  > @X? 8 4@@@@! 4?c   00`.o(`@0@ 0`$ 0@t 4``~ 8$ 8 4@$ 8$ 4 0 8 4`$ 0 $ 4@S  4$ 8@$ 4`0 $`0@F`"!`4`0$`08 @@ 8 0`$ 0ݒ ~ @ v-  (`Z`0  Ș ߄3 2``. -  &  > @i]? > @c0W?p'''''''''`   > @O?.`>,TC?c * 22` 0!_$ !` ;7ր* '  $(@""0 `7'()@&"p2i? > @  !`_`?c8.`.@7 `7Ԅ '7ؐK2D? > @ޔh""0  (@@`((`&"0 ` @  "!`_`.`0`!@" ƃ.`7 ` 77؂ ` '7 X ?9Q !`?``q0D!`"?0=!`"?=06!`"ސ?0/!`א?`_Ԃ b!7$7`': ?+> Ӽ  !`?_ 0!@N.`$77P  7  > @9? 0?c* ؓ2`* 62`2j @1@"0 ) $ 0` `(`^7֐ > @ ? > @H? 7܃(@ 7օ) ` B7=7ւ 7փ:  6 > @?'ll'P`'l> c<'  8 7P7R'h'T'X'\'`'d'p!P*P" ! > 0` ``7`!ă0` ` ߴt7` @F  7t`7x(`0`g@8``7z(``"`!ă0` `2'l`!'`7~(`0``}87~"` '`  'Ԁ ` 'Ԗ`"` `n7` ?Є('؀ s'؀2!؂`'! 7(   "``HЉ- 5`- /5`@/@5 'П-- /5`5@ //5 -5//-55 //55//#\//> /X5 //@ `!`7$7`!ă0` `_߂ t7` @F  7t`7x(`0`g@(_`` > $@؂$7x`7z(``2V!` > @ 7z!ă0` `"N`'ll$ς`'h'P'l B7j7P'T'X'\'`'d'p-PV37|`  B'Ԃ`E'Ԁ`Љ-5-/5(@'/-55@ //55///> /@ `!`7``|!7`!"p"t؅1 770 777 7 777> @s"p"t0)  0`1 (0#l(#\2#h #`#d > @]!Ā` " !x> c@ @%!x@j@&!x! 0@@'P'T'\'l'p'X'h'`'d 4 `7P@l7T@`7V'l  7\7^rpc'p@(1 ) 1 2#\  > @ X~!xP(S&!x&"$&" &"(" (@&"0H>  @0B > @0!Ȃ'Ԃ`0'Ԃ'Ԁ '؂``c @a!'> ` @(!@ʐ"(> !c<'  @D͔ ` /`!`7!!!((`@D@@@7!Ć1 `771 `\7`7(`0`g@8]``7(``"f``7(``"n``!/`/`7(`0``}Ҁ(7!!!(`(!!`!!` Ђ``/*(*0`4'!  /7`(`   "?``j- 5`- /5`@/@5 7-- /5`5@ //5 -5//-55 //55/#\//> /X5 ///@% ! ``*$7 ``M!"p"t؅1  770 7777777Ȑ > @!x@@@&!x! 0@@!'p't'|'''x''' 4 `7p@7t@` 7v' 7~7|rpc'@@  > @Ԕؐ2p!xp(&!x> c@$h ` > "2!!!!!`` :7?7 ń  Ԃ` 7Ԃ `` ‚7` ``Ԁ 2 ` @7` @"*؇(@*7؆*0`$!''p`'t ' 87r7p''x'|'''7t7vǒpp ! /7`(`  7 `` 7`7(`0`g@(`` > $@B؂$7`7(``2`` > @4x 7`7(``2`` > @& 7q7``,-5-/5(@7/-55@ //55//> //@ ! ``2܂$``ׂ!Ղ$>  @0*!`8#!7Ԃ`7Ԃ `` 2Dj7`097Ԅ `/?7?@D7؂`` @!&"$&" &"(" (@&"0> ` @'!@ң"@㿘!`!$ϐ> @ϒ ! !p !  !`_ԙ㿘!`z1"!@@<> @| !6"`1 (0`@)"d, @9 "!@S $" $ (!``@ $$ ( @$ ,!(0`@8"d! C!`_8!`  !`"!`_8!!`  !` !!`  !` (!`  !!> @ 0 0`  !L" @@"@@x > @(!`_ !`  j!`  c!"(@&"0P@!`""!! @"!"@"!"@ 4 ` ? !xa } a xHo4!p(@e!p`` "!pHp@"!h!p "!p"!p!hHp@㿘א!`_ !`  `  ށ `@ !) )  @(`"* * * * `?: @B 沈?b!x~"!x㿐#@ (a#'@ *C(( @@(`@eu' " c㿘!xhb@"`!xb&!x㿘E > p `. .  @@(`@沂a #` 1M`! Ą#`㿐'P'T`'X!Ăo@  > @? P@"'> @8 Ё㿐` ab"V!x(`0`3``P !^ !Y!@ d  M!xF d!x>`@ۀ%> `&!x@ (n#> a "`V @ݐ!x &!x> a> a "T+ 3  > z(`6@!x&!x >  >kadX >  >kadp㿀`g.`>j!`a!Āo]!8?c, ., . @$@(`@`   `" b` ` 4*``  P` * *``   (`   !`  *`@ '?#  >  > a> a > a$@@` #`#\ >     >  0!x` > &!xP 0!x!߀`N&!x@ >  ֔`0> b> c> c Ȓ 0?*&!ă0` `"2`"!`0`0& 2`((@  2:`1 ?`( @&??c 1  *) @?c&!0`0&(8`.02> a@2> #h#p #`@b?c2> a@2o?#`#h> #p* &b?c"?G &)#h#p2> &a 2#` ?@> * b#\#d#l >  !``!`z` w` u , 3 >  80 ?c> a2? #d@#l> * b#\#`#h >  2> a@> b#h#p#\#d#l ?4* > #`d0) > a@#d> #l ͂b2> a@?> #d#l* b?2> a@?> #d#l* b!`` * 2 >nb@Ӕ!x`&!xm >  0 > {h@r㿘 @&  $42 (@& !x``@! `4> Up (@& !x``@@8 X (&   > $!x6@g㿘 `4䪐 f"E e g h ` `  > >  X>n@Y`@˔  @& "1 ,{ ` `  >  ` X>n@;c @ %#> 'b @ @&  > ax`@$axN` & ,^E㿘!x``! &! !f 5>  㿘!x!`&!x&! q&!f 5>   @ > c<' 4@Z "Ga `S@@H@& a@  `'@F  $` a``@ > U@D  (& ,&  p> o> 9 0 > 3P0 > *(0 > #  @(#@ $>& > 'b  X@! @& @    @&  @@<    /7/ $d@?/@aa`$b$0 > x @(g& 0gd @!㿐L f, h* e*` *  !@?  A``"#耔2!``x (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx &`,@ڤ 5  `,` &`,`,㿐"!>q>jc&!T&!X(!P@&!&"&!& d& ` `I!``D!(0`4>q6 >b W&!P!"6 P6 R > H (> @/' !`g` e` dBj! 0'!> # @"!`$`  "'@ $P ~&%@?b 0'!> # @"!`` ހ` ݂ ! 6 R0``6 P 0(@6!   >& 6 &  6 $0`6 `6  ̂ 0(@6!`'| 0㿐 `4>nXc@*"0```48!x!`_Z!`   " @@!`j`_]!`   @&,"!(@&"  _{!`  !x``P@ Ő5>  !x``0 f"!x; g er`  0`/!x&!x!x`(`&!xʁ`   @&,!`   @&, @&,! hȒ  ` ` > -H>n@n`@ȩ @& ` !x /"!d(`0`""(`*0`2>   &!ds@Eo!`  b!x`@ &!x> 8%[@ "#> 'b @@&㿘  4!`> 'bȀ>p!x'!x'!P !`  $0` `.@a(08> 'bȀ2 &!x'!x  &?a=)2 7..`. (.` @@` 0` ` ""0 (@`(`@)'"a(7a <?c@" <@M@㿘!"4 "d(1 ` &`"&`(0`` ((0`1 @?1 `#!`(`0`@ &"4 `2! @*`"d@` !"d@   @   (0`2  ?` !@*`"d@ 㿐!!`&" " "h'"$'(`&!`2#``  '  `&` &@#㿘!`=`_!`  !` H `  !``@!`  !` !!`  !` (!`  !`  !``@! " ` @ `** ` `** @ ` `****! " ` @ `** ` `** @ ` `****! " @ `  㿘ǔ! "~``&! s`. ` .! c` 6 ! U` 6 ! G`6! 9`6 @`  (?c  ?!Ā@ "` ` " !Ā@ " `$`$"$```0((` @0@@0((` @0@@?`(@8`Â@?`(@8`@?`(@8`@?`(@8`@` .. ?0(c ?(`0@@z@ 㿘4! "D``&! 9`. ` .! )` 6 ! ` 6 !  `6 @`  0(?`(@8`@?`(@8`@?`(@8`ӂ@` .. ?0(c ?(`0@@@ 㿘۔! "/``&! " ``` ` ` ` `. 6. . . 6 @`  ( @`  ((?`(@8`ݘ@?0(c ?(`0@@ɂ@ 㿘! ``` .&. ! x` 6 ! j` 6 ! \`6! N`6! @`6 @`  (! "g`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",```0((` @0@@0((` @0@@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?0(c ?0(`@@m@ ?0(c ?(`0@@@ 㿘! "``&! `6! x` 6 ! j` 6 ! \`6! N`6! @`6 @`  (! "o`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",```0((` @0@@0((` @0@@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`v@?0(c ?(`0@@c@ ?0(c ?(`0@@@ 㿘4! ``` .&. ! ` 6 ! ` 6 ! v`6! h`6! Z`6 @`  (! "`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`(@8`@?`(@8`@?`(@8`@?`(@8`x@?`(@8`j@?0(c ?0(`@@S@ ?0(c ?(`0@@w@ 㿘n! "``&! `6! ` 6 ! ` 6 ! v`6! h`6! Z`6 @`  (! "`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`(@8`@?`(@8`@?`(@8`@?`(@8`x@?`(@8`j@?`(@8`\@?0(c ?(`0@@I@ ?0(c ?(`0@@o@ 㿘! "R``&! G`. ` .! 7` 6 ! )` 6 ! `6!  `6 @`  ,(?`(@8`@?`(@8`@?`(@8`ӂ@?`(@8`ł@` .. ?0(c ?(`0@@@ 㿘6! "``&! `6! ` 6 ! ` 6 ! ``6`?c ?@ 0 ((` @0@@#@ ``2@ ````..?..c` ??@  (1 (` @0@@#@ ``2@ ! "_`,`,&,! "P`0`0`2`3.260.3! "8`4`4&4! "$`8`8&8! "`<`<&<?`(@8`@?0(c ?(`0@@@ &<?0(c ?(`0@@Ԃ@ ?0(c ?(`0@@@ ?`@(8`@ 0(`0(@@@?`(@8`S@?`(@8`E@?`(@8`7@?0(c ?(`0@@$@ 㿘M! "Q``&! B`6! 4` 6 ! "!` ` &  @`  (! "<`0`0`2`360.2.3 @`4  (4?0(c ?(`0@@ׂ@ ?`(@8`Ȃ@?`(@8`@?0(c ?(`0@@@ ?`(@8`@㿘ߐ? c ?&!Ā@ "` ` `& ``%!Ā@ 2``0 ((` @0@@&!Ā@ 2` ` `0 ((` @0@@& ``ߴ㿘? c ?!Ā@ "+``&!Ā@ "``&!Ā@ " ` ` &   ` 0 ((` @0@@0 ((` @0@@0 ((` @0@Ђ@㿘x! "~``&! o`6! a` 6 ! S` 6 ! E`6! 7`6! )`6! "``& `  ( `   ( ?0(c ?(`0@@@ ?`(@8`ӂ@?`(@8`ł@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?0(c ?(`0@@z@ 㿘! "``&! `6! ` 6 ! "` ` & ! `6! r`6! d`6! V`6! "C``&! "/``&! "` ` & `$?$c ?@ 0 ((` @0@@#@ ``2@ ?0(c ?(`0@@݂@ ?0(c ?(`0@@ɂ@ ?0(c ?(`0@@@ ?`(@8`@?`(@8`@?`(@8`@?`(@8`|@?0(c ?(`0@@i@ ?`(@8`Z@?`(@8`L@?0(c ?(`0@@9@ 㿘! "Q``&! B`6! 4` 6 ! "!` ` &  `  (! "<`0`0`2`360.2.3 `4  (4?0(c ?(`0@@ׂ@ ?`(@8`Ȃ@?`(@8`@?0(c ?(`0@@@ ?`(@8`@㿘`/ .` ? c  0``  !Ā@ @``@ 8`(@0`  `+``0@```4֘` ! 7 @* `*! '`2! `2!  `2! `2!  ` * ` *  @`    ( ! `2!  `* `* @`   (! ` 2 ! `"2"! `$2$! `&2& ? c  !Ā@ "M((0`(  ? c !Ā@"8`0`00`0`! a`828! W `:*; `;*:! G`<2<! 9`>2>! +`@2@! ! `B*C `C*B! `D2D`@ (8`DŽ@`@ (8`@?`(@8`@2D `C*B*C?`(@8`т@?`(@8`Â@?`(@8`@ `;*:*;?`(@8`@?`(@8`m@?`(@8`_@?`(@8`Q@?`(@8`C@ `*2*?`(@8`!@ ` * * ?`(@8`@?`(@8`@?`(@8`@?`(@8`Ղ@ `**! @2! `2! `2! `2! `2! ` 2  @`    (  @`   (! {`2! m`2! ` 2 !  `"2"! `$2$! `&2&! `(2(! `*2* ? c  !Ā@ ",,0`,  ? c  !Ā@ "440`4  ? c  !Ā@ "<<0`<  ? c  !Ā@ "iDD0`D  ! `L2L! `N2N ? c !Ā@ "GPP0`P  ! `X2X! `Z2Z! "`\`\"\! "````"`! "?`d`d"d ? c0`h !Ā@2 h h `@ 8`(@0`h`@ (8`@`@ (8`@`@ (8`@`@ (8`j@`@ (8`T@?0(c ?(`0@@@ ?`@(8`@2&! (`(?`@(8`@2(! !`*?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`@(8`@2Z! 2d`\`\?0(c ?0(`@@@ "\! 2X````?0(c ?(`0@@J@ ?`(@8`.@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`c@?`(@8`U@?`(@8`G@?`(@8`9@?`(@8`+@?`(@8`@! "@@ ` `** ` ` ** ` ` ** ` ` ` `* 2***  `   (   `  (! `2! "u`` ` `!* 2*!! b`"2"! T`$2$! F`&2&! 8`(2(! *`*2*! `,2,! `.2.! `020! "`2`2 `4 `5*422*5! `626! `828! `:2:! `<2<! `>2>! `@2@! `B2B! }`D2D! o`F2F! a`H2H! S`J2J! E`L2L! 7`N2N! )`P2P! `R2R!  `T2T?`(@8`(@?`(@8`@2T?`(@8`@?`(@8`ӂ@?`(@8`ł@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`q@?`(@8`c@?`(@8`U@?`(@8`G@?`(@8`9@?`(@8`+@?`(@8`@?`@(8` @?`(@8`@?`(@8`@?`(@8`@?`(@8`҂@?`(@8`Ă@?`(@8`@?`(@8`@?`(@8`@?`@(8`@?`(@8`y@! "@@ ` `** ` ` ** ` ` ** ` ` ` ` *2*** ! c` 2 ! U`2! G`2! 9`2! +`2! `2  `   (   `  (  `(  ((?`(@8`߂@?`(@8`т@?`(@8`Â@?`(@8`@?`(@8`@?`(@8`@?`(@8`w@㿘! "``&! V`6! ]` 6 ! d` 6 ! k`6! r`6! 0`6?c  2!Ā@`2` !Ā@``@ (8`@2!Ā@``@ (8`@2` ?`(@8`̂@?`@(8`@6! ` ?`@(8`@6 ! ` ?`@(8`@6 ! `?`@(8`@6! `?`(@8`@?0(c ?(`0@@_@ 㿘0! "``&! V`6! ]` 6 ! d` 6 ! k`6! r`6! 0`6?c  2!Ā@`2` !Ā@``@ (8`@2!Ā@``@ (8`@2` ?`(@8`̂@?`@(8`@6! ` ?`@(8`@6 ! ` ?`@(8`@6 ! `?`@(8`@6! `?`(@8`@?0(c ?(`0@@_@ 㿘! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! `6?c  !Ā@ "60`  ! "[` ` & ! "G`$`$&$? c ?!Ā@ "1 ( ("(!Ā@ "! , ,",!Ā@ " 0 0"0  `@ (8`Ʉ@0((` @0@@0((` @0@ڂ@0((` @0@ʂ@?0(c ?(`0@@@ ?0(c ?(`0@@@ ?`(@8`}@?`(@8`o@?`(@8`a@?`(@8`S@?`(@8`E@?`(@8`7@?`(@8`)@?0(c ?(`0@@@ 㿘! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! "````.6.! `6! Y`6! "a` ` & ! "m`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`@(8`@6! 2` ` ?0(c ?0(`@@@ & ! 2`$`$?0(c ?(`0@@@ ?`(@8`o@?`@(8`]@?`(@8`N@?`@(8`@6! )` ?`@(8`@6 ! "` ?`@(8`@6 ! `?`@(8`@6! `?`(@8` @?0(c ?(`0@@@ 㿘_! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! `6?c  !Ā@ "60`  ! "[` ` & ! "G`$`$&$? c ?!Ā@ "1 ( ("(!Ā@ "! , ,",!Ā@ " 0 0"0  `@ (8`Ʉ@0((` @0@@0((` @0@ڂ@0((` @0@ʂ@?0(c ?(`0@@@ ?0(c ?(`0@@@ ?`(@8`}@?`(@8`o@?`(@8`a@?`(@8`S@?`(@8`E@?`(@8`7@?`(@8`)@?0(c ?(`0@@@ 㿘h! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! "````.6.! `6! Y`6! "a` ` & ! "m`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`@(8`@6! 2` ` ?0(c ?0(`@@@ & ! 2`$`$?0(c ?(`0@@@ ?`(@8`o@?`@(8`]@?`(@8`N@?`@(8`@6! )` ?`@(8`@6 ! "` ?`@(8`@6 ! `?`@(8`@6! `?`(@8` @?0(c ?(`0@@@ 㿘!`  F@6 ?9 c!Ā@5@  0`!  +?0``@(8`@`6 ? c 6`@!Ā@``@(8`@6`@`@(8`Ʉ@@?`(@8`@! H@2! O`2! V`2! ]`2! d`2! k` 2 ! r` 2 ! y`2! `2! `2! "``"! "``"?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! ` ?`@(8`@2 ! ` ?`@(8`@2 ! `?`@(8`@2! `?`@(8`@2! }`?`@(8`@2! 2w``?0(c ?0(`@@@ "! 2k``?0(c ?(`0@@@ "! H@2! O`2! V`2! ]`2! d`2! k` 2 ! r` 2 ! y`2! `2! `2! "``"! "``"?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! ` ?`@(8`@2 ! ` ?`@(8`@2 ! `?`@(8`@2! `?`@(8`@2! }`?`@(8`@2! 2w``?0(c ?0(`@@@ "! 2k``?0(c ?(`0@@@ "㿘 ! "``&! `6! ` 6 ! "` ` ``.6 .! "``&! "q```````.6.....! W`6! I`6! "6` ` & ! ""`$`$&$! "`(`(&( `,  (,?0(c ?(`0@@@ ?0(c ?(`0@@ւ@ ?0(c ?(`0@@‚@ ?`(@8`@?`(@8`@?`(@8`@?0(c ?(`0@@x@ ?`@(8`e@?`(@8`V@?`(@8`H@?0(c ?(`0@@5@ 㿘2! "``&! `6! ` 6 ! "` ` ``.6 .! "``&! "```````.6.....! /`6! !`6! "` ` & ! "`$`$&$! "`(`(&(! `,6,! `.6.! `060! `262! "`4`4&4! `868! }`:6:! o`<6<! _`>6>?0(c ?0(`@@@ &! k`?`@(8`@6! d` ?`@(8`@6 ! 2^` ` ?`(@8`@``.6 .! 2W``?0(c ?0(`@@@ &! 2K``?`(@8`B@?`(@8`@6>?`(@8`@?`(@8`@?`(@8`q@?0(c ?(`0@@^@ ?`(@8`O@?`(@8`A@?`(@8`3@?`(@8`%@?0(c ?(`0@@@ ?0(c ?(`0@@@ ?0(c ?(`0@@@ ?`(@8`ۂ@?`(@8`͂@㿘``..``..@````` ` ` ` ...... . . 6 `&`0`&66 @( 2 @ ` ` ` ` * ** *   `   ( `"㿘``.`@.``````` ` ` `.......66 . . .㿘ޔ``.`..` .`  (` .`  ( a  (a$ .$a%  (% b$  ($ b,  (,b< .<b=.=b>.>b?.?b@  (@ b`  (`bibh.ibj.h.jbk.k㿘{? c ? ````!Ā@ ``0 ((` @0@@ `` `㿘U `  (㿘F  `+ @` `*`**`(*㿘'``.`..` .`  (?c  2`!Ā@``@ (8`@2`㿘``.`@.``````` ` ` `.......66 . . .㿘ޔ``.`..` .@`   8> 'D`d!> > bh> `bx> ?pc 90> 2  @ۼ0@0`H0#\#` 4`(`@(#d4#h 8Ȃ`(`@#l8#|D@#x##t#p>  |  ,?? 0`"?@ > @x> c<' `> P +> -> b/p  p   @T`@  2  0@ /p$  > @ @> c<'  >  > > /(c (/( Ŕ@  Ŕ@2 @2/( > @А P㿘! 'H!@0``0``0 ` j %!>  h  ZH 2"@`00``!Đ!> ?ݥH A !>  ݘ!> ?ݑ  -  !>  ݄@oh0!> ?y؁<|=d=@=@=@===@=@=qq\ppphnPnPoonPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPopopop0h4T||H|T|~|||8   @ "   @2  @2 @ 2 㿘!> . L`0> ` >  ` @S 2 > @L   ؀ ` %D`   ؐ`  2 ؁@,  L㿘 ؒ @ . @ %D ` #.  ؐ@  . `$`" @ 쀎` ! `&%> .`L2   `1> @  ؐ@ . 㿘 @ > @ > .`L" >   @ޔ!q ؄ .%`  㿘!> . L`> a>  ؄ .%`  %    $@ٵ  @ٱ  L㿘 ؐ` !> . Laq>  ؂ .%   La2_>  .%`  p!%D` $(`>  @و!  `   `  ؐ`    ` %D`"+ ؁>  `    ` %H ؂` &%H %H ؂` &%H   `  !*@8  ؒ !)@2  %H ؂` ?&%H.  .    . `   ؝㿘`C` &%0@%( %D` H `   ؐ@ , 2 ؄%0!> . &%0 L`> 3`Vb0> @!` L`"Y%0%0` >  `%(@@ߠ %0@8%(> @ؐ %0 > @ٗ!8%(%0 @ %D`  ,``   ؐ@ , 2 ؠ `  ؔ `  ؒ @, ؒ @͐ > > aX@ؘ!` L`2%0%0 㿘` ` ` `((@(`@a " (@" > @:!x! "> @2>  @2>  @"$* `M`"` `N*`@ @ 2>  * ` ` @ &` ` `? @&@&`" `& @@!㿘>`0`(`& Hod4> l(@e> l@f"Hp@   @ P >@b8 `& ܒ 㿘Ho$(@e"` > l@G"Hp@㿘> a4Ho4 ܂(@e ܀` !"`,`@$`"2 ܢ`@ @Hp@ <@ 0`2  " ! ?   @l !` (`@ a 8 (`@ a 㿘%D`  %@%(@(?`?`~`, @(`@a w  ` `,,  #  .% > @f!!> . L`2> a>  ؂ .%  %%`@.%6% .@``N,  & @.% ! !@c%H   ؔ`  ؔ` ` `s`@!> . L`> a>  ؂ .%  %%`@.%6%`@ &%`H&%%``` , ! 2 >  @"0!> . L`2> a>  ؂ .%  %%`@ .%6%q  !%< !W@  * * "@ * 4%H 2(9%D%D  ` ?`"`@!> . L`@> a7>  ؂ .%  %%`@ .%6% %@֙ < ؒ %@֓"2 L`` V ؄` `Ų %@ a ؒ %@y"W L %@s  ؒ %@m" L %@g } ؒ %@a"s L㿐`;> .` `L ,  ka .%``2%D`Ђb@> 'b@ #@`%D` >  `  ! !Z%H  J ؔ`  ؔ` ` `"g`M%H`"`D`D ؂`/&%8&%4' %4%8 `  `  倈`@2G %D` "C `La~>  ؄?.%`  `La2l>  ؂?.%   @ !%< !R@  * * "@ * 4`%H n%D `  ?`  a|``/   ` `D*%H`y v  &%8&%4'`%4%8 `  `  倈`@2 %D` " `La!> . ؄?.%`  ` L%!`@6%.% L2>  ؄?.%`   @2%D` ``/`La>  ؄ A.%`  A@ #> 'b`/ .`,`D`,*``N*`%H` G``L`2> > .`L>  ؄ C.%`  C%H`Y a X Ѐ``Lae>  ؂ .%   ؔ `  `/`M`N> @"  `  k`L%!`@6%.%`Lu>  ؄ F.%`  F` %D` 2E`L ؐ`  =`L` %D` `L ؐ`  %D` `La A"@Ԛ Y ؒ "t@Ԕ  ؀a2<>  ؄?.%`   @>  "@|  ؒ "@v  ؒ "@p  ؀a >  ؄ B.%`  B B"@]  ؒ F"@W  ؒ ”"@Q  ؒ Ɣ"@K  ؒ C"@E 1 @A"(> .㿘9> . L`> %`>  `S> ;> cH``  -`a` J `@ ` `C Ho(@en-`@(`@a h a45"  ""  `% `!`  (MHp@ `t `  L`2e @`2` Hp@@ 2 .`M   ) @`  (```  `!M * * ) @ `.`N !" $  @fi :`"   a~" -`@(`@x a  @~@y L@6` `? @` &@&`&` &  @f".% ! `2 !2> @# * @` ` @` ?&`&` ?&@& & @& @@"㿘` 'Ђ`@&`&`  @ %`%` 1> .> 'b'@ #`@ܓ L`> a2>  ؂ ,%   %%`@ ,%4% *@  ؒ *@" L㿘`> . `L` `/P` , , , , ,  .`/ `  (, , ` 4`&`@ &` &`D #&`H&`- `* - @(`@a # `2, 3 $ ,  % `&@ `& `  `&`&` % !&ڠ> @Ҟ#X, ]& 9㿘` ` S` - @(`@a K+> .`L`2T ,@&``L`("X  ,` `L`L, F` `@)` $ ,`L`" (`2}>  ,`" 4> @a#ϒ @"f% ,`"< Q- ` @HN `L`>`e`H$ (`L`" ( - !+> .`L` ,> @-#p@ѐ``L`(2 , >  4`#*@2 ,`2  `2 4- @(`@ a "   ? $$ @fv  $ ,`L`" (`&  .% ,@# ,`2> 4> @#$ (㿐+> .`L`%> @Ґ#!> . `2 e#\> l P"   > @` $ e` `4e`,e`  ,`܀`+ "" ` $,` ,  ` & `  ,! ,2`ܨ @ۦ@א`܂!$e$e  ``8@ 8@`*(eL`& )!eL)!)!)!`ܚ`@  @`:  ,e`L7> `؄ ,e`  eD`4`/1a )!eL)!)!)!`ܚ`@ ƈ @܀``$`$`$`a @$`܀` `܆@@0,e !@# `ذ"1I#h '`  4@~7 ؒ @  H L %  غ` %% %%%> `> c`#x#`-`- 0`0#\#d#h#l#p#t > @ (Hod4 (@e `@"> > @А  Hp@@Ð   , @(0` @a%`@~V> @Щ    (@$ 㿐> 0b@%`"d %(`"e %`"S> %(`"O> %D F *> .%<`d@> @~!%< @ P`. A  ,`,` @ (`*` "@ @* %D . 뀠` -.  &  ` & .%%@ 6 h6 j  H6 V& x& |' > #@> 'bА*`*`@ @ > @? @; Ё & .  @c &% @b &%(㿐%> .L`2%%`@Y% `]La >  ؄ .%`  6%&%$%%  @&%$@(6%6%(`0``L6%```@"+ ` `Ya2%%`>  !@'R % M( N% (`&%$%&% %D` 2&%$ % %$vLa>  ؄ .%`  `]>  !P@”'$%$`"%%D` %$%P8 '` % %$ `  `  倈`@2O %D` "K La^? .%  > .`Le  ؂?.%   @Հ`u```2h%% (%&% L`2}%a>  ؂ .%  %%%`@.%6%La": >> ` %D` 2L ؐ`  L% > @:! % '> @3  ؂?.%  > .`L" ؒ '> @!  ؂?.%   @ '@  3%%.% (%$&% %%`.% ( `  (`@`(`(% &% > ' @"L ' @  ؒ '@ܐ   %`.% (%&% %`   )%((% +`% (`%&%$&% % (%&% %`>  !@ί'I %`  )%&% % (%&%  %`   +@%() %( !%(` !%(`% &%$ ! !`)! 怈`%H  < ؔ`  ؔ` %&% !%< !@ 8 * * "@ 0* 4`%H 2%D` `@ ͢ ˀ ?Ȣ`%D `  ؝㿘3> .`L`2X%0%0`"Q % `L%  > @"!%&%0.%`L`3!> .%`"%0 Laa  ؂ .% %0%(1> @@"@`8. L% `e%(o"6`L`2`L`-`Llb%(> @@"(%`"%0 L1> @ۑ!> @ؐ!%0`D>  La:>  ؂ .%  %%`A.%6%`La>  ؄ .%`   %> @ͮ  ؂ .%  %0%(1> @@͠"@ %@͜  ؄  %@͓  ؒ %@͍" L`(`L(```Lb2S ``&%0`]`O>  @q `L`2> > .`L>  ؂ .%  %%`@6%.%(``La}>  ؄ .%`  `La>  ؂ .%  %&%0.%`` v`Lb &@.  > @)"X%%(H`` `>  @ `L %(` @ `"D` `Lb2L> @z > @  H`L`2> > .`L>  ؂ .%  %%`@6%.%%(@ > %`2` @ pu`L &@ߐ"s> . &@ِ r ؒ &@Ӑ  ؃*`>`Lb2 `n%`Lb"j%> @̾#@e%`Lb%> .%`@"```2X%L` a>  "@̦&La" >   @̝& ؂ .%  %% `@6%.%6`Lb> , ` % .%` a$` #%`Lb> `@%&%`H&%`Lb> %$`@%$`H%`Lb> %`&`` a %`$`H` `(% .%`LbC-> . ```" ``@y` > @@ 7`L> @;#H% `6% ` % % &@' ' ؒ &@!"> .a2%`> ` " @ Lba> @ "La" >   @&  ؂ .%  ڐ , @(` ` ; , @(`@a "4a `M`",`N `N(`@",`N  * ,`N,`M"  * z%@ϐ"pn%@ː#XC, @ǐ#R`@@Ð @`@˿#hT%%> @˹"%>  @˳#%(`ݫ, @(a@`(O%Lb2q ` ```L `, @,%( `,,%L`"` |8`%<@ Z * * "@ R* $ , (`(`"@ G* ,`@y`  @ ?@ :!, , @(`@"> @Z#%`24 %L @&, `(  , ,LL>  "@?&La" >   @6& ؂ .%  %%@`.%6%@.% ! !@è%H   ؔ`  ؔ` % `> @#%(`> ` " @ %, .%( %H` ؔ`  ؔ `  Ҕ > ` # @ے , (`(|%@ ! !`@)! 怈@%%H   ؔ`  ؔ`  @a4 `M@xW` %> @ʨ"J&% !%< !"@ t * * "@ l* 4`%H i2%D` `   ?``@x#` > @v#%`G@@a(a(a`L2Y> > .`L"1 >  &@_ * !%< !ِ@ + * * "@ #* 4`%H "2%D` `@   ?` `> @/#%((%%D%D`,% ` X ؔ `  ؒ &@"> .x'> .L`ؐ@ > > `> 0a> > `> >`X> >`xؒ @,@ D ` ,ؐ@ ,`$`" @ 쀊` ! `$L`!> .*``` ``U 퀈`@2} ؂`,  2z 퀊 А 쀊` "l 4L`2 ؐ@  L> .`Lj؄ ,`  La؄ D,` D  u* o*> @v" %> @m!0h 퀈`@)`@" L`B   > @Z!ؐ@  " La2"> ؄ ,`  $  e  Ò-*@? @  퀊{ `w  `"`o ` ?`H#\ @` @ D@(w{ @] `@  ,ْ 0> (,`L0(L@@` `  $`H` `( ,$0La2Ԑ؄ ,`  0<`> @Ƚ#p > @}"(`2L`@J> 쀊󀊠D` "L> .`L؄ ,`   ` ,L2؄ ,`   $ @>ϐ<@ Z 2Ђb@' '`'@ 2@>쀠" 2؁  쀋`444`~, `,7  $(D`2 (@,L`| ` {> . ,Laΐ؄ ,`   `` > @ 8 @ >  @#  ```"> `@u` > @"`   ,(( ` ` ,] $ ,  `@ @ܒ `L`> .`L؂ ,   `@,4ؐ@ ,"  "  ߂@,`?t  ``e`{> ` ` S (>D`  ,` ` (`(``"2`2 t " ! ?   @[ !@e"X 쀠` $#\@Z   H`!8 2 !$ `@ $`H,$ L  "D`@`@2 `/ؐ@  "H> .`L>> ؄ ,`  H`"{`D`D$8'`/$4 48` `  倈`@2D` "La> ؂?,  > .`L2> ؂?,  @ $  H`"8`!ء*@   4 #\ #`> @ƾ La!> .؂ ,   L`> a> ؂ ,   `@ ,4 Laʐ؄ ,`  F!La؄ ,`  8!*0` 2 `M`q> ``(`LOLL (( `, `ML`F> .`L<؂ ,   `@,4 $ `;> .`L1؂ ,   `@,4 @+(pv!À L> @#@ܐ @(hF> . @(hF؀`2W>  @ (fؒ @(f> .> @"` `"Q> > @"> D`2> .`L> ,`  P8'`  $ ` ~$` @   倈`@22D` ".La> ؂?,  > .`L >  ` *u @ť`؀` , ؐ@ ` D` 2Lؐ`  L`@$> > .`,La2؄ ,`  $ `@(> > $ ؐ@  "  La2s> ؄ ,`  -  ` > @F!P g ؐ@  " La2V> ؄ ,`     ```  ,  > @"  @*؀`6h> .s  @*f `8 (`@ a  @),> @!!$0 `> @! > @! *k@ݐ $L`> @{`C`$@ `$` $`$` o$> @ (0H`" D`2  , > @į"p @ī#@O` ?`/La2> ؄ ,`   ` > @P!h g> L`@2-> .`L7> ؄ ,`  P8'` $  @c):2ؒ @^*{@Z#0 > @U#> .`D> @O"@K# WD *U@E @A"@ِ> @<!` D` 29Lؐ`  1L@&!90@"#0K, `ѐ> .`Lǐ؂ ,   `@,4 $  *O@ eؒ *^@ ؒ *K@  ؒ *H@ ؒ *:@ ؒ '@ ؒ '@ܐ $@  !  @̔)d6ؒ @ǔ)?؀`> .`L؂ ,   `@,4 d$ > @é#Pf @ > @Ý#`X>  cؒ @ @Ð 2I`> . @@Ã)s> .`L"ؐ @z)s؂ ,   `@@,4a  #\> @^# #\ *#`2> @R  ! @M)9ؒ!@H)/> .> @B#P  > @9!@La">  )@0 ؒ (@* @ h @#)}gؒ @)}]> . @){ؒ!@){> .> @ ː>  )@ Nؒ@  )@ Rؒ )@"H L㿘#> .`L`I> B>  cHp@#贆5 @ "`Ho$(@eHp@``Ho$4%(@e%``L`r0@¬0  @¥#h㿘#> . `L 4` `L`2` 4-   M0`- @(`@a I- P b& &  & D`& H& . LHo$4&(@e&&  $ `& Hp@`2 \ 2 S )`- - !纐 $  @U S> a4:" Ho$(@e`"   a <" Hp@> @#`L`"p@ > @#` i- 4 @ ? ,4,6  ,@$,@nR /& D & @$m& H0 $,@nՑ- `@(`@ a 8ttt#X88`fa0#X`? (` ?`2 `@0 (` ?`2 `@(`0``0`(@0#X`& #\#\``@0@? (`0``@(8`@@(`0`@`(`8 0@#X`& #\#\``( 0@? (`0``@(8`@(@ @`(`8 0@#X`#\`@ * 2 `?(c08`(@@ * 2 㿘 Š      㿘  (@20!  ƒ >    s >㿘#X88`cd0#\0 Ĕ     l i D c   (`8   4`2 M  .` g*   `:  #X@?8@8`fa0㿘#X88`cd0X e  a ] Y  U  Q  #X88`fa0#X#\88`dc1 `  (`0`#H ߀`1#X#\@880 ?(c0 8`(@(`?0``@8`(@1#X#\@880㿘Ho(@g #d `@$#d` &#@ 4Hp@㿘Ho(@g #d` `` Hp@  (@J $#d 4@ 0㿘#.@? c  @`(0`@ @(`0`@ 8``(0`@(`6 㿘#\#X? c c ) (`0` d"#`(`0``@(8`@ d` #``  >  @ h>  @} @㿘#` ~b #X#\@1   #X@&#\#\ (`0` (`?0``@(8`@` ?(c08`(@㿘##Xb#\# `&`# &`#X#\@880(#X 0> @  #X#\@880#88`dc0`:`(`0`#X#\@p> 0b@883`&`#X 88`cd0&``'` (`0`h"#X &`#X#\@880@^&##H&`#D&``?(c08`(†@` ?(c08`(Ղ@㿘#X#\`88`cd4`` ` (`0`74?8H8`@`#5z#"+#X#X88`dc0#`@`4@(`0`````2#X#\@#88 0@]#\@`880.`#`"#X`#X88`g`0`.`?(@`0@(# #X>d88`dc0c@`.`(``0`@4@`2#X#\@ 880` ?(`0``@(8`@` 7  8(`h``?(`0`@`0`y@ ?(`#0``@+`8`@ @`(``84@(`0`+ 8 `f?`@(8`]@@`(` ?0`#`@+`8`@ @8(.`0`(`+ `8  `.`(?0?) 8(@ (`0`@`(`8Z`(?0``@(8`q@`M# ``4#`1`K#X` 4c##`$`>#X#88`o`5T#``/#X` ?(@8`݄@` ?(`0``(#?@8`@`@(`0`@`9 (`0K?`?4## ` @㿘#X#\@#883`@V`(`0`#X ` p88`g`0> 0bH> > !(`Ȳ  @`` `@ `@ @@"` "`@`&#`> ,`Ѐ`> `> @!> b@@,,@``> `> > c@ސ!> b@@`?(c08`(@㿘#X#88`g`4Q(`> .0`> > c(Ƞ `<@@21` `@2@&#` %88`@ @4  `2 (`> 4 bH, , > @!> b@@9`@ `@y`Ơ@t`?(c08`(@ ?(c08`(Ȃ@㿘# P#?@[۔??@@֐@Z 㿘> 7cP#X#\ P>  @ ~’c(@cd  cd8`0@` @$ & & & & H```?`@(@ @k8 "}>        @`@?  (@ "ܢ@ B  ? <  ?3`   @ 2Ƣ@ 88`@`@4@ (`0````"1 `0````"Hp@? ?3`  0@ ?  (@ @X!  (`0````}e `@ `0```   @Ԗ(H` 84@'  㿘##X#\#`"#X@88`@`4 @8c8@4 @ @ (`0````" `0````c88P4@?8H8`@`4#X#\ 88`آ@ `(0@(`0```` | "#X`@`0```` #X#\88`@`X0  c@(`0```` | "@`@`0```` @`!h`4@88`@`x4@8c8p4@8c84@Z ##`2P@#X#\@8804 4 D@ (`0````e |m `@ `0```㿘#X#\88`dc0`?`@5@|M#`?`@5@#X#\88`@`X0  c@(`0```` |, "#X`@`0```` #X#\@ 88`ذ@ `(0@(`0```` | @``0```` {#`?`@5@㿘#X6##\88`g`4`H# yd@)> @!H#"/> > @ ``??c4#X88`be0`#X#\(88`fa1 0c܀ '1> @!`@!X.# 4>@bx`&##&@?8  4y "D>`&"D>b&!>a&!&!? @" P6 &"4@& P@ǐ#X#88`g` 0>>@0#>b>&#L>`&#P&#T(`h0`#`_> #X  88`fa0#X #\&#@8؃8`@`(0@(`0```` {+ "#X@``0```` #X#\@88`@`X0  c(`0```` {@``0```` @!#(0``"#D```#}#X#\@880#2.#X  4.#>@ޒbx`61##?&@8?(c0(8&`?(c08`(@W0Ւ???@X #<`@k K#X 8, @(c2   (c# " @A @T "4#X㿘#\#X ` (`0```` zk @``0````  `"XX88`g`04`@88`a4` "@X\@ 880c,@   ``(ׂ`X\ 88`ؠ@ `(0(`0```` z "X``0```` X\88`@`X0  c(`0```` y "X``0```` X 88`fa0` `  @`a? &@85`8@`x`5@`p`5@`?h`5 `  P@88`@` 5@8c8H5`@{4@`88`g`4`@7@4@4`1"@X\@880@ ?&@8?(c0(8` (@`@&X` ?c4`X@?(`0``@(8``ς@@`8(`㿘Ho&(@gHp@㿘 >  @Sa 膀@< 㿘#X#\c#`` `@#`(@ 0 #@`c> #`e8%&#&##`` `@"# @> @88`@`H4  6  @> #``&#㿘#X#\@881 @  #X#\(88`fa1 0   g  ?(c08`(چ@X㿘#X#\`w P#`` (`0`) ?c+0>`` (`0`22? ".   @ > В@ڔ  @ƈ `#`` (`0``@(8`@Ӓ ؠ`@> 88`@`@4`  @(`0````" `0```#`` ?(c08`(@ (`0```` w`@ `0```㿘 \#Xd@`@S#\??c!`5?"`"<!@yȒ   `"}>   `$9 "@`> @y @  #`` 8(`0`` ``R"`ʐ!` (@a ń( ` (`0`@* ?7"`Ȑ@yo `%`&##<0`@8`@@7 D @ H`#``?(Ҡ4?4 #` o  m0 $   @,@ / 2  ,`@Hp@ @>  b#`` (`0``@(8`@8(`0``[ 7 "&""",@  ǀ    0 4 ,@  2  ؄,0!` (@ W(0!` (@`@("@ 0"@ %"@ ƀ `(`0``@(8`@` (`0``@(8`@,0``@(8`*@<08(0(`8`` $`!&! ` " !&!? #8@5` \d6 \@1!  #?8?c(0(8㿘#\#X`? Pc +`!h4@0@(0` $7@4@      % {4  Ű mဌ @(`0``@8`(@(0` ̀(`0``@(8`ł@㿘Hof4 (@g a"3 \80a "9 \@Ȓ P 4" \Hp@a50 a6 @# 4 \`@$ Hp@A`@#`"  `6 \`  P@ I Hp@2 \ 6 \lި \4p(Dl0x88888@,Lhpx      4 , $    lXPH@ll80llllll(`` `@?΂` d 1*`?0``@(8`@10`` `@?̂` h 1*`?0``@(8`@10` `ഀ*` (`0``ഀ*` ?(c08`(@ 2 {`2  Ȇ@:  @: 㿐 ` @* 2  @ av`N?`(@8`@E  ` `?dശ`  Юิ+<d25@&@@?Ȃ`p@7(`0`@87(0`$@ߠ  ```  > Ё` ` `@(8`@7͆@?Ȅp(`0``@(8`@ ?(c ; c̘. +  t 㻐 ` &`&`3&` &``(0`8=C"77 `@ ?`(@8`@ ``&`(`X=C &` =D&`7" 7`@ ņ ?`(@8`@`"` `` ``&` `  ``&``&```&`㿘`6` 6` `@ "` "`㿘!  - ` 0 > @  )  `@?`@(0`` (?8 @6``  &`6``2&` &` `@?`@?(c08`(ф@` 2@ (>`  2@##`(?@8`@2` 8(2`  2@c?c( 82`  2@c?c( 82`  . ..archP catdatePchmodPchgrpP cpP ddP dfP edPexprPhostnameC ksh shP lnP lsPmkdirP mtPejectP mvP pax tarcpioP rmPsha256PsleepPsttyP|syncP ... . ..chownPdmesgPfsckPfsck_ffsCifconfigCinitPmknodPmountP mount_cd9660̜ mount_udf mount_ffs mount_nfsnewfsP mount_mfspingPping6PrebootPhaltProutePrtsolPumountPsysctlP disklabeldhclientC@dhclient-script . .. tmp dbP runemptyPhashPtzlist . .. tmp ... ... PPL < @ PLuSdP  PLP@@<@T UPevPp PeAPMYvP IP IUAPMPMPM \lPAPM#BP2HP2H APM hP!rP!r -CPM hP1>+P1>+ {!DAPMPMPM tAPMPMPM(P!rPe5pPe5pPX`hpD )P1>+P1>+P1>+/tmpPrDP2HPY PT@rPdtF/;^8&bN&LQx\2#o5-Л'd0"E(zv<TS+'ET5Ӂ P?ņQ hjX%H xgt͹fđrIbd3K-*p{YVNk]XzXKA@!qoldR|1 r 3rMshyXE)@'=g` g#Pgv~ #Cd6pw ;DbEFř=5.H]H+QQyEқ{֜3 qZ#܄A!:/GiJJvv/@FT/O3x:zZxl}:~TFpb1J0Bw #oԒR&>XJ+g kq\6>5{)蛠!'TR!b0-ڪ[ud(x(Rd>;SwYa [_Lo Eic{V<Ehc t<J@3n< '> )KDR.3 65+Z |bq#AEv7FS۫ S}\p[r)1 jZU_o`&eTn 7ыF([  4P k%\Rp 8' AO$;ϪT]mRqe9)ennjVY:#WaaL-i7`< ))U- N*a;2G9i{13p75ۿwl}WD_?sdAY8YygvZ0|g3V&5&8AgTtb5_iA sma$|{7:wT,&Ύ?2O4͒DwTE%c'CS~5OiP~qc1:6poj(s 3Je:}-QLxbHU\l*.]Y5i0@ß6`֡Q(` ޠ =>B}wu_qAAq0l)`PcЇ`Ph1 TCJ5DkrI2xv': ؞ f;I?c㷓k=7 c,wzAA\b<kMI}b2+!+&g J/3aPI+0fY h b<ΒkRwz< ~gѵa`nnα|sHEV5&o(Ii((,_}T0 QcY3wW7_@I`1ОaZk*GaAfrica/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete route -q $rdomain delete "$old_ip_address" 127.0.0.1 fi } ip6_delete_old_address() { if [ -n "$old_ip6_address" ]; then ifconfig $interface inet6 $old_ip6_address delete fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address route -q $rdomain add $new_ip_address 127.0.0.1 } ip6_add_new_address() { ifconfig $interface \ inet6 $new_ip6_address \ prefixlen $new_ip6_prefixlen } delete_old_routes() { route -q $rdomain -n flush -inet -iface $interface arp -dan } add_new_routes() { route -q $rdomain -n flush -inet -iface $interface for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route -q $rdomain add default -iface $router else route -q $rdomain add default $router fi break done } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } ip6_add_new_resolv_conf() { rm -f /etc/resolv.conf.std6 if [ -n "$new_dhcp6_domain_search" ]; then echo "search $new_dhcp6_domain_search" >>/etc/resolv.conf.std6 fi if [ -n "$new_dhcp6_name_servers" ]; then for nameserver in $new_dhcp6_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std6 done fi if [ -f /etc/resolv.conf.std6 ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std6 fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std6 > /etc/resolv.conf rm -f /etc/resolv.conf.std6 chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ;; PREINIT) ;; PREINIT6) ;; ARPSEND) exit 1 ;; ARPCHECK) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi add_new_resolv_conf ;; BOUND6|RENEW6|REBIND6) if [ -n "$old_ip6_address" ]; then if [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_delete_old_address fi fi if [ "$reason" = BOUND6 ] || [ -z "$old_ip6_address" ] || [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_add_new_address fi ip6_add_new_resolv_conf ;; EXPIRE|FAIL) if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; EXPIRE6|RELEASE6|STOP6) if [ -n "$old_ip6_address" ]; then ip6_delete_old_address fi ;; TIMEOUT) add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete delete_old_routes exit 1 ;; esac exit 0  2@c?c( 82`  2@c?c( 82`  2@c?`) @8`@c2`c`(@8`@2`  8(2`  2@##`(?@8`@2` 8(2`  2@c?c( 82`  2@#ۈ#㿘`` (`>   ` *`2``8*`@2`  c6`   c6`  `?`(@8`@ۆ   c6` ӆ   c6` ˆ   c6` Æ ``?) c c8 c6 6+ 8c 6 `` #(?#c86  2`  66666666666` }   c6` u ` #(?#c86 `` ) c?c86 c+ 8 6 `R㿘  * n 㿘`@`8  `a8 @ *`( cT   ? @(`8`0` ` 1 >@   `  cT>  @v!H`` @&`  c6o` (&㿘` !  0 <&`>`0&`@K  @?c  D`,``  ``@(8`@@ mb&` ```  㿘 b   `"4 4 ?c"q  FD J 4 ``8 (`>ق 4 ``(` `  + 0   *08  `@`@r> x  4 `4 `4 `4 `4 `4 `44 *02 㿘` ( `. @`5`` `  `% < @@]   @44 .>4 `׈ @ۈ!Θ ̘ ʘ Ș `2Ϙ ͈"`"Lj$ň(H `'=  '7'7@> cL ?c (8cL @ @  2m   `& `'=  '7'7@`?(c@ 8`@ (` *79  ) )  @ @(` @( (*; (` @@ 77 V&  > > c!  --00`#`#\#@ ؊##d@ l@ ؄ d d#h@ f,#l-`44 > @! > `& `'= '7'7@ `+ *(?c 89  @;` s@ vb> ƒ  &@=$ 77@ 2Oʀ`@$Ò`.2Oπ`-2OҀ`2OOÖ́ ?`OOІ+ &+  (** @ @ (`) *()  *)  &> fa`&   > @!x㿘@Q!   @}Ւ  ` ` *` 2`  6 {6 㿘 `@ ``&ϐ㿘`?` "``"&`9`-`+ z``8`〠dc``@(8`@29 `8& "`5`` "`F`` `Ec`(`1>#ʹ`֑@"`U`%`Cn`. `  `c(@  8`@6""H `ۂ`c`(8`6 Y`"K` ``8.`ʁu`c`(8`6 `*܂c`(8`6 `c(8`6 `c(8 `4& c(8`6 `c(8`6 c(8`6 ` ` `kY@#8 kT `c(8`6 ``c8.Hc(8`6 `c(8 `0& c(`1 > `@c(8`6  D`@ k `c(`1>#`͑@`c(8 `<&  >  @|! `8& 㻐` ``  `@ Dja ?c `,@` i i, 0``@(8`@4`  #<5@` 5` `@ MP G ` 7(<0?c) 78` 7 `@ +. %< ` (07  7 `@    ` `@p> c<' 4 `? W> @``'///'''2  * @@`? c( <  j ` ޔ @`@@ 8@@ @@4  4 4 2  `"? #\> ?@"0@~#x> ! #c<' e#`& cb(  >??cZ <'0@//'* ''0/@`? c( <  i ޔ`  @.`.`.@`(`.`@8@"4`,, 4`, 4`, @  > @#Ԃ`&&&@}#(P( \dB a"> ޲`!Ⱥ`(@m  @퍔 D(7<@I 26  \a1`@"`2ݐ!` ؀2؁@@0"@ Ĥ(`@ a$!&! =; `57!b݀3?c(87`2  `02>  #c8@!  `  D`  .o Dh” ```   0̂8’̐ h  hh ?77#7`7 n7#`@7’c< h cB h  c8@<` ?c(08`(@! 7 `  D`  < D @K @ \ 6 Z6 \ `!  @ #> @ѐ"8`7‚(7h2  Ґh-  `0@  #c8@ݖ?c! ( 87`  D`? D D a@" D`7‚( 7g8Ҕ g C 㻐!#c & ``  `!#@p &c > @["!#@o&`"=77 2 `2 > 'b@  #* @x0  d@ < 17cF7"耢 K  ,, @ ` @뻐  g `  @먐   bc6 "耠` ` @릔 d,@` `7@ `@ 㿘6 8k >  @ѐ"   `(```U1  `,```La1 b ?ഢc50``?  io ``(`0``@(8`@@`?   <  .`?0``@(8`@.?0``@(8`@㿘 `   @   >  @A#ab ?തc@?Ђ``@0` i??^@`@?Є`(`0`@0` ` J`:@?ނ`D@(0& `88@?̄`h0@   6  6`@8`$    @?ʄl0  2  @?ނ`D@?(c08`(‚@ d`?`(@8`;@?7 <(`"`  !7 <77</"('#$㿐 `` `*2 ! @ +`  8 $  `@?Ȃ`p@ (0@D  @?Ȃ`p@ (0`"6`  6@ `) @?ȅ0`p `0`?t `?`"`  ీD"` j*2 ` 4`4@ ?`(@8`@`h@.`@?0`@`8(`4` `? Lీf``ΰ <# 77Z<# `@?Ȃ`p@ ?(c08`(m@@?Ȃ`p@ ?(c08`(l@` ` @ $6` ` 4@!4` <( 77<((`>4` #+'%&"!㿘 `#``##?(f\ (@fW㿘>  @o! `@ @> 㿐 `6  #` @     cf*??2 > @C#@  `&?%c <77(7`ߠ  P! ?   D@Ð ̐cw !  ((0(7?c877   D`` <@!    > @ܐ#Xz 㿘??ദcฐ#8(`0`` e??" @#(`0``@(8`@8(`0``逤  `@?`3@ `@@?ഀ  1  `@@?ഀ t 1 ```1ab ?തc @?Ђ``@   e;??"0 @  @?Є` (`0`@8`` 逡 W@?`@ (08@?8`̂ph p0     `J > @"# < `> > @#x <.`?0``@(8`@/ ?0``@(8`@.?0``@(8`k@.?0``@(8`P@@?`@ ?(c08`(@Ȃ ``  D `?c(0(8 8```, D(`0 D Fh `  @ $`$`  t @ڔ ` c@/`  D  @> c`2  @w    @(``-``$`$` 0?c8 ?c(88 fc`(`0@ $`$`  `@ . M  `0@  > €`@`8"``2t t@ "m t > @ 0%0`` ``C`  , <(`0 <@ >> @ɐ#0  <; <@֒ ?`@(8`@' $`$` a a  a  ```  @ D "  @@U> > @ 0Є`0`(@> `0`* @ > @x @0` D``< <  <@+ `" > @_  $`$` @ '@y` h   `>  @? @   @ @??㿘 `ച   @?΂`d0@ ?@?̂`h0@  ` ฀@?΂`d0@x  @?Ђ``@ @?h`?cp0 *0`   $   `@?ނ`D@(08 8@?`Ȇ̆h0@ t E  `88@?̂ch 0  `@@?ഄ΀ ?dc  0"`  0 @?Ђ``@ ?(c08`(@ `88@?̄`h0@  `88@?̄`h0@ g 헐 ` ?88@? ̆h0 y o `88@?̄`h0@ <  `@?ނ`D@?(c08`(=@FI p> c<@'  #``؂!&&< 77@֨   > @! @ P#8_L@> @ؐ!H  `_@ ?& 0`6 `$"$&!` `&!`(&%&!Ȇ  &"$> ! #> aX# > c!   > ap`6` `6)+6`6)`6` 86`` d&6 `6`6`66`<67 7 @ W` 6``^`|`o `=O 77 2`,䀠``,!  @nX  @  T `=Ƃ 77 ` ?`(@8`@```T6 ` `  6 H#?c ``(8`6 ``@c2&# & ` ` `d2a& `Є& aj h& cx&`6#` > >@ԍD  @x ! @s ``ΐ`Őa`` ` `l `M @n 0@ "." ( ( ( ( @(> @ `> &@ax ` .!@0 `T6`&&` ` @& :_e `& ec `& !&   @ ! @ ```a  @    @! @ %`z`am  @א! @Җ %``aNe  @Կ! @Ժ `p`ga2M" @Ԫ C`( @Ԥ 9$ @Ԟ 0` ` b&  & ac `& $r& ؂'&" @| " @v " @o $ @h " @b i( @\ {( @V Z$ @P Q( @J $ @D ( @> u$ @8 l> @q7#@h>`0`Ho4(@g``K @> a!@fp @J J%!Ђ@%0a뀦@F 0؀@"8cኀ@ 8҂a@p5@5 0@*   4"\@1 `@1 (@d%Hp@ Hp@@>T @P>0Ҁ@ـ@>`0`@9w V "YŰ  @ 0怦@瀦@\` # `2@/$=A"2 2 `@  ?`(@8`@` (H   @H>|  a@tꀦ@m>`0`@9$ " i   chm( @ 4@?% 7҆`0`@8  Ґ @ւ@\`߆a@a@`@  `@\(8`԰ %a逦@0aր@0 a6@є  @' Ͱ>`0`@8} \ $ @.Δ "=22  ` `@ 2' `   >&(` @@ `{?'̸c  |'Ȁ` |@  |@{  ,``-``-` -``-`-` ,`,,,,,@ `4`@(@8`@4`> ,`S8,`R  (` :,`[  (`84`\ `(@8`@4`^ <     7 n` `,`t,`B 2`  @`(C,`B`2`@,`x@  2 ,`x̐ Y | +@&(` @@"|@ 'Ȃr'̒    @.$=B"2 2 `@ 2f  . (  ( ( ( (  @-$="2 2 `@ 2C ?`(@ 8`@6>`0`@7j I   @- ! !Y  4@ (# X  + 6h   @-$"`0`@6  `   @-$<2 ?c(82 I  \` ဤ`@ ـ>`0`@6 d \`Ұ 2 `C  @,̐$ <22  c2 2  `@  cc%>@hג`#> 'b@ į `* * @jb*#* @ !>  @bÔ`0`@63    @,$W$ o (`3`8l ?(`-1 ; a7"8 X  `@ 2H 쨒 B \`A`<`0`@5 Ȧ 麐 +\`5\` `@ )`@0(D+\`@ @w0 0 !W}    <!777 `@\`~ @- 〦 4 @+ P    <777Ԡ# *!tXr  4  2 #Ӣ`7 Ғ  &@ܤ< 7Ԡ ?4  7 (`7 XP `\`"`@`〠3ሀఀ~ @5;   @q D0 ` <  @  `^ # *atW 4 `8`(`8 44% 1 ?-1 ?`%q1 ?`C1 ?` `"۠` ) ܀*Cւ ҅1 4?c(84 4`@ (`4   TW +4〠  `  @۴ 퀧`) `K `@ Ӱ܄`(@ 8`@5` u  ĺ `1   `@~1   `o1   Ⱥ  @ DWIN`G   ` <  @ 㿘 8   `7 @?p` 6 㿘 ` '`7 ?x`Vതฮ4﷖ 6 @?  `l@1@@?ʀl0@@?`l0@ 6 R@4@?ʄl (02@?ʂ`l@ (bx0 4@?ʄl ?(`#0``@ (8`@(`8`@@?ʂ`l@ ?(0"x(`8(8 Ւ5 6 " 㿘  < @h< dHo&(@ `   <@Hp@   g 1> @ۑ!`#``'Ho(@ `@i` < 7ą(7!?#87 Đ@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą< 77@`@`(`7ġ< < 77h!`@2 ``3`'ȃ('Ć7Ȅ<07Đ7'''''''7U`  (`x  'ȃ('7Ȅ<077Ɛ '̐''''''U\7 `@# ``?c<7Ɖ)  87Ą7`@#'ȃ('7Ȅ<077Ɛ#'̐''''''U$7`"H <77 #8  UU ```  a2! ` 77Ą<7@`< K `#`   `*`2`` &: |> `& &: 2k> ``̀_&!`@ Hp@  `@{ 6 @fx <g `@n"0j0(`7Ă<-77`"` @#  !#8@ז?4`SJ 8`  SE`SA .?0c(84`ﬕ 㿘` !e "   `2  `@ߐ1> @ H> 'c<'P' 1`'P<#@@/'P v ! /ؐ k  `/c1c `2c ^>   ''PP C ! 6/0 > @K X0@{`> @D 0΂c@˔ 2 ` !ܐ "= `8, :, < 7   2 , :"- <``" <`` `2  , :, <@f!h , : , < < , :܈ , < 0 <`, ; , :`- ?0c(8m `Tb   !#8@ֆ`6'`R8 #8` R3 `R/  (?c 8`@0 '0'0`'? /耈? (? (? ( k o &0> @     `,,`(`0?c8`(@` 4 6 > ` * `0  `*>  @Z  Ԓ *`> @R!ԅ,`2 `   4 `" > @A!X   4 c@cq    > `א! U*㿘 `@[> @$!  !#8@ϐ 4`Q 8`  Q~`Qz .?0c(84` 㿘 D```  @$Ȣ T  q@ % * Ѓ9 (`@@  0 '"  9 (`@@  0  (@ @0%?`5 4@* % @ @$@`%   & @& @  $@ Q  >ېcd@`@@bِ'L'P `'P'L 'P'L+` ?(c` 9 8 zLPx ݖZ P`   P ؒ ! ! " c@b.0``"i` `̴-  !#8@?6P #8  P P'L ?( 8`@6L 'L(`0`@`8(`1 L`'L0L $`'L  ``&@7`> @!ȁ@/> @!LPx ݖژ P` ! `\- - `" > @ِ"  ," `T> Ho&(@gHp@ ]  дa`ʒ -0``2`` . @"/``@"/ "@ /8``2  ` 6 > @y"h @u"(0@  @=$$  2@  ` x|> @]"H}  @#) &@  `@$6 &@ j 㿘 `1 !$@ @"`@ !"&@6@&@ !@ @# x#@&@3>@_`> @"ڐ㿘 4 ?ςc @`<  ("Є  (@(0"!    ? @ & &  @ @&  & @$a @$^  @$@!$@㿘` !z " `@1> @Ñ"㿘 `_ ! "`96Ho5(@#@`T! >  c( @$ @$ `@`@  `" @@ @` & &Hp@gʐ#> : a Dy QK 2   Hp@0>  @Z#! 㿘`?`(@8`@!@2 ` `@  #<` `"@l > @5#x@@b`> @*#H@ `#:2 `#82 Ho' (@a' ` "  ` `UΔ Hp@@`( `?c(84 8Hp@``;` G""6<" 8`@C> b"< @> <&(`@aԀ"2 a (`@ a" d"&"`?@ݐ> @# 沖 @:  b6`@Y&"倠 !@ 0ހ<>  c<' >`0@` ' 0aՀ@@@8aׄaӀ@FaҀ@">  @d# k@ 0aր@2> &HofS(@@ e `{a ` |xc8`& T`|@ O @ߔ | c8' @77777 7 47 8/˃0`/ 6/7 :``  // :` ```/ ( :` ```/ ( :`" ``/ ( L  | "Hp@0{h L  t@'hHo4@(@g@ 'p`$   H p`@  M  4l7N  7P 67T 8 7R :K/V "Hp@ 6K̔ 0@* +tK  %t@@4@@) X K Ho&(@g }ЃHp@ @t'tK X K Hof(@g    7` 47^ 67d 87b :Kg/fHp@0@) X KP Ho(@g "  ``2Hp@0g@> @`!x 0 @ Hp@{ ݐ`2 @@^  Hp@0k㿘 Hof4(@g"3     @ ??& &6  `& `! !!#& ` > 'bВ #@ q@]YHp@! a!㿘@`. Ho (@  ``2"Hp@ a  2`0@]``;> a@.Hp@ 㿘 `;` `! Ho (@?c(<08`WĀ`M``a` Hp@@a`?c(<08`5`,? `c( @> :` @@` l`(*`> @ `0```P"d> 0`` ";> B`0`"Q> `2/> > @ 8``002` `(`2`> @  @Ғ ` `0-0```5`"/> > @ s`@ Ho`> @ j`(`@2> > @ ha` `2> > @ X`@ (T`> @ O`@ xK`@ G`> @ B`> @ X=`㿘Ho (@g ! 2 .> ?c> a 0#8 !`3j $  @ ?$$  @4 $  &? a  @e Hp@  0`ф$ `8   =4      @ $? @$ 4 $  @@\F&?"? `7   `*4   &@%@  4  & #@[Hp@?@@̐ǒ㿘# @ #D#dd# >a\ #D#dd# >(`D #D #dd#@ >(`D 㿘 \a86`6`6`6@"` `:`   @-  @2 (2   (@@`"0` @    \?6 \4456@6 \?`4`4`56@ \}6 \㿐 @{  < `$`` 0$`$`2' ` @   * 쀦` $` #@$&@  @⃖(```` (@ '`$`㿘e @>  "   t@ > @{S  0@ 㿐#X> > a> a #l", @ O`0`@"/````?`- @> "?:/77 #P #l" , @ O`&#X` @ @ #t, , "@@"@㿘 < @g `;  #@@@X@ 2 `; < @#@ <㿐 \d@`@Oc`> a!cpb,@ O`&a \"`;@M   "3$c` D "cx@z cx, , "@@? /6 Z7 07b c @ HcTcd$cd`   \d6 \$c`!` ؀  "$c`؀  (`@ a$ !&!"@ d6 \cd@c`" ah a"7?7""""""(`(@ ( 777* 0#l#H#P@�`7&#d&#`I&#\#p?#T(` 0@7I7#h"?* Ƞ 7ޟ#P`$#T  #H#t#l@"07/:?, /77 #P @f#T`  #H#x#p@"0/0, 7/77 #T @f㿘# @ JD d#`"#@@#@# @u##H#h , 2#4  @J' d#  ab" # # @ !"?# @ !> # !B 6 `@{ 06 #`@ @"#㿘Ho&(@gHp@㿘Hof4 (@g a"* \80a "3 \@˒ 0 4"A \Hp@a50 a6# `  @#$倢 4`A`@)W Hp@`6 \`E 0@e Hp@`@  Ґ \ 6 \㿘 >  @a @< s㿐#d`g#\> > bhX> b8'0) 3+) `y0`@j@nh @#@@ d Ѓ) 0`@> ЀdIc #d@> #T &#d` `* #p",  O` {@6  І@>  #d@> #T &#d` `ڠ &#\ 0#d`"6 "  І@> А@  І@> @@h@㿘# @ * 4  c ?@ c  @!  6$ " J"`> @Đ"`@ <``Ȇ@<`Ȁ(`@<`(Ӏ `> @" `> @"`Ȑ@ <`ȁ㿘ɐ `  E"$>`&"$>߂a &!&!>?`H"&%b6  0&!> & 0 @&!@#L@$ &#L  &#P&#T@"> @a##P> @\##P#T) ) (`  @) &#t#@&#h &#l&#p&#x@ @@@@2>   &#P&#T@@  > @"&#P&#T @&#T&#P &#P&#T  &#P&#T \ "*@*` 0*` *`; *` ` *@ 0  +@` 3@ `3@`㿐$ #@$#` #\Κ?c(86㿐#.0`@#@#D$$$ $@ ,`#`4 #\#&,`0`@ (`0`#`#\@@㿘 "\.@ @.`.` 0.` .`?`.`  .@`` . @`@  c0Gi @`@0 6  6 0h> $#ȸc<' &# #D#@$ GD#!,G@# !#,G; `'`!  &#Ȱ c>  (`` " ,0G  d  d  @(``?,@ ,  H,, @, 7> .X#`z#\А#\#`X@ȵ  ?,@&#Ȃ I,,?, X#\V#`#\#`X@Ȓ ? ,@&#@X#Hx> $c<@' #@#D$]$ "L$ >  @Ӑ#h@ >   $ &$ ?<.#.# I`? @.#>c(>&#$>b&#&#> &# cP`&#`)&#"D  ?,#B>@ >  @#0  &$ .#?  4 @` .#& 4 &$?`$#`#\ W `? @E@ ?``(b?,#Đ>`&# ",  ,#`#\$/"?@W#X㿐#D$ "`( @(( > ( (>(  (n /`L/ ` ">@`  `  /2 `  > @̐# "  / `3` `2`  / @> @`2` `"4/24` @`@ c0   E  @`@" > @ܒc@/`"4` `" @ `*@`2` 4@o##D` #D `@($`"#0#D0``($ ` >  ` > `>+` $ ` > ` > `>+`> ` #㿘#@" 㿘@"##,&`#0&`#?> `?㿘$` #D  (E0#D  (E*  2#D#D(`㿘#@"c㿘> 8`&#>>\`, &#<#>>@֖,͐???@" #$`@͓  " @ @Ɠ "$`$(`   > >+` `<  > >+``<> ` #> c,#㿘#@" 㿘@"6##,&`#0&`#?> `?㿘> 8b&#>>xb#&#< >>@t,???@" #$`@m  " @R @f "ttttttttttt#P#\ c"  @#@>`88 D#@?`88 H#@0`@ P88#@<@` a  T#@>@`88 X#@?`88 \#@<` `88#@`"  ``d#@ " "(`@c !0#@ #@ #@ #@?`@ 88#@`00b  #@ဂ88`@ @#@ #@ #@ #@ #@ #@  c"!#@!#@!#@! #@!#@!#@!#@!#@! #@!$#@!(#@ #@#l#p'@`O+ #``&@ " " "(`@`#@&+ " " "(`@`#@ " "(`@`#@ "(`@(`c(`~@ "(`@?(`@(`@`#@ "(?(c(ӄ "(?(c(3 ??c  0(`@@@#\$` #P`#\b"#h` #b ?0(c ?(`0@@@  "#h` ? @03`(?c @(`@@@#`#\#P* >0$` `  $`$`$ ?0(c ?(`0@@@ 㿀'D \d@`@: #(`@c1D!'`OD@D  #T#  /`@c @ `"%`, `D"`u!@DÒ @حD @9 @  #T @  D`,c @cpD`@D 'DD @r #T ``( @ `,`Ɔ ' 0?? @   @ ?? @  `(*`  ?+  @ 3` 2*@   ? `,- 54   *@+`@ 4@ @4@5`5 @  @@/`8`4  c     `,@g #l `B??    ??   ?3`? *)  + @ ? 0 * 45  +`   ((@, 2`2    4`4 @ >#T `# @ `,`d ` @'#l `#K 0 # c'  ((`@ c #P#\@D! c'D c0Z(`D`D`9 Da؀ D!` ,"D؄ ' D(`@ H a `D ??@@ /`0`(7`@ x@ 'D! ` #"؀  D(`@  a" Dt #T D\d0\ a!@ 0c a㿘6`@), @c #T `c @`(#Tc@@c$c @> $` @&cc& {6 "6  0 㿘% c` #T  ` @`(#T @@ִ$ 2&&&X#P@`)#\`4 DŽ}6 "`, 6 a@` +`3`??c @ @0(`@@@%@`4 ?0(c ?0(` @@΄@  @``@2 @"耢   @ 2 (2  8 (@@ ?` ?#@  @`@`60 ((` @0@@ 㿘@"#(&`#$&`㿘# ` # @ s 0 @q"㿘#\#P`0 $@!##(@@ @?&`?$#(@ `@?` a`@`+`3`??c @ @0(`@@@`<$+`3`??c @ @0(`@@њ@㿘 ?c!?@ d@@?Բ#P@0((`@0@@  㿘`#P8#\ I$K - `   $`&@$ ` `(#$`@8?@` $88 T&@ 8?8`@&@$  6?.?(0`τ `ǘ  $ #P`#\`0@@ @0 >b  0@ ?0(?0(`@ @@ `(@@0`(1 @  @0 >b #P`#\`4@@ @4 >b  4@ ?0(?0(`@ @@ `(@@0`(1 @  @4 >b 㿘#P#\.`.`?@c@b @$ # c #? 3@@d"# >Ր `0((`@0@@@.`6`c?@@(0`Բ1> @|ӑ X㿘#P#\@.``.@@b ( ? c%? 3@d  > @`0((`@0@@?c6`?@0`ֲ@>  @| p㿘@> >   @| 㿘" b`@h h d@  @>  >  @|g  `@ ` ` a>  >   㿘#\#P#` $ ? > >#@8?8`&    ) `>  @|&!@`@|!! 㿘#\#P#`$    > =#8?8`&     `>  @{!`@{!`㿘#P#`Ho&(@g@8?@8`@@$  ʘ  > @{Ȑ!Hp@㿘 0  (@ 7 (" ".`@$T `@! 2ؖT ` ``(@ l cq` `0.`@8@l"LL *     ? c +`  ?( 0@ *`  @ ?,  3` ( 4` + ?@  (0@+` 4   ?? 0 @@ 23 @ @ @  @  @ 8@T `@㠖 @  㰆`$ $`?`0? ` @ (3`  @  *   +  @ * ?( @0 ` (2`?@  (0+`2   ? @?0 @ 3 4      .`@8@l2WLL (       > @zʐ!> @{!㿘 cc`{ "㿘  c ) @    $ #T ` #@  c  ) @    @  `İ 㿐 㸀`#P'#\ 0'3# ?@?  @   @??  @ `(2*`  ?+  @ 3` -  ` *4@ , @ 4? 54  *@+`@ 5`@ @5 @  @@   Z! #T ` ``(@ #T @`@'@ S&   `$  (`C ? $ 0@$ $  D @kb @ `!#T. 㰡.@#  #l`2o  c  @  "#T! #&@`# a  @@ф?  ?0(?c0(`@@@  a 㿘@JK#8 \6 Z{`&6 \#c` #T  `c@`(#Tc@@Mc&c`@2ccc$c$$s@ܐ"Z%#㿘#P#\Ho (@g uא `@p` ` $@#`0`$@  $@#`0`$@#7`?7c$`@>`88`$$@ ??c` `($@$@$#p`` $@$@| `$@ c9 ) 0880`( @8`` $@`a"$@@`4@@# ``"@`c ca#8$@@I  \`@{6 \Hp@  (0?c?(` @1 @@ ` $@Q# ?`0?0(c0(`@@@ `$@F  (0?c?(` @1 @@ $@8# ?`0?c0(0(`@@+@ c ?0(?c0(`@@@ +`3`??c @ @0(`@@x@`4@ ?0(c ?0(`@@@ d@ c) 80`@8`9 ?08( ?0(0`(3 ?0(?c0(`@@@ 0?c((` ?@0@@ 㿘 > @y a @> |㿘 #P`@#\``` @@a4@@@ ; ccT 0`` @@a45?@) 1 ?  (`1 @@@/ 7 66`/`(7 .@@ǂ@ 㿘#P`[#\` ?E O`@F ? 08  `a`@`I %`E`@` @> `V` @ c&\`@ ccܐ&@He!ʐȦ` ?0(c ?(`0@@@  0 `@ ?0(?c(`0@@@ `@ ?0(?c(`0@@@ ` @ ?0(?c0(`@@@ `@ ?0(?c0(`@@@ 㿘  0 D#c` #T @ c@` #T @$#T# @"#T @##T  0c#T# (@#??@A@?@;@㿐&`0#T>  $a##`##\   "#T 1> @v"# , c  "#T > @v"8cTc (@# #\    U#T # @  c `> @v^"cT @ccT  0c@cTc (@3 @cT. @`(#\ (  @> `@v2" c@@` cT @$@cT @ccT > @v"hcT ' cT. @c(#\ (   "$#`>  #@u5@c` cT @2@@b> @u#HcP@c\ @( cԒ`&@ @``b$>`&b$?`"6`>c&a&a>#`0(  |&a&b@&`0 >cT&a&c,>>Dat&c&c4&c0b >>(@Wcp`$c\`P chb"ccP`&chc\`„ b#cp` ??@N c`">ch@4 c20` `" ct ``` ct`&ct@{@c8>c@DX1 #@3>@DSbc\a  ?(0?c(`0@@@ m(`".cpcP&chc\` ? @03`(?c @(`@@@b#cp` `Q`O???@ c`cp`7 $cPc\@?` P88# cPc\@?@` T88#@ cPc\@@8?8` >#@aX>(&c,&c0???@ c`` ! @y @ !Yc 3`?+`? @ @(0`5㿘#P 0@_#\aka  waa@@C @;B ;@aa a$a(@ @D ;%%@'@%%$" @Hof(@g@"Hp@ @E#8a ?0(c ? (`@0@@ a  ?0(c ?0(` @@@ a ?0(c ? (`@0@@ a ?0(c ? (`@0@@ @@C @;B ;@ua ?0(c ? (`@0@i@ a  ?0(c ? (`@0@]@ a$ ?0(c ? (`@0@Q@ a( ?(0c ?(`0@@@ D 㿘Hof4 (@g a"3 \80a "= \@ 0 4" \Hp@a50 a6 @" 4 \`@ Hp@``@& Hp@``@6 \`2  0@QMܐ "ڐ  Ր ͐ TXTTHT``㿘L?c??> 0g ""@-8! h>"0`@8` "' @' ` @`@0 ((` @0@@'` Ț@@ @ @ 0`0(΂㿘L?c??> 0g ""@-8! h>"0`@8` "'`'`  @`60 ((` @0@@'`  Ț@@ @ @ 0`0(΂㿘1?7?c?>`0@g ""@x'`h9 0`@8` "g  @@@@0`0(""@cD@+  " `?"( cD2@?0(c ?(`0@@@ 㿘"@"cD>@/  @ )?? c 7?/`' @``@?"`"`(0 (`0@@/`@' @`@?""@/` cD6@?0(c ?(`0@@@P` `T##`#@ (#(   @(`@ @`"@4" \0````") !&" f"*aU"Ujb "@B"&Uj@`?" # `   \ \ "? \(`@(`@0``ɂ` \ ?#(`?0(  0  0() 3   "?&c0((` ?@0@@ ""88`@`v \ # F""@P\\""@f"` `0```` "   """@s`\`\"""@S\\?c""@"@b"&"@s\\"""@\\ ?0(?0(`@ @@ `(@@(1 0`""@"?` `c00(`?`(0@@@0``\?0`@ (`?@(`1   0((3` `\ ?0(?0(`@ @@ @@0`(1 (`{u @s i0p\ ?#(`?0(  0  0() 3  "{" ?0(?0(`@ @@ `(@@(1 0`8"$@v"` \"@"@cL"&㿘#$#( `` c8$ #$      >  c8$ 㿘1#X$ @  #t`,! @ $ @ 7 7c, @c,^(z `c,``(`0, @@ `4@ 0@ 1 1 `` "`,"1 `&1 `,  @ , @ +c>ũ. (-z`0$ ``( @ $ c8  X .  , t$  c( `,@$& ˰㿐#` : `S (`Ȁ2B" fH" `@" L#``l""@pLL@"#@@ E""@yLL@ "' 2" #"@`"# fH"@`" fL'  !@@"! fH" fL#'˰ "@NLL"""@]HH""@mLLL ?(#?0(`@  0  0() 3  ~L?0`@ (`?@(`1    0(3`( uL ?#(`?0(  0  0() 3  "\H ?#(`?0(  0  0() 3  "uL ?(#?0(`  "`"` ##`0 "` ##`.`""@N"fl #"`5@``"`@``"``"``@"` ""`"@3"fh #"``"`"`@``"`@`` "`"` "` ?fl?(0c(`0@@@ ?fh?(0c(`0@@Ć@ 㿘" .##`" @" "@@0``` >  @n#`"@@0`` k@""`\<"@R > @m Д >  @m# ,# a@@@"""@DDb"""@gPP" #!` V""@  ""@  ۰  >  @m#<" ,# "<@(`@ ?#(`?0(@  0  0() 3  @ ?#(`?0(@  0  0() 3  P ?#(`?0(  0  0() 3  D?0`@ (`?@(`1   0(3`( e㿈# ''` ` > @m3#"`#"@!&"`$"``(`@#&@'``@(`@''' @?(`@(`ڂ@`` ?(?0(c(`0@@ӂ@ 㿈# ''` ` > @l#"`#"@!&"`$"``(`@#&X'``@(`@'''q @?(`@(`ڂ@`` ?(?0(c(`0@@ӂ@ 㿘$!#0&@ c@!c(*  `` #T `#P#@ `& #`&> @mA > @m> (> @m; `> @m8 㿈%X $ @  t`,! @ $ @ 7 7\, @c,W -c,`"''''0`'4777, @  `&"77+ `, @, ނ@)#>`7, @$ ``( @ #X, ,#t$ c(  `,@$ & դ㿐c< '!(`@c,)"`6@/  ! # `U 2m \"`1 @/ D @]Z (`@c,ۤ"c<4@""% 6 Z!`+ a؀ ʄ䀤!`  "" D؀``(`@( a"`!&! "@   @?0(c ?(`0@@@ d6 \ a㿘#(`@>  G/z t  c(X((@@` @> #,`"@#$$#,` ` `( #$`$ #(&$`&6 6˦` {6 㿈#( @@#>D#t c(+#X,  @, @ @> #,`"@ª#$$#,` ` `( #$`$ &$`#(&6 6ʠ {6 㿘c, '`" #(@u#$$ @$#(,`@@      `d 㿘 c,% "#(@Q$#(,`@@      `a 㿘 +,% `" #(@4#$$ @$#(,`@      `b 㿘#(z@`6 c,X #,`" #(@ @$#, `@$@&#(,@@    `cX  #$& @@  2 㿐 ""{6 ?`@88@!%'ؐVҐe=#( @#( #(@!?c>6㿐k''f }6 "`$"a 6 T'M'@&?"" ee @cL ""p` @& "耢  cL`  @h  3( $ &`"`""%?ec0((` ?@0@@@ e- 5 ??c  0(`@@@> @j& 㿈"ctc>&6c<6!%cX&:  @ """ &#$  #\( @       7#$ @ 7 p)> !#$' 8@ > #\#``$ܠ $@   >  7@i  !#$@ ! ,@$@@  !@  $> @h #$ (@ 7#$@  c,#\` $ @  "!>  @hː ! 8#$@ `0$@#$#$@ ֐` $ @  8TP0&&c0&@  `" &a' $$    @] 2"c0 &> @h!(#$  c,#$  c,!>  @hp!#$ 㿘  @ 7 4e 21 @@c:&&L@  c,.`@c(c(  c0@0#@ .` @ 1  1   0 1 `:4 $ >$ @` $ H$ P$ `$ \$ L$ $ $ D㿐 " #    7! 7`@""88`@ @!%$ cJ6 `'~ 㿐*'P:.` c(  @& &&c( P#(`0 .` 1 `1  P`40 1  #$P#\       ' >  @g!P#$ @P c(  @Β    & @h&#$P @   7P.` (@ ` 㿘 " "    7! 7"@88`@ @!%, cH6 㿐'P.>.` c( @(&& &@ P k,c(0.` @ `0`0` P40`0` P04xB #$P#\ ( (   7 >  @g'!P#$ @P c(  @@    @t(`(& &@Ғ c$P @  P 7@ 7> `@g!pP.` (@ `Ӑ 㿐8`  0c@cFcHcJ#("-# 8`0@g @(6 `A(``c(6  dS @K> #(ق# `"`"cF!%"`"cH!%,# `"`"cJ!%$@"N( (@@(6@`  ` W @> |#( 7"Z `>  $`$`  @> $` b`` 4`&4` t @W ?@""`$@vS `#((`a c(6, ,  d @> F#(`4`$ , 7`   7` ` @5   @> `D"!&# `2I"F'sG"cH?c((!%,# `2F"cJ'ZcF?(c("cJ?(c(!%$ @f{!(?c(`@㿐 " #   ;  7! 7`@""88`@ @!% cF6 `' 㿐"`x" #&\""@c> `'""@Y""#f"`A"  (`@#&'n# `+א 7P> -# `" c@6@'" 0  # #`@{6 x&#&#'"   ?(?0(c(`0@@@ "?(`@(`@ ?0(c ?(`0@@@ @e!h> #(c<@' x `` 0cB X>> a@> > a> >   a( ;@dϒ"``6"`( (#(1(@@0 *0 o`J`M`2@d0 `4.##@d3 @ /> ''''''''''͒耈@"  . @g@%> . @g& & . @da@d\@7 㿘"@9" @``` ?`8 @8#% `@G" e @  "`2 0 ? A # `ǐ-" e @2" "? @c0((` ?@0@@ ``0ɝ㿈# ` '`i > @c"H> b@@r 0` ?c ?`0 ((` @0@@$@  @` 2B``` `#\#`   > @cǐ"@; ` 2/#\`8```D ``<` ` `@`$ `0`4`(`,"`"` "!D@ > bx` #\#`   > @c"@ ` ?0(c ?(`0@@܂@ 㿘""@?`8@8!%" f"`2"c80``#& V8 #(`0 x d j#@3@ #(0 Ԃ@ ##(B " x f(#(6  t0 ! z 0 "g @2"" ,"c8  #(cD60 ``#@ #( 0 #@%  3@ 3@!` "  3@ #(0@  !c:1 1!` "  1 #(0@  #@ 3@#  3@! @ 3@! " 3@c8 #(08 Ă@ !1 Ȃ(1 #(0 ܂` #""?88`@@#`h#(z @n# `#(  @3@  @ 3@!   3@ "3@# jc8 0z@#@!#8 #(`0@`!#$ `` $@ "`"#`@  $f0"`y"cd#&4"`"c\#&8"`"ch#&@"`"cl#&<"`"cp#&$" fd" ""@)!@!@? c" "P3@ #@ 3@c80`` ??0(c(`0@@ł@ !@?0`(`?@@ 0`( ? c)  (3`0 "cd ?0(?c0(`@@@ #&4"`"c\ ?0(?c0(`@@@ #&8"`s"ch ?0(?c0(`@@@ #&@"`g"cl ?0(?c0(`@@@ #&<"`["cp ?0(?c(`0@@N@ #`@  ?2 * c?  2 (`@@@㿘Ho&(@gh    Hp@> @aq"Hp@㿘>  @ac"HԐ @> 㿘Hof4 (@g a"3 \80a "= \@o# 0 4" \Hp@a50 a6 @=# 4 \`@ Hp@  @%) Hp@``@6 \`2  0@>ߒܐ "ڐ ې֐ eaΐ 㿘""@ДDD?"c??c  %?;?-%)"@DD@#" ""@)DD @#"""@;DD @# N<`@""@~DD @#"""@ۘDD 0((0@@@@ (`0`@@0`(#"c""@ɘDD (00(`@@@ (`@@@@0`0(# <`""@DD("""@{DD""@P "DD D+@ D0((0@@@@ 0`@(`@0`(bD(00(`@@@ (`@@@@0`0(LD ?#(`?0(  0  0() 3  " DD?0 ?# @+` @( 0(`@@@ (`(@ ) 3 0 D D ?#(`?0(  0  0() 3  sD ?(0?0(`@ @@ (@(`(1  0P㿘""@DD"""@DD"""@rDD"""@ODD("""@,DD(" >`"@ "`D>  @_d#w ` `"@*"`D >  @_Q#8D ?(0?0(`@ @@ (@(`(1  0†D ?(0?0(`@ @@ (@(`(1  0D ?#(`?0(  0  0() 3  |D ?#(`?0(  0  0() 3  YD ?#(`?0(  0  0() 3  6" ?`D?0(c(`0@@ @ >  @^#Ӑ _""@WDD("""@4DD("""@DD"""@DD"""@˔DD"""@DD("""@DD("""@bDD"""@?DD"""@DD"""@DD("""@֖DD("V "@"`D >  @^1#` ?`D?0(c(`0@@͔@ "@DD(??"c   '%?-?D@# "@F"DD0```2&@#Ԑ ``8< ""@ߘDD0((0@@@@ 0`@(`@0`(̂(00(`@@@ (`@@@@0`0(ʂDD@0`""@.DD("""@ DD("""@DD"""@ŔDD"""@DD"""@DD("""@\ D D(". D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0D ?#(`?0(  0  0() 3  ҄D ?#(`?0(  0  0() 3  D ?#(`?0(  0  0() 3  D ?(0?0(`@ @@ (@(`(1  0iD ?(0?0(`@ @@ (@(`(1  0FD ?#(`?0(  0  0() 3  #D ?#(`?0(  0  0() 3  D ?#(`?0(  0  0() 3  ݄D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0 ?`D?0(c(`0@@@ D ?(0?0(`@ @@ (@(`(1  0 D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0oD ?#(`?0(  0  0() 3  LD ?#(`?0(  0  0() 3  )D ?#(`?0(  0  0() 3  D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0㿐 / ,     p&   衐  " >  @[B# Ζ  ! @gi> @[2#H#$> a#\ #` $!    "#$ >  @[ >  @[# , @  # #$'8#\       "#$>  @Z #$ 0@#$ (@ >  @Z #$   @  2#$  @&#( ""$>  @Zʐ##$ c8#$\`&"$`& Ȅ`&'Іdh& @&  pl&&>?8`&!6 >>b&!&!!c,  `&!h&"& 0  0#&!<>>@;#"`0 0 # @" !  #@  & @  & @  0 @   0 @    @ @@`@h  + @  `+@  Bp@B`BPBB@BBAܝ㿘` > ?4 : @ *  2 @8`$?6 . , +`@ 3`+ @` @0(@ ; (8 0 @ (0@4`8, @,` @ +:`B : 3  @ C+ 3`@8` @`?  `* (㿘> .a . `8> 8 l`ȅ(㿘> .a . `8> 8 l`ȅ( > .a * `8 2  ` 㿘 8G t` C `JB``O?` aĀ 5 : -,@,` - ` `2  `=`` d,g @ d,b ` d `"-0 @ ` ,` ,`- 2Ĩ` @,``,``%b͆ Gˆ?,` ,`,`,`,``  -¦㿘   8. , ,    `" . ,  d `2  d ,   8 ?,@ , ,,@ ,, 0㿘 `O ,?, ,,, ,  ` `',, @` '0ڐ  @` "? ͐ d @ 'Ѐ`  "   @` "  @'Ѐ` >   @Xʔ& 㿘 . , ? , ,  , ,  d  `  0``o``2m.  .  `k( `"?`(`> @Ya!H`( c ?( 2O  . >d ,  Z ,  , 2 `Z"  . > @Xs XX `   & .  , 2 ,.  T, >@'TaĐ <>@'Ob̐ >@ ˒c a& l ം & .  `( !, 0``"F.  ,0. > !@X,  @`& . > !( `>  & @X  `. > @X 0> @X 0> @X  p0> @X H0 `>  & @W  `.  . ( 2c?  ,0I>  @X!h㿘 8` `> 8`9@ T3`H  `@ @ ` ```@~ \. ` `@2i `l `t`%`t |$ `l@V `l(`@` `: ` l@  0 t x`& t%& x `"&   @?,,  " ` ` & @ . ,0ސ@( <0ځ  `  `l(`@` 2   (. , (`@`  > . sa> c<('  Hoe4 t(@f t` a" | `, ,Hp@ ,> `4  @ `" @X H`"  t`& t `2 `, , `2   H`@ H,0@*!Ѐ H p@  , 2@ 0㿘> . sa(`(   `$`@"   ``@"``A2`, , -` ` `$0, -` `"+` `z`$d ?-``>  Ha t!`W  |`@$ | | $ |*-``@4  `5F` , `$``(% %  % L ` ` @> 8 l(`Ȃ@`  (, -` , |`z`"Ђ , -`˂ -`-@<-`-` `, -` , -` -``$` !?-`(`㿘> .a . > 8 8` l ( &@ `]@"i  y@"9 Czx@"9  k@"&8Cl`j@`\@ؐ @E 2Ґ   0``2`2`2`2`.  ,. ,`   @. ,`0  (. ,`0@G{@2   `@. ,`0@Am@2  ?. . ,` `2`2`2`&}  ``(`N ` `2 ` 2`D2 ``2&b   . ,`0[ @㿘 > c` . `.> ]`L>`LȈ`0   @ 0`@ 2 @   @ 8 @k@%ː <@%ɐ T l@   㿘Ho%`(@f`" ` Hp@`@  @@` $@Hp@H``` @ `Hp@ 㿘Ho(@f``  `'  @` "?.@ @`  '  @` "Hp@㿘 b  ] 8H%$Y(@ ` & & & & t` 2 ःHp@@  `` . (Hp@> > 8aܪȮ T  `   p x`& p& x @ l(`@`  8 f  @%p < @㿐Ho4 p(@f p t& x& p& tHp@> c> c> `c> c#\ >  @U%aHo4 t(@f t`a`" tHp@ 㿘> .a .  `   8 l> 8(`Ȃ@`Ho4 t(@f tb < . .`@%  t$ t. Hp@ @Zl t㿘 > .!`?0` @ @D!(`@ " Hoe;(@ 8`/ЃHp@ t>>a\$ p$ Ѐ $ Ԁ @  uHo (@f 9` t`  Hp@  f 8 @` -  -  ,- ,  - `ӈ 2 t(`  t$ t`2 > 8' `  !`  @t tp@~$ t "  t$ t ` Hp@@$ t c $ $ c> .$ a$ $ `` $ `` @@$ `% @$ %$ Ho9(@  - @}_   % % % % + V  *' ?, ,,,, `KHp@ l> 8(`@fƂ , @  %b- G `. d,g  d,b @` d `  t$ tO t2  @, @}ѐ"@% 8РՆ?,  ?,Ѫ-  0E㿘H/` /?.`.@: .` .`.`.` .``Hp@\h\p]\h\h\h\\\\\\`4`4_`$`_____aa````````abb8bpba@ccHccax㿘 @?. :. 9. 8. ;. < D  @` ! ` @` A  @` B  @` C C @` D  @`   @` A 6 @` B  @` C 㿘 0`   @" 4 " 0` 㿘 @@& 0㿘>a@>>aؐ>>b>>bL, @$`` ` ` (` !  !! ! !  ! @`` `!  @&H! `ۺ  `"! ! `"! ! `"! ! @ &D !   㿘 8 9 :(> (b) ) @@(`@0``Z(`> ` Ho,4 @(@m @@ j ;`   @ ` j @@ l <`   @`  l @` i N @` ,` c2 @` , f2 @`  d @`  eHp@ (`㿘 @` ! & 4 㿘 @` ! & 4  @  ``2 ``  ``2  8 (>`` 0` * < `  * 8``8 * ;߄ `  * : `  * 9@ ````  (>``    "` < "` 8 *` ; "` : *` 9 *` 㿘@`  (`><? &``&`$&` &`>  `H@s ? &``&`$&` &`>  a@e ? &`$&` >   &`&```8@V  `(&`<>  @OaX? &`$&` >   &`&```@? &``&`$&` &`>  `h@5 ? &`$&` >   &`&``ђ`H?&`$&`    &`&``> @a  &`(`,> @`8`D&`@>  `@@  &`X  &`&`? >  &`$&` ``0  &`?&`$  &` &``> @`X  &`(`,> @`8`D&`@> ^ `@ &`X? &``&`$&` &`>  ``@Ӱ ?&`$&`   &` &``> @Œ`P`,&`(>  @`0 &`@ 㿘@ %`0    >  @`  &`$&`&` &` &` > @`  &`$&`&` &` &` >  @`x &`$&`&`  &`&` Ր`>  @`p  &`$&` &`&`&`  >^c 㿘 @F ؀ !" &!" 㿘 < @ !@ m@ 㿘 <!@ !쀠2  @2  ?& @ V$!@ S㿘 4  @ i Ѐ` ԰ `$ @ B㿘? > .!̱6 @%s V`@% > .a&`<!&`8@ E!&`@ #&!@%r 㿘? > .!̱6 @%Q `A@%b @ (!`@ @%U@ !@\( 0㿘 @ !`@  #@2` `? ?$`@ $@` ` &@ ` &` &`   &` $&`  x  &`$$@$` @$́ &`$ &`$&!@㿘!Ȁ  @ @2  @"   2  ` $ @  "  x     @` w ` @$ ` r 㿐? 6 > . !@$    @  Ѐ`  @ `@$ @ X$ Ф ؔ    #\> @G2`@G+  @F  2 @ _@ ?$ @$@E  0㿘 4 @ P  Ђ$ Ԁ`@ (@ @ $㿘` ` !@ 8@&` @ @ԑ㿘? > .!̱6 @$F  @ # Ѐ`` @ &  ??@ Ζ !Ȁ`2@$! `? @` "@"`  ,!Ȁ`"!@`&!@ `? @` "@"`  ,!`"  @`&!@??@ @ ߐ Ԁ`>  Ԥ` @b  Ԁ`@ @D @ ɐ@ & А@# > > >  `@Nm"(㿘!Ȁ @ @2 @" 2  7   ? @ $$  `$*`F @"`(````" "`, "`, HB  "`, :"`,``4  / &!㿘? > .!̱6 @#~ !@r @G@  @4 a@@$ @: @#wa@$@@N @'@#ev@@#\R@@#S @ @#H @ @@#<㿘   4` x$ `@ `Ѐ`"$@ Ր & ,@ `@> @L  & ,@aĐ$a @@ $a@]a耍 aԁ@ Ԑ ` > a @X  `@ @c㿐> @La В @ `Ăaa&a&a̐aԒ &`&a@ &aȐa@  a> @Œa(a>>|@Jl!> .a6`R6`P&`` `0&`&`d6`>'> # @&Д&`㿘> p`Ԁ 2 0  * `" @  2  Ho$4(@e  Ȁ  ̄? @" Ȃ " " Hp@   Ho$(@e" " " " Ȃ?" i " i @#iHp@8  c " )\`#` `!`") ((@") \@  @ \@  (2݂ 耢 2 \ "   \@ 2  X  耠``   p(((Ꝃ ((꜁   p(((ꐄ  ((ꝁ ``?!?  2  2 `?  `'`   !)!)!)Ԛ`d c "`)耠`   9)Ț`d!)ԁ`    9)!)Ԅ  !)9))`i>a("㿘b? "4"c @ @ `9i\b ! " #((`(@*i`Xb&b`,`(0(` @&b`, ( 6b6b&b̒`@ "* 7"耢``@ 2` b@ "b``` `b`X&b`,`(0(` @&b`, ( 6b&b6b`@  4 5 6((`(@ C2"`0`2`X"㿘b? ""c@`i&bi\`<`=`>`?`;`8`9`:*) +` @ ( 0&bē*`+ *   ( &bi\`7`4`5`6) ((@&bi\`#` `!`") ((@&bi\ 4 5 6 7((`(@ C"`0b`" 8 p @|bi\b`@ @v ``&bb`i\ 8 9 < = > ? : ; **((  +`(`, @ +*`* @) + @ O 0b((@ 3`+`+ @@3`C+`+ @ @@ q+C c @ 6bi\  p@'bi\b`@ @!  @2  &b@"&b `  , (0(` @&b ,?( &bĄ   &b&b@bАb @ 26b6boi\㿘    c` i\ `#` `!`") ((@@ $ b@ϔ &b@&bā 㿘)\  &)&)Ԓ`p @))@" &)#`   >@na$#``?㿘> Y cX @Iz  2 㿘 \ ((`(@耠` `$`"`` "```Rp`>  @IM!F? ++ꒂ ! +++ꗁ p`> @I9!X` (`() @@ @>@? `$@9 9 @ @ ? \`;`<`=`>`?`8`9`:+ (( *) +` @@  ` (`(@@>@` ```````` 0+`*`,2     @ @ @ @((@@4`** @  , ,`@@>@> @I!@x)\) ! " #((`(@  @``2 @ ) @X #(@ X4( ` ܂@@ 2 ( &)p> `@II!> p`@IA!㿘`@``((`(@ > @I.!㿘`>:*#@ϫ 1> @HW"㿘> 7cP >  @ Ԓc@*`:  @ 4/t@ "(  @4't@",$8  & 8`"8`2 8& p*$ p& t*$ !*`$*$@<*`@ ( t`2  @(8t`2 㿘 $@c` i\)\` @  $  2 *0:! tt? @ p t*"*p t"*p! tt? @ p t*"* p t"*p! tt? @ p t* " )p t"*$p >`p  2 )0! ̄? @ )" )Ȁ ")Ȁ >`p 㿘!> p Ԁ$@"@  22@2  ?" @ߒ  Ԁ`> p `ԁ$ ԝ㿘 )쀠`") **   * "@* *&)))&)&)   ), ,  @@(`@F `)*` 㿘!> p Ԁ @20@2  @ ""  " $ ԁ`  @א %               #l#p#\#`#d#h#t#x#|#### %> @FH㿘Ր> ``> @FՐ"@J > > c"@F͒@B 㿘)\  @> @b H  > @F    ((`@.5>  X@Fx 㿘 @uf  `?`@. . 8!> #<' @@:@k > @&!㿘> 7cP >  @ cX```p&`p*&`t* '*)X7>9`D@- 㿘 `4* ʐ  @   $`  >(`DX> c<' ` ` ```  - (>   :@ݐ `//// //\ `@@D\ `H@?\ `X@:ڐ : 0@!㿈> p`> <' `;''!> "@  2 "@c`"3 il2- "*  @ ` ` `((`(@ 2 ", `( @k@ 2 ` 1  > $ʂ@0@Y"㿀> ` `!`"`#`(`)`*`+c<' + (( *) +` @@ `** @ @ (`  @_ " &    (((`@" )ݐ)@  2>   ((`(@```V > @F$"@- $@    ((`@* @  @  @   @  ((`@`* @`@Д  v>    ((`(@`(`)`*`+((`(@  Z> ?, , , ,     ((`@  * @̐$@    ((`(@  X   @) (`(@00+`+@+`0+`    @) (`(@)00+ + 0+ +  8, , , , ?, , , ,  @E}"@W")\`)h> .(`H(`@ @ @u 6`6```'|`6```'x ` ` `((`@ ` `,`,`+ | ` ` `) ,`0(,`00,`,`+`@ @00,`0,`,`,`,`,`֔ ` `! `" `#-  ((`@ `  ))  \ ` `! `" `#-   ((\ `@@)l 6-   @  ` ` ` `((`@`*     ((`@*  ````) (( @Ӥ ` `! `" `#-  ((` `@0  )) @1  X1 1 ` `-`'-`$-`%-`&O \`@ 'x ` `! `" `#-  (( `@@դ*`  @{ x* '' @6 >  h@C#X !$ X>  @C#>  @C#(㿘)\  c r+ +  a m+ +  M A++  R C+ + + + +  + )d6+ )e6+ )f6+ )g6`+ 6`+ 46`+ + "+ #+ 5+ 6 + !+ 7+ 0+ 1+ 2+ 3+  +  + + + + + + + + + + )   A      F"()&>(h &X&@o 8H )`(8#@2)` 8`0``28`0>)>)怠(؆(ަ㿘>">:ax0&*&*>>"`H&*&*>>9`H&*&*>8>c&*p&*l&*h&*t&*x&*&*&*&*|&*&*`-` ``C`c` ` `@ @3ɰ  @Q @"n @, @  @@ 㿘  4 `(@c   *4$ *`"*@ 4  4 > > >  c@C(㿘 :*t`@) ")\@ )\ ")`@ )` ")l@ )l`" @ `@ @ݒ  2@ `(`@c > c*@V @ʁ> >  c@CX.)㿘`@ >'`0 ``  @4 ` @?@ `@֥ `2 `&@㿘 K*` > &* @  *``?Ho4(@&* @ > )p`!> ')p`)t` "В **@ @ #2)p `2))X @#THp@e&*  0 @+ 㿘 c   $@㿘 bd c `)\ p@ d*x`@ 㿘)`%> `` ```h @ΐ "`@A@ `` > b 㿘*(@ *  p t t t? @& p& t*X`$*X@ $* p㿘Ho$4`l(@e`l`2 `<2! ̂?  H `< Ȁ &`@ȃHp@  x@Ґ`<&`<&`@&`*(@ s&`p*`p&`t* *X$*$*X@ J> `@Aϐ (㿘 )`"*  ,&*X, @Ȑ"**&*&)* &*&*&* &* &*$  ) "`` x  <@@4" <@f@㿐 4'L'P'T@d'XL <'  @㿘 bdc `)\p@ d $)x , , ,,  >  ˒`H> c<@' >```0``\e``e @*?  ?@ 1> ` `h> ?``0 (``?@@`  }  C?@C  >`Ӱ?`>`Ͱ @"0㿘  @ &)\)h> .qH.` @ ) &) ) @)h(`(`@@` T )  "` @2 ? )?  `&)쀠 `*`) * `@ # @2"# #  ))*`# &))`   ) @`` (( @қ &)`> ` > ` 㿐 4'L'P'T@J'XL <'  @㿐 4'L'P'T@9'XL <'  @㿘 0`> 7@c"X>  bx#` @I@赐"#  @ђ "$#'D!@\ @:(@ ^E>0@++  @ 'p p'l'''t?''|'x''p` p'@ @pd+"" !0` @G 2Ґ̐!  "@@9DtȒ`>  @?!D> ` @? 㿀>  c<b'  $Sc\ p @4  > b'耤 '  @"  2 " (` @>  a8 $@]  # \````) ((@b)@bȀ(bڠ > @B"HӠ  ~ @gbȮb¤  @ @ 0>  a`0b̒ a ~@Fb̤b 〥l`2@ ` @   ((`(@ 2`. @"   @)$@** *  * @?((((l$`\$l ( ) * ++`(( @`) +0`0`) () )0`) *@   ( @Ӕ 55, , 55`, , , , 5`5`, , \ ` `! `" `#((`(@6 ( `*``\#\ ! N`\#\ x P >\ ` `! `" `#`((`(@  鄃*``X`Հ``2 ` Ѐ` ` ` ` `) ((@`0`0`+`0`+` +` +`   "/`h>  a'>  ڒa!>  aӠ ``(   `\㿘"> `!@= 㿐 #\  㿘)h`>  b  @F ) &)\ @  @ $ $ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T$ X ")\ \ 2 $㿐 #\  㿀> c<@'   @ ")'''쀤`'PTܘbCm       `\ϖ ϐ       ) (`+ @+`((   ``2`\`c ` >  b@2  $ % & '((`(@$`` < ) (`+ @+`((   Ƥ@U   ) (`+ @+`(( Z   2`@(` "< )`"8 `\]`>  #bX ) (`+ @+`(( 3 ) @ X` `\9` "   @ƒ > c<@ #> @M`>  ibX@2)р`>  ^b0> >  Xbxڐ> @<"@Ɛ"`㿘7 @9   ;?5> 7`@7``@;כ`a>  c<@' 9)耠`^`>  #c8@  u> )\`#` `!`") ((@> )X   , @ `X`  >  cP0Ԑ>  b0Φ `    0@ X"0  )  @:8 >>  @;#x0>  Ȓc08`0  @ؔ? 8 e<`e @)? >8`0` @Ҕ?8@[ 0@"xd> ``>`(`܀> c>@@`  }  C?@C *?00$ 0q0> @c0( ( @`o   > _`8>05- - @> cP>2)\|(`(`(`(`(`(`(`(``~ $`\8$``)\ 3012) (`(@@$`$@@&`0<`0<`()\  b`8 HU`H* @7  ")\> aZ>4@0> p> `P&*>  @!0՝㿘)\ !"#(((`@) `X`  ``X` (1> `p@: p`b@b耦m`@ d@&@"_)\`p>  @:h>  `+> 'Hod4*(@ e* <2 p" p@Ȁ p2<* <2 p" p@Ȁ p2 `h@:1 @~@:)\Ho$,(@`4@ѓ@/`<\  bb&b@2 ?&@| @RHp@@JeӢ`4&b(@> c<@'  ”   >  `8@  > >  a@0@ f"@R( >>  a`0(`0  @? (@ފ( `װ (>`0` @?@}(0 e,`e @7? T> `` `(`̀"> cԂ  ( @ʔ?@T(˂ @@` }  D?@D  @4 " \(" ` @} h?==(=0% %@}y 8 HH   %X@  c r.` a.`.` m M.`.@ A R.`.` C ` .`.` .`.` .` .`.`.`.`.`.`.`.`.` .` .`.` 4`.`#.`<4`4`.`=.`>4 4 .`8.`9.`7.`;.`0.`1.`2.`3.`4.`5.`6 4 .` .`:.`!.`".`?`@> @}$b !> `H!> @8  `X> @8  @˼*Ȓ!"")\")h") @}    $l@ˮ $"%$$  +"@A"耠`2`.%`2% `"`&"@   ` "@, @) `" (@# (> Ӓa @ 〤&"㿘b`9b;?b 0 c@ %&!> a )"> b\@ *\@"*`> a؂ bR bj @   )\p> ua `> c<'  )h') (`@+ +`(( PTbC" >  Eb w> (> .(bH  ">  +a0ܘam@ސ `V`@{  2   ((`(@1 >  bP 0>  b00((`(@    .... .. . X.  >  @7{ 0((`(@  P....@ ="> c<' @Dq?@0`2 `? )  8 * @  >> b  8`0  @? 8@A8  e<`e @? h 8 @? @,8db֦   @ *Ȓ @ 6`'@`'ih(`ܦ ܀p `2 ? (`@ߵ [8 @a? PՖ Z ` ` ` ` @ ` ` `) (`@+`+ @(( PTbC 8 @G?@88 @??@8u > @ "ܘm@8 А 28 ``* 8 @?@ۧ8> b@8 `I@3 0E> c08> ߒb0; >  ؒb뀤` @w (  @r  $$  $ $&㿘  @a )h> .(``H(` Y) ! PTܘbCm` )l\  X`  \@ " ` $ X \@֒ @ђ  ` ` ` @ ` ` `) (`+ @+`(( ͒ @2  \ \ \   @ q)\  Ĭ?h> c<' XU>> .`0H  ?к̸4  @Ԕ G " $ ,@?$`\ $`X A Ē@s * @? )`h@y $`` `"ߪ?` (@?"˪"ʦ˪?)" &)> ?ߒc`0@ڋ?0> @ L"p> bc<@' $H  @m :bb  @b*Ȓ "")l > @# $Xbz tb0`0$造 * 飐 "` АH>  c bb Ȓ   / @ W/?G$hb   b` 5 2$\ ? ".b\b`7`4`5`6) ((@@ Ð>  =`>  7c>  0c>  )c> @"N$bh`  $d鈔 `2p鐀  > b`p@ 2u2\b  ((`@( @ + 00+ + 0+ \b  +`(`(@  ) 00) ) 0) "\ꄟ耠`1(@Œ 4>'>'@苖` !`2 !$$0` ` ` 4#, @ @$c "#> a$c4  \> pap1 `#" 0S kd` > \pa0\ `2gpl "lꌀ`@ " 볐  2l`S@ ƐLp>  D`@>  =``  > `2@y 途 `h@x# p|@ A 耠` $ > @! $ \ ؐ > a@O > aPlp@쟔  , ?@\L p`,`44, 0, 14, 3, 2\ @wԐ p\p> Hb  "> b0\p>  a9 p@wД  у4> ǒa\㿘 4@ <@손0b @"e00b&@"P100b"@D0b!@< & L"Ő@ʥ b%@@($Qb'@    & L"@ʊ b(@ 0b)@Ղ ,耢 a݂@`8˂  ݀ o؀ r Ӏ ]΀ vʀ Iƀ 2```B`u@ `v@  ->5` 4㼈)> "> 'c<@' > > bPX   $@&@"#2~  @ş  "  $$`$@ @w   "R $@w  "K $ Ӏ   $ '$2 $?$$ $ % & '((`(@$ 4 5 6 7((`(@?5  1 X@v  2 T P`"p$$` i$$ $2"^$$$$ $ @`]$ @$' X @   `7`4`5`6) ((@$` `3`0`1`2) ((@$``#` `!`") ((@$` $`P`$`T T2"$`T$`T P` T$$$ P$$ @ϔ  ƒ @ɔ   ς"'쀥> 2T`2T  @İ   P'`\ @u`h`;`?`<`=`>`8`9`:*'@'`* (( ) * ?` `;`?`<`=`>`8`9`:+ *(( )  +`@ ?`(``;`<`=`>`?`8`9`:+((, ) @* @u?`0  `8`H H @'`X"耠2G'``2'` "`@ȹ&"T2~>  <b''Ь  4'" ?'C퀦` ? ( @ `P`29`[@$@` `@14`(@(@@(````````@+`+ (* ( ) @@  @ @`$`"'`(`@Ȑ@`"@`````````* *(( *`)  * =@`$`2`@> @0#87 ('7@H'@ )@'T2nP T  $@3 @0 `2@* 2P`  $@ @ `2    $@ @  `2 2   @   @ `@ > c<@ F> Ք"$`T @s  2 $ ' $ 2 ` :B`$J``?T>  b`q '{' > @09" >  @02"&"@ΐ"  (  % u' > @0"X'㿐> pЀ`" А`4> @Ƌcb> @Ƈc> p `&b>5`@递` > @0# @t%c@b> @/ Ђ!6c6c> .b0 &cch.cq'&c > #@ > &c>aܒ x> 7>&"X@͔&`0㿘Ho$(@e  "&)t> `@/#&)tHp@㿘Ho$4)(@e).`@`X" " `XHp@)@)\> `p@0V#*@>8&)tD  @ Hp@㿘Ho$4`l(@e`l` `< &`l@/ Ȁ &`lHp@> `@0 㿘  `?Hod4 (@e > $)p0%> '*XВ (`@6" #2*X $)pHp@@ΐ)p 㿘  4(`@ c "`)x`2R)\`xHodF(@ l`2  <! ̂?    < Ȁ $ @ȃHp@ @r x <$ <$ $$ @ $ `@`%"L*'`5`".*a``"Q*`2**@ 2*_e l> `p@. `*` &`,M*`5``(`*2**@ 2* *`4&`,   @rQ/뀠`7`*@ 2*#*@ 2*@ 2*> @. 8 &`,`` 2***@ 2**@ 2*2**> `@/" h > c<' \`<`=`>`?`;`8`9`:( (*@ + ) +` @ @`%3`   G> 'ԇ4 /ԇ4 '؃, 4 /և4`@'܉, , //؂ 4`4` /'''''///ߐ////ޒԔ 粰 0'̀ 'Ђ?////΂ ///Ӑ/Ғ̔ 瞰 04`4`4`////@#(')\> c<' 89?<=>:;ࣕ**`(+ +`@*(`, @ () < +  8 3`@@   C  `  ৃ+  ` ?3`@; ?<`* :2'Ė 2B:*   > ` @-   @ @(; Ȁ'؀7`̀@ 81`Ȁ ̀ 0e((@ 3`+ +`@@C3`+ +`@@ @ TzC c @ Ĕp> @-N  @ @( 'ؚ`5`E ?-  '??-` j4`'''''Ȁ@v@ߌ ' } @߅ ''ܒ  |@p̐x('؂ '?'/3`'/ʅ3`'/Ʉ(0/'/ę3`,` 0`0`0`0(`0@-/'/''////Ƈ(@'// x` j ? [  |?@p/M/P ?'/N/C/O/E'' /F/G/H/I/J/K/L'(C''`  @ ` *@ 2 `8  Ho$(@e p*$`p#`t*$ 9#*$ Hp@ ` >  @x `@ݽ@ݺ)\3`) ) ) 3 ) 3`) 0) 0) 3 ) i\``<`=`>`?`8`9`:`;```````* ((+) +`, @+ *,` **`@  @  @0g((@ 3`+ +`@@C3`+ +`@@ @ S9C c @ Ԁ ȀV  b'`<`C ?膀@`C ??ȄC? Ri\(`(`(`(`(`(`(`(`i\# !") ((`@@i`Xg `@Xa`@ *`  b@&5@ @#j̀ `@ '> `@,k!i\> p@+!'m̀ j0  8f@{̀ 2 >  @ > @+y!P> `@+r!p؀@  @汒  "\ p> @+X!> @,!0` ㆥ   " >=bt"*"*p>=>=̂b"*l"*h>=>>H` * "*t"*㿘)\@` `!`"`\`]`_`#`^+`+ (( )  *`@@ V ,  욐&) 㿘  *g 㿘    㢐  )\ `\`]`_`^((* }?$ 㿘  >   ch > @oc)\ (`_(`](`\(`^)\ \ ] ^((`* @2 >  @ R2`, <2`2`, >2 , ;, =, ?, 92 2 , 8, :)\@`\`]`_`^((*`@@ V&  $* &) h'D 'Ԑ> # )\  \ ] ! ^ " # _+`(`+ @ ( ()   ? '̅2`(` *` à<< @ Q֒`$ '  'D*` 4)+`@(X `)  (`  F?ؠ@@ Qg̱*@ 2`8*0@*@@خ@ЬD<f4@ಀ@ "j)\" <" 8" @>?@`" 0" 5 " H-@" 4" = >" 0" p" ,D 0" `" @ (`@" 0) 0@  \" D)@``" p` p" " D@ " Dd`@ O `@`E 4:D4@D4`9-`D` 4)`X@'쀤ݬ )\p`>  @)# , 84@(@<<@DD4E  ˺ خǬeqmHo$(@;D Hp@ e*D D0㿘  @Ho(@e 0dN &  0`$ 0 ( 4`@ <$ ( ,`] % ,% (j`O``K2`p pX t t t? @ 8$ p $ t p M!  t t p t? @ 8" p" t羐ip`jX`@ƐHp@   4`> @)# ,`$ ,  "& j@  (`> @( ђ% ,Hp@$j p t$j$ 8> @) d<P8DD  * >@c$" "*p>?>@cl"*l"*h>@>B` "*t"*>@>@`"*"*"*)\`#` `!`")  ((@#)㿘  l`2  <%@! ̂?  ܮ  <  <Ȁ $ @$ <$ @ $ j@ 2 >  8 2 l> `@)B H@)@ hx)\) ! " #((`(@  @``2 @ ) @X a(@ X4[( ` ܀@,` `  耠` `N   * p> `@(!>?  8 (@ `'" -&)  *  8 (@ `  8 (@ ` 瀣  8 (@ `&݀ > p`@(!5>. в @ > @( 㿘  ; 㿘  Ґ  v 2 㿘  >  ` > @k`)\7 (<7 7 (=6(>(8(;(?66(9(:&) 㿘Ho$4)(@e).``X % ++ Hp@)@)\> `p@(L#`@ X*@ >8&)tD  @ Hp@>?$`䀣`@`"@`&*`@`π`@㿘  @Ho(@e 0da  ,`$ ,  & j@  ( 4` G$ ( ,"Z$,$(j`s `o2`p p t t t? @ 8$ p $ t ,`} p "  t t p t? @ 8" pv" t R`P ip`jX`@Hp@&  0 4`$ 0 (` $ ( ,2$,h1  > @&Ő ֐ l`A <$ <$ @ $ j@ Ԃ $, ``@Q$ 0ʒ > @&  2@Ӟip@@$ ip > @&! $,@ӎ0>  @'Q  8$jt p t$j$ 8@> `@'A 㿐>  8 m)\````(()  @?h\ )\`#` `!`") ((@ |& 4> 0 73 3 ")\`>A$ 0$  0@$ 0< $$ <$$ 8$$ @ $ 4$ H$ p$ ,$ h"*))\ ) ` `! `# `"((`@*`@@ R5 * % `Xd > `@& !H   & 4`X (@`If` 0$ 0$ ) 0@\$ D)``$ p` p$  l`` $  @$  @ & @`Ho$4 (@e ` ` ` j 8Hp@ al$  @$ 00p(@`2 ` `A" 0@$ 0$ `! `" `#((`(@(p` 4ٞ& 4p`>  @%#> `@&A!h  " ")>D>Cb4"*p"*l>D>DcH"*h"*t>C>Fa< "*"*>E>D`Hp* "*"*"* *2 :     @   >c`x  >cax 㿘`*> > ax> > aТ  @%,  2 @%% `Z@ .@%  2 @%`@ 㿘 \` P`Id>$  @>E$ 0a;$  0 @$ 0 0< $ 0$ @$ H$ <$ 8$ 4>`0`.`$ , 0  `\@$ D`$ p$  p`" p$ h$ $ $ $  @ $  @  4& @`& 4$ 0$  0$ 00{ d?㿘   ! ̂?  ع  <2Ȃ <& <& @ & *@ 2 >  8 2 <& @@%R hx)\) ! " #((`(@  @``2 @ ) @X d(@ X4^( ` ܀2?!  0   < "1 p> `@% !2 8 (@ `%"&)`ߘ 耠`ۘ ؘ > @$ ֘ 8 (@ `&2&)8 (@ `'2&) 8 (@ `2&)> p`@$ɐ!㿘  T 㿘    ܏  )\ `\`]`_`^((* j?$ 㿘2  `0>  a@g )\ (`_(`](`\(`^)\ \ ] ^((`*@2  :  @ Kt 2`2`, <2`, ;, =, >2 2 , ?2 , 8, 9, : >  a@g )\㿘Ho$4)(@e).`@`X * "9`.  `Hp@)@)\> `p@$0!Ѐ` `X*@ >8&)tD  @ Hp@ ׀`耣` `X `X㿘  @Ho(@e 0df &  0`$ 0 Ā "  H < `2l H ( 4` I$ ( ,w"j$,$(j`^ `Z2`p p t t t? @ 8$ p $ t ,` p "  t t p t? @ 8" pj" t >`f ip`jX`@{Hp@ > @"ː" ,`$ ,  \& j@  `" ( H <s& H > @"  27@Ϥiph  > @" ֮ <$ <$ @ $ j@  $, ` `@,$ 0 > @"! $,@{0@$ ip| 8@Ӿj4ip$ji p t$j$x 8>  @#* 'D ''>  ''' z'\ `\`]` `!`"+ `#( *) +` @ @ `^`_'` '`$'(HD ! !  ?` '  .ȃ, C??F< ?'4` @'C??48 ', = `, ? ?''@ I\@ ````) ((@' `  @@ IB?Ѐ` @ I7 f?ЀHԮE( @D J , 'D'   @ 0 (@N8 @ Ij膂@ DB ;` i-P`X > !H@!`*4@а 0`.8c0@(( @D 40@, @ D,''   @ 0 (@8 @ ID;`膂@ DB ;` i-`X` = #\#d#h(#`# Ԃ #`#\#d#h #\D#`#d#h #\  #`#d#hD u@fi@@G`'/ (@7@ @ '?' @F4 '> "0@ ڒ` (@` `A=#`#d#\#h> @ "Hܒ @do   !D( #\#h#`#d <耥8@܀Ho$4(@e`D  8`8` `8! p !  p*$! t*$ @#*$'DD `` `  DHp@   * "   "*?? !8hX>Mb>K"*pd>Ob"*l"*h>I>O`"*t"*x>H>QȂ`"*"* @ ` ` `((`@(   `, 㿐> ֧p  ` `0  ,i\````(()   @?& 4 \>Q`@" 0" :  $" < $" 8 $" @ A`0 0`4" 0@" " H" 4>`0`" " ," i 0 `\" Di@`" p` p"  l`1 "  @"  @ & @Hod(@e` Hp@  0 @" 0 " H0i\@p`> @#`@> `@ W"㿘 8 0` <`@$`($ `( @$`(@缁㿘> 7cP >  @`$`( l`" < "  Ā "  Ȁ 2 Ē)p`*X`@> `@ "㿘 , 8``8  ,Ho$ (@Hp@eHp@0㿘 O  0 "@b  0@ >H׍b(X?@(X@ ??<?  @] $ 20"  ? @ <$ $ @l@ 0 4 <@d 0@_  $   & (@1 à(X͢ 㿘"Ȁ` "Ѐ`"Ā`   @ "Ġ" " "İ @a@& "Ā@ 2  ` ` (8 `, ( hh `2h4"Ă &"   "ĝ> c<'  '4_'8Ү / ->  `8ݟ  8`@ `@ޒ @ے  2@`@Ғ 4 `@> @ے4 >4`0  @څ? 4 e<`e @֘? d`(`܀d  @   >  c0F 8`0` @c?@40 Ƭ   `4 `5 `6 `7((`(@?c  @Ȑ " \4" `" "  \`Y588  (4"#"@  n    ((`(@   7  >  b Q )  >  b C @  > >  ``Ӭ 5  4 @?4@y  * > b$8> @1 㿘 , "& 0b"!b & 0)\ `#` `!`") ((@&) ")\ ")\  ``bЀ` bĀۑ(h   #&b̝> c<@'  %s  > f`8 @ A> @ž8 >8`0  @g? 8@  8>`0` @e?@80ڔ> :bհ  e<`e @٣?  d>  &``ܰ  8 @C?8@̠ Ұ `(`܀  > bİ   @ " \8" ` @` h& & \`7`4`5`6) ((@ && & (& ,& 0& 4@` \  # 8 H H  & X@~  c r*  a* *  m M* * A R* *  C * * * * * * * * * * * * * * * * * \`  ??,`6,`0,`1,`2,`4,`5 ,`7,`3,`# ,` ,`!,`",`<,`=,`>,`?,`8,`9,`:,`;`@> @`b!>  #`H> @.  `X> @(  @**"#")\")h") @`w   &il@ &i"& 4 @K&i  @   @  8$** *  *  8((((`۔ il$i\&il ( ) * ++`(( @`0`0`) +0`) () )) *]  @~ `  i "@u  @q `ܐ@l ـ @ 8> a  @^ ܀x'> <' ؒ  '''''@_'''''''''''''''''''''''@'ܔ@?@o@֔ @Β@@^ @^ @^ ` > @6 X㽰 ?@^!!@  "   @@@ @ @^r!㿀 ,> c<' )h )i )j )k((`(@ (4 @^W @^T  ,>  ! " #((`@+  h 4 (?ߤ (O ,)p @^ "Ӑ(@^& ͐@Ð p> c<@'  ?? !8hX >  4c@ (X Ӟ  >  c00> @   >  cH0ݒ @* $& $'& (  @ @ "͠ @*$ ($  ( @& ( ( $ @|@$ <@ Z$ 0 <$ 4" <*@ߐ @ , '''''''''    ((`(@@`N` "')\`;`<`=`>`?`8`9`:*) +` *`@+   *0  (@y  Ѓ, `4, 'ܐ(X@3   , >H >b0_^ (X?b(X@ ??>?  0K!'ԝ㽰 ?@]E!!@-  "   @@@ @ @]-!㿀 ,> c<' )h )i )j )k((`(@`(` @] @]  @]   a>  @ϔ  h ,`` `!`#`"((+  Z(?; ( ,)p@]j  21 ! " #((`@+  h ~(? 4 ,(ik(ih(ii(ij (ژ ,ip # @\(@(  > cHӰ @D > bc<' ")bȲ|@ @\ @\ @\  K> bȀ`"|bĀ| ,׭(h ߰ |@ߤ "ٲ|bĀ`ղ| ז '| $@`ʤ ׉  ` } 2  2 Ԍ @@ِ 㿘 ,  4((((@G( , (` (`#(`!(`" ,(4 ` `! `# `"((`@`h(+ ǘ  ,(ik(ih(ii(ij ,)p($ @\( , (`(`(`(` 㿘 >  ch  @   @)$* ** *  (((?()l$ &)l)\& , ( ) * ++`(( @`) +0`0`) () )0`) *& 0b7 0be *& 0 `& b` b > @\̒c)\4(<44(=4(>(844(;(?(9`(:&)  "b bȀ`&b́ #㿐 '' @Ӑ $    ? && @ঐ  & `$ `2u `   `` "z```"``$ 8`  44 > > `@24 0 `< @+`0`2( 0@hX9  0"Y`$   0  ( 0 4 0<   4, $ $ $ "$ $  ,````) ((@``"$  0 < $  e @? 4 l؃, !$  < @ ` Q`$`` ``````() +`   ?2`$ <` ```````` 3`(*`,2        + +`@  4` **   , ,`@K?```()   @?' ( > >  c@!" 0& 8 8@߽> @C#㿘`'   >I 0al @Hof4 0(@g 0@K   0`,Hp@0 㿘 , 8`8  ,Ho$(@eHp@ 㿘  @Ho(@e 0dB &  0`$ 0 ( 4` $ (Hp@ ,W % ,j`:> `62`p pe t t t? @ 8$ p ,$ t p Z!  t t p t? @ 8" p`" t  `> @ِ# ,`$ ,  D& j@  (> ` @Ɣ h ,`@Hp@% ,0 %>Q 0ah @& ăHo& (@@ 0Hp@0g0$j p t$j$ 8> @P > @M O NOOO`O *2 :     @  㿘> q.>cؚ@   1 1 `1 @  ((`/`&`@> q `(`> p+`؂ #    (`) (#(` 8`(8!8``""؝㿘  . & >U>U`p&*p&*l>U>UaH&*h&*t>R>U` &*&*>U>Sb0&*&*&* > p* `@> q؄  `* *`> p > q`؆㿘> q cء. @ ! @ $@ ?> q> p`ؘؚ +` @@ @( `a+` 㿘 \`hlɯ ^`^d L$  @>T$ 0`P(I$  0 @$ 0 0< $ 0$ @$ H$ <$ 8$ 4>`0`.`$ , 0  `\@$ D`$ p$  p`" p$ @$ "p  @U "(" " p"$ $ $ @ $ @ 4$@`$4 $ 0($  0$ 00x` ސ ?  d0l?㿘   ! ̂?  \  <2Ȃ <& <& @ & *@ 2 >  8 2 <& @@ hx)\) ! " #((`(@  @``2 @ ) X _(@X4Y( ` ܀*?  `  耠` E   * p> `@!>R 8 (@ `'"&)  *  8 (@ `2&) 8 (@ ` 2&) 8 (@ `&2&)> p`@q!> @! >  a),`@X@`2)> @Z!(㿘   Ho$(@e 0dw &  0``$ 0` "` H <` " H <@@ߒ &  `2o H ( 4` L$ ( ,z"$,$(`a``]2`p p t t t? @ 8$ p $ t ,` p "  t t p t? @ 8" p@" t y >`f p`X`@۷Hp@ > @" ,`$ ,  `& @  `" ( H <& H`> @  2;@ph `> @ِ  <$ <$ @ $ @  $, ` `@h$ 0`> @! $,@0@Z$ p]y 8- 8 @4p$b p t$$q 8> `@b 㿘  ` & p* p& t* !* <   Ȁ  㿘  ˗Ԑ 㿘  k    )\ `\`]`_`^((* ?$ 㿘  `> @Wqa@i\ (`_(`](`\(`^i\ \ ] ^((`*@2  :   @ : 2`2`, <2`, ;, =, >2 2 , ?2 , 8, :. , 9 $i 㿘Ho$4)(@e).`@`X * "9`.  `Hp@)@)\> `p@!Ѐ` `X*@ >8&)tD  @  Hp@ ׀`耣` `X `X)\`#` `!`") ((@+``* ") 'D ''> <H'''p 9't\ `\`]` `!`"+ `#( *) +` @ @ `^`_'|` '`$'(D! ?!  ?|  ?'l| ) C??@, `?C 4` < @''ȅ5`C??-  |l'ĩ-` =8''''h|9 ;`''@ 9e\`  @```) ((@'@c Ԣ @ 9 @ 9讣@  c E@`E 4`E +` @lG `h| D't,@'pp`` @ 0 (@8 Ȑ@ 9@ DB ;` ??鄖 ?   (@X8 (@`" ^ _@ g@ ?8  J`h ahɀ> > Ḓ> @!Ԓ @UOM   48D( #\#h#l#p#`#d  < &`3?l@C?Ԁ@'h|((@1 @8 ''2(U`+` @lG `W|h4`|0@ |,,@ @D'p'tp`` @ 0 (@Q8 Ȑ@ 8D;`@ DB O;` J???`hm ْ Ԓ  > q   yԐ> q > q` @#p (#\#`#h#l#d% Z( #\#`#d#h#l#p I( #`#d#\#h#l#p 8#\D#`#d#h#l#p &#\D #`#d#h#l#pߚ #\  #`#d#h#l#pD͚  *4@װ 8|`|3`8+@0 @ݐ4 '> "0@q` (  @‥2Ԁܠ (41#`#d#\#h#l#p> @B!X> q9 Ԓ @SD( #\#h#l#p#`#d` ޠ   .1@3@ > q ( #`#d#l#\#h #pD; q < ܆2(֒Հ@쀥Ԁ@ > @ݐ! > q  А ֒/Ԓ @S~D(#l#`#\#h#p #d (D(#d#`'#\#h#l#p P   68@:@<> q`  #l(#`#d#\#h #pD  < Ն2(Ѐ΀@쀥@ߠ ݆ ֆ φ Ho$1(@`D  8`8` `8! p !  p*$! t*$ @#*$'DD `` ` Ɛ ȔDHp@ e  * >Yc" "*p>Y>Y؂c\ "*l"*h>Y>Z`"*"*t"**") 㿘  ? 㿘  ֐  z 2 㿘  >  a>  @Rb)\(`;(`<(`=(`>(`?(`8(`9/(`: ))\,  `< `= `> `? `8 `9 `:((`@ `;(*)  0+ +`<00 +`=@+`>00+`;+`?0+`8+`9 +`:.&) 㿀'DDD@ '>  2)\` `!`") ((`#$3 8`@(` ` D'  4  + )``1 (  )     ))\-`X) (`(@`' d @@d4i@" <" 0" 8" @>[a<" " 4" H(` @E 8 (" 0 @" >`0`" p" ,D 0" `" @ (`@" 0) 0@  \" D)@``" p` p" " D @ " Df `@ l `@D 4D ` 4쀧 @ y'쀧 P`   @@8 @d1@    @ e E-@ ``) @ 1 (  D W2@ @Q@ e E-@2@ E(J) Ҩ8 (fb8'))\p`>  @ s#Ho$(@eD  Hp@ D0㿘  @Ho(@e 0dN &  0`$ 0 ( 4`@ <$ ( ,`] % ,% (j`O``K2`p pX t t t? @ 8$ p $ t p M!  t t p t? @ 8" pƎ" t˞ip`jX`@ԦHp@   4`> @ # ,`$ ,  "& j@  (`> @ ߐ ђk% ,Hp@$j p t$j$ 8> @   ? 2  ` > lcp   㿘!> l1> l%> l#> l`  #t`#x   @  (  4l  cp#@"@@8@ "`cpl" @ 㿘#> 'b>Ca 1> @ t"(>  @ObP > l `" > l1  ct@3 > l 2 cl"  >C"!$a "?> l" b cp > l cx`> l 0(`3`  ` > l,`(> l$ ct> l> l p cx1> @ +"X`> l1T000L00ltddT@(ldddddlllllllpllL ,8  ddddddddddddddddddddddddddddddddddddd ddddddddddddddddlհհ@lհl`"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@M` 2V``2   "`""@@") "` @"(@@9`9 `""@" @` ` ` ``2`@"@@9`9 `ݒ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2`0"14`2-0 (-"(4`"" 4( "D`, , 4( ! ,! 4 0 0`K 0 0(@"J ( ,! 0 (`024 `4 4! 4ɒ ,`",`4"7 `4, ";`(,# 4 ! (! 4 0 0`*#`0 0(@"? ( ,! 0#`,` ( `00`1"`00`(@"#`(#`, 0 , "! 0 (! 0 ( 4! 4"! 0#`,` , `00`"`00`("#`(#`, 0 (  ("! 0k#`,"(",4`2`4, "`0 4`w`0  4"4`2R"4@ L`( 4`2( 4,"`4"`( 0`0`R 0`0(@ " ( ,`("`0 ,`,4`.( , 4`y"`04`"`0`4 4"`4 4(`"`, `0`0` 0`0(@ " ( ,"`0 (2"4 4("`4"`, 0`0`F 0`0(@ " ( ,`,"`0 ("" (4`2`4 (! 4  , 4 00`K! 00(@" ( ,! ( 0`((`4 4"`4 4,`"`( `0`0` 0`0(@ " ( ,"`0 ,2"40""" ,4`2`4 ,! 4  ( 4 00`#`00(@" ( ,#`, 0`,s,"""㿘`(U`,2(^`0(`2,04"0`""`(@"-0"`,0@",`(`( (`, ,`0 0`4 4`0""(@" ( ,`(`, `0 0`  `0`2`0 @"`(`( (`, ,`0 0`4 4`0ْ"`,`0`4"0`""`(@""`("`,`4 , 2 (0 (`2  (@2 ,0  ,@ 0`  ( 2 ,0 ,`2  ,@2 (0  (@ 0`   `" `6 , (`2`("1,`2-( -" ,`"" , "D`$ $ ,  ! $! , ( (`K ( ( @"J $! ( `(2, `, ,! ,ɒ $`"$`,"7 `,$ ";` $# , ! ! , ( (`*#`( ( @"? $! (#`$` `((`1"`((` @"#` #`$ ( $ "! ( ! ( ,! ,"! (#`$` $ `((`"`((` "#` #`$ (   "! (k#`$" "$,`2`,$ "`( ,`w`(  ,",`2R",@ L` ,`2 ,$"`,"` (`(`R (`( @ " $` "`( $`$,`. $ ,`y"`(,`"`(`, ,"`, , `"`$ `(`(` (`( @ " $"`( 2", , "`,"`$ (`(`F (`( @ " $`$"`( "" ,`2`, ! ,  $ , ((`K! (( @" $! (` `, ,"`, ,$`"` `(`(` (`( @ " $"`( $2",0""" $,`2`, $! ,  , ((`#`(( @" $#`$ (`$s$"""㿘` M`$ 2 V`( `2 $ ( ,"(`""` @") ("`$ (@"(` ` 9 `(9 (`("" @" $` `$ `( (` `(`2`(@"` ` 9 `(9 (`(ݒ"`$`(`,"(`""` @""` "`$`,㿘 <@  $` 8 $& 8  ` 8 $* (` `? "`("`$"` "`,&& & $ @8 $ـ  &`(&`$&` &`,"ذ ԰  @ $ 2 8  ` 8 $* (` 20@8 $瀠  $ 2 ( `2  @2 $0  $@ (`  2 $( $`2  $@2 0  @ (`   `" `6 $ `2 "   @    `    `  `:? "@"`" `" ` " @"*`*` @@ (`" " "> 4" 㿘>  a4 $*  &  & #& J@ /F$& #& &  @    z@ 20 z@ 2   @ $ 2 8  ` 8 $ (` 20怣@8 $怠 > rc`@> u8`>d`" $`  `2" Ȁ`2" `?" @ * ` *0`*`(00 ?0c `20㿀_c> c<' @,@` 6@`=  >   `* 2  * 2  * 2  * 2   * 2   * 2 *  32 B `* 2 * z2 * t2 * n2  * h2  * b2 * 2 \* ,/ 2 2`T26``G* A2  * ;2  * 52  * /2  * )2  * #2 *  ‘2 `* 2 @"㿀> c<@'  _[ `2@* 2 * 2 * 2 * 2  * ܑ2  * ֑2 * Б2 6@@ > @շ"㿘 & & ``` ``$(` &`7@4`"$ ``" &O````  7@4>\`(B``ڂ &  7@```` ` ```` ` ` `````*`.  .`+`*() /`@ / . . + 0@4 R`2  ʄ `  &`7@4  & 7@ 4 & !7@4 & 7@ x4 & #7@r4 & 7@ j4 & 7@ b4 & 7@\4& 7@W4& 7@ (`M4& { pk\> c<' `gIԒC``@@6@@*` 4 / ە27@@Ֆ 5@* ,`2 4`͖ 5!F4  * 2  * 2  * 2  * 2  * 2  * 2  * 2 5"- b> @ z  * s2 5@m   * g2 5@* 2 ` 5 Y֖* S2 ؖ* M2 ږ* G2 ܖ* A2  ޖ* ;2  * 52 * /2 56@*`/ 2`2% Y5@"㿘  ""` `````@, ((``@ `2```(`"`؂ ?@`` *`>\`??   ``*  ߐ@.@* 2 2 .`.`    ``* ϐ@.`* 2 2 .`.`, (`(@ `(``* 2`@,  2* 2 .`4 2 .`4 4 .`.`.`.`````((`(@) ``* 2`@- 2* .`2 .`2 .`.`.`.` Y`` ?`  ?`Ġ     ?  " `c .@6`  ,`Y .`6`,,`@0`0`N 6`6` 1`@-- `` 2? &`6`??Ҕ `9(`>\??Ŕ .`S`  < 9`e_c`l- ?  ?   ?      ?    `(`>\   ` ??   ?   ?  ?    ְ  `  e    `    [    V   Ӕ Ѯ   ͔ ?`   D `    " @ @@@ `?@@@ `@@ `@@݂  `  @@Ղ ߀ "  :+@       8       ن݀2  @ `? ` (` >\  `? `?@ @ @  `? @ @ @ `?@ @ `? @ @ *`** 2`2>j`2 @    @   " 8 dz`dT@`?@@ "`42 86" ( " "@(@@"`(@@" `(@@"   ` (@@" @(@" `` `" `" `" " `"  " `" " `"$0`22`$4`22`#`6"@ $v ` @*` $V@" $ $*` $`2*`$P`22`$V` a@2` $`2*` $ 2*` L@ " 0㿘 $`$@` *`>  @͐#>\H@@@  ` @@  ` H H@@   `  ` `@ ` ` ` `@@ p  @``$2 @  ##"$yԀ@" $u ``b@2 ``'$u $u ؀@" # `db@2 `d'##"$y܀@" $| `hb@2 `h'$| $| @" $} `lb@2 `l'$} $} 䀠@"  , `pb@2 `p' , ,v耠@"  \ `tb@2 `t' \ \`쀠@"  ( `xb@2 `x' ( ("F -@"  X `|b@2 `|' X X" ]@" " `b@2 `'"`##|$y $yw$u ]@"`   `b ܆ ܀``` +` - X $ynv$| 0 0 " (ْ " \㿘 > . `,1> @! 28> 9 @> @ @    ``> @ 耤`2> 2> ܃. > @}"0. `1> @w > @t#0 > @n#؀ "뀤> @h 怤@d ɀ    Π 㿘_???    (@< ` "7(" ` @@4P > > bXp  @1@``- `.`  񀦠#2`@```- 0``1> @ 8ˈ @"$ ? ??  ? @ހ   `> 2`@ .`0``1> @ 0 㿘`  `z`'   :H, > @Ԑ#p ``"F> ``> @ʐ Ѐ``$> @Ð x` `&d> @! `"`&]` $> @ @"z>  &O> @! &"H  "H 4 D \> @  d $<1> @ >\h@ p`> @ h `> @~ ` `> @y @ `> @t P `> @o X `> @j H `  ' { | 2y x` 8 @ <#> @R` E`!>  ]` `@H  L P X T@B` E` ]`2 `@8  D@4  > @/ 0> @+ !>  >m` 㿘 $`$?c &"  > saP@?`> s `> s `> s`2> s> s ` > s `> s `> s @> s `"> s "` > s $`$ 00> `> ` & > @` &f#> @a@ & "_  '!> @!H`&> @!X` `&S@a@`&`"M``'@!H> ?@ Ё㿘" @W 2 㿐```<``?`@ (``(`@ (`@`` @ 8`````< `?(``(`@ (`@ ` @  8` " `t`"````?(@cc@8c` B  8c@cc@8c` B 8c"<$"`@`H@8`H`@ 8 @ 9 82` `@@ (``@8`` B `8``c@8c``# @ 9#@`2`$`$T`=P ` ``?(`t``\``?`#\#`@f9`?!  ` ``?(`t``,``?`#\#`@f`?T`L`H㿐'L   LMNO/. ///.. `. @4 6 * , .2 4 66@㿐  `@  2   L  "E .  `"X ``*`: `  q ``  H    "    `߀`+ 0߀ 8"N H P.@3 "  H  `#\ #`™3    0"r L T/ @3  L "< H P.@3 "  H  `#\ #`3    "` L T/ @3  L` 23  H 4  `` /`0``v\`2 .`0` l`B 7`  d0` L2N N 2  H  "k  `  ``I m LD  H  L8  2  H P  `#\#`.3     L T/    #`#\3     H P  `#\#`.3    L T/    #`#\3      Ly/`  r  2  2   L  " ` К     @2   L2   L  " y   H P. H PΙ. L T/  L Tl/   2 P 2 P 2 P. P  2 P 2 P 2 P. P  Z  X.   R : .   2 T 2 T 2 T~/  T  2 T 2 T 2 T/ ! TՖ  `b`  L  2 2 220 LQ  L  2  2 22o/`   ' L 2  2 2 0   0 㿘"@Tw  "  @T°   ``& & & @T\& 㿘6 ::" $  $  a@``@  ' "2 * `7R4 $D> Ą`   $ " @``հ  $ !"  ` @ $`' @ $4 $   @$ $ @ݐ   $@ $ $ :>,ah(@8h( > `  >t`  㿈 d'& $`  `&``## #\#`  p @#X& l&  #\#`  p @ޚ#X& l& p> ''жc<'''''''' ``'`    '/ق '''/@Ѐ    t 8@`?" 8  >  /'/@ 0@o"X> c<' `#> =`cz`"8, .0`08 @* @ @> '' /''''@/܆  ,  <`cx`l @(`0`@* 8" 8   ''Ȃ 'А''/''''@/؆ (@, @"p> 'Рc<''''''''' ``Y`"8 `h" @YЀ !    <h`"T @Ű`? ) Ѐ  8`F" 8 B> `3`"'    > D`?  ''/ـ / 2 <h`T> =a /'܀/ ``` 2  ``2 @"0@Ȅ"㿘_ " @K (`0``"& @,  7@  ``(`(  7` 7@> rc`@8` @ ˀ 0 7`27@> rc`@8` 㿈0?c t( @ #\   <`" @#\   A`G`" t4 @ `K> r``(`V @#\  m ^6 t4 tb`ߴ> saP  > @Kap> !x@y > @v Ё> saP > @:ap> !> rc!xL   7 @@< @ c!x(  > @ap> @M!> @J 耧 > rc!x(‧  > @ ap> @;!> @8 ր > saP > @ap> !> rc!x(ŀ  > @ap> @!> @  > @ap> @!> @  㿀 ` (& ```& t& l& p`(`. >]?`T <)  `> r p `*& ` @  #\   `  p `*& ` @  #\   > s p ` ``3E`(`& `.  `& l`3(`& `.  p`r> r t`  @ `#\  h  `@& p. & ` p`  `` `@ ,& `.  *  (``(`2 ` t`2> r ` c!x  > @ ap> @O"> @L Ѐ 6 @@< @   ,.  aP > @ap> "@1 > @. Ёc!xW  6 @<  c!x(π > @ap> @"X> @ À> rc!x(… > @Вap> @"(> @ ր> saP > @ap> "p> saP > @ap> "@> rc!x( > @ap> @א"> @Ԑ > @ap> @̐"> @ɐ 㿐 \@6* . @ & . `?& <. . & @`. `> @)"``45`  4> rc` @8```' `& ``  (@`( 瀤 |   t`"]  4> rc`  @8` `(``& ` @ƀ `@€   & H& L . 6 ~ &  >  . @`(6 | . ``$  x`& x ?7! H   L  , ~`"u +``"\ @ P`" T@6 \ T` @6 ^  6 ~& L & H  (`(.  >   p. 6 |!6 ~i`:2 P @ `   #\ ښ d   `~8  (@`c   @ `  #\ Ú †  ` & d @: P6  `   #\     `& d`  @ ` #\     `& d`  0`(`  +  #@ ` @& T& hs& P  @ ` #\  t s & d` ` `  値 `& PS& T 8ހ Ԁ  @*؀  P > c<@' 0`(` 8   @ 0>  @ `#\ 5 ?쀠` ̀`  ("     @ `Ӱ 8 @Đ"㿘 ̀`1`3`9(` dc`#> wcc 2$> wcd> sc`D( : @> F$@@ B$@ `$  @> a4> > >  b@$> > >  b0@$X > c<@'  0`(`쀧   > c<@ i>  ` @ `#\Ȗ    ?  @`` ``%@ 4 @ "> ```@`@K >   %@) 値  Ĭ@ D` "Ɩ ` Ė "2 @$ ۰ @Ɛ#㿘 h`" TP` > s#@w`"P`P`2#> saP  > @ap$< > @F#P>  @B Ё㿘> s"`@;  8" 8" <㿘 &> s> wa#>  F& `\ \X` X da4d`"@ t@ 2㿘.`@``$`82 > s@@2 +! ?  > u@!@``8"> s `"\@`@`"`D `@`D`> s `@Ԑ"`@ `"`<㿘  @ `` & 㿘 > s a` @" @ @埐`X`&`X@& H> = cx> 7c<' 0`(` 8    1>  @ `#\ A  ?쀤 $  `(?`2  t    $ @›#(> %> t(c<' ;#> u`Д X @  `@  ``  H @~ L@z @> s$> b< $  H@c  L@_  !> s@n"H@+`В"H`@S  $(> @F#(㿐 2 ??$ c$ $  ``@> b ``@>bX `J L H  `#` ( @$  @$  @$  *0`2@ 2 @ @\ 2 @0@ |'('0`*2@ 2 @ |' @H 2 @0 H L㿘> s c(((@ ' $`$`2    `  c ' @>  $ $h&@$x`&`&2&&@ d2 x "`"x`&㿘 c '?2 "&&&@(> sc( ' `2 ' ' ch&@@&? $@>'  ' $h&@@& > @cxb&&㿘 沖 @H0  :" (`* :$`2* <$0 2   " 4" ,` @ `@S l`(> c<7\@' @?s'Xz``gj`"`( @Ew  ;t2B :4 8|  $ ($`2, <$0 28  > c $ $ $ $ @0`": `"@  66 ,`@@& \& `. & 6 \` `R`:> <@ > `, :$ 4$ ,> c $ $ $ $ @0`̀`  4, $ $,`0`0`, , , ް(  @( (6   @``,,#\    @b > u`@@6 /@(@$4> = ,a@ (``,4, /4 X'X '`/'ܐ/    7ܒ  @  |>  . . \  n`> =a@DCl>     @  c> @#8㿘_c@?``  @ER   `` @@B @F   "6 `$@8@C&`>@D0 `@$`  @$ $$ $ $ ` @@4 4 4 , `:"2 ,  $ @ `$ *`@4  @/ ( `, (00, , `" :, ``?(,  @,     , , 㿐  @ ``` @A @` @Fy& @ ? `&`2?  @/z `, `  @(`0`0`,, , ``?8Q @,   , #   @/X<(,`(@$ `  @@@U444 , ,  $  ,$ ``:  @ @I ! @. .  `   @*@ @ :* 0`0`. .  , @"@ * $ @?㿘 $`"  @]& 㿘`$` @_Ĕ &` `?㿘 X`(>  ta4# 0  0d `2d`> uN!(> rc`ap?@8`1> u ap@f"ā@D 㿘> u?!(ڤ > .'> bᏐ X` 4 t@8`` 1> .@7"؁@Up 㿘> 7cP>  @^c@W X ̀`2y>  d `P  h" ` `a  ` !> u c@ ` & `  `  d`2@DC @ ` 2@/ @t0  ":    ? @ &  & > t@א#4> rc`al?@ al8` dd`2 h@D h@?> t@ཐ#4> rc`al?@ al8` h@C  `> u a > >  b@]%h> 7cP>  @̒c@y} D` " 4> u" ʀ`@@Ð G,   8 Ȃ` &" #` #\#x#h#l#p  d#d#t$ #|##> u㿘 )'> .> . bآ -> u +> a4(`@$Ԁ` ̀`   `@$Ԁ 1> .@S Ԁ`$Ԁ 1> .0急 @""㿘>~> cT> r> wcؤ '> 'Hp@А @Ho 4(@a!l@ -` @ @/  0ݝ㿘 !@-O`  ` ` (`   @. 8!. 9`"0`. :#. ;`$. <%. =``&. >~`` `y P`   . `!. a`"0`. b#. c`$. d%. e``&. f`. `. `. `. `. `. `. `. ``'. ``&. @-s``p  `> 0 @0`0`. ǃ0`. . O. Ń2 2 . ȃ2 . . . > 4. . . . ` . `. `. `. `ʃ0`.!`.!``"`!`.!`. `. `. `. @.`. `. `. `. ` . ` . ` . `4. p`5. q`6. r`7. s`8. t`9. u`:. v`;. w`<. x`=. y`>. z`?. {`@. |`A. }`B0`. ~`C. `D. `E. `0`"`L`. h`. i`0. j`0. l. m. n . o. k`L. `M. `N. `O. `P. `Q. `R. `S. `T. `U. `V. `W. `X. `Y. `Z0`. `[. `\. `]. `H`"`d`. `. `H. `H. . .  . . `do?<. =. >. ?. `hl?<. =. >. ?. ?. . . . `0. . ̉00. . `. `. `. `. `0. . ԉ00. . `. `. `. `. `00. . ݃0. . `. `. `. `. `0. . 00. . `. `. `. `. `. `. `.!`.!4"0`0`. . ȃ0`. . . . . . `h2<?. . . . `> c<' H "[  \ ``$ \ (F`d$2T \(`_ `"E dc9> rc`ax@`<`''''''''''''' `&/ `&`L`2  d?/ ? ? d> c4@a`d2J`ax`0>  ( (D(\ > :(> rc`@8` d(` ΐ `> rc``@`8`۰ @Đ  / ' d> c4@aD`d"ax`> u@"<`?* 2 ;ax "6ax ` && ` `3`       @1`d > @@c ` &K`(v> @c#lax        @`d`  d * \* D* @#H㿘  ``` ``J `F`"` `O`"w>  ..`> a4 `` ``(` (́ 8 `8 (́ `(` (́ (`A (́ .`  .`" ">  .` ` .`.` . ">  `" b "  7> rc`h@8`h  (́ `. h `'T'X`2 `   `|``ʀ"z`p `"` `P` h ` N`.` $ @ `+`0`(@`$  @@, +`0`(@`$ @$-`0`@8H4 ` K  U 2W` @,(@  ?b% ``PA `LA\`"6D> rcax`> T`T 0`P@=`P  `  @ `  h@@" 2`"` @ ` 0``( "X  aۀ, @ > saPD `"TX@'՘ ( -`0`84&@`4$( @ $ & `   ` , `   .,Aaۃ(@@&f ` `" 2Y`"2XT@' ߰ -`0`84&@`4$) @ $ & `  `H  `   `` . ` >  .,> a4 ```8`Ѐ``(̀` (́ @" $ `  ``Y `T X  ` `2   ` ``: `5 X   `2'/`> r ` `" < $4$> rƪc> @姒`p, `  > a h> a( >  > `(#\#`#d#h#p#l> @嵐 0(@ $ 8`8  `? b%`   3Aaۃ(@  4Aaۂ#@@8``` #\;`> ` @匚` uT> @U`^ `  > a h> a( >  > `(#\#`#d#h#l#p> @d 0(`(```] (́  ,`2 (́ , `  (́ Đ* `_,.`(6 ` Ț . 2 ` `" ` Ӑ " ` T`T 0> rc`h@8`h , ` @( " T`T 0> rc`(@8`(  (́ d` D |``@ $  L H#|#  #\#p##`#h#l#x#d+#t  ` -` 0 ` (@f0㿘 `' ' `& &d!h"Q``  `" "" `$1i ,`"0 ۰ $􀠠`  8  ?` 8  ?` 8  ?@8ل :`? (`2 "`0"`,"`( ."`4&& (& ,  8  ?`  0@8  ڄ?` 8 :` Є? &`0&`,&`(&`4"ް  Ą?`   ,㿘. `> s^"\ "c$ `8 2 ` -  2 &`& "H `&@2 ` " '`L> sD`H> s\`D> s(D(\  2 > s@"` `> u @! l> .`b" ``8#"`8 ` 8`8"  9` 2 '٦  "<" <   `< `<aP > > `@z > @㥐   > @㝐 В> s?@آ"`> > `@_  棐> @㈐    > > >  b@A"s?拐> @p  ̒ 㿘> 7cP>  @c؀@]&) J#  K> r `2 > u`>|@>`&> u" > u&a` &`!l@`>&l@k#`@] x`8[? > @a> @ > s?@"` ? Ͱ? &㿘 P`0 0@ " @%? `z z3 `x x.1"` 8   ?` 9  `"  ذ`2԰ "`"`"@ "` &!&&  퀠4 ` 8ބ  ? &`&`&@&` "   τ?` 8Ą  DŽ?` 8  ?  `0 0@* @8 `z z `x x 4"` 4  2 0  8 *` 8 *` 8 *` 8  ` 8  ך P`0 0@* @8 `z z `x x 3"` 3  2 0 8 *` 8 *` 8 *` 8 *` 8 *> c<'  d `  X@f> r g> //x\2''> rc)> u@!(>}p $dJ> ud8G @> Ѱ?d(d,e `\`(z8(`x `0 D` =!( '> a0 p`0"` p`@&p> c`?@8`@#` @X"$ `0x`8 > u?@S"0> @aH  > @=  y `' ' `& &@D"M``  `" ""X`$*W , 2 ' `  8 ,*` 8 ,*` 8 ,* @8 ,:` (@8 ,*` 8 ,:`  ( 8 ,*` 8 ,*ޚ` 8 ,0 $ w `' ' `& &?C"K``  `" ""V`$*U , 2 '`  8 ,* (` 8 ,* (` 8 ,* (@8 ,:` (@8 ,* (` 8 ,:`  ( 8 ,* (` 8 ,* (` 8 ,0 $㿘> rc`@> s8`|"\ , 8 (  ` `@  ``"`& ` `  㿘> rc`ax@8` O50 "2> s @ .> s&0 8&> .b"   @ @  `& & 2 22@2 > s "\ 2 80 ˔㗖  2&00 `@0$ @ > @zah  > @ߥ p   |  H/7/Б* U L * O <  @77 w&@ ̀`t  "r d  0 H H `I  ``K > @a4 `"M `@ (@2 &`&E "B  (`@```& >  H ">  L`Ԅ `@ gH  |`$ . v  @`$ ()  ``>  +`> @a4 `2@ ``@ ( (`@` ``2 u`2  "  <Ј  u`2{  2 |  (` "R @٦  L ` (` 5  ٙ@ . 2 | (`@     L @(`@     .  `& *`v@  `& ,*`p@  . `& |. `2 `@2 @@2 c |@ @@ > > > Z b@E> >  b@=> >  b@5> > >  b@,h |   H7 / * / L *  @(`@0 ` <  @(:0 &@ ̀`"  " d  0 H H `[  ``] > @a4 `"_ `@ (@D &`&   `(`@``&@ G ` H,@` `#\#``,@ z   L ,. ,`&` @ #`#\`h  @`$ (  ` @ @7 )  ``>  +`> @a4 `2@ ``@ (̀  "U H,@@ , H@` `#\#`@-  n " L |`$   . W q,` , L`  (`@`z  ``2D u`2@  "<  < 6 u`22  ,  ,  @  @@@2@@`& ,@ `& ,`& f.  L,@ `L,` L,@   | H,@x,p@ L, @ 0` 2,`& @2'`&@ 2"`&{`, @ l  g  @b @ ] V |`$ @  `(8 |   H7 /'*  ל/ L * ז @(`@0 ` <  @(0&@  ̀`"  " d  0  H 0 D(` @`` " ` ``"  ʀ`b  `&&  "X @@ "`& `&   `(`@``&@  ` H,@` `#\#``,@    L ,. , ` #\`&@ #``ؚ  @`$ (  ' ` @  @6W 2@ ``2w u`2s  "o  <"k   6> rc`p @8`p  ` ``" P 6> rc`p @8`p^ 2i@  (`@``&@ t `  "K H,@@ , H@` #\#``@S   " L |`$   . r ,` 8, LT`u`2  `& ,c@ `&_ ,`& S. `( `( > saP ) D) \@ T&@`Q > ```y 8``s 4``m``" 1 @@ PC  **@`   d #\#`#h#d B#p#l#t  #x$*#|## *옖 . L,@ `,` L,@ | u | H,@],U@``"``" 1 X`@  `L@`d`@#\`#d`#`@#l#h#p#t  L H |#x#|#S#@  8 *@ d` * #\ 4#d`#` X #l#h#p#x #t$*#|## *1 @ P4 @ <@8L @ T@4X@ 8@L@@ P@(E(]@(`D(`\ 6 L, @ b` ^ @Y@ 2T`, @     @ނ @ ق  |,  , @ @@@2@@`$ @ . `(> @AaJ@ ` > @l @ ` `#`` 4Z 8@ | d`#`#\#h   L H#d B #|#l#p#x###t/ -6= 8``7 4``1 `   @ ) D@~ D@$ P@ P 6> rc`h @8`h㿘  |  K   ` H  L `:" ` * Լ ,Ե  X(`@0`   Z(0  - ,' 0,& |4$@y2 @`@ " H \ X" |菐  > s@А"`  H @ L ,@" \w  2      , `:" `* ^`-`W "o   \(`@0`   ^(0  ``: , ' 4 $, & `"h&@&&@> saP  > @>a@܄ > @i Ђ `Q``` `[,$ @ ` `S ` (  $} x @s L 8 m 4h 0c ,@^X \|  \(`@0`   ^(0  , '@K 0G&``j` L`d-`$ @ ` `\ `Z :y, 'w, ' |''''' ''?'/'/'''''''''''>4` > Ő` ` ~``:    \ ^6 X6 Z> wc$  '''+> rȬ ,   ?@"# d'쀤 +#x@<#x <@^_c $y" ` $u2 #& $| |`?"  h $|" $} " $} l 'Ā 쀤 2#x@''d'$p $. @l耢?c솀@=c $v``"  ~@m  ~a" $t $t ";$p @  @w | .  $t`2  ~ x`" ~ $`2 ~c @@9 @ `. !x(eܐ > @ap> @!> @ Y @` ԭ`6 ^76 \P'쀠" $ " $ pF'쀠`"" $``" $`" $`" $`" $`'   "   ו  , " T t'쀠`  ` `  ` ,2 t T`" T`"  T`" P T``"n T`2 \ y " @  0 @V  \ " ~ x'' P @` G \ 2 x ~`" -`:`Ҁ`" $$p`"! $ ~a" $"' <~ ৐  $`n`   $`f`  @C3 w $`_`  @`? l $`X` )  `M $a"6 ${> u` #@@$'܀`2@Ѐ`"  d" @ ` @1 ``ʀ`" dpqЀ``&&Ѱ `$p` 2 $䀠 $ )> tc x `` C 79 x@9 `   $ `2  c`(@8`(> u` #@@˽'܀`2@  + T``  0F  T`` P @B  T` " `2  `  @ "   hl  " <c`H@8`H $t`2- @πa2$p -`2" ]`2" `" $$|?@2" $l`2" $``"$p"'6 ^6 \`G@os B @@r< ;0 T``  @ 0+  T)> t @'#4 $`h$`l$`d``@ `d ` `d` `h" `` ` `h` ``" $ ` 2 $``ʂ`4`ʚ$p`4`$p" `4`ʚ (`@ ` 4`@4`) ,`,`4`4`,`,``,`̂?! ,`΂ `"쀠``   ,`\,`D,`> > a04$` `$``ʀa`0 ,` Ԁ c$p@> . <. > s&a ` @ˌ c`$`"" `X `X2 H$ ,@(2 4` `". ؀V `2  "   (`(` (@` (#\ڵЂ@7'Ѐ"$@ 2"$@!$T`2% @#`" $R @ʒ $R`2'#`?u  @`  \9 "F ~> rc`8@8`8 ` Q {" "$L:",A$N*`"< @ |2`   z $2"#`" -@X*@U$c  - 2 ( ] 2 X $``" $l` $`$X$\5  "`" $l`"T$p` $l$d$h2  2H$p"'쀠`  D` 0 H` @ L`" \0 $~`" $@25" $`")$p@"%$p"'@9Ђc`( 7@8`(    2` @?@`h"`d  `d  ``" #4  2#4@_ `܂ `R> u^}&"' *ԥ \ 2i ] |' ZԜ ^ 2d $` ' H#\ Q @c`h@f8`h@? $Tԟ̀ #*`: @ |2` " " `` ` ` ````` 򀠠 $t` &@&' n'@ $x`e"*'`:  ,`͂  ,`\,`D,`ސ &)b`"e$|"' h$`4$`8 ``"- ${$`< `" `8`0$`8,`E`"  `E` 4`@( 0`(@8@4`@ `" `8`$`8   ,`\,`4`X$`P,`D`2$`<D`4" $`< $`<`<ط  'cؔ@=c@h2 @> u @f# ' P$p@ $. @g耢? v``"j@c`` ${` |(`0` @,`D$`8⦐ *  H2 *  L24`B`8 |  L H`#\#`  * 2 #|#l#d#t#h#p#x##Tc p 7@9 p   c`X'؆'Ԅ@8`X o7`H@Ɣ ac`ʀa"9 `0`4@Ѐ ", cax(R  > @Қap> @ɐ!> @Ɛ F f  `  $  L H | D@ #\#p#t#|###`#h#l#x#d/`( @78`(i`h"`d  `d  ``"4#4  2*#4㿘 .`& `.`' |\6`$p  (0  (`@0`  H  L `:"f `* @ . @ <  @F =& ̀`9 `2   d`W`"cu  `&&" @ d` @   @?> saP ,`> 2@b( > @ Ё`"A  @?  (0  (`@0` `$`"```?* &@`@ ` ` `u`2  "  < `2  ``t0€`p. &@ @ ` `h `8 > c<@'  H/ L:, `0(64Q 18640#`#d,#\ ƀ " > <@ >  0@` `(64# 68 @ߔ    < @ | 't7`?//@ //'x` `" ` )[  `/7/ڠ*  ڑ* tx775 &@ ̀``" d  . (`@` $ .  $ @(0` (†2w   ` @ @+ x (@+ i  :` x 6> rc`  @U8` `S> 0`2P(64#\#`#d[  A> @> a4 ! @(@"3 &`& `  ) @``&@@ ,`?',`$ | . `$ @(0` ( `Ҁ`,`& X@ `& ,,`S@ `& . > saP(  > @Tap> "@Ђ> @  #\` ( L 'a ЂԄ(' '?H' ` #\`  / ?  26> rc` @8``(`@'L/' '?H''x#\   7//ۑ* ݐڑ* אtx(0(0܀ &@ ̀`" d   `&& 0  H 0 ` `Ԧ`  @  ʀ` > s @ > r (@  > saP89   @Ā``&& `"  (`@` &?``f+  + ` #h#\ #`#d``4 $ .  $ @(0` (  T+ @ + @` #h#\#`#dܚ  Z 2x  ` @ @)| x (@)v xx#\ - 47//ۑ* ڑ* tx(0(*0܀ &@ ̀``" d  @" `&& `"  (`@` `&``R+  + ` #h#\ #`@#da`倣``$ . `$ @(0` (`ɀ`?+  + `  #h@#\#`#d4``"[ x @(Ԙ & ƀx#\ܖ ؉ >ܔ'PL640,#d#`#\ > @@" `&& `"  (`@``&@,`?',`&` ̿  ݐ  `  @ @( `& @ `#`#\ + +`@ @ ৔ Ő  :. `&̟ 4`,x @(` `$ @  `(. `& *`@ `& ,*`@ `& .   ,`@`r `> saP(  > @ap> "> saP(  > @ap> #(.  , H @ 2  "} `@ W  L,``  @2  `"  `@C  .  , (` @` () 0`0`**  @ ` @' 4҅, H@@    L,`@@    .  , (`@` " @  4 , ( 0`  @ ` @' > saP(  > @aap> "X@#x``2Y u`2U  Pt"N    ` @ @' x  @' א  `(`@T`(` B #\#h#`#d  ʾ `3`+(` @ )  $  @  2  $(`" #h#\#`#d  ʋ (`2  $  ` @ @'& x  @'  Gx 0 H K   .  C  z :?.  `(`@6`#\  ֿ h 'Pɂ640 #`,#d#\R  6> `230`2/(64#d#\#`:   > @@" `&&& `"$  (`@``&@,`?',`&` ې    `  @ @& `& @ `#`#\ + +`@ @ Ô   . `&ʻ 4`2,$( 27$ў @| `=`20 u`2,  't"%  `0`2G u`2C  >t"<   `&& H  0= H H: 0(` `  `` @ (` @     @ 2 9 W  `  @ @%  `& @ #`#\ ,,@ @ ! ?  `&` :. ,@ `&`  #`#\ *H@ ,@ `&`   #`#\*9@ x @% `$ @  `(.  `& *``@  `& ,*`Z@ `& . ` > @^c  H1 > @ˉ"  L* > @˂"Y@> @|#@ ɿ ݐ  `  @ @%  & @ #`#\ `,,`  ݧ Ő  &` :. ,@` 7,`x  7@%^  $ @  `(.  & *`  & ,*` & . > rc!x8   6 P @< P+ @+ + @=+ 5(`@2 `$ (`2j c $+ I+ A+ k+ c`@2 @@2  u`2 S (` @   ނ  @ق @ 2Ԃ `$+      @@ 2+   ʼn+   @@2 @2 @ 2  L> saP(  > @Cap> #x> saP(א  > @7ap> #P(` @ ΂  ɂ  @Ă  2  $+      @ 2+   +  @ @@2@u`2  u`2  ` > @גb  H̪ > @"  Ḷ > @"@> @#ɀ ". , 4`+` { `$ . `$ @(0` (`S`  ` @ @#ߘ x  @#٘ x @#Ә %  `(`@1` ^. ,  4` 耡 `$ . `$ @(0` (``"  ` @ @# x (Ö `(`@`(`@" #`#\ @#d#h  ֚  (`@2 `$*@ q4`+`@    #\#`#d#hƳ c(`    @@b @` (`3 @B*@ 3 В * 4 4 @4@ 4!`(` @ &  !  @ @ 2 `$(`@ =4`R+`@    #\#`#d#hA /(`@"?  #\#`@#d#h  + 1 (`@2 `$(` @      @ @ 2 `$$* *+`@` @ $(`  4 4 @4@ 4̀`@` O(`(`  2 2 @@  ( 27> c<@' > w7Fc'@'8'4'<`.> rcah"  h`"&TP "*ax a2 `` > `:` @' +`: @ o> Ԥ  "P P 2 ax`  > @Вap0> @#> @ 0 HبF#\** `Ȁ``@`&,"OaѬ `/у6`9 8` `" `ʀ`2 `@цax@`<`@/ф 7F L ` `@G `8ȃ(`@D`Ѐ8ˀ`2 `8 `ڀ`(`<̀`"8  Ѐ ` `4 ,Ѐ` Ȁ`\`=̀`4 <``"4< `Vр`"m8`Gv` 8G@4@\$8`\<`` 2 W@ 8  v`"G@4@\ `π  :`(:<2 2 <"" " " <@`:(`:Ѐ  < d2 <#\D* `Ѭ `,/@ ,6e "E&P < d` Ȁ`p`!`?` ,a` , 0``"(0`@# , 0`@  * 2 `8@݀`]<`2 & <8@u& ΂  `ۀ`@#<G <o `~ |&`" `` `0`ƀaw(0``'`K`:`〠``8Ӓ* 0`t8@e48 `d'<`h'@ `̂@/@&Ȁ`@`2&@rx&@n:` (:``` `2Pa28<8@54 *  U` 7F@J<`@Ř#@:g&<ddV@d"<ˀ`2<0(`<`?e88 `",<@4* 4`?LȀ`` ax @7F <`  <  > @Şap> @͐ >   @Ȩ /`  `?@* 2  8ʒ* 0``^@du88`d'<`h'@ `̂@/р`_<`܀`ʵ,@ǃ6Ȁ`>` ax @7F <`  > @Vap> @Ņ#>   @ŀ ͨ8* `8@K`?<  > @6ap> @e P> @b 8 8@4ɐ8* `8`2`ܔ<@R48P`m,0P> 'c<' #> ``;(;&'@ d`2& > @ď d``du@ `?' `'8> saPِ > @Ēap>  @> @  'Ȅ /''''''''/ȢВ d`n c p` t`  p x` |`"  p  " N[  e "d `'> sЀ`R`r lE"|@ @9 d`( l @, pd 沖 @q '0h` 耠` 쀠``"cX1 cX 2 K : `(:#\  @ 0C@#@Ë 7dт``2 X7҄ #\#`  @R > saP( > @ap> @ ؂``ဠ`2 X7ҝX> 'Ġc<' (> $`"`;(; &'Ȣ@ d`2&@"2 > @t!d`{`du@ `?'` `> saP ֢̐ > @èap> @א! > @Ԑ ɢ̀  8`q" 8` ''''''/Մ /d'`('ТFԀ jc p`2' / *M  Q !Ȁ`` `8?`> saP > @Zap> @É! > @Æ |Ȁ`2'cX 2 r 沖 @^ '0p@m̀`B> `P`<@8`P4`20:`(:@eM0XȐ  @  "/@$ C@# #\#`   @QĀ > saP(Ȑ > @ap> @0!H> @- "ȄhT` T@} l@ 8!6  ؀`8>  $h1 $x` x`$`#`> ,` ,! @d!> ł`h`L `Ldv l   @Md"!>t0` 0Ȓ `@*`6 Ȓ@N 'Ȓ Ƕ'> !Ȑ@  'ȶ&@6> ńhD` D`0"14`2-0 (-"(4`"" 4( "D`, , 4( ! ,! 4 0 0`K 0 0(@"J ( ,! 0 (`024 `4 4! 4ɒ ,`",`4"7 `4, ";`(,# 4 ! (! 4 0 0`*#`0 0(@"? ( ,! 0#`,` ( `00`1"`00`(@"#`(#`, 0 , "! 0 (! 0 ( 4! 4"! 0#`,` , `00`"`00`("#`(#`, 0 (  ("! 0k#`,"(",4`2`4, "`0 4`w`0  4"4`2R"4@ L`( 4`2( 4,"`4"`( 0`0`R 0`0(@ " ( ,`("`0 ,`,4`.( , 4`y"`04`"`0`4 4"`4 4(`"`, `0`0` 0`0(@ " ( ,"`0 (2"4 4("`4"`, 0`0`F 0`0(@ " ( ,`,"`0 ("" (4`2`4 (! 4  , 4 00`K! 00(@" ( ,! ( 0`((`4 4"`4 4,`"`( `0`0` 0`0(@ " ( ,"`0 ,2"40""" ,4`2`4 ,! 4  ( 4 00`#`00(@" ( ,#`, 0`,s,"""㿘`(U`,2(^`0(`2,04"0`""`(@"-0"`,0@",`(`( (`, ,`0 0`4 4`0""(@" ( ,`(`, `0 0`  `0`2`0 @"`(`( (`, ,`0 0`4 4`0ْ"`,`0`4"0`""`(@""`("`,`4 , 2 (0 (`2  (@2 ,0  ,@ 0`  ( 2 ,0 ,`2  ,@2 (0  (@ 0`   `" `6 , (`2㿘.``?6` ` ``2/ @ ```2- `? `@2 `@ ` `@. 2#``? 8. 耎`@҆(6 8. ӂ@6    ((`@() (00. .0. . X > c<@'  0`(`쀤 ! ` @ `#\Ȗ Ț .`0` ` ` 3   ` @@ , ` } ƀ@+ 4 ` @   7ƒ`@ϒ"@ @ ` @ɘ $ Ĥ> @!h㿘  ` ;> rc` @8`  "> r` ` 2> r 2> r@"(  ,   ($  *` ߓ2` 4  ` ``  ```@  @| "ӈ` І     4 4 㿘 @P>  D` `G   @(`6 (0`! > s @> saP. > @ap ? 6 ,> 2`@"8>  @ Ё 2> saP > @ےap> @"h> @ Ѐ   > >  a@!> > >  ax@!@> c<'   `0`  0`L `"@``"< @ ` *#\ Ƞ 8  0`(`쀤 1̈    ` @`(?` ``( $@ 4 @  '@ `  @2`*@ 0 ` ``2 @ @%ڐ " `2~  `  > saP8  ς` 1 "0 `"  h" h``2 h  `N     `!`  > 2 h`"  h Ӏ `π ʈ``ǀ "ݰ @˂> rc!x(7` > @ce > @  *` c> > saP8Ґ  ς` v1 > r `` G` ``/ / / /" `" ``2 ``/ / / /" " `2 `  ?@"  @ ` `@( )  +` "  @ ` `@( )  +`a0 b(> s`": hdd> x@` ٬ @`(* h `(& h (`(`$$, @#,  `  @`*> rcax8 ` 6@`0 @<`0@$ ,   , ` `   `  0" > @b> @& (` h  ['  j  S 4 `2+ > > >  a@ɔ#6 @ 0> sP` ```>  @cǐ B > @ 0c!x ` 6@ 0 @< 0> @b> @А _0<c`2xu > > b@> @ ڀ`@!`r l Ьb@&@'> @xp ` ``"@ "" ""@8 8 ; :` ?  3`0:: 12> @#%> @ax`` @Lp#@> @s# @qax` ` @8p> `` @d#X@bax`` @)p> `` `@T#x@Rax`(쀦`p@ " @Eဦ`" h `> r< h> r㿘 0`" H> v@7!$ H`1> v@1!$H> @c<'  > v @!$&@ D  "" " " " "  `q" `"g @ ` `"2 ` 0`(- @`(  ` @*#\ ǚ  ` 0`(`쀦 $ ̀ ` @`(?` ``(= &@ 4 @  9> ` `@`0@F@$  ``/`/@// `/ `/ `/ `/# @ @ @"@ ``* ?Ƣ@ @`* @!> > >  a @N#㿘> vX! 8"- < < < <? @ @& 8 & <> v3> v`L  ? @ $@$ @pa&a @ "  & D1> v@^!> v a  8㿘%> v (`@֐> saP> va`@ 0` &` > @ap> "@@" 8> @ 㿘!> v @ L > v`  L@   > v  6> rc`( @8`(㿘> va> a4> x /c| H!@ *> r> cجp> > `XY`  H@ x`@  @ː@ɐA` 2 H㿐````@7, 4 `> ,`(.`,2`2 @ @,` 8 `> saP   : `@$ ` , : @ 2 :@  > @Lap> @z > @w ހ @H    ,(@ &> @ސ h㿘 @>   ? @ $$ @&!> v@T L%> v$@`" L@ `? @`` $@$`@@=@$@` @`$D@ & D㿐#> v `L   #\> @`!> v P!   #\> @ݚ`    #\> v> !$@Ӛ`!@|#`L c@ > v aa `㿘  ` ` * , &`   `% % `$ $"  ꀢ  ( 2` \ `$U  㿘˒ > a4 8" H < > v < <? @" <?" 8!!`" 8> va 8 v!#` 8 <? @" <?" 8!`" 8 8#`㿘 @` ` F ,`" `   `% % `$ $" 逢  (`2 &`0&`,&`( &`4 && (& ,  `$ݒ   &`0&`,&`(&`4$ 㿘`W``"`"`> rcx;> v`9> v > @ap`> @ > @ ?c> rcx;> v` 9> v 6@=`L@!'! cx` #> v9a 7%> v @ > ` L+`2@( D6 L`+` D``*2`  2@(`0`6 `;> v`9> v `="`   2`    2 ? @8  $`ۂ @ ,` 0x;> v`9> v > @aap> @!p> @ `L;> v9> vĀ ``2{ x`  `@ ``@ #@6`6` e* +`00`] $`   (0`͢> ;> vap> > `9> v)`L`"6  ?$`  @ $@$ @K!'!````- $`m`@ (0`@ x`(@ @ @`2  ?& D   $@$ `L@!'!" @`&@ `&`$ > @Ȓap``> @ @ > @ 逦> @ap $> `> a0`` @ > @ݐ > rcx;> v`9> v > @ap> @͐ > @ʐ €;> v9> vx`N :;> v`9> v  @谒 c (ug> & @ @& Da4a& H`!6 L> v`b& 8 8 <  @& <`\&@ @ `& @&`x,``"0 @    @4 x4 `M&@ @ `& @ @&`> @Aap> @p!> @m 0j& D > @4ap> @b!> @_  > @(ap> @V!> @S `@M   6(;> v9> v@?=( 8! & D> >  a@!I& D> > >  aP@!ih> c<@'   $`4`4`  (@`( @4```(@4``̄4` t t````((`@( /'// "u & "p  @` L D `?`x`, &0`Ȓ@   @n X``"(  $( @R  A 2 0`0`@؃(`0`0`,`,`.`0`W,`/ , 00`?@؀@> s> rcx89 ,``,` 7@ @<aP  @ 8> ` 7@> rc`( @8`( > @+ap ` `*> @ @U"@>  @Q 0> @ap> @I"(> @F ,`@   (@!> @"> > >  a@"s㿈 p`  @ #\    > saX"  p  n*2 @@ h> c<' ` w"  2 `(`2  ( @2  ?((`2  2  '  '/ / /'젒 "I & "D  @e D `d@& `    $  @`?4`@4`.`,00?@c> s> rc!x) 4` 6  @< aP    >  > @Map`> @z"@>  @v 0> @@ap> @n"(> @k Ѐ@!> > >  a@$"#㿘 @` ?((`@(``0> rca @(2 @ax`) ` 6@`@<`   @'   @    (?Ѓ0`@2   > @ap> @"X> @  р`㿘 / `+ , "'`   `% % `$ $"  ꀢ  ( 2` y `$r  `"0 `2,-" `"" "D`   ! !  `K  @"J !  `2  ` ! ʒ `"` "7 `  ; ` ! !  `*#` @"@ ! #`` ``2"`@@"#@#`  "!  !  ! "! #`@`  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@U`2^``2 "`""@@"-"`@",@@ ` ` ` `""@" @` ` `  ``2` @"@@ ` ` ` `ْ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`U`2^``2"`""`@"-"`@",`` ` ` ` `""@"  `` ` `  ``2` @"`` ` ` ` `ْ"```"`""`@""`"``  2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿘. c`dd`"F $  @Aɰ  Y 8`e`h@$d`>  bp  @(@d @$c /@$`@(@d @ /c@ع`h@  9> saP%  @C2 $> @ܒ`c`h@$d`> N `> ےb $@  > @apch> @ܐ"x> @ِ Ґ,@@x L@`  @ @w$@B d 㿘 _> wc[ 8`W`$`Sd`O @`K D`G @B $@=> w 4`/d07`$ 8@B dh0.d`*`$`&d`"d`d`dx@d@d`  8` ` @B 㿘#`` &##$h&#> saP &#> @ ap> @;"> @8 &#㿘 `h h@ɐ &   h㿘 $@@    $@ h> wސ#d @B;㿘 (`8`/" > wc۰ $h㿘 @Z H && & & & $& 㿘 #`h h@{ &%  `" &`&`&@ &` &&&   &`&`&@&` $@ ߄?㿘 `h  h@F  &    h 㿘 `h h@0 &    h㿘 #`h h@ &%   `" &`&`&` &`&& & Ӱ  &`&`&`&`$@ǰ ߄?㿘N> wc/ N`/" ; $ @?Ĕ @$ /@`t%,@  / 8`@$L`a> 7> w`ȴd@ / "DL-@L`T@ֶ ?N$@֯h#G$ @? A$`$`(@۔ @ `h$h@Ӑ@$$@ -$$` Z > sdh` $d``h@@ 0,aP rd@@ @@ 0~ > saP @@ @@ޒ 0o> @zap(h> @#> @ ے> @kap ( h> @"> @ ސ㿘&#.$.$N`i $ @?  uN`/ ,d`8`",J`h`2Z`h, N`.,(N`.2' N`/"(`2d> s d`,dN.2 N`.2 N`/2 L`O@- / 2*, (`2+> @$@ / > @ђb  ސ @@Z> s8  $c$`"$,d.@$ `@Ô$ԒaP  > @גap> @#x>  @ Ё> saP   @@% @є$> @ap> @#X> @ 㿘 `h  h@x  &    h ? 2 @? ?  ? 2 @? ? > .b* H0` L@"L2H` L㿘> wch > s > s aP > s aT> s  aX!\@d   H*`0` @ "2H>c4 @ * > .2`>a" * > .2`>a"㿘 xjx&`X㿘` %  " @ߐ 2 L H`$ L  H,1  (1 0cP P @=  @ @ L6 H`  & L &&   @$  H &&  $㿘> ."* 2 㿘> ."* 2 *`2``($H@  LH@ L` L ! ?  >`p " * > .2`>c"* > .2`>c"㿘N` @2M  &@ @4^ &@ 㿘 0>@>`0  8>`>`8  @>`>`@  H>`>`H  P>` >`P ( X>`(>`X  @@e``Ē Ĕ @` Ԕ `@[  @`@V!$ @a$@Q!d @ad@L! @a@G !a@B"b"bc#c ݐc Na䀠` bА@ &c$ `"$ bb ĐbXbh cHcX ##&c &c@J # &c@J c  @Jj&c c@  P $$$$ $$$($,N`&d&d&d&d &d$&d(&d, &d0Na$`"&d4 z&d4$8$@$L$N$PNad&d8&d@6dL6dN  6dP6dR*  fNa`" $dڐ6dT*  [$d$X&dd$h>dX&dh$v$V$`$l$p$t$u$w6dV&d`&dl&dp.dt.du.dw.dv.dw$x$y$z${$|$$}$~$$$$$$$$$.dx.dy.dz.d{.d|.d.d}.d~.d.d.d.d.d.d.d.d.d$$&d$$&d$>d&d.d$$$$$$$$.d.d.d.d>d6d&d6d   㿘 `$@OА`$`)`` ``( @O`*@O `, @O`-@O 2`(@O `@O `(@O `(@O `%@O ے`(㿐Œ`0`@א@O`@А@O`@ɐ@Oa@@OydT7@Os c'@Ol d@'@Of dX'@O` d\'@OZ d`@OV dd'@OP dh'@OJ dl@OF dp'@O@ dt@O< du@O8 d|@O4 dx@O0 dy@O, dz@O( d{@O$ d}@O  d~@O d@O d@O d@O d@O  d@O d@O (> c<' @K͐ ( " ,@<  , & (*  @; & (    $@ E$< ((` " @O> s ll     > @{#㿐@   ! !@m 'Ho&(@@mzHp@g㿐@b  !` !`  ''Hof(@!@mQHp@@m! "!g!㿘-> t0`> s Ho(@a%> t> u, $,> s bX   #> l ,L $`2 @l  c|`"  " Hp@, <> u+> l"a,c|`>@m`? ` @lm `2@,  "   ? @L $$ $  ܒ@, 2 Hp@%0°  㿘'> t0`> sa%> t , ' > u a,@l"@d, "$0    ? @L $$ $  ܒ@M, 2 $0  㿘%> t, +> u  a,@k@1,   #   ? @L $$ $ Q ܒ@, 2   > s ` $ > t c0  㿘 $`" * @G2  "3> X@Ǖ  @ē`㿘@-- $`> ` 㿘 $` @Ht* 2 & ? 㿘@3  !  ް 2 0㿘 d `"dbbb b? @&d<&b&bd ` d`b``2b`0ߐbݐbېcc "b@qbdRdTd4d0@d0`0@2@2b@2b@2c@2ސ c@/ c@/ b@/ bh@/ cX@/ 1> u@I & bc "c@&c㿘 "  `4`" `0@> w c@9Ho 4`(@a``$```(`,`0&`&`&`(&`,&`&`{&`$`" `(N``( "&`(@: &`(&`,&`4(Hp@ < 0㿘̐  `4``0@"`$ `" &`4`,`$&`,`&`4 㿘a   $`" `0`,`$&`,``0 `&`0$&`4 @> `$0"`P@"}01>@˂<I@؂JG@ E1;@O:1E@|AI@ -> .32G@X-> .@<؃Ho04(@a04@"> up01A@",HH0j`@^=0;/@"&8-0B)@-@> s Hp@ @ .0 `W@0;0'@T@@ T@"8i0 0`@"(.@'@@V0|@: D<@ >@-> .D`ڨ -> .@<0(@"p0 U@> u؂&@k> wĂ+@,@ > rc!h+ > a4!x!!tN!!h" @:D0B`@":0jcт@` 00@ D`* W@"$Y@ Z@0`@0@&@VJ@vD0@0B/@-> .0`@0"`P@c0 @"NR0 0 R@"z0T@ Q@) d%  @6ߐ$  @6ڐ$(> wc> y$c @> w chch ` ` ` ` ` ` `ް   $ $(  @ $b Тd@$Ɛ@b$ N`ဠ`L `2  "@89 @86 0k@",e32D@",AFB@C@ ,`4D(08@ @ Mc@`@0f@c@`0`2@50[&@WU@-0S@)0O`@a0j`@-> .0\?A"  > u > u?<!(     t   Q 0`_!> r @/ Hp@ h@:؁!> rb#ؒ@. 0뀠`42O D(08@.@ ߰a%> uذ  > @=ap> @l#Ȱ > @h 0˒ @e, l b L`$`$`S`$  C$`> tc, 0 @E  2 L $`2  $`@h F > t,@@0`-> .0`@" cƂ@`0@0`2@ -> .0`@"M80"Y@ЂZ@ȂW@װ `Ӑ@."h@"0V@y\@m@2 > wh ` O @" ,Z?1;@<@:@ .ΐ 9 & 8 "> w $i? . `& 2% `2`2 `2 ` `|`x`t`p @"H. 7J@"2,*#,M@Z ,`4VD(0H#\8@ 4`42G D(0<@@ װ`42: D(08@@ ʰd(2- D(048<#\@@J  \0``(`0 %> u @C J 2-  $|$$D4 $$H @( `2`$@. /0 (> .( @`|`L@8w  ` (( @@`l&,`2ΰ D<@y@ `,`2° D<@Ȕ@ T. N . 8 "> w $~? "N` Ӓ (@В ( + 2N`20 . d(2 D(08@Y@ "> u`> saT&    &> ub `&`> sbX &d(2_ D(08@@ > wh `  `> wh  ` `s > saD((&?" xNx`@ 2 ` ʐ`4 ʠ`&> saT@@* 0 @, @,7'􆈠NL `%`"v݀"F@` `? @ 7/ޢ/ߒ-`ܐ@LD-`0,Ґ@F,4?ɔ`k  1-`@` &` 6H &0`  6J $T6Bd   @3p$  @3k$(   /> t;> s ̐ " 4`" 0$d@^$ 2V`ဠ`L `0`a$"@4ؒ  @4԰ 0 > rcah > !4a`ad #at#ah!48;a`#a`#adax`(  > @Vap> @# > @ 0` > u?!(     , &Ѱ c$̰ x | 2 x O@@P@90`[@ > u?!(Ѱ *> ub4D  0 x  ` x  X`  $ t"&dȐ &d~ @!ːz@!v@.N@(*@Ӱ > ub Q  I L $`2 Ɛ " > saPT > @ap> @#> @ 0I@" 0F> ub %> l  L $`2 v " > saP. > @ap> @Ð#> @ 0#`2@Q@B S@ d|  @26$  @21$(`ɰ    Δ$($ q@]x$ `ꀠ`L `l$ "@3 @3 0N`(!> w> s a\a\ ` ` `> sbX˰  > u' >  @":  ` @ '@)@  9(> y`@ > w(c &`8 (`> w@c &8 ((> . b y&@#%@I0@հ > sbXi > ub c  @   `T + *((  +`(`* @ *)  @''? ް 0*`8' @B "@,`2 D(0@ o@ `42t D(0@ @ `42h D(0@#d#\#`48@b<@,d2P D(0@@ d(2D D(0@f@ հd(28 D(0<@@ ɰ@@X@& . O   `"&<`&  &. ;  ` `@   $<@2"$]Lה  ><@:8 6p $```2d<? `h  c  `[\0``(V '> u @ E  |` $D @4)$H@߰ /087  @8$@᪐$ @ "-@1 @1 0 > s> l  c|> s > l  c| @$@ᇐ @  "r@1˒ @1Ȓ 0 @0 ?> u!( /> 4` !+>  $`t l d$ )$`h[g * .`4`(  \  0`"`pd<$`0`pa0 @$`p$`t^ h@ȉ`h @$`h#h@) #h  `$  #ؔ x@ਐ> a4$  $ $!t$ $ ` ` ` ` $ $ $ $  ! "  D`" <$@"X@1I  @1E 0z?  bJ   @@6N! @/ > ua` !  `͒` , , ) Zє! ``2 `ͅ) ) @&@1 06@W> whS .`& @0 0)?"C gx'(HX'" "Z& ` `N`  2 &" '2ꢗ  $2増 D &V "ݢ &tM "Ԣ E 2@u 2pN`"Nx`dJ``"â @ ` 2 Nx` `@ 2 ˪` `  & F` D`2"@0@0y 0?ꡐ#d 2   V   ``&?ꌐ#d "cN A "\N ` ( @` | .x& `t `ڀ0n  [) 0i2ʇ( &@0+ 0` `$`\&Z #,$`$`` #, [  0K@0  @0 0C @0 @0 0:@0  @/ 03@/  @/ 0+> .b `<@``L` @  W    $$($ @Gd@Y$ 7`ꀠ`$ "@/ @/ 0 @$@g$  @ "@/ @/ 0`ٰ $$$#x$#|$#$#$#$#$#$#$#$#@/  @/ 0Ő@/ @/ 0@/  @/ 0`"$$<<`$$< $`"  T`"   2  $|x 0 2  $|q" 2  $|j" 2  $|c# 2   2  $`" $ $u`"  $``(  $``(  $"`$"$"`$ @`$ `,`W$`,@/  @/ 0N `` ` d<@2b ` 䀡 "bb$"" b"b$"``$``` d<b``` `4$`0 @(`Ր ` u`   2  |ڒ0 2  |Ӓ 2  |̒ 2  |Œ 2  € "̐ 0B,՗2 " u@.  @. 0> .`Db@  @ Y@$` @2@> x> ycD>~`PcT`@@`$@(`@a`@$@.\ @.Y 0@.V @.S 0@.P @.M 0s 0~@.F  @.B 0w,@ 0r@0o@.7  @.3 0h@./  @.+ 0`@.(  @.$ 0Y`"( b$"$"b" #"b$"`"$"` @` 4`$`7 + 06r,42 " PN@- @- 0'  2```B `@㿘   & ` d<b`  `& ݁㿘>~ #T > @  > @  㿐$   !> 7> u#( #\> @V`    #\> u> "@L`     #\> s> !@B`0    #\> t> #4@8`@ H   #\> s> "`@.`P    #\> u> !@$``    #\> u> #@`p    > u> !,`@#\@'@#@)> .bb  @ > >>b8@@ab$ 4> u> w a( d> w%#> t    > u aa `> u> w b㈂ x Ta Ą# - > t Zcp  r#@=  $!x@V$!1>$!|!T@ DXHd"1`2-$-"䴀`"" "Dd$ 䨂 !$!$ $`K $@"J !$ d2 d !$ɒ$`"d"7 d䬀 ";d#$ !$!$ $`*#d$@"? !$#d` d`1"dd@"#d#d 䬄 "!$ !$ !$"!$#d` d䰀`"dd"#d#d  $"!$k#d""䴀`2d "d$`wd  "`2R"@ Ld `2 "d"d d`R d@ " d"d d`. $`y"d䴀`"dd "d `"d dd` d䨀@ " "d 2" "d"d d`F d@ " d"d ""$䴀`2d$!$   `K!$䨀@" !$ dd "d `"d dd` d䨀@ " "d 2"0"""$䴀`2d$!$   `#d䨀@" #d ds"""㿘dMd 2$Vd$`2$$$"`""d@")$"d$@"(dd9$d9$d""@" dd d ` d`2d@"dd9$d9$dݒ"ddd"`""d@""d"dd$ 2$$`2 $@2$0 $@$` $ 2$$`2 $@2$0 $@$`   `" `6$$`2㿘 @ 4 &`+`" '?` 8!?(``&1  8`8 (J`?(``( (`8? )`ݐ  '` (݃(`?H@  8@؂ ?㿘$$܀ `[` !@$`2*`6$*`2`$4 @6$6$``$,``4 6$"" " " " " `" ` *  *? $"  ""   " "  * * "  ?(@"   ?(@(@ `   㿈 '''' 耦 d>@-jbx$>@-cbx㿈$''''!>@-U"x "$> saP $"x@-I > saP  > @iap> @ > @ Ё> @^ap> @ > @ $㿈&@$'`?'`'  '>@-bx "> s$ >@-bx > s&aP( > @+ap> @Z!> @W 퀦aP($ > @ap> @J > @G $`k> c<@' \`d'''''l > {$ ` $Ȁ M?$ `IԀ`  @`&  $@6 @    8 `?` `Y> {  `8> {&$y'  "e   @ `դ@Ӑ$ @>$> <@ >  `X `Y`` ` -  Ӧv r `Y  ܔ> {I8r b   "9$@2 `Y؀`2`2`2 `2= `X$> z@* `4> {&w "k `Y$$܀"f `Y$ @`] $Z > {@*ݐ! ƪ`e `Xn u h `=  $@>$ @ ``P`" `[`@8@ `[``" ``Ȃ  K0> z`a0`\Ј ? Ք @$@>$ `P`" `[`@8@ `[````0`\Ј  @gO#"" " " " " " " " " $" (" ,`" 0 `X* & `Y* ' `[* * `Z  &`"!`4`" `8`P`" `[`D" `[``"``2 $`\` >c4 * ( &`倠``4""`<" `@" `D" 㿘$ ` \$Ȁ g$ `ca ` 3/` > saP8^ /`/` @@d8dh`C @8d8D8dh > {Ra$> {@)! ` `״ `Z`ф `Ӏ /`@(`@d(dX`C 8d(@8dX $ `@P "2> {(`@:P@` @8` > z " @)$ 2 `> @ap> @+!H> @( Ѕ/`/` @@d8dh`C @8d8D8dh @ H &P0֝㿘$ ` $Ȁ / $ `+ )  $ @>$> {Ra$> {@)t! "$ `2$ "$ Z`2$$ @>$> z " @)W$ 2 $㿘 $@ɒd @`㿘   $ " $ 㿘  Ӑ &$$ > |>ցa !P㿘  $ +$`"  $`2 &d&d&d &d &&$&$ &d&d&d&d$ 㿘@ @@ 㿘 %> {`HHo (@a" P Z. Z P`@=& PHp@& T L 㿐2Ho(@a&$(&$,$( `( `, ` ` ` ` ` ` ` `$&$X&$\$X `( `, ` ` ` ` ` ` ` `$&$&$&$&$Hp@&$ f  0ǝ㿘  $ 㿘 P`> {@ܐ H [(`(` ( 1> z! @ё㿘`@> zaN`> wcT㬰? 2 @㿘N`/"N N#`?@H#N`0(`` (   `/ J`/  $ @ P$"@ N# # 㿘N$`&N$`?@ $ Hd$0(``  $ $ @ > @ap N$`0؝㿀> a4  ð  R 'd `#d &''' 'd''d!>@("x "xd@(  쀠`> saP۰  > @ɒap> @!x> @ Ё g  d&㿈F g A C  $ ` $ &''' '$''$7>@(\x x$@(V `> saP  > @rap> @!> @ Ӑ  $&㿘   L  > 0c @c  L  @f㺠> c<@' > a4m:`'M > |P NH$( 2+   2$  "$' ,$(< 0c @cސO^$( ”  @ > @eN $( ǐ  &.@ch#㿘?Z >  E> |&  ?!PX # 4$(MԲd( * ` ` `> saP   > @ap> @!> @ Ё Nה$(d(Ѳ`> c<' `+  M 4    4< 0c @cMu 4  /N 4  4 > N 4耦@eސ@b#x> `Xc<' `6`"$Ho`4 `Y(@a`X`Y`` ``` @ `01`0@( Hp@    >  @( 0$@b#> saP? > @ap> @"> @ 0㿘@``L`㿐`#$ "$@#- $ "$@#' $Ā "$$̀@ @+$̒> z@#X  YȒG$㿘 $ɒ 2$㿘1> z @Đ#X  Mt$( $e "&$ @`" @$@& $@& @    &$&$&$6$6$> z @#XҰ㿐@  $ "$`<`0@c @c [`2 L$؆@>$ L $ @&$$$܀ @d [6$6$ Ӗ ``L`㿐`"`"`<``$`$`2 &$ $Ā "&$ . &$&$ > |!P$Ȁ "$`"$ > z   `2&$ $$  㿘$` `&$$ > saP > @ap$> @"(1> @ 㿘  $Ԑ$ 2$ԁ㿐} ʐ  `D``<@"' > |?!P' 2 d ܐ d  W  ?&d &d'& $`D㿐}4 > .> |'?!P 2 $  $ `   $$$$' 2$  ަ &u` <`$<&@ $D㺐\> 'c<@' }geca`''D > |'P 8<0c @c@ @K$( 2E   2> u "d "@$d@ "<$d5 2$ɰ$(I 2'  L $( q Ȑ > <@ .> @bzJ$(  $d'd "􀠠 `$(À`'$(Ȑ @`#㺠> c<@' }R`'; > |P <0c @c5 5Ju$( 2:   23 ْ "d " 7 3 2$ϰ$(3 &K|$(  Ӑ @ > @aJ,$(   $d$d'$(πH΀@_#㿐=?w :[  2> |'?!P} #> ap2  @Ϡ $ `$$$$'  ` &@ `㿘> |P!P> z` $Ȁ $``&$$ ` h> c<'  $( 8@'@ϙ  h@ϓ$ > $`` &$  > $ S`0@^#a4 ͖ 뀤   $@ &dȰ$   "&do 0̝㿘 $ 㺠> c<@' > a4}O ''`A  > |`?aP= 0c @cC`CI*$( 2H  CŔ 2A (`'( "Vd 2  ?( ;Q 2$ ̰$(l=  &> c<@ > J#$( C "(  > @`H֔$(  ( @$d $d'$(ŀ   "ݰ  " $d 2$ $dO'`$ @! $dȨ a$(6  '(  ͒ 2$|$d'(  Ȗ " "$'$d@] 㿐}/   ( $ ``    А$`> saP8 $$  > @ap$> @L"P> @I $$x> `Xc<' &@&`&`&` &`&`&`&`&` &`$&`(`8&`,`"$Ho`4 `Y(@a`X`Y`` ``` @ $`0@$ʘ Hp@@?  > `0 @$ 0$@]Q 㿘@` 1$<`0@c @c `L`"#$ `[&`T``$؆@>$؅<`0@c @c2`L@_j`L`$@&$> saP($ > @ap> @"> @ $@&$㿘 *(`(` ( @ > z ! @@ / `*`$,, [ [`" L`* `&`> @"`$4 `L``/ \ " `&@0  `& ``"@ `' `(, X, Y Z`, Z 4`$@ , 1$ 4, 0``` $ 8, 1 $ <$ @$ D, 0@`$ \X> `&c<'''''''' ``I`"U@`' $$ Ho4(@@%MذHp@  `2  <> @  ` X Y`` `  a˔@$ /'/`' ``` ` $``` '/ق '''/@\4 0`> '/c<'''''''''''''  @` ``''Ă?''/d  @ '/> @[ @㿘 Ò ,P ""> { @2 > saP8  P`D@: @P`D> @Lap> @{"> @x P`D @r H &P?㿘  P " > { @@: @P`D @U H &P?H$> c<' ?"v$ $ `"O  ~'''' (  Z`" L' Z* Z$ L'` # LĔ  2 Z$ T$ L'`2  | k b$ $$$&$&$&$$$$” $  `C 0֠ &$  >  2 @[" X㿘> a4 }E ٶ @ `D`<`<@8> |?!P 7   ː  d  F   &d    $> 2$$`DƐ2& &`а  p> \c<@' m    C  T    D` <@" $ 0 @ 'Ԃ`;> |&$ aP `?  n Ԯ $N\'Ԗ ` 2'АԒ L 0 `l `?m  D 4   {  " `@U`4?`0@c @cF 40"@\ِC "Y  2$ L' [`"VجԺ`ؒ $@8$ @ʪؐaP" "$Ȓ   "Ԯ "$'$> @Z  p `?א` )Ā "   Ԃ`+$ ?$$d2& D B'   07@<ؐku  㿘 ! $ à    `[` &`T$`&$$؆@>$؝X> c<' y ϔ 2g  "b $ `]'c   ,D 4 9 ﱐ 4 є `@?`4/D 4 2"  & L'`@2 4<`0@c @cΐE 4 Ґ `;0"@[E 4Ҁ   >   & |  @Y `> c<@' _b A 2]  "X  `xq   9C 4 F % A `` ` 6< ? C  Z`@?/ Z``? 7Ca 4  `@4`4<`0@c @c D 4  @ "> "@ZT 2 Z /D` 4`@в`4 &ܰ @X @> c<@' > a4`'\'y'd'  2u  "p d `ހ`j > {`?!(  : `> D'''  ' * Z`@`" L' /逥 "  TB͔ 4 2  Q 4> 0c @c<6B 4 2 P /p  "j Z`ǂ` /   > <@ > C 40"@Z5ĐC 4  4  UR&{& G.. @@(` @BV 4 2j  L 5 4j /Cx 4 L   d  "  O'%`L' / `[`"JdؒM   '.ϔ  ' `2 @ &  a> l䀧  cM/@WG @ c<' yR c 2K ? "F d `P`@ d  8```@LB A 4 2' : 2" Z    Z* Z 4< 0c @c B 4   > "@Y$ɐ 'p     ` Z@U / Z@6"   CAH 4 2\  L 4> 0c @c+ %A. 4 2E ː ? ɀ  Z@Ѐ̀* Z`" L'BE 40"@XՐB; 4ð   ///'' x v& rI0le@VJ P> c<@' > a4 y' j 2q F "l  ``f > {`?!(   ['m   0@ 4 2= A 28  a \ r /途"_ " `=@ 4 z:`4<0c @c%`ʐA 4  Δ  ef @ U> "ߐ@XA 4ʢ`4@ 3Y2& @ 0ڂ /  "ð  $ L'  Z`@  /Q/  /р @Uk 㿐$   #\> z> #X@zޚc \   #\> z> ! @zԚc `   #\> z> !@zʚc  d   #\> z> "@zc0> {#\ H H   > @zc@?> { `8`8 > z ` ` `  > { ) (a   +a ) 㿐> a4?   T$'&  > |?!P .I !`Ho` (@a .?|$ 2dHp@$$'ꠐ ؐ`> saP   > @;ap> @i#P> @f Ёd@$0֔w値`Hp@ > @c<'  `    (>Є Z`2 ` & L` ``&` Z` `&`&`ږ  Z . Z`&``> 4 2Ŗ ` `4&` X`[` ``\ `\ Y> {   8`> {! ( < $! , @ ! 0 D! 4 $` 8` <` @`  D`&`@Ho $(@ P Jx?  P ? Hp@ T@K'`> 2n ` `i&`a P``X\ `X Y> { ꉐ  4`> {!  8 !  < !  @!  ` ` ` ` B $> @Sݐ Ђ 'x'|''''''''''''''/i`? `㿈 ''''Ho 4``(@a``&`X`?`&`\$>@bx```?"$`2$Hp@造`$>@גbxHp@㿘 l`)  @2  @2  `2  `*  @4  ` @2  N 2  `2 "v  `" @` 2 )2C`v``" ``(@  @ @%ܑ*  2 @% * 2 @2 `2 2   `2 `" @{`*  2 "| `@n*   @ɐ * 2 @Ґ@_%*  2e @% * 2 @2\ `2V `"Q @E`*  2K x"  `"C @7`*  2=   `  @ 2  @ 2  `2  `2  `2  `2""`"` "`"p> |!T 9!T@V7 &  V? ? ? 쀠`? 7 `2耈``@2 (7 ːޠ "> saP  ͐(`7> @ap LL , #\, > @Ӑ > @А ЁaP > @ap> L !@,> @ Ё㿘`) B6`  c+c6`c `?c@   > s 0c@ "`0  > saP'  @ > s 2 > saP   > @Lap> @z!h> @w Ё> saP 8`?> @6ap   , L> @`!H>  @\ Ё> @%ap> @S!(> @P 8㿘  @ > |aT  ` 2@ @"  @``  2 6 |  l6 x 6 ~ 6 z . & . <ְ @ p x z | ~   > s'''aP'?7777///'؀ .'%> |T 2@!> | @t" Ȣ p:  x 2  z> |4` |!X4` ~4` ,` ,` $@@t,` 2"@s  > @~ap> a> 《 `> a> ۀb> c> a> ۀ b> c> > c>  a> ۀb> c> a> ۀb> c ## 2 `#\#`,,`00`#d##h#t# L#l#p#|  ,#x+`> 3`@~t!> @~q %> |T s!> |@ $   , L > | 2 @ 2 ,@  L@ 2 > | @tA!X ; l, +, K, k@$$@ T 㿘%> |T > |> |bX $T`" @@s"$`2@@sT 2 㿐 l   !> 7> |#(!X#\> @u֚a> |#\"    > @u̚a> | aT㾸>  c<'    $?   'X'`7Z'\'d/b'H'L'P@'T^@7^ D@'Dp @ 0`(`쀢Y7X`U`TP((`0@'T'P  "C @> s`/`$  4 $ "G2 4 TP1 (`) @?P҄#2  TP1 (`) @?P > saPA> |H!T) ( mk TP1 (`) @?P4n TP1 (`) @?P'H'L'P'T'X'\'``D'd``(`^`(7Z@/b`@{7^[ > @|ap^> @XbZP`> c> d a> ۀhb> c> `a\> ۀab> ca#l#|`. #h0+0`;`#p#x#\#t **223` > `@|א!> @|Ԑ ~> |/a ```/l/m/n/ol`^T^Y7^ /\A/]> @O"@P>  c<'       @  `  `2#\* k 0> @N"X   @  `"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`M` 2 V` `2   "`""`@") "` @"(``9 `9 `""@"  `` ` ` ``2`@"``9 `9 `ݒ"```"`""`@""`"``  2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2   " ```2@ `" @2`  $`" L`X\@"  `  ` @`    `  (@@ 㿘 N` @ @?`Ђ`` ( ` "  `2@ `"  @@ϔ  2`0ٰ >c 㿘     "   㿘  ܐ &   㿘  $ + `"   `2 &`&`&` &` && &  &`&`&`&`$ 㿀> c<'  '''@4'!> |#    > @K"p @ Ȕ @ > a4 Đ#& & & 0㿘#> |%> |c@%'> |('@> saPw (( " @ *  uc'> |(`(`"6•*@ 5 $c$``? 8 ($( @@(` #`$+`'#`#`#` #`#`#`#`#` #`(#`,#`0 !+`&  4 `' `' 0 8@)( `'`8``@(``$˖ Ȗ?`〦   #` #` #` `(`Հ ````΀3`> @xuap> @x"1> @x > saP} > @xeap> @x"1> @x ```"3`㿘 U  Q6`  `  D" ````?8 " \`"  ``"H /``?`F`" `E`` 2 `2  "(   22 Ȁ  \`" € `?2 ̀`2 Ȁ`Ђ  `` ` ` ``"        㿀!> |$#` ''_> |#b #\#`#d  > saP > @wap> |c$> @wȐ#> @wŐ Ё``> |``#`1@`2`> |㿘 `"  * `3`&> @w#`7&  `" `> .b ` ` `> |#@  `&  `  `&  ` > saP͐ > @w0ap> @w_#1> @w\ > saP > @w"ap> @wQ#X1> @wN 㿘`` `> @v# `&  `&  `& 㿘 > `L``H !> .$"􀠀`T`a2"&$@v#㿘 Ā "  ߐ  ` `  `  2  " \  X  H>Ձct 󀠠" 8 H>Ձct `( >ibИ ` >ibИ 㿘 P Ho`(@> .`  @+L $$ & P  Hp@a> .㿐!> ."`> 7c(   d #\> |> "@ns` @> | c @-> | b> - $"> @v 㿘Ho`> .(@a> . 0`  $  $& P>@+x $ OHp@> @uא 0> @uӐ H㿘Ho 4> |(@a> |?#   2Hp@㿘Ho`4> |(@a> |?ː# 8$  @$ y Hp@ 㿘Ho`4> |(@a> |?#   @$ R Hp@ 㿘Ho> |(@a> |?#{ 0)> `*,ː 2` @ `!4$ j2 в`Ѐ   `Hp@&  Hp@ p> c<' Ho`4J@(@aJ@`?6`4> |?# !> $ `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4 ` d` `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4!4 ࠆ 2 0 @!> |#  `ܐ`3W `#`&`&` ` ` ` ` ` ` `X `\ ` `$ `( `, `0 `4 `8 `< `@ `D `H `L `P `T&a@&aDa@ ` ` ` ` ` `܀_ -)> (`@`@(`.  @` @@@ @ 8@ @`@ C :@   @ 8` H`@ C :@  ` ۂ1``PЂ $ $ $ `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4$ `$ d ` `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4!4$ 2Hp@ > ''' ''Ђ''c'@F"㿘Ho (@a> .`l Hp@㿘 $`" 4L`0H`,Ho )(@"+  ?@`   `  `L `L EH > | `H @iO"& Hp@a L `ȝp>  $c<'    > +> | b@j  Ho_(@> @` T> $ L L "]  ```$ TВ@ה `%`h`w`n`e>  T " > @ > "@@r`> ʼn!p 0  4$ H$ `"$ `% L, `, a$$   L ` L$` Hp@ V $ La> @J` > 0 H   " L L "b b@hHp@h >  @9` `%`@3  T>  @-` `%>  @'` `% yЂ v$ T@Eǐ"㿘Ho > .(@a> .` " > AHp@@rʐ 0㿘 Ho (@> .` &  Hp@a> .㿘|Ho > .(@a> .` " > " & Hp@@r 0|\@Ж " 'ނa1   #@!(@ ! 0`   @0  @ ) @ ! 3`@!#@0`#@ @(  @0"@  1   #@!(@ ! 0`   @0  @ ) @ ! 3`@!#@0`#@ @(  @0"`  1   #@!(@ ! 0`   @0  @ ) @ ! 3`@!#@0`#@ @(  @0"`   1   #@!(@ ! 0`   @0  @ ) @ ! 3`!#@0@ #@(` @ 0`@"` 'ނa1   #@!(@ ! 0`   @0  @ ) @ ! 3`!#@0@ #@(` @ 0`@@ "@ " @ ` ````?>  lc<@' `!   d`= R> s ' ' ' ' b`"< b4bh/ xۂ``  @ ]> `;`S?> saP(  > @q` & to>  @qŐ!80 p | t x'''' b`2ʒb b4`" c$Ēb`ƒchaP ð >  @qq`0 &?ð> saP(  > @q_` & t2>  @q!0 &`H@Cܐ#(㾨`\(` > '4<'L' 'H y $ ```y s'H'L`8L (`> U ` ~ Q 8`N `J `F `BH  @H% D@H% @L@H% <L@H% 8L 8qkה s > s 4&4`#\ `, > saP( s`  > #<@  m> `  `  ". ~ s> @pa `s} s``"98 $`ـ`" >  @pɐ >  X`I s`'H['L `e`LH 8 ` pu 2  ` $?8 l`17F`"E 8k]kY  + "U \ X ` l h'0','('$' 7FkB   "?8H Жp8 W8"U $q9 $`B`!LH p$ 2e  $``"*  `8 lHՐ  l `䀠`uLH 8 ` p 2A  $ ``" j   "p s ` (LHp sLj͔ ` sLHp ` s 8pϐLHp s s` " $`" $`//ʒ `j> rc4@'<ȒP> u!( l$ À "  jx`(հ ` > @oaX rg> @o!r` >  @o > \`0 s8`'H(J'L d؀y \H X ` l h  `H>#\cD#`#d#h#lLK 2  l hX7FpS $ `ဠ` #\#`#d#h#l d؀"88<8(@ F0) @+`0`b  @ `H؀@"88 d؀" ` ` l4 ,,@@@b  ($ 0`H>#\cD#`#d#h#l,LH " $7 `H؀@" ` ` ($ 0#\#`#d#h#l $``"  s`H夔?2 s> saP(  > @nВaq >  @n!>  d؀")> F> ) "@n2`!> `H؀@"> F`g?8ibH`2Ӡ 8@X H% 8 ``H ` l#\ h> 8cD#h#`#d#l \LHw X " $  ``H ` l#\ h> 8cD#h#`#d#l \LH^ X " ` <> @n" $`2?8 `2?8 `2?8 `?8@@ܐ#@`Ѐϔ8 `} `H؀@@Ȯ \`2؂ \i#҂ \  ` `#\ l h#l 8#h#`#d  ` `#\ l h#l 8#h#`#d`2#i` \ ` \ ` \ `2 \ʐ`  ` ` `ې 䯔?> s s `@ Bx>  @mؒa> `5  $`2 (`. ,`"-x0'H>  \c<@'  ''''' b#`#\` ]  `c`:a  , |/7/hh ^ Z7܀WV@ \7ޒ w " \b``0  (`4",>  #`#\"   ``"  @2 쀠@2 耠@2 䀠@2  > <@ t>  ^``   ? ,@(``/ /`42 "N74/`/ 42 `@"(0`@ (0`@ 7ސ    , @XБ2    0?(@ {4(0`@t7ސ  ? , @X2  ? 0@ ϔ  X 0@?^#P 0@X> rc> xc<7' "`> `(> b0 b> `8> b@ > @lbH`\`o`> @lܐ"`^`o}`,> @lՐ b4`b~b#\Ӗ€ `?@U6`\a"o` b`2```Ub @  `A``,@a# ``g^`gZx`$ `> `(> b0 b> `8> b@ > @lQb`\`o$> @l|"``^o>  @lt  >  ```*) 0``16`\`"6`\ b`@@ -    ` ```,@`͖``) 0``%6`\`2 b 6`\`^6`^(`0``Q`"6`^~ b z6`\`^6`^(`0```2r b n6`^ k6`^ h6`\b #\#` ?b`26`^``*b@ ؒ ``,@`| Z`x`(? > @kapbb~> @k"> ?@k 0u /6`^@><#`> @k]"`@Q7b``,@`~ 3`x> ``c<7@'  Ĕ@ b"4`"~"#\• >&`fi`6`\"`2`ߐ " #\#`` 2ѐ?"``:`,"`"1"`^" X` @@"@?c8"7&`f7ℐ` 6`^> saP(? > @k6ap""~> @kc"> @k` ?> @=#x`27&`"k" a@ \`"`@ 0\ 0\0> c<'  "? < 2  @? |> `> .wc@t> .c+``" `D`jt''/'/'''''''''''''''''''''' d/' ' ' L'<<'  ' 8``(@ v`4 =?  ''  HD''/̒ e  ,e   \ ^//77``@<` @`D`@9 C<` @@Z 0@=#~ z&<?'''c'㿘 @㿘c-   1> .> .,   @    1> .> .@!  #@4c! c > .@ > .&# c 㿘1> .#> | c1> .#` 1> .@d"@ϒ  &#> @i# @ƒ  &#> 㾸> c<' > .> . c   2 >(J$ `@4@ #$ ``"% `= @@ @@@@k  > Ц``ဠ` (@  @˖ `(``  `@  @  ` '(Ų@  (@  `; ( 0@ @t2@ @$$ @ 'ؔ!   @  %    ?% $$5 ``<&(#\u՘ 2 `>p/dPtdKx` @|` @a```b`<`@#\`Pnښ 8.`=<@h ?8  @# ;  ` ?8`=` G $=`"  @,  |h 3> @h#@;#> @h#h  @ 8@@E  cc6``6`bDcޒTcڒ㿘Hof4"(@g"> .c(` "" "? @$"$"> .c c)  ?`?2ZHp@@r @  0㿘"  @X E $" 0> @gI a>$ l>ah$!$!>?$$!, h> :` d$!, j@m@lƐ D u@Vޖ dHo&(@> |㴈㴀`$"㴂" $"> .c`> .c.` Hp@ g> | > .Hp@ 㿘Ho4!(@g!`&! ؀ 2؃Hp@ @0 (`@ a" !&!Hp@  a ؀ 2؁ (`@ a"   a㿘 D`@`    \ C`` ` ` . `((@& 4` ` ``((`@(& 8````((`@(& <``(`6 @``(`6 B`. D`. E``"i 0  \ 8ô   L. `((`@! 4. `((`@& L  ((`@(& P    ((`@(& T  (`6 X  (`6 Z . \ . ] `} Hy `0 H (     H((`(@f'`(h`\  ``0 0`(```` 0((`(@'`` ` `  4. `((@! C.3   ` > |c`0@8`0 > |0> |c`0?@8`0 *` *` *` *` *@ *` *` *` *` *` *` *` *` *` *` *` *@ *` *` *` *` *` *` *`  ʂ`2 > .c܀  $#̂!#"$"( ("(? @ $""$""((" $$<"#́!#!$@"$> .c܀ \0``> .c܆ ΀`" @"  @`?`   @` *   > | #>)c 㿘 @ T .` .` .` .`.@ .` .` .` 4.` 5.` 6.` 7.` 8.` 9.` :.` ;.` <.` =.` >.` ?.` @.` A.` B0`.` C.` D.`  E.`! 0`" L`.``.`  0.`  0.` .` .` .`.`  L.`0 M.`1 N.`2 O.`3 P.`4 Q.`5 R.`6 S.`7 T.`8 U.`9 V.`: W.`; X.`< Y.`= Z0`.`> [.`? \.`@ ].`A H`" `.`(`.`) H.`* H.`,.`-.`. .`/.`+ .`H .`I .`J .`K .`P㿘  4@i !.@ `.`  .` $.`!h $.` 0( 0.`!.`$.`".`#.`'00.`&.`% .`, .`- .`. .`/ .`( .`) .`* .`+!.`0!(`0`0`.`2.`3㿘 > .`)c܇+`#̅+`> . c!##  "  !  +` @ ?. & & 㤀"#́##́+`@ c > > >  ` @eY(D㿘 `@`> v  @[!$&@  㿘$`> s$8`> saP  @4͐$@4ː$$&#&$&$ &#> @e3`@> @eb P> @e_ @4$@4$$&#&$&$ &#㿘> .c#  ``%>   l!@y?> .b@t`> 'І$(`@4> saP > @d`@> @e+ h>  @e' Ё a0   ((`(@@! > saP̐ > @dݒ`@> @e  > @e  0$#$#@4a$1> } 8`2 ##> `> `@?#؀` & 8$#> saP > @d`@> @d > @d 0?> @ڔ$#؝㿘 @Q㿐> 7cP> .c>  @&`A   ? @$$ #쀦`&# ʂ&0  d d` `& + 2 "  #\   @W "@Y`&``2" `U " @ "@Y `_ "&#     @ "@Y㿘> 7cP> .c>  @%`#䀦 2 > >  @2@3  @cϐ!㿘 㤀" ?(2(΃)  㤂c 㨈  #Ѐ"$$<"! ? @Y6#Ѐ"$< &#? @Y$#Ѐ2$<&#?c$@ $$2$$<&$<&$@ (&#́㿘> 7cP> .c>  @%6`c`B ʀ`>`c:c쀠`88cb@Y  0`: `.`: 6 c`$c c c $c>@1|c@3 > pH`` > `l@#  @3   "Ȑbؒ Ðb㿘> .c܀̀`( \`@D`"Ⱀ @q  !> #@ # @  `#  @& ̒& & !  (@_4`4`    @֐ , ̒ (`0`0`,`,`> s !!lЀ *   ,`(  ? @$$   @ !n @XRЪ`  ` %,`0 ,0 ,,, " < !N@ %@<  ? @c`  @ $`4@$ $"$ <%<%@,0 ,0 ,,,> .c  &  @` @@?,  @  %/`c%,,,, - ,00`0,,,``դ D` `& ̔ & & @RD & & & Ⰰ`:ఆ@= @8`C =ఔ  x@~К > |c`x@8`x (%́`  Mc``@8`` (%́@-> |@c=`p@8`p6 (%@؞@㿘> .c# l@@(<##̂@<#$#Ɓ㿈> .> scT''  / ''/7> $0/ @'ؒ 㿘> saP> .c> u`!> a0$`&$ &$ Ӳ @1$$ > @b`@> @b2!H> @b/ > u &$&$  @1$$ x> 7cP> <@' > .c>  @#Q`@  \`@2 '@ >   '''''//7ސ@Ԕ 'w 0@4G 㿘 > .c܇.`.`> . c.`@#" c`l@-c̈`$c& # & # @$#. ΁> > >  `h@a(*㿘> 7cP> .c>  @"`X`#`\`@ ʀ``2 c̀`((dH ΀````>  `Á  ʀ`"c > @`!@1d  Ν㿘> .c܀1 ʀ`"  ΀` ``` "> @`Ӑ!f > pH`` > `l@!J> @`!㿘> 7cP> .c>  @"m`p``\`@ ʀ``" c ΀`T`(JdH ΀```"> @`"   ʀ`"c :' `!`5 ,  > 0 @`> pH`` > `l@ >  `'2 ς`, c`@>  @0  Ν㿘> 7cP> .c>  @!` ddp2  `'  \`@ ʀ`#̀`( $H . ρ ʂ`6 ʁ@0 㿘> .cܒ @Vb 0$ " $ cc`l` `@$c> $ cԆp c$cԂ@ $c̅H`` > `l@ q 㿘"`) \`@%> a0#&#5> }8`)> > saP&8 l!@z?> .b`@t > 'І$(`@/   > @_`@> @`*"h> @`'  lP@  > s㿘"#k`"  \#܀`2 \`@4 \#܂4 \@/b$H > @ $# \`2k㿘   +` `(( @`> s `` > saP> |c`X@8`XHo(@ 3 2+` 0* @ (`@ ` *`@@i f $ , - % & ' . ( ) / *+`*( (`* @ , *`)   ++3`3`3`. ,3`. -. .3 3 0 . $. &. (. 3 . !. *. ". #. '0. /. +. %. )ah*( ) ` G`"Aal`@ @"F`=ah , ( + - . / ) *(((`+ @) +` @ =`Hp@ > @_`@> @_F"> @_C > |c`X@8`Xa  h @(`Hp@M> s@ (=ah0㿘 ,  㿈?> | cZO "<X`ʀ`4 .       ) +`(`(@ (* @ ?    ((`(@' ѐ  ְ a ΀@ | c  `r0ʀ/       (((`+ @) +` @ ?    ) (`(@Y' 2X @ | c  `r0ʀ/       (((`+ @) +` @ ?    ) (`(@Ye' 2X @ s@\> u b    N((`(@ !@X}? `"X/ @ ʐ`rS4 ʠ`ذ { U? `"UW 8  @"  "` @2ʂ`0r" 㿐> |c > .#܆ @8c c \`@"> rc!h  "  `@<`@ @9  @8`C9 `" `@<``(` @d  @@`(@<`(   (`@ !`8@<`8` @<`  @ > .`? (`$`0~ @ ((@` 値`0@<`0^@   (` Β0{`8@<`8㿘    ((`(@%> saP > @\’`@    ((`@*`> @"@\  > @\ ЁaP `"   s > s `"     ((`(@> w    ((`(@?U`> wc"` @I ``?> t` #4@R "' k_ ""  >"E  f"A kR   h0 o @` @!> s@Q"``"`@Q $H`"0> v@Qz!$0`"> v@Qs!$> t@Qo#4 > w> vbd@:> wd|+`@```` ( 8 9 ` a(`( : ; b c(`( < = d e(`( h> @[`@> @\ #> @\ A`H @  ʐ  (Ɣ  8 9(`5  : ;(`5 " < =(`5 $ - ' >- & - &@+ @ ` P  ` a(`4`  b c(`4`" d e(`4`$ f`,`& ,`& `& &"  `Ȁ`: ,`'    ((`(@$    ((`(@ $ԒpԔ     > 0((`@(> @! $a4$    ˇ(((`@ `(`` @> wcc @#$ ,  ,,! !(`4  (`4!,!,       ((`@(+ ) @ +`@ <    ((`@($ p q r s((`@($4 t u v w((`@($8 x y z {((`@($< | }(`4@ ~ (`4B ,D ,E k`"0    ((`@($L    ((`@($P    ((`@($T  (`4X  (`4Z ,\ ,] `"H$d$h$0?$, `$ `$ʂ`4ʐwj `  T$      @ A B C((`(@+ )  +`@ %`0g $ % & ' L M N O((`(@+ )  +`@    ! " # H I J K((`(@+ )  +`@      D E F G((`(@+ )  +`@      @ A B C((`(@+ )  +`@ Ȁ`0  P     ( P 8ʂ`94ʂ4ʁ k,`'"I$d `0H (    H((`(@5#`"  i`00 j( l m n o0((`(@#` :<,`':,`' > pH`` > @`lʝ㿘3> r> |c> `@> > 0`Р   >` f ` 8x ` 8x `8 x`"% ``x` `P@<`P ۰ @Y @Y@Y`P``2x ``2x 2 0n@ @㿐`  > }$` `8 @   ( @c   b#\ ( > @QE`ȂcЄc&cԂd<&c&d@ (?&c.c&c&c&c&d< 5 @ <  &c6c `0> @WԔ`>>`\&a&a>?`&@&a.`h> :a` &a%.`j&`ldH>@&`d$>@&bd>@&`@^@]C> @Xa0`D @GW > . c܁ > .>da #㿘Ho(@a@(jd@(hd$@(fdH> }`81> c܀`7dD`b@ `(@bc쀠` c@(K  c쀠`2c@Nbc@ 5@  > . c܃Hp@ p@В?c܀`"dD> p@ǒ?dD㿘Ho (@aHp@㿘Ho 4#(@a# G&#&#&##> }`8`2 ##> `> c@ꐒ?#؀`" $`8&#> saP  Hp@> @XI`@> @Xx#> @Xu ЃHp@?> @g&#؂ $`8&#> saPې > $@(I    Hp@㿘Ho4$(@a$ '> u ΀`"   "*$ @"+&$ `$  l#̂ @a8 &$$$@' Hp@`8  $8   ۢ`$ @ۀ`&$ &$ Hp@㿘Ho (@a" Hp@㿘Ho& (@g0`@Y&! 2!Hp@p> c<' >`0` a@H@(aa@e0a@"#'ذ  > @2 Ho&r(@ \`A@uHp@ ''''''b`ؒ`0@g c' c'c m'Ȱb`"İ (( `l8 Ho&4  l(@g l@D& lHp@ @  8 Ho2(@耠`"+8$c쀠`$E,cHp@ g \`A`@6 \c؀2%@&dHӐ0x& l`$cg`@6 \$cؒ > @ \d`A?> @$c@)T 0$cO؀dD`"c~b@ w`(c~`O$bHp@0.@T  l`l b``l 8c~(c~`7$bc8`">T \$c$cc ` ` ` ccb<)@(@$c 4c,c$c$c??,c,c ( > @ JD$dDA0c4c~(`0`@< $cxc4c~(`0`@<b $cx$c`&'dD`"$b@  ($bHp@ 1cb@<1Ԁ $dD`"$bb@ `($bHp@ 7c~b`$cx4c~,c}?,c|㿈1> r> |cؤ> > `@> > `жp  9> @ @`lY` 1 2 3((`@($ L 4 5 6 7((`@($ P 8 9 : ;((`@($ T < =(`4 X > ?(`4 Z @, \ A, ] +` H )`0 H *( , - . / H((`(@#`֒ S   `0 0 (     0((`(@z#`  ({ H 0 1 2 3((`@($ L 4 5 6 7((`@($ P 8 9 : ;((`@($ T < =(`4 X > ?(`4 Z @, \ A, ] +`"  H> 4$  PC, Y`">  )`0 H *( , - . / H((`(@#`㿈1> r> |cؤ> > `@> > `жp  9> @ @%`lY`   ((`@($ L    ((`@($ P    ((`@($ T  (`4 X  (`4 Z , \ , ] ` H `0 H (     H((`(@#`X S   i`0 0 j( l m n o 0((`(@z#` h듔 { H    ((`@($ L    ((`@($ P    ((`@($ T  (`4 X  (`4 Z , \ , ] `" H> 4$  C, l "`X@  `0 H (     H((`(@#`㿘> .c܀ # $"$<!`.! #`@%> `& $(& $# l` 8@#$#&"$$@"$&"($@ @$$@ $.!& $pH`` > @`l $e#܄ 8㿘 &&@@}8 &"Ă &"Đ@}0 > &"Ȃ &"""ȃ() () @#@ @(`@ 8 `㿘"`#`l@    ́ Ŕ & l@| 0 &" &""(`(` 4& l & l*@*0*`*`00`*`*`** * *   (`0`0`*`"`*`#* * !+ @+ `0`*`*@0`0``*`*`* * * *   (`0`0`*` `*`!* "* #*`**`+* (* )*`(*`)* ** +*`*`* * *` *` * * *`-* ,*`,* - *  *  *  *  *` *` *` *` *  *  *  *  *` *` *` *`(( @@(``0`*`*`0`0``*`*`* * * *  d> (a0`!> wcc!(( @@(``0`*`*`0`0``*`*`* * * * *`%* % `'*`&* &dd*`'* '*@*0*`*`00`*`*`** * *   (`0`0`*`"`*`#* * !+ @+ `0`*`*@0`0``*`*`* * * *   (`0`0`*` `*`!* "* # * * *  *  *  * * * *` *` *` *` *` *` *` *` *  *  *  *  *  *  *  *  *` *` *` *` *` *` *` *`(( @@(``0`*`*`0`0``*`*`* * * *  d> (a0`!> wcc!(( @@(``0`*`*`0`0``*`*`* * * *  `'*`%* %dd*`$* $`   @` -   > }  H>)c 㿘)> < > <``, 2 @~ː @(0`@ (0`@ ,  0`@<  ,(` 0(0`@ ,  0`@< ?0 㿘 `@N   > }`H` 7@8`` , #0$ #4`4 #8<$ #<+@4 @(@4 @MK$ 4 ,  @`, 4 4 > >`P2.`$4  D`  `@*`4  D@@Ӕ   @> `@8`C >   "@l˚ > }`H`@8` `C > `6`$    (0@@?@@ (`0`0@@8 @4 㿘``R`"B# \`@H> }`H@<```.`"(`(` .`0`0`) ) #  7]"(`(` (.`0`0`) ) #   @  2F`@< 7@#`9 \`@&#@ #@"耤`*&# @y  "``(00(`(`(@(`> 40(`(`00(`(`"(`"(` "ք *(` "(`(` (` (` (`  ((((> a0(( @@(`(0`0`0`(((> 40`( (0`0`( ( "( "( "ւ *("(((({(㿘#@-"耦` \`@&#@C > }`H`@8`"`) 1 1 +`+`> a0 > (( @@(`0`0`+`+`+`0`> +`40+` +` 00+`+` !+` !+` !+` !+`㿘#` `  㿘 @㿘 .@   `.  (`0`0`.`:`.`;. 8. 9/  @  ~ /  (`0`0`.`8`.`9. :. ;. $. %. &. '. . !. ". #.`$.`%.`&.`'.` .`!.`".`#. ,. -. .. /. (. ). *. +.`,.`-.`..`/.`(.`).`*.`+(( @@(``0`.`3.`00`0``.`1.`2. 2. 0. 1. 3d> (a0`!> wcc!(( @@(``0`.`7.`40`0``.`5.`6. 4. 5. 6. 7 `'.`=. =dd.`<. <x @  /  @( `/ $ $  $ # 77  @ʘ "Ԕ ' *7//ܘ //7@ "&" @> }`H`@8`@0> }`H` @8`㿘#@ \`@     \#?@  > }`H`@<`#  @W j @  20``@<` 7@Ұ  @  "`` l(`(`(@(`> 40(`(`00(`(`"(`"(` "(` "ׄ *(` (`(` (` (` ((((> a0(( @@(`(0`0`0`(((> 40`( (0`0`( ( "( "( "ւ *("(((((㿘Ho&4c(@gc "/b(`(` >"@ @` > }b H@"bbbbȆ`@&b>bЀ@  Hp@R 0@2bІ@9 H!  &cHp@ 7c&b@ c㿘Ho&4c(@gc "1b(( &@ "@*`@` > }b H@"bbbbĆ`@&b>bЀ@  Hp@ 0@2bІ@9 H!  &cHp@ 7b&b@V c > c<' &`A`   r @ > 'x'|'''''''''''''7`x    :   @0̐   R @ & ','0'4'8'<'@'D'H'L7P` ,       @@0 7    > @8 㿘Ho&4c(@gc ".b(`(` 0"@ @ܒ` > }b H@"bbbb`@&b>bЀ@  Hp@ِ0@2bІ@9 HҒ &cHp@ 78 ''''''''''''''''''''''''Ā` ˜       @    㾰> `\c<' @A c``z `?  `C $`G?` G?? ?''?  ?@t|@rd E ???y >"2  ``  0?D? D? ?''?U ۔ ?@t?@r\d @ E @?  h0> @  㿘> }`@   *#`8 # `&``# " #` `&`2#O# 2 # F#㿘#`"#`#,`1#"`'>!#`@k `#,` "`3>!"@`@Ȑ#"@Đ##,#>!`l@@M "`@ #>!a@"㿐# @Ԕ 'H   5 '@ʐ < #"3"##83#<##0' 3#4+#  \#?@'?#< ##@` #d@ ##<(`#l0`(`c#h @ @  @7 @ ?@ a`##l#P#L @ @*#H#X#\#`#p#t#x##D#|9   /@1##P53@;  @  @   @ @ @ @  $##T ?d##X ##\ "##` ?##d *##h ? ##p`##@ $##H ?##L @##t ##x   ##|#######@ @@ hH ##  ## @ @ @ @ @@ ! ##" ?####ba ####  0> '@H>>c#!#!> ?c##!+ h> :a` #!+ j 3 \%ܐ t'  @O< @Nc   D @8z > }@## @> }> . `@>da #㿘Hof(@g@S> }@2#@2# ?$#"@E 5@B Hp@  @㿈>`0 `@X@ a@0a@:@m @@ @`\`Z#8`W#<`S@> }4`\H #<"Ђ`` Hof(@g:Hp@ ''''#0'#8'#< 7 #/`G3h(&Hof4`l(@g`l@ mHp@ 4`\ @䰒 Xg  R` 􀠠   (@f "F Ho(@gѐ``$#8``4#<``$#0`%,#h #?``(## }4`\ H<"Ё4`\#@ ` $#<?@ ((`0`(`$#@0ϝ㿘Ho4!(@g!`&! ؀ 2؃Hp@ @i0 (`@ a" !&!Hp@  a㿘Ho&(@gG Hp@㿘Ho&4 #(@g #` Hp@`  Hp@Hp@㿘Ho&(@gHp@  > /`` @2@ " @` 㿘  @㿘 1> @G!& ((@@  @F`1> @F!(㿘 @"`& @ 㿐P'P'T'X' Θ㿐P'P'T'X' 㿐P'P'T'X' 㿘> /` 2  "  @` 2㿘> /`20 @ "$ ?  @  2㿘  @U   > /" " `" ` "  㿀> c<' 0'@@00b&@9/00b"@20b!@. 0$@4%#@%0b@     &  > b @0b(@  "  @ 0@!0> l> n c > n> n a > n`* Ho$'(@ > na> l+`+` @@"``?"` "` " `"`"`"a"Hp@  e> n ? 2   `  > l`   x> ܠc<'  > l c  > @M!@a@`` ? > n" 8`"2 㿘`A > na> n @Rax> `c<'     > l> ´c !@m ^ 􀦠@ݒ 0ސ #> @!P㿘> na @'> l> n+`> l+`# @  @ ` `? `  `   `  `` @" #@ "a> n @U̐!c> n> ° @E(!> nሀ`? ` @ #> n @U!x!> #<'  'ܔ '@2 > @!`x!> #<'  'ܔ '@ > @!xR` > /`"`8Ho(@> na`"` `Hp@ e> nHo4> n(@e> na 2 @2  ?" Hp@! Hp@㿘$` > '&$@oa 2$@I㿘 @    `8   $ `$ $ $  @Ԗ( `2 @P 0x> $c<@' 2 \@# @  `A`A" '@ 2> @#($'''/?․`d`c$$      \*`*@*`*`*`*`2` `|6`$< &`($ !@@> 0@PN$`,#\2> ’ 0@D!`㿘$` $  @m $`"$`$`" l` le8 i  m 7`  (( (((((4 ($14`( ($ Ԑ$`,$`=  **  **$$* ( ( ( le  ** *  *  n*  l* C(( $`ؔ   **$0`*$*$$$$`ɂ   **$0`*$*$$$㿘Hof4$(@g$$ $? @$$$$@ $Hp@@b]@Nm$ "$@͒ $ "$@ǒ $ "$@ $ "@׻  @׷ 㿘$`| $  @m! $  @m  le8\   \`  (( ((< 0`@ (((8($`I<`0`@ 8( ($ $`  ** <0`@ 8* * $  * *   * *$$*   ( ( ( le  * * *  *  n*  l* bC  2` 7(( Ð > @C!㿘$`Ho&(@ &$&$p > ' \`> 'bА$(@`@Hp@g &$&$R "> ' \ 0> @B"> '㿘@q /$`2@qI  $ @`4`    (($0`($((( D  @3@q'    @< @[㿘>!`0n@H`@(  0 ap@z1ao@"$@p0@(@$(lh8(@  0ꀢ`p`0@< $`g @6"$`^ "@/ ` 3 $``V3 a@o@j N``$ "&$@_ &$ @kҐ?a   @ԭ  I@&$$ "&$@G &$ @k?aâ  @ԕ  1@&$$ &$&$&$&$$&$& .  . .@K$> :&$&$&$aa.$`$) `) `) `) `)  @@  2 h&$ ``2&$ l l8& l&$㿘> }> / `h@= $!> }> } a 㿘$ @:  l   0> @A*@!#`!$!%$#$ l? `, h4 \  $#, j>&>&a$!$!>$>%@c$$$x$$| > :!$! !!,$ $( ( $( >'( b@%(@G_@F@l D 3@0 Ho&%3> }@o`h" $$2$$`h> }$$``hh$ h$$Hp@ (@g3> }㿀>  \c<' ;> $`>`t`" $ 0> Á > '"ЅH&$(``&$ \"Ѕ(`(`  " $$ \&$Ԑ$@vHp@0В 0@@"H$`ƀ`Hofv(@$ؒ``&$> :.$$) ) ) )  ) &$M&$؀ "$ \`Ӕ$> 'bВ`($@7Hp@0Ho4I \(@g$`?$&$> :ᘆ.$$,  , , , , @Ē &$$ &$@Խ &$$t&$6$@Hp@0[g$Ԃ``g&$<(g$ؒ``&$06 \`e> $$ $ ,``00(( ?((((  $'''777'/?`c7`2`ᄔ@ &$(`s. ($ \`#&$ؔ 0> @?"$ؒ 0> @?ڐ"X$t &$> :aa.$`$) `) `) `) `&$) > 'bР$(`D 0@?"$ 0> @?"$ 0> @?",$@K#8㿀> 7cP> }`> Ð @%cHHo&4 (@g (``82(`Hp@`>> })> } h```> ` ` p```> @?l# @/0ͪ  @ 3 `]> @?X#h0``$$`@$@Hp@`)> }> }> ä`l> > ìbP'> }Ho&4 (@g (` 2(`Hp@ h` ` @ ` `(ؐ `"@? @̐0@  2`0     `/(`(@ > @>#0"@ @`7>  `  '' ' % @  `@@```((@ "2ܤ〢K ef D> a` 0.> ×2@>" 08w ހ2> Ö > @?c-`2> @?Ր 0 7 ` `T$$ @$@Hp@ Xh`k(`e h`2d0_`]d`2dd2dd2d`D(` @/ @  - 0`>$ `@@o<`0@>;02@’  2( @>30 `> ¢ @>+#@02K耠2G@V  "B > Ö > â @?)c> 20@? D `" 2 @/ 1 h `` "/  `> Ô > @>c-`T> @ K (`?0􀠀B > @?! (0`@4> > '0`2ݤ@  `''H> ;@I$ \`" '$.> Õ2!@= 0'$> :ᘆ/$$) $)  ) ) ) @ '$$ "$t@ '$$t'$'$7$'$'$@0> >  b@>z#> > >  b@>r# 7$@$ \`  .> Õ2!@=T 0 $@'$$p@0ဧ v h$` 0> @=B!x0֒> ¢ @=<#0В> @=6 0ʀ $ "@ѣ  @  '$'$"䀠`" l$ "@ю  @  '$'$  l(`耠`> @"` 0@<!%' l``7$ $3`  '$3`'$ > ' \`> '$bВ`(a$@ 0o`'耠`h> @<А!@0d 0> @<ː"> '> > c> `І////d@2dd@" dd`2d> @< (``> Ò`0@< X`d"``0> @< ` `0 T` " P" X" `" d" h\`" l`" T" p  T` `  X`  " T" P" X" `" d" h" l" p㿘 t > / `D0 ( @@d (&@ &` &`&@ 㿐@8`0`*8*@0((@ @3`c+`+  @` 0@ ((@ @6`F.`. @㿘`2 t`7 T``  (` Q2(`$( (@ ($( d@ 퀦`2$(  `<(`" T`4 T`".  @e@'@c@B.<)@`< ` `8 T0 `&"  @& @`8 T0"<@ 8< `(<㿈> /`@h!> / D` #> ' D@gb> / `H@ݐEbШ > n! !> @X@А8"  88`@2*:*@ 3`b+`+  @(` 0@(@ c@ C 3`+ +`@@B " D2`*`d* @0((@ @3`c+`+  @` 0@((@d@$ Db@f D> / `H> 'bА> /@f `D> / `H ``  ` @#@@@@Ȟ@ ``  ` @`@@w@@@ ``  ` @@@@@֞@J $`  ` ` `  ɞ@@@@@@(@㿘N $`1> / D`  `` `  D`2 > @;#h@!@3@㿘@9, ` !@! `  ` `  @@@@@'@㿘> Ò@:#> @;H#㿘!> / D`"@`) `t  $`t @ #> /`L` > /`P B>/ @  $`L D`> ð @:R# @ 0 D@ 2  @ai  >` > @a^>   > & (> `t $`t @Σ ??> a4@  㿘 T`Ho&(@ h @  T& THp@ g T` (  `&"  @& @@ ( 2 <( T `"  @& @㿘 T`: `7 Ho&4  (@g T`2 (`  `"&"  @& @@y (` 2 (` T l& T& THp@  `"  @& @ h @  T㿘@8     "  Ho&(@` Hp@M 0g`0㿘Ho&4> :(@g> :a` b`" `a` a`@>*``2bHp@ > /`P >/@ a4 @ @ > / `L  (8@"@ H:` P:` X:` `:`  h"`( l"`, p"`0  ,  8 @ 8@ 2  0``"` @ ` ` `((`@(1 ` 瀠' 0`0`+`+@0`+`+` ` Ԁ`` ?+`(( @@@8` 8@83`  㿘 @ ` , @` '.@: ` 㿘 `&  > /h2`2  @  h㿘 8߲ @㿘#> /`h 2      @2 `$  @3  " " `h"$`h? * @c+$  Ӓ:  &  `2` (@$ ``  㿘@"&@  ` &`&  00`  <@l 0㿘&@  @f@ 㿐 0`H (` ,  (` < @& ,& (``$& 4 &S 4 h`& h X `@> X@8`C& ,@> `?& 4``6 h@"& `&@`&` H P@> H @8`C> P& 0@  < @ <4  @ ) )  @(`"* @b?`$` 8,< ` & 4& , $ ~: "`  l`& l " l p& ,`& p㿘 x @U  " (" 0 X"" `2$  $ 2$  $ 2$  $ `B$ # $ 26 @b7"@ 1,!+ @$   8 (@@ $ > â @7K#$     @ (@($ $ * * $ $Ð$ 8@~ <   `Ք ڀ@ $" $  ʄ` `(`@`    @ 0 `  @  㾐 L C  ܀ > a< ' ? ? ? ? ' ' '  '$ ' '( (', ,'0 0'4'8 '< '@'D $'H` 'L` " \! !&P㿘      @`$ @ ( $Ȁ ! $Ā"$$ā  $$ȝ㿘$@t " $Ȇ@ $Ȁ@"&$$Ā@"&$ā  㿀 ` ܀``(` (# (@`2  `( $Ԛ` `A   > İ @64 @ < @<4 ܀`, #\#p>4#`#d#h#ld@耢 ۰  " "  `<ΰ $dā@ > @5 dĀ`Ұ 0` dȀ`>2d#h#\#`#dd8@ d T` X \!` `@:@㿘 )  `  ,   , @` "  @` Ā`"Ȁ` @  Ȁ@$`Ā@Ҡ $$ȝ㿘@3  !`   @F%"%% ` ` ` ` `"!"$$` 㿐@3 "$  "  Ho&(@#\#` !>3>3d">3aHp@g 㿘` X  ` `@d$T` @ 㿘 X$@ `"$@@'$@㿘``  X \> Ē`0@5 h@ǐ 7`4ܐ "$Ē@` >```@<`B  7<``2$``@ 7 $ @`& @㿘 `\ $``"```$  H 2``@2`\@`9 $ 7 @_`|$`` *`@`㿘 " @ l& ` p `2 @ 4`2   8`  4   " ْ  D  @` `㿘  p  l |`& Ђ#`D`F` 4`;`" 0`0 h&@`@ Ђb? & l?/a & l& p@ Ԅ `& 4& > 'ԃ(`@  ` @>9a@$@@j l  ` Ђb@@Ђb@@㿘 `20!  $  @" 2 $$   (< <㿐 (`@`Ԁ : ` @`К@< =C<   (@`؅(R' @`܅: : : @!@` " ``` @ ׄ  Ђb?!& ?/a & `  ނ Ђb? & ?/a& ?/a& ?@@"  ̂`$   P$ t $ hN$ x  x  t !@@> @$  ($ $ ݐ $: : 8: @@ $ $ (4 4$ $`$ l@ $ 4 ,6$ $( 8`$ l`$ l $ p`$   @@< C<  `(@-``  耠@&) ``l`܀@ 6:` `܂`8`"W "C  H  &  (@ `@_ `& &~@Ђb?M& ?/aD& `p6 @  (@& ` `@_~& &Ђb@  & (@ `@_k `& &Ђb@㿘  *@ ` P2 4` l -@ 4 Lp`@# "L$`  耠 @ l` p@ & l& 4  *@ `Ё " @`,`$@` @@ T& |`&  㿘> @3 ` `@  ""@  `"`" >0a \㿐 x  `v@m`"  & (`@ `Т `# ,`<`"`" H l`ǐd €" L H@2`,`    & 耤 =  &  "> `2 ,< < $  `$ @ (`@ ` (`  ` ؃(`@ ` `@^u& `&@`"  & (`@ `Ц > ,@`<"5` `(< `" $  l`2 `6``& ݒ 2 `2$  L`2$  H؀`ӂ ǃ,`Z   S & 耠4 $ ̀` (`@ `$  H ۀ``2FE H` ː&  "  &  '> `,`< < H  `(  ؅( \   H(`@H `  X& @1ϐ @1͐ 㿐  `@G 耣   l ' 4$ ` `"` \@" " `"@`"`` , +<` < p@   L2 @4$ p$L@6$ L" 4l4 L   "  !   " @b`" ??(< <| ` `?㿘 p   @O ؂ "  ` ` ` ` ` @C \& L&& @& P& &  & <@["& & & 8& $ d `  & d: 0`@8``& ,& ,`Β2  & (& (h (& $2  & 0& 0"& TXl#@[  d`, , @[@ d, @Z$  & \  Ho&,(@g,`"C `& H`H@2 H P` `@'`<& D'`@ `P "``  @```2Hp@! a#@[\ \|` \  |Hp@& H㿀 h \`d@sp \4 `l &`&`&`&`&` &`3#@[.* &`&%b: &`  &` `| ` `\ `< ``#`#d#h&`&`&`&`&`#\#l#p >6 ` &`" 1> @/} 㿘  Ho&4(@g@Z"& & 8&  `2  & ,& ,ݒ2  & ( & ( (& $Ғ2  & 0 & 0``   (`@`| f `|Hp@ 㿘 Ho&4 4(@g 4`& l& 4 ̀`@༃Hp@㿘`4`rHo&(@g`P`"``@ D`{ ` @2`D@j`D D&`D`(@` "  H@a `H@2`H(! H@"W`H `23``P  @`& ` &`D`2`  @!  P 2 @Hp@`\1@ ` @@ ! @?`0`(| @ |`(\ \`P@ @@ #`@ #`@#`<   @@   "` `  !?@` ?" h@a``Pa`2`P: h(a" h" l ` !  ! !Ą? @"!"!āa ! !   @@  "& D " 8 88" <!  @@   <(!怠 D@ †@ ܆ 0㿘> /`D2  *`@U@* 2`@  㿘> /`D6`.`. @ 3`+ +`@ ` @0 ( @@Wn( :: @: `: `: `: (` : 0`(: 8㿘 4/@`( B . `8`@ ` `   ?U @UZ ,, 2` @4 4 4 @UN @ D@F @ (`(@+ "$@ ``@  ?# @U- ,, 2` @4 4 4 @U! @ D@` @  8 Ԁ ?ކ???@㿘  5`>``?3> / ( @`$> (!`"! $`!&! H@*!@"!"!"! @ ??&!&!  2 (M!(  xp@B@bf> Ha !")  HH@ 8$ @ "L`H@ n ! "  H@ {!!"!? &!!&!&!! @ !! `" X (!h  `@ B  > X`Hf8/ X)  h8 P @ P@" TJ> P   P @  T@ (!p> HB `> x( h X f@C> XB> `@c!c<! `!""L!!"!?  &!!&!&!  a  2! L@ (|!!@ 8 m@ q !㿘@  @   (  @ B $  (@  0c D@ d, 4`4 @S@ D ? c@S @ * 2`2 @ D@ @ c , 4`4 @SҒ@  @B? c @Sǒ @ * 2`2 @ @ E8  㿘@`  P? ``@ G F>2`d*`* e@Uj@ @C= 8>> >  ? c@St ,, 2`@4 44@Sh @ D> (@`@ > >@ >> `> `> ((> ˔`ŤD8>` `?(`@`    @ 0 `  @      ܰ "~ a(z '` 'd "v'hR'h ^`'l J` 'p "n'tC't O`'x ;` '| "f'4' @`' ,` ' (? 0? 8? @? H? P? ?!'<!'@!'D ? ? X? h? p? `? x?> /`D?' `'  `'!?!? !?(!?0!'8  'H  `" ` ! !&'l'p 't'x'| '''P>`p 㿘 `2!05   '! !!@>! 8`@C@]>!   @ @ 2   !  ݐ  ; A㿘 f  `b Ho&_(@ `` " 2_ @V`2  @" !@(@ ` !!!Hp@! "  ` 7 @".  @"  " @  " @  " @  @  @ g S     z 㿘   z ܀ w 㿘  #  `   2 0h " `Z  2 T ! @; @8 㿘` X  `2 ` C " ``7 2` T` @ 㿘@(  a`   @Z!$  @U "" $! a$ $ 㿐@' "$  "  Ho&(@#\#` !>@>?Ę!T>>՚cHp@g 㿘 X` ` " $`  @@8@"D ` `@> ""@  `"`&     @: ?% @І@@C<Ȣ<ɐ`"0@<0`k`` ``T06@>`@<@.<8,@@@ * ! @ D@ ! `@@ i !  @@ yĆ"Ă? $!$$! @!!ā   "`2v$@` `0>`@ @ <8Z` @԰ P@8@"TH p@*9 p@2 t@:9 p@(2P & D"#DĆ"Ă? $$! `$! ` ! `@ ( 2! D@ (~!ā@ 8v > @(!㿘``  X \> Ē`0@(, h@ 7`4 " `"  2$$@ܐ 7` ```` @"&` `"@`"` @`& @` `͈ `D`렰0  @@` 8 0"S`$$$ $$0@>`@<@<8! `" $@@@ 8@ "D$! $!  @! `"* "&     a``&a `X`h8 @`P@"`T/>`P`  値  `W$!``"  p`H @ 0(0@ !a"Q`H>`H`H``(` >`@ a(ja(@a``&a!!&`x&`|`&a&a!&`P&`T`" !`HH@ 8V@ "OL!&aa&a @` ```h`(ah2`(k`>`X&``&`d @ *>`H@ 2`H`L@ :`H>`H(~`P z @|~@~Ɛ< @ 7<ؔB < $ 2 @@ (!"`H@  &a&aἂa  "LḀ2H`@ (2va`&`@&`cn>a(t `@ ($" @@  $$Ă  "D2@@ (Ā`  ` @ 8```2`! p! t&`H&`L! '! ` `@80$㿘> /`D2  @*  *`2 2`@P@ >@? ?5   @@P - >` @N$  @P#@ >` ? c@N ,, 2`4@4@N  4 @ D>` 2  @* *`2 2`@Oْ@ >`  ? ?5 -  @@O̓- >`(p 1  `"/ (  ܀`$            '''''''''  `?  ؂ `Ҩ  ܒ  @!  @  % @ "" %, 0`` 2  `   ]% 耢*܀* 沄@?b4` `\2l 2`*`@ 3`+ +`@ 0` ((@@ c@ 3` +`C@+ @3`C+`+ @@3`C+`+ @@3`C + +` @L@  d`, , @PQ@ d, @PL$  %   쀠``  @1 0%ې        `耠`Ԕ  @ 0%(   u Ԁ`܀`"  @ 0%h   _ %`$%%%Ho&4(@g=`0@`? @(`@`$ ^ `@(`(@@ `2$ " $ 2% `2 Hp@ς  Hp@ "  "` ! "@2  "@,  "@&  "@  @  "`2  (` @ < 㾸 Ϡ -  ܀ ( `&' ' '  '$ ?( (?0 0?8 8?@ ` 'H ` " ⏔ ఒ  &2P㿘 `-20'   !  0 8@> 0 @8`C@{> 8 2   !  㿘Ho&4 (@g `"  ` (`@ ` $ Hp@ 9  `(@e  @a   ` (`@ `  ) @ #` `?<?#` J @<  @8 #` @2  @. 㿘 `  `` `    ` @  @ 㿘    ܀ v 㿘` X   ``   `'` 6` T` @ 㿘   ` ܀`(`@` "   ܩ,`  Hof4(@g`Hp@`  `$ -`0`` 2 `   $$  4$ $ U$  沄@?b4`  `\2l 2`*`@ 3`+ +`@ 0` ((@@ c@ 3` +`C@+ @3`C+`+ @@3`C+`+ @@3`C + +` @I@  d`, , @M@ d, @M$ 6 $  `   g0|  @| @  @w }$$z㿘@!  !`   @` T` !" " ?" $` 㿐@  "$  "  Ho&(@#\#` !>F>Ft!,>Eߚ`tHp@g 㿘 @` X  (`@  ``<@ "-@` `.@ ""@  `"`"   @& @ `2  `$   (@<  @8`C< (` ` ဢ 㿘``  X \> Ē`0@" h@yÐ 7`4\ ") `` `+```@"&` `"@`"` @ `& @@y`0`8@< <`0B  7<`8`2$`@ȳ 7``鲔 2`0 @㿐`  (@>@㿐` @j`   . @` .`?(2> /p"  p> /`t2"@2> /`t`t> " > @2 >G`t>hcL! @㿘> /p > /  pl> bl l> @!p!0㿘 1> @!e!H  > /"" " " t"  t1> @!T!X @>Ga 㿘!> / t`> @!A! t > >haL> ` @!5 @)@!/  2 1> @!&!p۞@㿘 2 d㿘#> /`x`> /`t " $`x !   2$`x㿘}  $ $    $$ $ $t > @ !X0㿘%> /x`> /`t $t`  $    2 $x@`$  K@(9  ""`K@(9  2`   "`@`2 " `@`֐ > / b>h> Yc̘#L> bL`"> > >hcL `>hcL!㿘#> cl`a" @   @cl  @@8N  @ cl  @ 㿘@滐 㿘@涐 㿘@汐 㿘@欐!㿘@槐!㿘@㿘@  8> c<' @dԀ > @ !@  Y> ā@ Ԁ %ܠ , "   #\#`#d#h  ؘ @  > @ `0Ѡ @*  @#` $ @   2> @א!@ |0@ v@  > @ː!@ p0 4, @3#> @!@ a0㿘 > @#(@ X> b z>h>c#L>h>`#L` >`0`>h>atL>h >[`xL@@J>h`fL>X``?J>h`fL>X`8`?J>h`fL>bp`?J>h`fL>b̒`?J>h`fL>a`?J> `f>h>!@`?L>[`J> `f>h>!4`?L>[`pJ>h`fL>a`?㿘N> $`f$`? >hcL@J>h`fL>c`?>h>`PcL>h>cP#LJ>h`fL>a`?㿘` > Ġb@@   `> />Ic<"> c<' @  . [ > @ߐ!@  > Ł`T> tbH ; 3t `"G@ z @ a0> bt'l?p/x &pl@xta > > /`|> > bp>  xbx>  t> @"0@ 80> @"@ 20   Z 0bt>  xt`ˠ @ 2 (@ /x@p > p> >  x l @   @ ?'lt`%t@Ȑ bx 'p@  > > @H"@@ 0i@l t> @="P@ 0^xbH@ x0Ý㿀> bx>  bp> >  b|b>  t'#b> b|*> > Ī`Ш`> 0> /`#> 0 !> @@ !"|`@  "$at@@$at@ "|`>  b  @B `"@ 8"@@`2 # 0`` 8 "!""2 " 0``2 0``" ``3``"• "   㿘  2 (`(` 0@@```> Ť`(`  ` ( @a;` 2   (`(`@@`㿘  ʐ !%> n`" -  ``"" *`` +,  @ @8,`2, /, &,,㿘  "&@&`&㿘    `" @@ _ " 㿘`" > Ű @ >  @`[bP > `` > Ŕ`> Ű @ ؁`> ŀ`P`2` (`@(``0@@`j@> Ű`       "`  (`(`@@`@!`  ( `@`o 2  @> @`d ` 2`  @`@ -+ *> ŀ`@> ł@ > ń8@  ?}&`> Œ  h@v > `}` 6X 5 5 6p 5 5 5 5 5 5 5 5 5 5 6 5 5 6 5 5 6 5 5 6 5 6 :T 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 :8 :, 9 9 7 7 7 9 :T 7 7 9 7 7 9 7 7 9l 8 7 8 7 7 8 7 8T    ((``2 ( (`` " ?2" (㿘!>   ?? >  $"p 2>  bt㿈@ /@ @# 2 > @ސ!@@ &> @ ?'@ <@l?'@s > @"@@Z@! @T!> > "H`H@_\  ""H>  @_TaЀ ""H>  @_La > @͐쀢 > @"P@.㿘 >h@ wL> @|!0@ 6 x> Nc<' > 0(aPaP``8> (`>L `^8G> > @X!> @U  ?> Ł ؖ   @6> @A#(> >h @ 3L>  > @4!@>  > @-!P>  ؖ  ߚ  > @!H>  > @!8> @!X> @!p> c<@' >h> ŶcL>L'Ԯb0> > ŸaX .> Ԩ    , `@  ?``1% , `Ii@ "۴> @Ӑ д<>  bt> c<@ > Ł(`  ؘ  @> Œ@!p Ҕ > @!x ǔ > @!     ?`^@   ?`^@|   > @j!u  q  n  > @Y!d  | ?`^$ @LW  S > Œ!`@B ] J<`@ 3@9> L bp@  Y@  T @*5 @횐!㿘N`3> 0"  `ؔ x`㿘@ $   % (  = ,@ > c@"@ > bx"@ > bl"@ > @ "H > Ł > bp"@ > bt"@  !!@ > @ > Ű !Ё@ r@ !0㿘@t  @X  >   Ѱ $! >  $ ސ!㿐Ұ @@> > ŠaШ)`2 6`$@F'@( ?`?` $M ߀  ک'@C?ڠ' Ѐ`@C'@%@ 㿐 @?`"> Ţ a @@'?`  ^ @@'?`@$ 㿐ǰ @?`-> > Ťaа 0@@'?` #퀤  (@@'?`@k$ @@#@#`㿘> 'bȀ@Gd@[Z@D㿘> > Šb0h : Р `Ѐ` :  L@@%v (` : @(`"> ł` (`8`@`$`H`  -@%^@(`2` > Ų a@r"`{1> łH_2`@%I``{21> @_"@%@8@pN`s"N 3> 0>P `X a/> Ԩ1> `Ka@% ?  H܀L@` @ H (`8`@c`  +$ (܀ Ӏ`!> "`$"k> "b> @ "4_L@] "> @"a''''''耠`'  , @2  4* '@̐''@@o L@ @`  `` H``Ω`t% @(`8``:` @(`8``:`L@` @ (8` +)?{H`  _s(ܶЀ :3> 08  H IP I H I I J< H Jx H J K< H J L H L H Kl H K L( H L8 H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H Jx㿘 @#㿘`#%> 4#> b8 @: @`,* @#Б: b8  @@8@ ܒ4b8 ג"@b8 @$b84  @$44㿘!> %> "48 ͐""4#> b< ǐ @b<$8$"4㿘 N@#  > "8b0k?`^5!> "4( (("4 ("8`$"4@#v&"8"4"8Ғ"@"8"4  @  . >Q,!> %> "4< @#[ "4< $"4 !> > "4b<@#J "4$"4 > > b48  [ !> 1> "4"8@#0H"4"8`$"40> !> b8"4@H@@# "4`$"4> > b4<  0 #> 0> 0a\d%> @1> <"8@ %> 0 > )> 0"%> 0`"d"8`@ !`` @(!X@$`#!`> > b48@"   > 9"x!> > "8b<@0"@"8> b4 "@ް > !> <"4`@l ("4@"(@" "4 @"H"4@"H !> %> "4<8 H0N "4<HH`  0B%> 0)> 0`!X > #> 0"a\ 5H`i@!!\!!\a\ 0'#> 0a\ > $a\")> 0@ K%> 0!X`@> 0a\@ @ \ \\H@a\a\`Y> 0!X/ \%> \<1> &"8H`"8(@!X`&"8(@`#!``"8$a\(@`&"8 "8> b4"8< "@!X@$a\ \ @" !!\!!\d!\`1> %> <&"8H`"8(@!X`&"8!X \ \%> <> 1> b4&"8<"8 ,K@H* > )> 0!X"@  "K@K@ I2ך`@ " <> 0a` $a\)&"8 K@`<)> 0"㿘@!> > > b0$"<3> 4&b8@! @ b8(@b8"<  U Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul U U U U V( Ul Ul V V V V V U U U Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul U U UP> > b> @ > 0ah  >  ah> "@b?H!"@> 0 ah> 0 al㿘> 0> 0 ah l㿘?߀`]  ? ?Ѐ` ^ 0E> 0a%>  $@ ` ` `7 ?@Ղ@$@ /  ? `?` `?Ѐ` > ŀ ?> \" `> ŀ _  @Т?4΢?@ O o T& t$ X$ x"> 0a0 u%> ?` \?` \ _ \K `?8]> Ń(`>Tl   \;> > (bH> łbH`xⰢ`L?`?` \?Ѐ`  \ _ \ : \,@H  \ ,@`@0' ?2,@ِ,@ ?2> > ̐">   >%> @w"?   <       .        > 0al  al@㿘1>  xe"Ȁ "> > b@ > 0ap㿘1> n!` 1> @"> &!@# !> >h@7"> @# &!㿘> 0a`` > ŀ cX> Ŕc` @" @> ŀ c8> ŀ c@> ŀ cH> cP> 0> 0ap > >hcL 㿘-> 0x)> 0+> 0!p6%xa|@=l@  !p&a|%x@ !p㿘> 0a`$ ?#> 0at@> ł?߀`]3 Z C P cch @@o8`  (``@[ c: q8 Kat $at> Šcx@X8`  (``"҂? ΂?!> 0@H!p> 0a$!p`> 0,!p x> 0#> 0a|ap@<Ӡ$ap$atΤ > 0p` p@! > 0t> 0` p t> 0 x$at @@ > 0t> 0`$!p t xh> 9> e!t<' > d@=> > c> > ŢcԤبЦ;> 0@@    @Ԕ@' @T ̀`b쀠 Ԁ@Ѐ @!t` @Ր>CW`t@  > Ł   @ʐ0@;#> P`  P" J `p> > cP> `? H cT> >  L b|J> `p>   cP> `? cL T>   b|J> `p>   cP>  `? D cT> >  L b|J`c >   cP>   cL>  b|  cP>   cL>  b|㿘!> #P`  ````  > L` L#P`` > cP  h@ 㿘1@&  " @ `"   " &@ `"&@ & & &@> P` `!`` `  P   P   = > H` H> cT> Ł @#~>  @ Ё㿘> c\` `@㿘> c\` `@㿘> c\` ` @㿐?+> '%cX> 0 a?!P` @( %cX 2&㿘> c\``@㿐 !> #X@  #X&&@@%@&@㿐> 0b䀠 ۔ > 0 a!P ` `  㿐 > na@`((`` :(('(``㿘> c\` `@> cX   >Xb,㿘> c\` `@> cX  >Xb㿘> c\``@8> 0b> <'  @*V` > 0b쀠: @`2>  @  Ԛ > ƀ#( $> Ɓƀ#( @` > şƀ#0   > şƀ#逦`@) 㿘@Se   L@  @S[`?㿘(`O> 0> Ťa   (` `8`:2 @, , @`@S9 * :  ,  :, @(``,> 0a`w >  ` , ݦ ٨  cX ަ 㿘'D D 㿐(`Q> 0> Ťa   (` `8`:2 @, , @`@R / :  ,  :,] @(``?> 0a.`> Ƣ>Z`@``@`@ , ئ Ԩ ? ݲ 㿘> 0 a,` `@R  `2,`1> @ϑ $ ` ` `㿘> 0a > ƅ. `2   ` ` `?@ H㿘@J` ``F"1> 1> @ x @8[N` @2N@R "`N` @ p㿘> '>C b1> 3> ư @I``@> 0b܀bܰ&@> %> `"1> $\e  2%> 1> $\@& 㿐  `?`?@' #> !>C$bH p )> cL`B`2(> > @6  p`1> &"x> 'bȀ("x> bL  20> > @ > @!H p $bH@ ؂ p`1> &"x> 'bȀ"> "x> >h#L @ > > @  `"> > @  > Ɲ㿘 `@  @&@㿘   @ "   @"@@  㿘{ > 0> ư !c8> 0@> "H > e@Qa 2 & > eat> d@> "H> @QK 2 & 㿐D > ϐ! > 8  > + > !!0!0㿐'D Dy 㿐 ] > 0D"  D㿘)> 0#<`> 0cH > >Ba#>B cl@ 8 @    2 %#<> 0 c<㿘!> 0#H`> @ "#H  > Ơb  @ "   21> @ !@> 0cHcH@8 `> >hcL! >[b4@㿘> 0D > 0  D@> ` @> @ ɐ"0㿘!> 0#H@ @2@21> @ !H  @"" #H" $#H> 0 c<1> @ "H㿐 ڐ 2cΒp> Nc<' h  hNl" > ƶ?Ɛ"`>h> ƪcLp> Ơ bx$ؒꙔ  c    U@ aԖ    K@ WԐh  2ې &> 쏐"&> >  t p  > Ɓ b>  @ߣ" r t| t\ t< t s s s s㿐 ``((` ->\ !> 7cL>`0> `$`,` -> Ha`` ` p@ @Ľ 0Ґ> 0@͝#L> `$D> 7@#L0> `$(> 7@#H0> 0@!|> 0@w!> 0@o!> 0@g!;> 7cH'@^  `('cH ;> 7cL'@M z x`8u s'cL  @*@`  `*``  @*@`  @ `*`*@`  ` @*@*``  @ `*`*@`@@ *@@  @(( *@@  @((  `(`  @(` *@@  @(( *@@  @((  `(`  @(` *@@ (( @(( *@@ (( @(( *@@  @(((( *@@  @(((( *@@  @(((( *@@  @(((( *@@ (( @(( *@@ (( @(( *@@ (( @(( *@@ (( @((ɞ@@  @( ``(  `(`  @(`  `(`  @(`  @( ``(  @( ``(  `( @`(  `( @`(@`?㿘  $ @4F 4` @8`& & &  . 9@& & & & (& ,& 0& 4㿘 4ܐ h  =`2 tҐ &    =`2   0"  x 0" 0㿘   @3 @* @8`4 < ʠD?& ʜ x t& Ă @& & 㿘Ho,4 4(@m 4`4 !8`" 0 =` 0 Hp@㿘Ho,4 ̂(@m  4&!04` 0@ Hp@㿘` 4  !  h`I` E0@8`$`@39`` ?@ 0$ 㿘`"  ` ! > 0@#cP@4#͕` 㿐 &////@4 `9```2 /@3$@ ? `  `#  (@/.  `   ``(( U/?(?/㿐 4`d>r 0 t x l! #\ T  . `( 0 t l>r@T 㿐N ݀`2 4  @   4``"`$ 0   >t#\!   . `` `$ 0  >t@  㿘> 0c .  4 0 \@ ? X N ݀`"    0  . > Ho4 (@m 造`N ܀` Hp@ X0 `  `  ``)   "  ` ` (c& "   "  "   "   ` `  㿘 .` .` &` &` 4 0`@   &`0@8`.`  4 0@@P> c<' .`  4'`H 0 Ԁ 4'  0'`D . > @Ґ"㿘 &` 4 0D@  ` &` &&` 4 0D@ ` &&p> @ c<''' "t`` `"' 4  0'`D "~`Ѐ@"p&@p(`*`&@1. > Ɓ 4  0'`D 2` ''Ԁ m'  ܦ $耈@"` 4/' 'І`?Т` @1|'@1x'Ѓ(@`4 'hЀ ` ''ZЀ@& .@1R& @ @. `'`$@ц @̄ 2(s@" 㿀> @c<' ""  4` ' 0`?`'D 2 ` `` %  `$`` > Ɓ   ``$"` @ټ"㿀>  4c<'   !<&@! &`@!&`! !&`D &`!&`H &` !&`L &`!&`P &`!&`T&`\&`!L&`d!`X&`$`{֐`і`;!Ā  4' ''D 0@ 2&`&`&``k!@0 &` !(@0 &``  ̂ @&`0  &`p!,&`t&`4 .`8 .`x Ԁ@ .`9 .`z.`:@ .`y <0``.`> <.`~ .`? .`!@0n &`(!(@0j h&`h!(@0f l&`l @0b! &`,&`&``, &` =&`   @0M &` @0I &`> @"㿘"!!( h @0:&`  @06&@ `" &`@0/ $&`  @0* &`&`   > 0cR` * ! > 0Pc"`8"` 0Dc"`8 <8`2=`2 0@  ̀@  <8`=`"4Ą@ `` `"  㿘" 0 4"  T`@&@ L`  @ &` ` ` ?   @ &` ` ` ?  \  @ \ @ "  2  >`p 㿘> 0c . ߰ 㿘 4`P`"`  0` @ @ 㿘 \   @y  2 㿘> 0c . aЀ``4> ưaРcx @i aЀ`0a@"ID(  a@(0a@"&@ a@3 b}@`  H`0@  @  `\" "$`\ @`0@ `@`0 8`0@`0@㿀> c<@'   @" ` ` '@ ` '`@5 @02 @ 0> Ɓ` ''䀡   ``$'耡`  4 0`@ 90؃( 4@`$'@@ 0@U"㿀> c<@' 88` 4  g @: 0`@8`@"g`` `<' 4 '`D 0 )`S  $"4' `"4`ؐ @ G 4 '`D 0 ```$@# @ 2(0ĺ"@@: 0`@8``А ' 0Ń(@`4' 2`0> @ֳ"P> c<' ` `4'`H`0 Ԁ`4' '`D`0 " `4 > Ɓ@ '@`0@ P0@w#` > 0#`> <@' %#@ !`!`  ' 4 0`HȀ "@ +!<`ꀦ  Dƀ Ɛ`?/0ǀ  'ǐؒ0"'> @"#㿐"!. . j  耠@ `2``2( 4"  4``)>t 0    #\!  耠`"&! 4`d!>r 0 t x l! #\ T&!@! =` 0  !  `$ 0  >t@   0 | l`(>r@T&!@Α!㿘> 0c`?0` @ @c(` !̀` !Ȃ` $!Ȁ ?` $!ȁ?  !@ɜ!ȁ㿘> 0c . Hol`A(@m`A!8`"5 =  M  ` !8`1 =`":!4   @&  '` Hp@@ @Hp@`"  !0@ ΰ ̰`р`ذ@ L`ِ0߀`" ̰  㿘> 0c`?0` @ @c(` !̀` !Ȃ` $!Ȁ  `$!ȁ k!Ȱ`$!@!ȁ> c<@' !  p` ``  8@&@`` @ `0> @Đ#0>f ࠒa >;a !>9b%㿘```> ƀ`c> @ǐ#> Ƃc> ƒ@# > c㿈  >g'''X@ۇ > @# 㿘@, @ @,`@  `@D 2@`@D 2@''@h> 'Ȥc<'  @D Ȃ`' 4 0`H ? > Ɓ@7#H㿘@Du B\@Do w`;`q&@1(  &#/`/` @``,@DN `,`$ @$ $`$ 4`&`@&`(`Ԧ&@3 (  &#/`/` @``,@D `,`$ @k$ $`$ 4`&`@&`(`Ԧ .` (> c<' > @ Ѐ`"> @`"> ``"> ` `"> ``"> `$`"```(`"`d`,`"> `0`"> `8`"> `@`"> `D`"> `H`"> `\` &`8&`4&`0&`\`@ 2&`4`h @ 2`h`" `@ `h @a  .`.` +)p?> 0&a'''&a<&a@&a&a> 0> 1c> > 1`PL> > &aD.aH&aL&a.a&a'Ȭ`hPȰa@`'`H@ P`'`H 2Șaxaq> 1,a<#\> !#\aȀ`2O`(> @7#&`4@ > Ɓ`2D`,> > @&#0>ga@b0@ҿ#X> &`4@ 0`!> 0#Ta  b 㿘 !@Ϭ&!@ƨ!@Ʀ d@Ƥ `Ho,4!Ȃ(@m!Ȃ`&!> 'bА!ȃ* *> ǖ @ @X => ǃHp@ DA h> ca `0> ]`L>q`L@`0   @ 0`@ 2 @z   @u   @p   @i  @ `0  ǰ `'> '`d=Hp@  @*ݐ$a`G$a@(`~`0a@`:`Ho,)(@`$`@$`Hp@ "`ԁ! ÔЂ *$`d*@ a$`d` `ԁ m``=`㿘> 0c .  4Ho,`(@m`"  耠`28!8 `&  造`2'N @ 02 <`" <`2 <`2 &!8 < =. <. =&!8& XHp@  =. <. =` 4,@ 0. 造` 40,". 0@ 0. ' 2 4`" 4@ 0 4  `  ` ```    >jcX@㿘> 0c . L ݀`u !Ѐ` > ǰ!Т` @4 !Ѐ```2!8!,`$!, `( =`/> !4 ",!@'`:  @>`!@'$@&`!4 @$!4`> ǁ `ڀ``&`@>` ` dHo4 (@m  Ȑ! @ T @$ d!$ d`U " Hp@!`I @  4@ $  $ @$ 䀠` $ L ܀` *Hp@!@'v@ 2Ͱ !` 0@``Hp@ # W 0㿘> 0c`?0` @ @/c(` )!̀` !Ȃ `$!Ȁ```  !Ȱ` $!ȁ`  `$!@!ȁ 㿘> 0c . L `L !Ѐ` > ǰ!Т` @' !Ѐ`!8`"; => Ǵ` ```1 Hol4 (@m Ð T!   @$ `!̀`F$ ` D 4H 耠`L `! 0ߐ `> ``> Ǵ` `Ho,4 ̂(@m !0 ! `V u @$ `!̀`w$ ` " ̃Hp@ Hp@!(`+& x 4*@&$  $  t$ Hp@!$` 0@!(@&^@ "h`0Hp@ #ئHp@!(`@&A@ @&8 !0@$!0`p n0xHp@e # 㿘> 0c`?0` @ @/c(` )!̀` !Ȃ `$!Ȁ``` !Ȱ` $!ȁ`  `$!@´!ȁ 㿘  &! 뀠`> Ǡ d` 뀠`2  & d! @  造`& d 耠`  ꀠ`> Ǡ `` ꀠ`  & `! @ٖ  耠`& ` !&!Д"s  造`2  4 耠` 40@ 0 ,@ 0 㿘```"&!́    㿘` @ d L `@` @ 0 X  @ @2@ %&@ X 㿘Ho,4 (@m 耠`"   ``  40@ 0.  造`  d` 4,@ 0. Hp@@ d& d@ `& `(>  4c<' `C  ` / `/`<a 6 @ ' `@ ' `"`T'`T"`' `"`H'`H"` ' ` "`L'Ĥ`L"`' `"`P'Ȥ`P"`' `"`D'̤`D '      " ``= 'Ц'Ԫ  ```,`=`,`= `=2a8 `\@`0 2 `=%???? `=``0 @    ```l`l"`,"&`,`,`  `,`,`ޤ  `l?@$ `` "`l`,?̠Ē@$ؐ `ހ`2`l `l8`, ,``,8` ,`` `*a 4 `\ `za< ' `ؠaߐ`ߐj `X"`;`\`"`;a<ؖߐ`XߐT `;`"`{aؖߐ`;B `{`"``\`2ga<`" `Ғa `"`aĀ"``4' /' '@`0@ఒ `" ` `=`M`N```@`0 `"B`Ho,'(@U .`@`l@" `=o `=`  `造`L`܀`*  `耠` L``5Hp@ p`" ``8 ( `$``" ``8`$``"````Ă @4$``8`"%`x,``8`2 `x `造`2`x `=`"`xHo,(@m Hp@ %`x`"! ,``x` `耠` `=`Ho,(@mĐHp@@ > Ɓ`3 0,`=?  8 耤 " c ''   2`\``@`lF`lP``,`=`> 0LcP@#H#q `> 0EcP@#A#Q `::6. 2`\''''''!h`Ă  &`l????''''''m0הؖߐo`{Ȓ "`0q `=^`2``8@#h; 2 `= 0 `<`, `4`0@ $&`X&``&`d&`.`.`&a,&a4 &a82`< "M`4a`> ``` @2 `4@`0&a8.`<.`= `.`<`< `.`<`<  @:ːa`a aa aaa````'d'h''''''''`'t'l'p//.`.`&`l&` 2`4`h`" `0`@ `4`0`h a aa !> 0#Tޒ`ڔ a㿘> 0c`?0` @ @5c(` /!̀`  4`' !Ȣ``$!Ȁ` `` `  `$!ȁ F!Ȱ`$!@>!ȁL 㿘 <`> 4 ꀠ`: @% h | l x@ @ & | t& | N @ +&  N `1&   @ & :& &  d`"7 ( !Ѐ | t ``. @ `& ` d` ( 0 |>r@T & d  @ &  &  t& &  t&  0 |>r@T "Ő> 0c . aЀ``4> Ǡaа` @ aЀ`!@ }@"*0a@"v\!~0 a@F0&a@2 @"a #@@@H a$@a# a@&a@2 ﭒ@"\a"@ @ Ho,4a((@ma(@!)`&``l`@!#"&``|a(`t$`@ q &Hp@ C `@`0`0@ €<``0@ $a8`  @9  `=``'` a@ `&a`@ , & ` `̐Ho,(@   `=,`,` `造`   2 `=  `耠` Hp@`"x$`X`X`B $`X 倫 a a(@ `&Ho8(@````a`̠` $@ t &```@ n"&`a@$`&Hp@ @2 a8& @2  @2 a m`m0v 8`0@\`0@ & `<&$ `0 㿘> 0c`?0` @ @4c(` .!̀` !Ȃ `$!Ȁ``` [!Ȱ` $!ȁ!Ȱ`$!@ !ȁꀠ`  㿘 <` 4 뀠`"  @#   @@ &  &  N ݂@&  $&   @ $N ܀`$ !4@& &!4 䀡  $@ @@  @@ (@*! @*& !`"!@n  0!@  :  Ȃ& & @@64`` 䀡   $@ @@  @@ (``@*! @*& !`"u !@  / 0!@```"O`$ =`"!8N ܀`") !8`2! ``.!Ѐ   d`K. @A d& d```B`$ 0 >t@  Ā4!8 !8 ؂@S& ݒ !!& `l&  ܖ t  0 >t@ " = =!& `&   ``㿘> 1`l > Ha`  ``((> ] `L㿘> 1`l> Ha 2 ((> ] `L p 㿘> 1`l``p2 `(`(`> ] L,`" @> Ha`" `㿘> Ha` ``@㿘!> H!` 2`` @ ! @㿘> Ha  > 1p`!> 1  p`$ pp pp`!> 1@ 㿘> Ha```> 1`l  > Ha >`0 >`0 p 㿘 `b@> 1`l> Hp2 ((> ] `L3> 1`l` @  &`l> Ha 㿐> Ha$!>   @$  @є 6 ((> ] `L@d 6  㿘> Ha ? > ``4 ((> ] `L@@4 > @ܐ!    H'0`w@   @Ґ$$ږ " @k @9$ 2  $ϖ 2   ,@P@ 􀠠 ` @ؐ@]0''܂? ''P@ `3`( @$ @`3> 90 bl  `( ` `$ `0 `4 8 < `@ `D H L `P@ `T ` @ؐ@  @@]:0@v` `P@Ð@M> c\> `0`@ $  @-  $> ǰ ?@(#  @Œ   '?'''''@ ` @ @ 4`"@       @ @  D '''''''''Ԃ'@@  D&@&Ȱ @l  $  0 \ h h L D p p 8 \ 㿘 Ă?!( (@ Ȃ ( 1a( ܰ"㿘 Ĥ``([ '> 1`@U)> 1` x9$,7$n  ` "?0``@)8 (@ Ą`(@ Т`  | , L  @ 2? Ą (@ `@$ Ă ( ( Ĵ$ ((@  㿘!j! i>  `   `2b> ! `,` $`,!Q> &!   (`@(`@@ d$!(&!(@ &!`逈 %2  `݀ $`,! ``$ &!&!  (`@(`@ d> ǒ @! $`,! $`,!> @ڐ!$`,!> @!@@!`@!@!x㿘> ah, , "!("  @ $  ,   ) (`@ d    &!  &%6 >( (@ ( (@  Ђ?(!`@㿘 ! ( ``(%m%&%  % @(@&%&%` Y&%> ǒ @q"` .%% &% -> 1`@]/> 1` xU ,S 9  ` "?0```2F Ģ2%%`"| % &%+@ Ĥ(@ |` " Ġ ,   @ 2? Ą (@`4J `(`>w%Ȃ%C  `P %2% Ă (`" <>  !  8?@?`@ @.% .% {.%> ǒ @"0t  q.% n.% k.%`@p %%@M&%  (%Ȓ @Ð!S  T 㿘 Ģ@T `@O'> 1)> 1` x$@,7$@  ` "?0``@)/ @. Ą(@ Ф`  | , `  @ 2? Ą (@ `@$@ $@(@ ā 㿐!`>  @`%> 1|`@? %-  @``@$  `@ w` (@@  ``2   > @." > @("h Ą (@ |" Ġ > W T>   @2? (@ (  @ > 1 `x> B  ?> א  ` "? 0``7> ǒ @#@! Ă` &!(     &%H&% (@ (  @?(!&! > @Ő" @# Ē @#! (@ (` /> ǒ @#X!@l",`@ (`@d *!&!`&! !&!   &%&!$&%&%&% (@ `  ` @   Ȃ $( > ǒ @q#!㿐!`E> !>`g > >wa|> )> 1``  `@> `  t !"!( d ` "?0``,@:!%`&!&%`> Ȑ@+!%`&! Đ ``(%&% ̂ !(  T >  $  &%`"  `b  @`" !`&! @ !`"  %"P Ć&% @ 2> Ȁ`> Ȁ`2L!` `!$&' (``0> 1 @@x  "  @@2? Ā`(@ Ȃ ( ( Ђ?(  (  &%&!&!&! &!$&%&%&% ``(u% `&!> @싐!`ʐ`! ̂ ( %`!%̂ &!&%Ԣ 7> 15> 1 `@"`` x `^&% [ `@  ` "?0```N ` @ " !%"P !`&%&!`2 Ā`$ %  Đ ``(!%`&%&! Ą (@ Ш` | `, `  @ 2? Ą ?(@` ` `!`Z> Ȓ @ !%`&! &% `!  ( ":  /   (`/////  3 @   $ ,!%H&! &%‚  @Ɛ!%&&%   > @븐"    !`,0` ``8> Ȓ @렐 ! Đ ``(v%&%> Ʉ> Ȓ @닐   ` Đ ``(`%@|! r %Ԯ%̪  @@r  `' ,g `!${ `" !6n  ̀(@2Y  !$! @ ! !$@ &!  &!$F ` Đ ``(%K% ̖4(@   2 ` @6 8`- ` > Ȓ @-! V&!$> @#@#%@(``C&%Ԁ`"O%$ %̀2 %͂`@2 Ă` > ȃ(`>wT!$! @!  ``(%@  `)A  Ъ 0``2ۂ `> Ȓ @ސ !%̂``ʀ` (`6 ÂƂ `` 2    % % Đ ``(% Ć&% @` +@ > 1@ a|\`,Z`}  @ 2?R  %`2 !%` &! Đ ``(b% Ć&%` &``! %!$%  &! &!$%΀`` > @c!%2   Đ ``(7% Ć&% @` `> Ȓ @I!P% Ą (@`1&%̢ 㿘!`"!@!> Ȯa> > ȴbp;9> '  2> !`2> $ (( ,`" 04(`@(`` @(!`@a,&$ &!!`> `"&! ` ! "!@!%`&!&%@(`@ d &!   &!$&% &%&%H&%2$ ,@Ɛ$ ,!&%&! &!$&%&%&% (@ ( (@Hof$(@ ?( Ȧ ( @@)  `@"( (@Hp@1! g  `T`! $&%&!Z  ` ݐ  (Q `  (@ (Hp@   (@) Ă  (6 Ă  (0 `@  "T %  @@"? Ą (@!A Ȃ (!A @"8@"PB b@ !;&%2 ! @ &! ! `"  耠"  !$!&  `"   `" @ `" @Ԓ#@ 0  $(!   ( @@2  ̂ ( Ħ ( ( (@  Ђ?(!㿘!`"!@!``&!%`" Ă`&%Y!`@ ``(%㿘 4!` Hod(@e!`  ``> @藐"!`B ,`+```8 @& ,Hp@+`  , ` @ 0 ` 8 4 < $? @ H D!(`$!(2$$!` !`> @#H> @#㿘Hod4(@e`".> `  `4 > Ȓ @6# `& !)  (`@(`@ d!` Hp@ސHp@@#pHp@.!㿘!` `!`@!`  `}! 㿘#` @㿘#Ȁ` "&`&`#`@㿘#Ȁ` #쀠`@&#ȁ㿘#` 8@?@#@7@ 㿘#Ȁ` #耠`" @  > ɰ @疐 ( &#ȁ 㿘##L? #(@`# #` ` > ɰ @i H㿘 @?  & 8.$0`` $,`0`Y "b(0`8$ #` @$@(`5# @#L (`0 ?@ ( #3`& (`3` @(3`$@@(`Ϣ @?Ғ  ,`$0`   @?Y( ` ($ @ @> 㿘 \a  b6 \?(2((2(" .   @*f  @D2 2   (@@`(` @*P    \ b6 \?(2( \}6 \㿘.20 "   |@ > @  8@ @> 㿘 \d@`@##!((@" \"`hE `>  D @ ###(` (` (j@>#(``<@# <#`04#(`0`@l#(0``4###@o#D ##P,@c+# ##`(( @@+#d+`+#h0`+ ##P+##`4#(`0`@C# 4 !`4 ؀2 6؀"(`@. a$!&!#L  ?,   (  @ 2 04#"@ b4#d6 \ a@懐 > ɒ @怔 㿈> ##D#P<' 6 6#6#6#`,@#"n##,@#x,@#|,@##` ,@# ,@#"#\#t,@#\# ,@#T#š,@#X#Ę ,@# ,@#l?,@##P`A,@ cT `,@   8 #p ,@2#p##l`6#,@##P,@ #` `#,@#,@#Ѐ`"#@##P`,@ @6 @ > Ɂ H,@#x@֐!㿘#D##P`,@#l @(``c" # #l @(``6?#Ԁ`@㿘Hof4 (@g a";`\80a %@ݒ 8 4`\`@8 Hp@a50 a6 @#/ ߀ 4`\`4`\` 0ڂA`@&`"Ӱ Ͱ  Hp@ 8@Œ   40l`\4`\ 㿘Ho&(@gYѐHp@㿀#D> > ɸ` ##P`B-#l# @ ##P`-#Ʈ  U) @#) 0` ## @ @+`0` `a `(`@@?####`#d#\@3(7#€ 4,#Ā0*2#ˆ@6##ń#\-#ƅ) 0@"####؅0` (#L //(`@7, 2 > @ ah @Z> 㿘 >  @a І@< K㿘#̀X>#c  4`" 6### (&#( (@ ;`&#; 6#6#6#ğ   c4.  6#{  h !>>P& 8&!Ā` &!",?`"&", 6 &!@ǐ"> @㐐#H#@ 8@@ 6#`\&#>b&!Н㿘 #>>@!, !  @  !@㿘##D` 8##P`,#l , 4` 2}#l` Q`#`M`#d` `#`   І@>   @ {6#> 6 ) 1 /6 ###@r#D##P,@c+###`(( @@+#d+`+#h0`+##P+##`6#(`0`@"6# 6 ``0`"# @> #܀`<@t##P`,` "#l##   #l  (#l,#l ``   @8> 0#`  @ > Ȃ} z <0> ɒ@x  ##D`@#P @+@#\#D   $"`#D#P(@ #"`#h#D`@`#"`#D#P(@ ##P#D`@ A??+@#T#D?(##d#D `?`+ #h#D# @@ @ +@#D#T(#D#P(@㿘#D?(@#D``@"%```" $(# >>@,> ɠ a @Ֆ   2@" 0 $@`# #㿘  > Ɇc @(`*@` > Ɇc @(*@` *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?(( @(`@ `(( *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?(( @(`@ `(( `> Ɇa ` @ *@ > Ɇa @*@` > Ɇa @`*@` > ʆa @(`*@` > ʆa @(*@` *> ʆ@@  @(` @?( @(`@ `( *> ʆ@@  @(` @?( @(`@ `( *> ʆ@@  @(` @?( @(`@ `( *> ʆ@@  @(` @?( @(`@ `( > Ɇb @*@` > Ɇb @`*@` > Ɇ b` *@` > Ɇ b` *@` *> Ɇ@@  @(` @?(( @(`@ `(( *> Ɇ@@  @(` @?(( @(`@ `(( *> ʆ@@  @(` @?(( @(`@ `(( *> ʆ@@  @(` @?(( @(`@ `(( > > ʚa @(`  @*@` > > ɚb @(`  @*@` > Ɇ b` *@` > Ɇ b` *@` > Ɇ a` *@` > Ɇ a` *@`   -   L` `"  H1`   H`  (`@ `( ( H `" H`4"""" `,"   " `" "aH`@!㿘!>  @ߐ   @ڰ$`㿘 $ " H@s L& $ H (& H@ `(㿘``(&` 4& 4`2` 1>  ? $$ @կ @sђ L & $ ? 1> $$ @՞ 㿘 `1> @Ք @Ւ 㿘> 1`2 @`  ` T  `> > ː#@'a`J 6 P`6 R(``2` 6 R`` L& L``` & L`& X``@& L` & `& L@㿘$ l`@# 㿘 $(x`@G &6``A` ``=``@  "2!!,`@&`@% ` @&" #`   ,`@& "! 㿘(܀`  @ (|`2 @" @``@ 2 @@s L(ܠ @` &(܁㿘 N $ "`@r L$ $``@`# ``?  `h81  ( %   " ``? ` 쀦(8  L @q$$B$ $ $` nd 2 $ $ @r L$ $㿘(ܤ`  7`x@  L`@p `@L ܆$܃(( @@ h|&@ h` h@r~ L㿘@v  2 " ,  㿘  2 0   @2ߐ` 㿘>`0`@vr < ,@7 ," #  b!@  @z) `4` > `$ a@  p> 1` >`0,````# ' `` ` '?؂ ''''''@* ` @&` '@``> > ː#@Za`㿘> 1`7w 0>`0`` `@H " R `2  ( 4`"` `` $D $H $L$ @}` $ @}`> > ː @a0ŝ㿘 ` @za$" `,H`a 㿘 ` @zC$" `,H`a 㿘@z @n㿘>  @ > 1``> > ː#@Òah ,`$ 4$v$  $$l  & ,ް 㿘 4`@ 8`"7 >  @  .> 1`"> ː L@om $ $ `   (@2 `4`0`$`4`$$ $`0$$  $  $`$> ˔a.`@z ې 2 0  `2> 㿘@`8``"> 1 `2W``c 7  &` > 1`2;`` `` q ` @2lV`@"iV` 2  > 1`2`` X ` @2#`@" ` 2  `> > ː 8@ a` V`V` > > ː P@a` > > ː @a` +  "` `a0.` `"&` m&` %    @?$$ `$$ `$ @$`$  `$ `0$ `  @  (@$`$㿘` ;> &`> 1` `` $$p` $$l`$$x4$v$  , $  , & ,° `> > ː pa@ې``  $$p`$$l?$$x4$v$  , $  , & ,  @ Š㿘 T  `&$l6$t`6 T&$p`  a0` 6$v L`` & L&  , &  , @$ , L`& Ly@r> >`0@E   a L` ??6$v` `  `!$x`` >`!$|` a0   x >` |㿘&d|&dx&e7   \ ) @  䀀 ##  ?) ## "d|"dx2    ) @   䀀 >`Ȓ  ?) >`Ȓ 㿘> 1`2L Ϣ   ,H`(! "! L`-  L`"  .  ? @& & '   ? @&&  $  `! K@1& L > > ː @چa$ , $ 㿐cd@I   L@mE P> @pa``(&`` &`&`(&` &`,&`$@vْ 4  `&`< ` &`@ @qǐ ,@Lِ @q ,   0` 0 > 1`  (& ,! , ` @E&`8@n L㿐(   #\> > ː @>` >     > ˚`#\1> @23>  @pa㿘 (d # > > ˤ`ب @qp@qn@qJ (` `0`, #@q<! @ dl@Z$ `` ` ? @`Ldl$`$`L`$` `> @ @q$ ,`㿘1> @q* `0a ' @q"@p  H`8 @" h (@`  @p`, %`$%`, h`2`8@pޑ@pܑ @p l@pא "`,㿘!> @p !`@p@pȐ 8``  ,a2   < "  ,`l@p@@ ` L`l` `l@{$  $`h,`l@p㿘)>  ئ@pa % @p@p 8$`$x` <```  @@ @O  @pl@pj 㿘!> @p ! `h@pa 㿈#> @p~`a `@pU  `a0` V>   @pe@pA` 8`26 ,a20 <"#   a0,, @@@ `` E@p"`   @@ޤ   "a0 ՚ a0@,, @#@ @a0$(xU` @p`a )>  @p@oݐ T P`"T R L`  $ Lݒ   $`U` v``a0''  L` 2 X`@2 `@o`@@oʐ`a ˀ L  @ X`") \ ?% L @  ``"" d ?$ L``,D   8`2> L@oy`؁@* L L. .   @ B@> 1`2`4 @ ,, @[@t@oL> @!@oB ؁ L`$ L'@oZ@o6`a0@->  `"f$ @oGa`@ `@o@@o```` @`@o/`a`,!> ` @o'@o ؀`U`#\ LC$ L> > ː `@ث"8$ d L0$ \@n؁@nݐ ؁> @nؐ ؁  @ @ 㿘#> @n`! "` @n@n`ؐ`4z ">  " ` `4@n@n@!@㿘%> @n!`!`@n@nؒ?f@n&! ,H`(!@nx ,㿘 (!> @n @n@nm ` " `(? @  ` `(> `! ?   @U`(" `   $`,` ``H "`L@}~`L @}x@n2 (@kW L& ( 㿘 (`A!> @nG @nE@n! `(`@n`@1 0㿘 cj@ (@* !cm@">3 0o@<0ch@2i@d!> @n @n@m آ `9?  3 @m~@C} f@l@e@@!> 0܂cg@!cn@7`? `?!> @m @mߐ@m ؀`̒ cg@" 0ci@Kco!cn@W!cm@w @ ck@!>  f@o#lck@Fe@ i > 1`> > ˖b@)!P0` 갆 @" cj@2 {@ 0ch@2t uo֒je L ``$ LD`\  " @| "H@|yH &L& $D$LF$HYBv>:6?? 㿘!0> `0*`!!4`@? `@1`@r!4& & &!&!0&!4&!  0`X ` ` ` ` ` ` ` `$ `( `, `0 `4 `8 `< `@ `D `H `L `P `T> @W"㿀@rא &!4 @hY"! !$>`0`"!0"!4#d #l#`#h  #\@  @i㿐 |` @ ` `h@  @  >> >`  >> >` 㿘> 1` ?6 4` > a, ,  0@Y `@@N 㿘! @ΐa$&(a( &,a,&0$ 8@a ` X&t]bi&@! ]ao! &4! \#` #` #`6a  &<  aW&X&&6p6r@@6 ?(0`1?@#`3> @6.  `@@@J`㾘> c<' @qC +?> 1  04`, > a, @ @@@e0b@"f&0c@`8 `   `e@"(%`r@ `h@"7 b@2 \?"&\  ) a) @@!2 &d&``s@2ͤ `"ɤ   @g6! @ฒ\!@hϒ 0`ʄ `&ฅ(&` 0@y  Z  `$$ $,?$( @'d''`''h' @$$ ät 4` `@ t$ @ $ t @t$0 u@ 2t ӀH( H&&  t`@? `@c`@0A`">  07`KӔ!00`20+ @ & `ਂ (@"Dࠐ@ 00@ ฒ@  e`g@"T@Ԑ0&!0`@   @” Z &d&`> @4"@  t`@? `@`@0ޤ ऀ8 @o`H8@g @@0V$ ` $@Y 8, 6   (?c> `* @  @f H$8@Ӓ@= $ >`$@$L@W0$8㿘> 1` ?0`@4# > a) ) @@ 0@F `"!!` !`" ! 2 @@&`2! $!Ж !㿘 !. .  @@e )> > %!bP  ! $ @ҟ @l 0@E`@@> 1 `1> @ő"(㿀> 'c<'@' 6 ' @ؖ"b@? ''!8@^ `!8@"@ > ˁ@+"` `<`H>c㿀> 1 D`?@0`@0`@  > a+`+`@@a2a8  <& 4 0& @d& 0Ho$(@e@THp@`T <`@?"L& @ <&& <` Ga8(`(  0 "Y,`>0`0`   @@B  a0 #\#`a4 0 H <#d5 @- - @4 B #l #h@G & 4 0d& 0a8`v 0& <``( & < 0>`0 `> cP> (b 4 #`#\!> ˒`@ې"X`P ,`㿘`C%> #>  ``> > ˘`d gffg(`c3dτg((`+`ag`(`( 0((` 0#@?``@`@ ͂`$,``  R`  > 1 `"`8> 1 `ȁ"`8("  "  a@`` ?  > #   > > 1! ! b  >Fb㿘  > $@s 1> "X@}!㿘%> 1@ܒ> 1@[ > a`@8`@p㿐!> 1@!ܒ > 1@I > a`!܆@@^8`㿘   @5@-㿐9> 1@c > a 6'> `h%> 1/> 1ఆ@@&8`h>  c|``'` '@%` @=ఢ@@ <`@:$$`@ @s'> ̂㿐 > a > . c  (8`    $@ @8` 8!@$;` @48? ?c8 8 882V+> 1@֐` > 1`> 1 ` @8`8` @`0v $$ $  > ` %> 1`pn$ . (`@ > !. @  `@,ဘC `> 1B `;B9 ``8D 88@ ; ``I@h`  @8> . c  (8` _ 8?c{ x 8?l8;` @]88$> a`x@8`x> a`p`@@%8`p@ 0(> c<'  `-> n%> `d` 5@sD@vl@v(&@  `@@ X@  > ˁ@A"@> c<@'  @> a؀A @(2'> 1@ݐ> a `3)> 1 ؔ@y @@ܠ @@Q$@@Ɛܔ! Ԑ bC @<< @ܐ@\ @@Y!@ > ˁ@8+ $`ʒ@"㿘``8  @b  ` `$'@ @  " 8`@*@```8`2`@F:``` `ဢ@  @ @c} @ `b 㿘> cl `a"   P  > >!@aX 1> 3> !@ؓbh  2`0H> `c<@'   @ X> ˁ @a (< `'`*@ `@Д@' "``@@c 0[@ ``` ` @!@u` @@ @@]@& @@w `@"㿘 `  ` !x`B /@& &` ` "tp0@& $&@8@&&& 7`& 8/0@&p0(8(@@& @&  㿐  >@ >`.`86(@>@@   @T  H@&'@OY''@   @'(% ''' @' @G''Ѐ '  'P`$` @\ &'Ёd'`'H`=I ` '0 "$8p@ H$8$<  ̂`?p8''@ 8' ??@''    p@ 280$8$<    @    @N8   E    `H 8  @8`C<8'Ѐ Ā  ` 7`!d`%`0``"8Ԁ``3N`!@h`8 @C<8@  ``Ɛ`(` @  $@@_ @-ؐ @ay 8"88$@ȥ8` ` 8 2  ''ȃ8 8`@  @N2Ȓ   ̆@`H<8> @ ```8<0@@ Ă P@ @”@N  @ @% "@\Ё "@MC`` 'І?'І'' *2 (@2 @''"t<8̠ y > `h`8 @8`8H`.$%@ɒ=@ J@`’ |@ 2Rv@\D@M@ @%@P @ @: I쀤`@  Q(y%`h`0@F8`0 2)6@MZ@li p@"`!  ``&<'ȃ(` ɰ@#'Д   > 'Ѐ@ :z<80$8@֒`  '(%@D<'@p'Ё@8$@  `" `  " "㿘 gl     &`&@ ` @u` ?Aa9, , @ @(` @,`,`""*  @a, 80`@8` d$@V0 * 80`@8` $d, ,  (( ` @ @ (`(`  -8`(`(` ( !&@&`   (Ѕ( @㿐 ? /  /  /  /ߐ  /ې  //|㿘> 9aX  <`> ^@Y " @q$  @_ :&  @n̐#0㿘> 9aX   <`> &  @p `@qC @n# & 㿘> > `  3 @ @(`@@@ 2@ 2`2 `&&   D  @W!  㿘>`0`)> 6` %> @ ̂ @(` 2    @2 @2  @qr  ȁ㿘> 'b 9 > @> `́  ` ```((*  * 㿐'H`*` `>`>` @K```  ( 8 *􀦠2Hڠ``= ` `>`` `>`2 㿐 `' 6`6`H`" `&`am&`6` @Kc? 6`6```  2;```@`a6` `@2``@6````` 6`````6```@``6``@2``6`(`@&`(&``. 8  ` | 0  8 8 8 8 8 8 8 8 8 8 8 8 h 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 P`( x0@"`㿐 `'p !`?@@f``!h @? c) @&`C`2@ `< @*9` ` L "`H@ 2HL @``ـ "@Jm  2 ``` 倢 `` 8`4 `2@(`  9 @ : 4     ,@4`8,0@,@@@Nؘ `H`@@8 `    !\(`((@@@@ 2d!h!lb`$ 7 ''6'''Ē> 1<( ` ''ܐ'Ē> 1/㿐`(`,@`$ > @ c@N !`2``( 0 !` ap `$`(#\ `@$ `( 0@>` 㿘N  `7 ``2 `2@@ ` ` `2@@`8` `2@@`8``&` ` ` @` ` @``&` ``2 `2@@ ` ` `2@@`8` `"@@Ғ```̠  `Ơ  㿘> @ #H@ܕ `!> ˢ&al "#`@    " #`&al`1 @  "'ܐ'Ē> 1|耊" ?X6 !p  x7 !''''' @ז` > 1bx[*> 1'M㿘 `"  ` ` > ˰ cx@ E " `> ˔ @ =c `}&`" > ˔ @ 0ch "`0 `@"`!@㿘 ` !(`> @x#`,> ˠ`@ `(@0@`,(0 ``(`$&` @ &`$0>`$`$`@&`$ ` &`> ` > 8Ѣ    ˆ > ˠ c@ Æ > ˠ c@  㿘 `(@ `$k`0> > ˴c@>> `D89> @`, `@@4&`(w @L`2 `,@$  /`-  ` ߃(`@`,`  @ߠ`(`$&` &`0 &`$1   `,@ˠ `,`  à `,@ `%` @`,`,%   `(&`$0&`0 ` ` &`  ) ((`@@ @"` 8` "` () (`@@ @"`8`"`     (((`$@@@"`㿘    (`) / @(@/`.@@0?0`@?`@@(`@'``&` @`??0`@@(`('``&` ` ``` ` () ( ( #`"`JC`    @(`@ 3` @() (`@@ @   @() (`@@ @# @  (`@0`"`㿘.  `"  ?.> 1ch * ..㿐+  `2 @ *"Ė ;``;  ?P`.;`;E `` #@@  Ђ``  ,`? Ђ`` ,,` ,`Ѐ }. . Є@$@?i`;2? ?㿐`\  = ."6  `;@.`B `.@6 `.F6  -   2@ "`|"`㿘"` @bѰ  4 0&& 㿐 `` &`2&@iҐ F&㿈> 1> ˬclئ&&`% @l :  @W   @R D `$ $ $   @kR " &"'$  @e3$ " 6@ < x "@E   r `H    (((`@@@$ l8`$ h    (`()   h < p  @ @ < x `4db`2> '<쀢 "@E " @E > 90` (` `4:N2\ p@Y\ h8` &2\> 2` 0`"'(@ 8  l@ 8` 8&@hi6@@#@h F> @#> 1c 0 @k3 `> 9$`b  0@j|@j'$ @! $  @h F> @א ,@8@I͘ H @@h " @E   > ̒  P@ó F@h@D> @è 8 >bؘ 㿘" 0 &`&` &`8&`&`&`&` &`$&`(&`,&`0&`4 ` Z!` Z!taD t&`t 㿘"!8!d``?㿘 6`@`Ӕ  "b `|` @W  ?@ @h0 @Wǒ 9`$$b($`$㿈 |`$'`  @`Ր @iZ > c\@ @)` `  @cؐ @ y ?@\ l`"'p` '> ̮ `  '  (8(@H H @  , ```"@D4'd `@D)'` ` `(`@?b $ 9   @D"@D `@ ?@@" @W 9&b @Uq!t @N!t`P$ `P) ((`@@ @` "$8 ` ` ` `(((`@@@$\ ` ` ` ` (`(($`$p@$t$?$0`%0@C` &b&``$&`(&`&`$$$$ l" `$V` $d"`|@C`| `\'[Sl'` X> ̐`@˔   '> ̔ @’`  '> ̔ @` 2  ' `20'0c ?@~ > '`@K 8 > $dd`쀣`" V "    (((`@@@$\ (`$p(($`0`%0\(8@G $d`H $hl&l0` 0@BlV'l`&l  tΒ ! $ @`"&? @&(&&0&,&@Z9  4`@h    @d|> ]`H&@g 0@]ْ  $@ @D @g0ې@L` `!@} -@f!0ʒ 2  Y Z  @$ ! Y $@֐!t t} 00 @~ $@g٠ > ca>0> @i`  > > lb!> @i#\ > @ > > ̐ ؒ`@jj #\' > a$ @  `a$  ! 9 0@ik@3 `  @ia@U@ #a$㿘@E(?0b > ̦ " D` 0@@$ 0 0D($ 0$ << 8 @̔ @$ @@@s  H @;  ` `DڀP 0 h$ 0@A  (`@?b@ ( @Ԑ 8@Д  0` `0` ``p<) 1     @  6@ .. @ &6&@  aW6&&&6&&6&6r@6 0 h$ 0@A  ,   h @ , T H  ,4  "$ 4    (@` `"` "  4 8       E   `(` >     "      `d`  %    $      `>c4 D㿘> ̰ @!  `` D>`  ` >` D㿘 @|ޠ@do 㿘 @|Ԡ@de 㿐 ` ad` ` ` 0`( @Ep @@   H``@@ @@ `>  c(>  ``8> @# @#@@`c @u> @t# @$@  @ 㿘``@(`6`#0(0@ #D #H` #H#0&#D&#H@uk  ">#8&#@?` `$ `$ `o$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t2$ H4` $ H $ D`$ (`p< P4$  @Q$  ' '''Ă'$''''''''䀢 Є& < @S  $ H$ D`$ (`p< P4$ 㿘" `"N"`="2    !! C!`# 2-#" ``` 6"#((`">#}2 #((`># !"}2 "Ф # 2!   .!#' ဤ".  ```6"#(@ "Ă `! `4``> c ox'D'` #P' @Pٔ *!* *"*!* "#0D`  0`'@Pő(`'$H$D $@<(䦌 `<8p8  ' 8, @ &@ d` D H  D`  "8@?88`D@  @R+!(d @  "(@>( u ^  `H   ( @ 8`@C<( j 4 ` ,`!& ``P`(` $( @ <(d`2> ˔!@c@ `2 dL`!`";,`] d p`#\`?`! `,d2(ǐ  h(, l jV`,(怢 $(ۀ M"#D'' $@<(䦌 `-<8    "(@Qy ?(, @Qn x '``o `` p` %` `` Z' #@'>4O: :*82(@:@పDL@@B=ర p @   H@s @)`p" ` @= V``RP`p ` '䀠S :t0` 00! @O< D 0(  (8(3@@p@*@"t#\#`@B$ @P=  @@=@(#\9#!@ ͘ #\V 㿘  4`W   @" ,`  | $ D0@@  @y ")  0$ 4d$ 0Hod*(@@>^Hp@Ho$ (@@>OHp@ e02`  H <@  $ @e0> @!@?2J@?``0`   HH(`0`@1`@  + 8`` @ H0 * 8` 㿈@ 4 * ' @ `   "@<` @0(? ?c(`0@@@ @ @<&@  @<`"   4@`<  @@ @"@㿐  &@@ i#?`c@ `8`9`:`;`?`<`=`>*) +` @+  ((  ` @+`  ?( @0@,`  @  ? @ + 3`?  (0 (,+` 4? ?  `@4@ 3 @   @5 0 @@@ @ܠD?,   D4`@@M%<& 4y D`@_&P> c<' @@( 0?ߨ@" 0 0 $(: " <0" D" 08   @$@$ @@:    H@  " H  0h$ 0@; > ́z  1 3`?)  @ ?3 c @ ((` @1 +`@ @   0 @) (` @g !@`@Ű  0 @$ 0 0($ <$ 0< 8 @ᇔ @$ @@:. " H @Д @ n 1 0` `0` ``p<) 1     @  6@ ..  @ &66r@ aW&6&&&&@u r6@C ς@!X (`*`2`?(c8@    @`   -"  "` "` $"`0"`4 "`:`"`"` "`$"`("`, 㿐 `` &&  2@8 "`  `  `" `+ `( `) `*((`(@" , 㿐`,`-`.`/) (`(@%??0(c0*   @Lc& d a `,`-`.`/) ((@0`(`@@0` *@+`(`) (`0* @E& \`0`1`2`3`,`-`.`/ *(`@  * (( + 1 ) @ 3`  (1 +` @( @3`8*  *@?;   " d@: d@M `,`H`-`/`. d) (`@(0(0*x@:g d '   d@M  d 0 1(`0(ђ  0 1(`0( & `*@ `8`9`;`:+`( (1  ) (` @1 @@ ޖ0x> a a aac<@' * ((`@ `?0(c? (`0@@@" a?`a> ̆ap> > ̦ aa ؀ @  @ Q 2   * ((`@` `0((`@0@@@ ?` ӆ w/@    a a aaΠ @@   @  逢 倢 > @#H㿈>`0`&"' @ / `' -> @xВ'`ǐ``(8@> > @!@e @9^! `H ? י+ *(`(@ ( +`@ 21 ?)  ?3`c  ((` @1 *@ @   @ؒ @J %`@@! @9 ! i> @!А! `@`Hw@9'@ 0 `@@L @`@`Hw 0%`8%``%` ` %`%`4 @X`   `> @EV@ \`@``"rW` `"ja``V  `4`4@^` > @m"`> 9$ b  0@]@]z'$`& (*(`(@+`@ +   21 ?)  ?3`c  ((` @1 *@ @   X@ %` ` ` > `4@"!  `4`  `4  `4  `4  `4 `   `4  `4㿘"?<c0`(`@ ?@0`*`@@@ @8` 8㿘"6`  @TG 5@tђ`   ?@W ?@s @t; `|@]Q ``2 4 d " H@K+  H "@K% @K" `$$b($`$@K  d㿐!   !> 7> #(!#\> @b( D#\   > > ̐ @b0 0#\   > > ̐"Xb8@ X@T' @\ > c\ @t`` `  @W @s͐  ?@r ڒ  @I h&b|` ` `$&` &`&`$" |` " " !' $(@<0 ( H  @J  @J `$&b(&`$ @7i@t` ?@r^@s  `H 2 H`Huh @7L?(0?c'  (`0@@@ 0 ((` @0@@0` @ @'  '77κ  +` (@;̘  `H B ׉) (`(@0((`0@@@% v% ?%  ! ! (`+ )  *8 +`7Κ@ 0((`0@@@' J   `Hj 8 É) (`(@ 0((`0@@@ % $% ( + ) @ (` `@+ ( @;`@ 7Ɔ 0((`@0 @@% % @6􀌠'`"  `"  `ƅ(`(@f> ̰ @(" H` N'瀥 > @"@ H! `H  Ӈ((`(@1 ) ??c  (`1 @@@ @    ) (`(@??0(c  (`0@@@% ,   ) (`@(  0+`3 (@@ @% 0 " P@6' P@|  d  @jՖ L`% H` ,'Q  ( @: !> @"s H  ,'  ( @: v> ̰ @"`Z H!`Hn P! 8s `  < ,5 @@% <@5%?' @;! H' 2 Hv@5 > '@)# H! `H   ! > @5i |' `!  ((`(@@#( H (`> ̔"@  H㿈 $& $ -r  쀠` &? @&(&&0&,&@L R4`@Z\ |> ]`H& @ZQ ``@q` !`@p @q "$ qt Y Z  @A$ qh Y $@6@Z @?`,`-`#`.`/`"+ ( #*+` @ ) (1  8* ? 1  2 a @ +`2 (`( 㿘  d`?@@  @!`?㿘&`  (`?c(84 &@&@ (`(` &@ (( ( @&@ (` (` ( ( @&@ `* *   @> ͂`Ԑ@ (` (` ( ( @&@ @ @b&@@c&@46@$@' !m* *  ( ( @@&@ ((?c8`@oh(8`(@(  @&@pb&@    -㿘 `4`@% `8% %  0 1( ?@#`@(8`@%  $ % & '+`(`(@ ?0( 0(`@@@ 8` @%  ( ) * ++`( (@0`@@ (`) 3  8% L` % 4`" 8% `8% $% 7!  H P  , \ 44`" 4 L M N O H I J K) (`+ @+`((    4 8% <% @% H % D`% ( 8 9 ? < = > :+ (  ;+`(`(@ )  `?( @  3`? @  *+ @  *  ?  @(0 ` 2`@ ? (0+`2 (? ?  3     @4 0 @ = P4% X% \%  , T 44`" 4 D E F G @ A B C) (`+ @+`((   `+`#? c ,`  @  ? + 3` `+` ?  (0(@ ? @*@ 23   2?@   (00@?  @ @ @ 2 ; @ @(<=  ? < = > 9 : ;+`) (`+ @(  ( `+` ?   @ ?( @0@ *   ?,  @ 3` ` 4` + ?@  (0(+` 4 ? ?   @3 2  0 @   = 㿘 @! 'P'T  B ח**(`(@ ( ?1 ) + ?c@ @  (`1 @@ @ 3`@ 3 (+`    (`? ` @(8`@"> > ̰ @Ð#  " #(`0ր̒ ش    /?@. @! `  @ ` ` `) (`(@0(0d(`@@ @ ` ` ` ``((`(@< <` T3 +  @??  0`(@G `P@C 8@`d`` ͒ 8 9 :`\ ;((`(@?) 1 ?c  0)  "@ ? c!?`+`@ ;89:) (`(@0((`@0@@"@ `&+` `?`<`=`>) ((@+`? @(P3` ? @3`   8@  @#T @ 8`P 8@?E@B@d `> Ͱ @ݐ ( ش    9?@e @! ` @ @ ` ` `) (`(@0(0d(`@@ "@ ` ` ` ``((`(@< <` 'T3 +  @??  0`(1E@@ ` q M?,8 4 (@<  @,8 4 (@< ֮@> ̰ @p#؁> Ͱ @i 㿈 `  `!   `@8 B     ! (@! `2 @ 0`80@(!(@! 㿈 '?7 2@&&@@8&@```(8*@5 > `8`@f H@ '@ݖ&@@ P @ג! 1 @? Ӊ) (`(@ ؄?(0c  (`0@@@ '@ ։) (`@(  0+`2(@@ @&@ ? ) (`(@ ?(0c  (`0@@@ '@  㿘  @l  㿘 > @֐"X"" " " 㿘  " ,@/&  ,`   "1> @B 1> @Ñ"X㿘   @ "} ,`"    " & ,@Bђ    $`& M@ "@ `@ @A m&    @/&   $@& $& 8` $  R`%$Y   $  %(` &?(c8 L>   @ m$  & , ,` &  @&  $ % (`?c(8@&  &@ ,& `   @& & $8 $  "~ , & (`Ӥ @/+&  @  &m>" @ΐ   & (& ( > @Ð   & (㿘> `  8@ @9 > @ Ё`>c4  `` >`  ` >`  "   `@ " " @ *" >`" ?㿈  `^ `@`8`9`:`;`?`<`=`>*) +` @+ @ ((  `?+` @  ?  @(0@ *   ?*  @ 3` ` 2`  + ?@  (0(+` 2 ? ?   3  @ 4  0 @  4  @   `D4$@'ۚ   @.P'  ('$@' @ca㿘 > @ݐ А #> @!a ?? c  a( a(@ ?((a@ .@> @ a@А 㿘`    4   (@`&  4 @ $ % ( ) + & ' *`((`) @(..@@NÓ㿐 > 2@T &@> @n! 㿘  P@t H 8 L @(`@`> "    ? && @t @!P㿘 ِ " @@R$  @ @@ > @ &  㿘> `0` @j"` P@t} H 8 L @(`> `& ` & @tM @Ґ!P㿘> P`0`&@t] L H@(`@!@ 2 80  8@2@t* @R 〢  &@t @t p> c<@'   '  4  @>, ''''`" @,@"0 $@ `8`9`:`;`<`=`?`>+ (+` @)  ( * @  ??  (+`?  (- @?@  ?  03 @  45`@@@ @?c 9? "` V! 2 ` `2c8 $ %(` &p/    ) (`(@0(0(`@@@'  '؀`@ (``/7*`2` > ͒@$!`   8% %`"` ( $` 2_ ` > c<@ V> ́ ' /'آ  .///7 S  ł    +`( ) (07(`0@ @@////''/ / 耦  8% %( (`> ͒@!x@ ` ''@?! > @~H!x'  @'`;'`?`<`=`>`8`9`:'*'('؆  ` *`+ )  +`@  @fԒ @ "@97 &`" ` ?*  @( ` ?  ? @ @+`2`0@ (@ ? 3 ? 0'<`   `" ,@ 0 $> a ,  ! [> ```& `+ `") `$` ` ` ` `) (`(@?(0(`@?0@@ ( 5`U`f  `$ `%(`@+ " @&d   (@h@  ` @!7` ( $H@.I@J. &k > c `8 @d8`8U $  ```  @%<,>  ` ` `@f  @9q0  ``"  c `0@8`0㿐   7``@8 5 2 H | ` $ D` `0 <@ݒ ??$ @< Ho$0(@@+Hp@ 2`  @f "  0$ 4d$ 0Hod(@e@+bHp@e0΀2| H <@욒 $ @㿘 !mg' @ !m d@Ր!n 2 !@Չ!m  !n@`2 @| d 2& @v!     > ̈́ b8    (( @@(`(` ((& 8 h 0> ͐gb8!T@`!!@B '@=`.` !m@6 d !n@0! !n!m@ D!m@$ d  !n@! 8!m!n ݢ$@@퀦 6@@ d , @ ! & Ȁ@  ̆ $@@`.`.`.@ ..`@ <@ <.`@.` $@'> 2b`> #> 2 a`@8  ##S`F@ a2   `2  `" , `    `  ` 㿘  (`  2  > F!> #@ ` ` ` ` ` ` `   @` & 㿘 @Ut   @Uh  @Ub>  4c<'  @> > ͔hp@b@у 80`@  @=$@`2aT@_   P * ''' L@( ! ''' لa`\ &> @z# > c<'  |'`  @ h!` $!d!!' h'''' 'a'a'`4' @4' `' ` `"'@`4'  `' p@'> ' '  ' `' `@''Ђ  h'p 't'x6p " 0 > ́   (``'P'''T'D`| ='X'\'|'@?H@@͔ h`۰ 0 'p  ('x't @Tw ːp  @Tnp lht* @Tc   'p'  'x't@!'p֪@  0!0 ` '(ߔ   @@ є  @  }&{@z #8H> c<' ' >@5   V> ́`'  ''' 47 7//'S `F''/ł  ''77҂  '//'''777'7 @S֖ 4 ( 4@@ E @8ޔ '?>@4Ȕ  @:s 0@y#P  @ `  ` `  `  ` @S* ဦ(4 @ @> ͒@"x> ͐| Ȁ@G  > ͒@"> ?`  "    > ͒ @f"Ȁ@  @SS @D  ?@ޤ x  #`#\#d#l #h@d `2 㿘, ,  @8;aٖ 20,(`@@. * `2  $8 *  @8 a   " @9 @9  @9 @2 @ 2 耦㿘'T\`> @ & 8 @  @@ @0``'@'@`(`@'@ k@  + +  &  >ɠ`$  $ `$ @EV$ @$ $ @"    + + $ &  @$ $ >$ c܀` @E7@$ @$ $  @8@@T G  & >Ȃcp&+ +      @  T@  / + +  @&  $ $ >$ `耦` @D$ @$ $ & @&>   8 @T @p @l @hg   C8@_{ x` '/`3`*   `(`0``(a @`" `,8` > @" ,  @6a`  ?@8 @ϐ`ߐ &a&a `,5> c    !(0`@) ``2 cܒ @0a  V  `,"ǒ> @##Ð  ``  @P> 2b&a4 . 0`?'> ͘ pB  "`,> 2bb`   !`,`o  `''``6```,@[ '耢 ؐ. 06?9   'a#\M'䀈``a"a(e&a @&a "`,a ""a(&a @&a  '&a&aa '#\̈́ @&a &a&a  a "&a a2 &a@> a a&a@@(@&a&a@`@&a$  @5ݔ " `*" `," `@"" &a8&aD@7r @`a@A0̂ @n&a> c<'  D '?'l'''t'p@;l   4`"` @G'@ > ́`@_/ 2 P`$"`@vX#``!@_  ``@^ @7   4    Ѐ` ,  @5Xܦ 2`쀢`  > '`8    ` @`2 `-  t`@@ @@ x`"` @@&D'dK'>  a '`` ` ,`t8  'x t@@@@ @ @ @@'@  `@Ϛ   ^ &D' Т  `d/@ @@@ '&D¢ ``섐`?   (0`@2 ''`2 `"% `  '#\Ř @  @   @ @&$& '' @_` @u ePaDa@'` a8 @  @6 > @#@6 > @#@X`'  ''  ''>  'Ђ ''̄ '  '؂ '''a<'''_ @̰㿘@  !@`&!< @㿐`a(`8`!a` `> ͔ @咒cp ` @ L ` ` " (*H  ( @(`8 р ππ    al` @_`!`@]l @^a(`9 @8t ,a0@@8J , za(`&a( 0 > 9bl  (0`, , ` `? ` ? `  a( ` @3&a(` ? @3@$`  ? @3$@ ?$@3 $a(`,"@)  2$@&` @Ò 2`a(``&a(> @#a(a&a, &a(@ a ` ,a ` `8a(``l&a(`@_ `> `8@Ð# " @4ݒ ?  @4Ւ ?@"`+`>(`  ` @(`8`8@ 2 2`((`8` <` 9(  H`( @^(`!`@\ @] ?=?a( `2  &a(@7~ ,a0@@7V ,`` @(`8` €` ` @(`8` ` `a0 > ͒$@I$@ $]Ȗ "B$@> @#@ ``@_T >@$] 逢 > @#x㿐`  `> b`8 &`  Ac#\`#` ?@?㿀`  `> `(&` c#\*#`` ?@̚?   #\#``` `` #d#h#l@^ ``   @8@@ 㿐` $ > `b%`! ` @0d A`` ``c #\` #`@ 2@ 㿘     (( @`  @E    & @3 ? & & 㿘``"    `(( @@ `>  `@$ @ ``@` "``@#㿘 @  , ,  ? &, @1" , , ^9 @   "& @3= ?& > @ > > > ΐ `(H@Ɣ Y㿘<>&a&a > ` 4``(@5&a `+ + >Ș &` cp a aa @ @ a    ``*```` &`+ +   a  a a @       ``@۞@>`0`@%ў@>`0`@I@P @ '܆?> ΂`X'''''@7  > @G > @B h@Dā`!> !<`'> ΢!<` @g- !<`͐ $5> a  > @#\'#` ?@P? d > 2 xW> Ψ`7> ̬0 @ $'\1 ?''\) 21? \!'''Ԑ@Ȕ ' @ِ " > 4 -/ ˦  s$/'/[ '[ Π?> @!> @w!> @t `>)> `0"$@l `@s-> @> > ΐ `@b(8@]@y@@@c@@@9 @3@ {@@> $ a@$a@$ $$$$ $d܂ > $ %> $$`$88 <> @a0$<`"$ `a0  @a0$> !  c`! c`$! `,H`b we41   ,1,> 2bdp1 1 $0\>0@la4>3@lb`> c @:Y$` @Q0 > c@G$$@ ɐ > `@$$``?8@8`@28@> 'b  @<`? $$ @& @9 !> !  <`* P <`p   <`X@<`h  8 $`  <``!>   >>B @漒c> 'b̒ $L  @8I$ @@@c>@C, 0@p@;@/@Q@@^@/O@l@f@6@> -b b   2 @g@oHo&(@g@@@vHp@ 8>  c<) @ ؈? @ L+> @qc8#\#`"#d    >@ Ga > @#Q!> "X` > ΢"Xa0 @eO "X`2 > 7@Q"P > @w,!8 > @w(!@P2> lb`> Ο@ > @!8 > !$$!> @ $!$  @ \  \#> `@< \ @Y ` c8 \ `c8@<`c8>  > aa!!`! !$` $ `   @ $ $   2 @% >ٔ  > @#2h T >ʐ > > Δ@#(ሀ G >ʐ  > @#᠀ ; >ʐ!  > @#` / >Ր!( > @# Ȁ 2$> @ ʆ@ވ>   `T> 7@QT"`> "!<@cN!<> Π"a @d > @c!P@a! @_!> @\!> @Y!> @V!> @S!x㿘. @a c  2 `(`  `2 (` . 6 㿘#> `> `0!>  ` @Zܔ?$ $`܁ ؀  㽨> <' >`0`> !> 5> c> > κc#> 9> 6/> 6)> '%> 6 $ $`@NP\"В (@d. ؀ " ` 4`> P ` L@8` @ d(@8 ؀@2P,@ P ؀ "'& 4`+ P ` "H@Ñ8` @Ġ d(@8P@`ܐ $`&`@P @Zd?&`&@" ,@ 8P`ܖ @ZV? $`@"&> `` >> ΐ!H>cȒ 8> `> <'  o ! Z  `X@;"77a@'aa!"@'``' 7ڒ'Ђb?@' ?/'a@'> '@Vb> '[bВ26 7   @ 7`'` '`,`+?`` `"%?`p'a /#\ ##`#l#d#h  ( @Y    @7'?'b@@'> @mӐ#0P @6 O@` '?'''''@Z "ā @W 4`2. #> `ܦ`%> ؀`"@> @a ܀ "  `@Ys$$@`$`ܰ  > ` @@Y` ` @YX  X  X X` XX \ X"`X" X`X``X" \ X@ "`X `X @"   X`  `"`X"`X"" @ >`p >`p 㿘   @,^ ""   >aؔ @tw@㿘1> 6@aѐ"X> 6bT`> `@aɐ`@a$`@a@`2`> ` `@a"X@a㿘 @a  & `@a&`p@` @a&`p㿘 @a @ @aw㿘 @a  `@ai㿘 @a @ @a]㿘 @at @aT0 > έ.`c.`% %@a` @"!(`(` &@` @@ 2%% @% % @a(&@` 㿘!> 6@a6"X>  "X@a `> 6bT > Φc@ @a(   $   @b  `@`  㿘 @a  `> Π cH @b  `&`p  ` & @@`Ӂ㿘00 d 4 0Ho$(@e@Hp@R 㿘  `)> 6"X@`& !>  䀠`> Τ cP"X @bF  䀠`> 6T2 @2 ?&@`"X T@`"X㿘`0> ΐ @`u .`& .`> Ά c&  "& '> 6@`X3> `䀠`> ΢`cX @b `䀠`> 6TX&@`Q T @Ր#X> @Ґ#x㿘` `hc > 'bԇ,` ,` @(`"* @s  c > '> 'b!#@¶#@> 'bԒY[ @T?@H`> aa"`" Hp@㿐  7 ` hc> 'bԇ,`,` @(`"* @  c> '> 'b!#@c#@> 'bԒY ?@@Тb@Ȥ㿐(&( @@(`& H`> aa"`" Hp@㿐(&( @@(`& 㿐@ > ```  @&& &b@& 㿐(&( @@(`& 㿐@ j(&( @@(`& 㿀> `> '> 'b> > 'b '''''@OU '''''@OJ 㿘 ,` , ,H` > $` $> 쀠`Ho-(@ > v> v b@ Hp@n㿘>#> v`0bT@  P1 T> @``@  ,` M>0 P`%! P> ,` 2K!P0`P`#`P > aO "`8!`&!`8@;`8> @`  `& H$4  (@9 (b>`0  `P P> `& P,`>0`` @k @Ɛ>0 P`! P @`>0`P`#`P @9 >`X@ > `& `0b#`P@;`0`0`@@8`@㿘>`0`  ,b"q> `쀠>0 L`& La_> a8> ' b> v"> `@ #" @  #"> aT> > aP #aT> a` "> > aX@C 8aX@ ` C< 8aXaXc> ! Жb?  > ?/a !#!> a  ?/a a#a!> a4a> a0@e *> `@  ؀`> ' ܀`"  > 'b@` Ѐ J!4 耠`> ' 쀠`z> > 'b@_ 2s> !L@fG n> a@VցƐ>0 L`l& L@ki@  `C#膃`C<?2 ( 8aX> ! Жb? > ?/> @f  >bp >bp 㿘 >8 @V`> % a> v> v  b@ > `쀢`> '> 耠`" @> '>  a( ؁> b耠` > @ؐ#㿘 ,` . ,H`` > $`` $> `쀠Ho-(@> > a(> v> v b@: Hp@n> c d d, dd d d e0 e e f$ c 9 (@` `< (`@4 ) ``??2? @* *`  ,`2  *`0*  ? 2 "@   "㿘@+ ,.` @ $@>`& $ +  " @ (@ (#@ @4>  & 3 ( (@ (   & & @#㿘 `">  ` `@   ? @ &@1a& > Ē> Đ"@w@ 㿀@ z` , V` ( -` `(`&` 7'''而 -'쀌    7`@ 6` @Q ` `&` 7`@ 6` @Q 0 7`(6` @Q~ ݰ㿀   `+` & ``" `D`2 V   `& `2  ( 7''''7 @QR @ [> @a 0㿘 `*6`*(``N` `@&  ` $< & ``)`8``8``$ ``@' '`@' '` "` @9` "`8@9`8 "`@@'Ғ `@ "1> @'̒ 1> @!<@@'ƒ '``8``8``4``㿘>  @!<    @3$` $` @3`,> @)`H> 2bX 4`(4`*`H`$@$` `$`$``?$`$$` $`$`4㿘  ,@* > @Y!< HRv  " @3  @3  ,6 *> ϐ@)o`H `4k  H &&     P  (`*  & & RL&   RH  RD  R@@*!@*A 4n  `&` P` `2`< `6?& 8& @& <& 4  c  ` "` @` `6 @)ې c (`@8` c, 4 ,  '@%I &&  8``<`  ' * @%; & (`  '@%4~& s㿘 @( , `11(` 2 2  Ȣ Ȫ !  '@%  , Q$@ @  Q%@  `4U`8``8`@&,& && (`8``Х=` ' @$ ,` ' @$   <  < , Qq$ @ճ   <   ?, Qc$@@@ե  `8``8``$ &  @&_ ' @&\ '& & & && @&S ' 㿘 @6  ` T` `$` `` -`` `$` w -`(@O``@ON @O ` "&`  ( @ .   `$  `!$ @- 2'`O p ``8 `,`> ϖ p@e`P$߀ 㿘 @' ,` &`  .@"  `$   @(@` *`"'2' >+` +@  "  4$  `$ '   4 S ג׀`@Đ3`(+ @ 㿐 X   !> 7> #("#\> @#`X> #\!<!0   > @``> bȁ㿘@' ,>`0``,a7D 8R @3  c- .`  >``( +``"   +@  "  @4$  `$  3 @Ɛ3`(+ @ 㿘 > '`'L ``$@<8`-``0`` +< .  ?0@@"" Q}8. ?,``@;  )`(`@<(܄ m .  (@@ӂ`    8 ?0@@  ΂`.  ( `Q%8. ??`,`: +` +@%`2 ` `3`(+ @ ` 4%` ``$`%`%`$L @`(@  x @>Ӱ c<9> '`,> V $ ``  (` `$ ` `" @') < "$ EL@&Ő``& `,@' ``` ,@&ߐ  T (`8`&  34 `̂@4 `' # b~@ "d  T `Y ``w & T `"`` b @(  "  `&` `` `v pT `"M`j  @T `e ` (ؔ Ma 2\ W`W쀠`ŀ`_`"W M  PJ @(HZ" `, (`<&< `@' b}@ "0  b~4 ' `# &` (ؔ M 2 W`W쀠````2   @L @ 2 `M  `2 `D   `" `DH``  @LZ :7'''' @LI @ 7  (! <`! @`! D Cހ    2  &1  @ P?ؐ   `` ``(@% @L @  2  &  @ i?ؘ` ? ` ?ؘ` ? ` [?؝㿐 @,  $ؐ@%  `@%$    `$ В @%_  @%R㿐` @-> ',V   ``8 `" @@@Q `@%L$ @=4  ` $ l@%͐z @% @7> $@<`$$+  "@ (@(#@ @%> "$0 @$& 3 ( (@ ( $ @D h@B#㿐  ,@$ _ ̔  > '> bĀ@!  $@L:` +  "N @ (@ (#@ @[> L > & & @ `> Đ"@   " ,"9> `" `"   (`   " `" ` &@& `"  & $+  2@ 3 ( (@ (  4& ȆȀ`" ` " @#㿘 @# ,.` > `&  $@>` +  " @ (@(#@ @4)> !  4@$  $ $+  2@ 3 ( (@ (  @\$  @l#㿘 @ ,@$ @@#  `@@#۰ 㿘 `,@#`  `@" `  6`@#㿘 @Ű   ,@#Аm@# `" 㿘 4 @`4R``( > 6b"`8 "`  4`(2  @2  ?"   4(" 8`"2  (` 4(2  @2  ?"  ( @ "  R``` > ϐ a"`8     ?` ( `" (2   2 (㿘 Hoo (`>    ? @ (& & & ( ! Hp@ !  > > ϐ `x@$3㿘 8@"& 8 (`@2(@2  (?`"& 8@"  4 ` 1> @ّ#<@0@@(`@2& (`" 8 8 4)1> @#㿘@  8@ @ 2 8 *``8>݁`  `" > >^c" ("`8"`<"`"`H"` "`L"@"`"`"`"`"`"` "`$"`("`,"`0"`4"`@"`D"`P"`T"`X"`\"``"`d"`h"`l 8"`H:`8o "`㿘 8`2`4`< : @ `@0@ (`@&"& ( 8!`8!@:!  @ʑ, `4`8*J_`4 *$ @Ξ*`8 "&`4@] &`4&`8 `8(`@&"& (  @@`<`<&`@㿘 ` `2 @9 @Rg&  `" & @U 㿘 Hoo (` &  &   @!  (`& ( ! Hp@ ȑ> > > ϐ `x@$$㿘 2 80   8`  "  (``& (  2 8㿘 ( 㿘``4 (>  c`8- @  @ @3`2 `4 4`8`<>  c`@,@  @ @&`2 `<@8`@& ( `V$ װ  8@ 4 ` @h$ 8@@_$@ 4’㿘 (H``A ` Hp@@U   `$ Hp@@`l "Q''@#耤 Y'`V?   $ `2Ȩ Hoo `2T   # `!& > ϖ@RHp@ 2?``" 0*, ?  '`'Ta> 'Ї(` (` ( ( @ @S  '@􀠀؆ ֆ '' @`U&  $ ( & `M e@  @?$ f$  ( `"i 8 & & & &  $& `p` "f$  ($ $ $ ( & ͶHp@ GRH` `   @?''Hp@&@, $,G,&@'@ &   @?$ $ Hp@@=ဤ`  2  ($ ( u&   $   &  ($ ( & Hp@ 8@ H`Ta.> 'Ї(` (` ( ( @1Ђb???/'a'' {'@@'t& nڮh  #"t sp 㿘V`  8> 6(b@ `@ 5` `$` @4/ 8( 2 (` "%` @2T V`@2` 6  8`y`` `X$` ``   `$ ,` $ 0`$ $H` 8`  2D (Hp@` (`H` (`$ (Hp@`` (``H` (``d$ (Hp@` ``$ (0< ` @@1 @@ (`     2 @2T 2c >  #@~ܨ j `4 ` `8`$ ,`  $ 0@&`&` $ `$ `$ ` $ `_$ $@ e”0Q0㿀 ,<@   @&  %` @ "      $7'?.@'''7ؔ  `&  (  4?`& (6  (2  @2  ?&  ! ( 㿈 @{  U `" `% ` ! E: " ` `% `8" &``,`2 &`> ϐ`@ &```O(` $/`4 (`('E  􀠠$)` `*,o,4`* $] ``" $`04`*D` ` ``&` &`ޢ```( @(&`&`` &D `% ``` =&>`㿐 `,@@Ð ) 0` 0` > 6bd > @}""$  `(&`4&$`4$ , , ` 㿘 <@V@ > 6 㿐> 6> 6b@' ` 0#@#'@(( @@(`'`  4 @ >@U bp@Vϰ $<㿐  (`& & ( `" 0#@ϐ#'@(( @@(`'@V <. 㿘 @ ",  ,`'>`0` "`` @ @"> `$`4`  4``0 $` $`(4` ($`$ (  a"` 㿐 Ĕ   !> 7> #("#\> @~`> #\#> ϒ @a  @~ 㿈`8`4`@ @> a&!@@m`@  `@@*a!@#\#`  @ز  `@@Ӱ  @@R&`@ %> B`@c@#\*#` @ؗ "`4`@@ DS ؂@ (@ @ &!@㿈`''` Cx  ,!4 &@(@'(`@`@'C ''耠  CN  CD  ( &` B @ ' C(    C  2 x`(D$($,@ &a4`|`"   8> @{#@)a`@A+ 28P`$` `" as  ` @@A 28a`I֠  ` @@ߖ 28 @B  #\#``@`#d#l#h  @Cš M`+> 2 @&` bC > 2 a @`@  a4<`F   @@ a(` b"   @ b @%` >a$8 a 8   ` `a r` `@C 8> @z~#0c2@۠ @ è $@値  p , '@ @0M''L °,H`@&`, @''''?'''!> # ?@ # '''' > 2bd'' ''''''ܐذ n> cc@l `# @H` ,H `,@@( ?`@ `@ ?'`Ȁ`2 Ar ~`$'A  H`2_``!> @yː# "@ ؒ @B@y#> c@@ْ ?H`(&@.ǐ> @y#W@7aP a `,@ Ȁ8 'B5a @)@#'a H`@&,``` "H`@!$lH`~&`` `` , > cHo)(@j@Sy%%%%%%%%%%%%Hp@> c@!> @y #Ԓ @B0(   `,؀ 7 `(L؟@   *,h@5 @ ?a0`  `L@ " ?/`3`$/`3`D`"`؟@ `'a08``,`@ H`(&@-Ȑ`,aЀ@ ,@ ! !> @y#@$@찒 ̀5 ?''''''5' ,@'+`@f , ?" 0``  ? `$'@*  "q#> 6b䀠`(   `@@`(`@@ @`'X V '  @.@>` > $`p(@0$``$`t$`h(@0$`d(@0$`l$`x$`|`?> ϐ⒒؀  ''`$>Ц ؒ  = ?Ȓc F@=`!> @w֐# "@ @w͐#ؒ @@> cc@@ ? @ H`(&#@w!b*  @@^h> @ ! @͐ JH`a&<`" `8`&`@ `@{`$$h d``, $d"```0 `  ,@~`h'耢  '`@M ,`2  H`(` ``e @@J> @ 9bl  `(, , ` b`'Ғ@'0`@ ,`Œ`@T!PH`&,H/`@( @H[`@1!8 @ > c8 "   @`$?" "   `$" "`$"   (㿘 ,#@Q    ? @ ,& &    ? @$ $  `@! "!d@&!d`!$!d L " P@ * P> @vf l `2!> @!  @>@ > @vY#> @vU > 6 > @vM"> 6 @y > > ϐ ap@"~㿘`,` D  L`L@`$  & L6al P x@!A $6al& L P x@!8@~  ,H`w $ DI`(`2@@GO@0 0㿘#> 6@Gb> 6`& 8 8 < b& <@GӰ@G8㿘> 6%> 6b> +a@G 2  8 @Ih   8 < < <? @$ 8$ <@G@  ,@  , 1,2 (`@@0h  @F0͒ @ 0ǝ㿘 4`6`> ϒ` @ ! ,H`@!  @" *.    ? @ ,& &  `> ϴ aА 2@H  ` ,  P` %> &!n ,zr!0`L`" 8@ 8 . 1 < < <? @ & <& 8  > @& ?& `&    ,*&  $'%> 8@Fm`8`\,h"`,H`w 0 g @/ `8@   ,9& T@3> a`@mf `> @[! ` @F3  ,;!0@O-!@O+!4@O)!L@J ` @" @㳐 <`"s ,@^o ,|` P` @; X@ђ x , `$ > c8$`@E0@/S `$  ` ,H`@ @#@0al ," H`@#@ ,H/`@( @E   @*A ǚ ,@)   @uEl P`@tGl P "& @" | "&@$x&&h $ P  @1.  @~ "&@: 㿘@*` y 㿐> 7bl @`';     a @0   X 0㿐@`2` ` &@`b > %a') +-  $  "` `"`   `,2 @2`4``"<``(``?2  `1(8`  ,@h"3 08`"X ,`" " `,H` (!`4&`` ?c';p ,hɆ `(`@ Æσ8H1`˃8,@ǃ8 ,H`@!`4&``֐  0l (``;<'0̀@``h`` ,H`@!`4&`` al(`` ;'0" ``'! @Eі "A `4&`` al':  ` `  P: H ͒ &w u 㿘@F  @v > b4@``"`@24 㿘 > @s̐ " "& " " $  &  " "!d  @$ ( t`;ڒ  > @s#`$ ;Д `!@>3`  b``@KP !4>@KKa!L>Ӕ@KFal``,a $ , `  ,H`` & >`0`P ,> Rb(㿘 `,@/ @fp  > 7blB [@b@ b> '`+> 6b@ @ > v .%b> '#> 6 b"bP> v> 6"@Fc D> b%b #`〣@> v> 6"Ēc@F # > @}#ȁ@> v݀> a> Bc܂c'`> B> c@#h#\#`#d @  1> @0?> 6bb%b b @|"b$b@  > : `p8 > a@ ?bb$b%b # @rŐ" " (" ,2!l* 1  ,H`@!" "   "   d% `%d  @`@a: 4`\>0@JEa4,` 6' ,,H`@! $a @晐$` @ ,H`` ,H`@@!@ `,H`@! 2L8@2h<LM$`L@$$`$ "a0@$a4a0`H`@$aL`> Rb(\"'\\@ #\@q '` > \\` \ `l`d@@!  ,h 䀠`! , 7> %> ) T@X $X T`#g@# ) *@ ] ޺> > b`X$`$`4b܂` `4> > "#b$` (`@$`8@`8 <"Ԃ(` @"`4 @(`@4$`<`$   $%$ $    ,$%$$  `4 $ Dڐ䀠`$ LL  @ L L4  L4 ``4b@'8V   @- C! 4!Ho-4 (@n ,`1@~$`@ 6Hp@`@k *  > (a`4\@ > a ` ` `"d` d2 ,@@ > Ϥb @BƖ ,@쀠``,h3 Ѐ `4b@ `@   > \` `l`d@@ @.$`$恐q$`;`> \` @, `@@@L\ ` `l`d@@ 㿈 #`#\#d   R 㿈 H `#`@?#\#d  >>bx@7 ` >#`#\#d +Ж %ax``  @'''7_  `8 ,`#`#\#d +>a> ϐb@ 㿘#> 6c >  `|c  @ @ r  `$c$ @ @ c  2㿘> `|  @   > 6" " "c` `> @y"㿘 >`0`. q 0`0`> `4a@x"8>㿀"'T'X#\#`#d>  "   ,H`b T!'@xB & ``@`"`?` `8``,a `?㿘&& & & & & & & & & $& (2 `@4a$ `4Ђb@ $ 7 㿘%>  8 <@& 8@`& <& < @  & @@@^ @@> > > ϐ bh@y* b> > ϐ bh@y# c㿘 <   @ `8 `@@ `<@<h ( ,''''Ђ''''''Ȁ,''' '̐@`Ȕ @4w  @> ϔ@xb> b܀ 2 @@2     <@2  @㿘 `<`@`  `$@h>  ,c<' H`@`$@ 4@'ϐH`@$@> c< > ρ@K"h> <' b'''''''''''>Ԃ? ,''̅H``$ FȅH`$> c< > ρ@JԐ"㿘 ##?`8(@@%&`8``2` ` ``8"``,`2`a0b``2` ``㿘š $ ` $`2 0 @ `" P``  ,H``%`+ `!? `$@ @'''''@6' =Ā @ՐH`%    `,` < @< X- ͐ @5Ȁ  @3ޔ4`=`  @Ғ  ` ֦@  ԰  ` A``  > b܀`<2  h'>  ,<' H``$ ` @۶   @@ @ϐ@5H`'@ K H`$ > ρ@I_"`>  ,c<' H`@`$@ ȒC ''Đ'ݔH`@$@> c< > ρ@I&#>  ,c<' H``$ Ȓ '<'@'DH .`>`4b'8 '8H`$> c< > ρ@H#h>  ,c<' H`@`$@ ɐ@'dH`@$@> c< > ρ@H#X%>  ,<' H`@`$@ Ȓ@? 7''Đ'&H`@$@ > ρ@Hp# h> c<' `M  ,H``$ O @} " "6    .@`"/!0'Ґ@  H`$ )> ρ!0`< ` `  - `<Ғ Д- 2 "ǒ@ @G#0h> c<' `  , g> ρH``$> a @8 ǐ @ ""  1 >&`0@2@ `'G 2 @&&'  ``"@I @b H`$0@G}#@ ` @ 㿘 `! > &@sÐ! ` 1> @s#  > @s#x > @s# `  > @s#P0㿘>`0``>> `4@9``>  @@tQ (@&@&@@@@`p`5`,``->  @ɲ #   `  `  ( &@:K`d> @t !X @ـ  ֲ  ` %  `&    @<( &  @ @& ` `&    @<  &  (&0 `Q @ &  (@&?&  `o   @ v  `r `n '%  @&   @; ]@ ` `@&&  & 0H `q>  & 0#  `&    @; &  .@ `& 0%  @& & (&?&  `"  @: 0 `&  >  `@s0 `@" > @s( @s&#> @s# @> @s #(&`@&&  ` > @s    `& 0> @s!0 > В@s @r!`p"  " ?" " " " ""   X | ۼ> 6` > v> 6 b b́ `> Bc> v > 6 b̄b  ` > vb́ 㿘> vb̀  ,` ,@` 2 ` 2 ,  㿘 ,@`? (`> ְ  `` `> ]`H@> \aT,` ,`$ 1)1% $  `< ,` ` `(` (`> 2 a1 ɂ`K ,` ` `(`(` > 2 b0 0ڀ`W ,`  @ˁ` ,` `O `X( v  w` `> 2b@6Ȱ > 2a.`` .`$0̐` 0ǰ 7$` S  T` RaJ .`> 2bĒ` .`$0` 0 $` 6  7 @(> \(aT"@@ 0 > ](`L"@@ 00  Y`)> ca @%> ]`L,` 0,`$ 0q 00l $ > 2>b̄P aK @2`aK.`  > 2b@> 2a  ` 8`s `@20> ]`H0> \aT>aT`@ `&@`@20> ca > ]`L>`L`@ `0@0`@20> 2 ;a> \ ٚaT> ] `L@}4@@#Q@㿘#> 6c`"!> v"ԀD" 0,a`"Ԁ"$c0` "> 64@Oc"Ԁ` `0``2` $c> 6@Ac `$c㿘   ? && @Ȓ > v bԁ > v b ? && @ > v bԁp!> v"`> <@' @``$@&  "̀    $@  2 $ &  &@ > Ё@C!Д - &  "̀ / ,@`  2 , &㿐> `$'0c @ 0c @   @,!> 6 0c @"8=0 0c @"( 'c@˂@c@ .> vbԀ "W#`( 'g!> v $"  (@   '@@Ƃ  H @] ?" " D" > vb̀($"  $2$ $$b`$ ` `7> v &0 c@Ƃ  $$ &> 6$ c @0 $ ` `& `8 `4 `0 > 6 c!> v ~$"  (@  w'" $& , & ,&  > &a@ & ,& ,  & ,-`!> 6#`8s nm 7> v @e -< >'  @  $#2! 3> 6c`. `01> v`8"԰ @? 7> v84 @7 0- ' 8 4@{  $#! 8$ $$ $ Z "` `"`@m "` `( ' *7> v 0 " 8 4:1 ,"` &c $ $ &$ 3> 6c @k $  $ `%& $ 8$ 4$ 08&  &c& > 6 c" <` _ٖ$ D> `<@nl!"$ 4 $ <c@9 $ 0`0 `8 &  $#! $#! 8㿘? 6  !> 6#` 1> v"Ԁ`"#`` ## @5$#"ְ ##@5$#0㿘? 6  1> 6#`#> в`a%> 6#`! ``2 @7  #> Ђ` $> 6# `> 6c$`"#c$ > 6#(`2#(> b8!#(#(>>aą808 c$*## ## :## 㿈> Ђb> #\> Ђb(#`#d> > А!a> > Д> > И!b> > 6a > Ц0b8 `"`@`     #\89 23 ;#`3`#d@: ; ;` `bH 㿈!> B##>  a'> 6` > vbؗ( '  @V#\> 6 c#> a> *` cH @E a> > ax  <`0((@ @C< ` 8 (@@ @)$ : $`0((@ @C< ` 8 * * . @@ > > a\ @` @2 @㿀`%> ( @@ ŀ    (@8%8 (@@@Ho4> (@g> a.` > 6?.`c0 @`4 @ @5 6  (@$'- - > @X @@` @>  cX%@ (`0`(8`?`!> 6#%> Д!E@ے#` @ #@!H`"#`?7ob6 & @f#`@2c#` 8> &> a > ! &8@(`P@@`0`@=`$`@=`` $ $$Hp@  @ > 7> #L@7%a  @yY%> +Hp@  k'> 6c0@w`7ob"#\:#d> > > Вcc@l,#> #\> > А#`c > @lcm%@(`'> > a`8> > Bc> 6c`@ @ #\8@ #`, #d#h  @@  > > @l#0a`8ܠ@ `` > > !a > a @ =`$@8@ (`0@(@0W$> @k͐"y `$0``  @ -C=`7o@b"%@  @`8 @2  `" Ѷ %`> > > А b@l > @l]"h> В@lX"> @lU > @lR 㿘> al> cHi.`> > aa &8@(` (@(Ho4a(@ga $P    (@@8 9  (@@ > ҄@`܅(@ƒ+`.`> a:(> (cX!n7ob" \  7ob 8 6  `4 (`%0`  > @k .`> 60> ђ@kِ 0}   (8  02    ,(  0@< 0 ``@<  @ @$`@T$@  `& $ Hp@> ҅(`@ 6@@2{@> 6 c( @ `( @$`44``&@-@ $@@< Hp@`2q `m2`> @j > @kc $@8 x ( w> @24@.`> 60> ђ@kL X> (`@(@    (@@8 9  (@(``2 "9  `  (`>  @"@ > 6 -    /> 7x`Yx@#I> 6,`.+> @#<`    (@8 9  (@@@((  8> #X)v''@"X 8  ,` @> Ѥ `آ @  "@*@i@ِ@`@(> 7 @a| > 6 c0   @"H  > > %x`   )> 7@i!x@bH @$`x`@(x> 7  xN` 2  _.> 7@a|^x@    " "㿘`2 > @jB! 㿘" ` > @j4!0㿘`"  >0@2 > @j!H> @j!`㿘`   ` ?   ?@0ҁ㿈> Ҥ`$,!>, 0@ @` @ ?*`@`` `@}  `$#` "E `@` @1&]@1_`?`Ґ #0@0ܐ > Ғ@i"`"$  ؀` > @i!`@0Ԓa4@16`?@0 Հ`0 > @i}!> @iz!㿘E`W 㿘%`F 㿘>`0`   V 㿘`N `  <@@4" <㿐 'D'P>`0 ` HodĂ(@>  @_a@ " D" 4" ," !P" 0c!" Hp@ ` @?`> Ҷ b+@.@`"  0 z$ 0 0 @@9 '0 $ 0$ ) $ @($ <$ <P@ <`@@ K`"{$ HD@Hod (@e0 @0  0a 0`$ 0Hp@T@ 0d" < 4 "  < @ R@Y>  @$$  @9  @C'  ? Hod(@ `@Hp@> @]a@6vHod4 (@e `0えe;> @Vɒ$ H@VD@4P0> @hD"> @hA"> @h>"`@h<" 2 @"  `48  > > bԄ (@  4@2 80 @ 8 2 4> > bԄ (@24 "  4@28, > > `|0 (@  @20 @ 2 㿐N` n.(8``m"> ҆> b耠@(`L@` @(8`m> @g "> @g#> @g#@1> @g#p> n{b܀w> Ӏa> > > > > Ґ#cؔ@g#؀5>> Ө`0> > `> > Ӯ` '> N1`  4@` @f`*L@`n&`w`a2 L @fՔ2ܤ X)0t`"@f ?`4 `?` X`1,t`"#\+ #`; @f݂> Ȃc> #\> > Ӓ` > > Ӗ( 0> Ӑ#@f`8> > Ӓcؔ`> > Ӗh x@f} @}bRb㿐 1``9> ԅ(8`0 , 4!> > Ӑ ƀa  !H`!> ӟƀ" > ӟƀ"0!L  > ӟƀ"P T d@ d@: L P x> ӟƀ"x!  > ӟƀ"(: > @eϔƖ㿘  J 1`  H`1  2 @  @   2㿘 `@` ` @, $ 2 0   "  @2 1``  `"   2 `"  ``&``&` $㿘 ` "|@" |   ? @ && `  > @[Ӑ!H1> @[ϑ"㿘    ? @ & &  `& & 㿘5@ `>  @ 4] +> @[" f b      @ ??& &  `H&  `&    $  &  > @[r!H> `4b 23&& ` && > >  |a0@(`@& |a0@(`@  |a0@(  |a0@&(`@&2>  @[>"K& &&  &   $G  ,H` >& `0`"&> @e#X@e"> @[!HΒ> @e~#> @e{#0㿘> > b (  @20&@$ 2   )i @ 2 " @`"@ `$@"  ""  @2 )㿘ǐ @ " > @e5#㿐> 'b> 82 >  )   bܑ: > @t!> '"#>  )$bԔ 8`> 2 |@g: " )!>  $!0> 8` 2 @[: b> Q `!0`M K!p   !> 7> #("#\> @]Pc!h#\   > > Ӑ @]Fc H#\   > > Ӑ l@]<cȒ P#\   > > Ӑ#@]2cؒ #\   > > Ӑ"@](c 0#\   > > Ӑ!H@]c> #\#> Ӓ c  @] > @d#  @4"> 7bl [`4 Ђb@"  @4"  `"  `"  @" `,""  "   ` "  @"R` `(``@`@2 @8    @ ` !`1! @  ,h  *` ` `!P@  ,!P ,"㿘 `  "@  !, ?  ``􀢠   "`@>&ct 㿘@ ````  !f `  !]   !U ` 㿘@ ````  !> `  !5   !- ` 㿘 @`P  `!,  & P &`"> >^c#㿘 > @Z# "㿘! P $㿘` ! PӐ $㿘 @` @%  @  @  $" `,H`a  㿘@ ``]` @Z`  @Ȓ H @`  @ 3 @`  @ 2$ u$" 2$  ,H`a  `  @  @0㿈` @`'' @'u 2'?j'`㿘@ ``p` @m`  @+ [ @`  @ F @`  @ 1   ? $   @$" "  @2$  ,H`a  `  @  @0㿈` @`''@'b 2'?W'`㿘@  ` `@4&  `4"   `  㿘@  `4"   ``   & 㿘` `@1 %>  @X䀦` `  @`#`4\ `4" o  >    ` ", @V`4߰p    ` Ұ  㿘  )> `4@W̐!H%>  @Wǐ @K  @VÒ!H@V  &㿘 @`@< " @ @ ’ +@   "$ ? $ $ $"  ,H`a  @ƀ @ 0㿘 ` @  \@$@``2,  @0`  ,H`a 㿘 @` @%  @  @ J %$" `,H`a  㿘 @` @5 "  @  @"$  , @" $  $ $ $" `,H`a   @̀ @Ȱ 㿘`` >Оb??/&a& `@G ;`@F ;aF;㿘 Xْ`֒&a&`&`&`&`㿘Ho-(@nHp@㿘   @ E@ > &@&`&&&&`쀠2`> 'bЃ2`*`8* @0((@ @3`c+`+  @` @0((@@  @@& @@5`-`- @0((@ @3`c+`+  @` @0(&@(@u  @n@&@ @k@&`5--@0((@ @3`c+`+  @` @0((@@K  @D@& @A@&`@ "Кb? " ?/"a"  ` ` "  " ?/" a" ` @&"  ` @@!`  `" > >^c!4㿐#> vc(`!> > 7c( #\!4   > @Wa`P $c(!4@U   $ P@`#  P`0 H'    X ܐ    X `F H`     ВՖ ` x''''''''''''''''''â㿘@  ``(   `8  ,`> Ԗ 習``㿘`?  .```8, 1 ` ` ]$` $  `i> 7*``b> 7?# 8- f @8,>@"Z`) <<"J@Ɛ@4 6`> 'b8 > @چ >` <@ 85#@ /@ " > @  >  b  8  @  @8> 'b8aa@@`>>(Ԕ" #@ > ҄ @ ǀ 㿈` L   `82 ,@J`2@> Ԑ`` @㿘 ``  `@ &'?쀦4 N` S .`Ho(@``@0``Hp@ $N`۴ n`㿘@`4`` ` I  "$ ```"9 > b܀  #,@2 ``@"/`2,  ` "& P "   `q   `&`  \`㿘@`;`` ` O DJ (@ )>?& ``"9 > b܀`2 )`` )`,@ 2``` @2`K 4`` "!      )J 4  2J Ā ) `&` `@ ` ` (0`(`H`@ 㿘> v#0` `(> a @@ `?` (@08(H`@ @ ` ` (@0(`㿘> ! 2 > a> 7 Ha > 7a> ߐ" > 7> 7 \a> 7 `a`2 @`|`` @40 0 > 7a&> 2b\80`@8```    @  > 2b\80`@8```    @  > 2b\80`@8```    (  㿘> 2b\80`@8```    2  ( > a?* @@"> v> bc0㿐 ,">  b@8b> > b!> " - 9>  >`0* B"c  !'4&  > b8@8b8 `\@> b @8b  ̐0> b0@8b0㿐> b> H!> -"W %" c?N   \  `@&@8 U"㿘> 7!cP0> Ԑ @Ȓap  \! \"  .`   @?&& d` T (@( TT 1> V".` `h㿐 `@> b c '@!d *  \ 2 ,ې    > & b@8b@   ,@2> $> > > Ԑ `h@Zڔ!㿘> 7!cP0> Ԑ @Ha , \` \&h& h> @ hT (@@ T " 㿘!> v#,> X > Ȁ #,`$#,> @ZY 㿘 ( d`d h & X> &!h1> "㿘> 7cP > @aX>`@*T`> , @`T " g&    , >`@`H "Y>  X`F . 1!T` &`0 2. X H / Ho@  Hm(n!T`!T%?*  T͐ > "(@9"(N 1`2%>  X`> . 1 X`>  > > > > Ԑ `h@Z!> > Ԑ `h@Y!7> > * `h8@Y!> > Ԑ `h@Y!!㿐> @@`! '/'  @& Ђb?&  ?/& a& aX`& 8aX 8 <#aX!& @Yl!?'b@'㿘>`0`Hom(@n ! $ ,!, 1 ,H`@! Ă`@,$ ăHp@㿘> `0`Hom(@n> m! % - 1 ,H`@!@,P%> Hp@>`02>   H> Ԥa-> 7 ad`RP` @5!T` 09!T`4 ` `HHo-(@n!T`?(H`$Hp@@!T`ad`PHom4 (@n @+- 1Hp@!X8 "< > > Ԑ `h8@X > > Ԑ `h(@X > 7a@6  @" "@4  2 "@ 㿐 `d28 "  8@2@@2&㿘 $`  & $@ $  & $@( ͓ & $@㿘  >@*t   @(W! & $㿘@'  $`` `  $> @W!& $ $ > ԰a @ $ `$`땓  & $㿘 (     "" " > @&aTHoo> b@`> 7" > 7" b@`#b@Hp@ > Ԑ >#baa   @`$"!" "!" H`> @ > 7! @@2? "Hp@ > Ԑ >#b@a!!Hoo ``2! d H `"`@ d"@" d`8+ `@@@2 ``  ``" `Hp@ `8 8"88"@"@"`@ @   @@ @ `$`"`@"@ @`"`@Hoo ` d " `@@ 2@ ?"@`8`@(@" Hp@" d S Uh Uh S UT S S Ux@`` " ,a"  0( b2 `@@  @ ` 2,0@ `?``@`? $$` $ $ "" " 㿘 (@ $H`.`!`n?&b`l `]!8!!`@S!!!`J! !! `!!!" > 7a@x!@!!'!!!Hp@@!!> 7H`@ `"!!!!!@!!Hp@@!! @!!8@!!?b` `1! H`@ > c8$ ` #`H`@ j2!H`@҂`H`@` $> 7 a) @ "   ?a (@#a  !)  #a !"`H`@`*``  Hp@ !? b!!Hp@ ?b"! Hp@ ! (@!!Hp@ ! ">`0` ` " 42  (  ! ( 4(2  @2  ?"  (@*@ "  @ `" @ 㿘  0@T ," 0H`(!  <?% cHp@  /"  ,@"  ,H`@ Ho-4N 1(@nN 1` ,@ X` . 1@)0> > > Ԑ a@U:'$㿘! $&!X ,H`` @?b> &!b !(@   㿘 `0`42)%@`4`,@'Ho-4 (@n @'. 1Hp@`0``2`,`4`$`4@|`,@ݐ Ԃ 0؁ @@"`4 ?㿘  -`- ,*: `u> Ԓ@Ty"(,`"e 4`_ .1Hp@, 4` > Դ 4b@ 2@  4`H`@! $ 0$ 4>%a)-> d",@2Hom,(@n,H`@ 1`(`@`@(Đ 4`$ 4 4 `$ 4%H`@@! ,H`(㿘 @֔ && & `  (@m& & 㿈``@!4B ` 2 !<`􀈿c&!<&!4&!8   &!<㿀@`? $ m`` h g `>, @'`'' +@2' 2`'"`'2K "M B+'ݔ 7 `8 ` ,` `'''耦`   `8 ,`"4> Ԕ`"   `8"  ,`  `' `@' ```' ` ` '> ԔbHG  bH@ ɒ㿀   #d #l#\#h#` @v " > Ԁ`bX4 #d#\#`> ԰@R$"h@> > b`@> @`c<`' !  '@3!`!h''''>  `a``( ' d( ' l(@ @(@'@@f "  @   #d#l#h#\#`  @ 0> @%o#X㾨 > c<' ,@ > c> `d`l @@(@`@В "> Ԙ!@Qs !  7 0 `p#$` !`  $`?'x't'p''@' @   4`  @ @0 D@8 `  `6 `@2@A'(@ ', `0!0'''''0@ @ @d "0힒  > 7 ,ae> "L> `a"L`u  > Yb> @$#h㿘 ,H`@! .``0> 7a@ &!`@"   (  "`ѕ `0>`0`  $? !(@H`8 @ !`. @@  q  `8 2R ,~e> !aHoo ,`"]! ,H` !X!`$!a a @ $a> 7a@"$@a$a$@Hp@ !``-$ !0` 'tt`'tx7t ,`"!!XӘ@Q"!h!d!\ !0$!`$!h$!d$!\` 'tt*> @P"㿘   ,. 1H`(! ,H` @&> c  `@$ @ ’ > @Sa`㿘  ,!0``,`??`> 7a> > Ժخb!!(@    ?(@H`(@$ $A`,"!h>*p 4`  `,2!``` 2!`6!lHo-4(@nm Hp@!`,2X!`,Q!hƚ6!l  `UHo-H(@H Hp@ `,!!l~ (@@2y!H`(@ $ $ H`@$ @O=!Q`,!L`,n  @O'!;`, !5`,㿘!2   ,7!" , ,h!" ,   ,"! ! .!(H㿘 ,` (@ ,@"(,@2@"(@@ !.`@> 7a@,h" $!H`@   !H` (! ! $!H`(! ,H` (! $   ~  ,Ho-4N 1(@nN 1``z`"a , Hp@@"}!("z!ô@ u!N 1`@!@ @   L`  , `!H`@ [ & H!H`  @!H ` ,`?"w``U! !`2 2.!@#Z0 > d  c,h ` N,` ,H` @! ,H`(! d ɴ  X`ʴ  U. 1"L X!H`(@ C H`(@ 04 ,H`(! `` !H`(@  6!l/ 0`  ,`@P0> @N#!H`(@  X㿘  H N㿘> b܀ (7#c@   ,@ ,H`@  @ $ `   >bȔ   ,h  $a (@2 !&!h&!d&!\&!`  2&!h 8t` .` ,`'x !0't`& @!@&!a߀`a(@ $a> 7a@"$@a@$a$@'t@!/!㿘   " ,`"    􀦠㿘 c ݕ 㿘 & > b܀S b4`$,@ C "`? 24 6 " -   ' bꀦ 4`$,@2 "` 1``% 㿘  " " `"`"@`@ " Ґ    0`"`"@`@  "   ܀2   㿘 `` @  -Ђb@c"   @  V ,      ?         $a$`"a$" $> >^c"D㿘 > @Bǐ"D $ y!( $!$㿘 $a$ې& $㿐 > >#@Ya> 7c(!(#\> > Ԑ"Dc   @Dt 㿘ܐ $a (> 7!a N?*  (8$a ` a$aH`!a $@ 7!4a `P$a $`P> 7bli [@!?@c! @a]a` +   . P `8> ' ,`"> 'b(("@@@u*`: 8`> 'bЖ@r8@ D_c!& HH`@$!(> @”(!`"2 H "S> Ho$` ; <" # "` H`? (@)$& `*> &``ސ p  @4 H`'p 0!ɐ?> ϐ`d ~> '> > Ԑ a0@Kr&?> > Ԑ a@@Kk&H㿘``   @  2      ? @  $@$ `"& ` @ 2@ @"@@`@ ` `?  "@"`>`p " @㿘  ܔ   " ` " `" ` " ""    " 㿘     , *, , ܬ   ? ( @?&> @J#x㿐``:> ``4> @ 2 ` &``(&@ ``"/`(@ `$ $``?@&`>`  ʰ   > @JP#@JN#㿘`k`]>`b> `0  07 &`2& / "@`$``6`2(   @$ $!@&>&@`Ұ2`2 ဢ `܀ ׀ @ `0``> @I#ܐ > @Iܐ# D p x H l \  ( H t D P p  8 t  < ` | $ X p l (   ( L  (  H d  0 T x p D ` h  d D (  x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 8  0 @ 8 P ` 8 p t >PbD 㿘` ``` > 'c <   $@@f;> 'c  D $$@ 8  `W`> 'c c "`" `" ` " `" 6 3@Y &  />  ;> b0 $@I ``X@ -, , @ Q`$ @ *, , "@ E`ݠ  @"$@ C > 'c Ô $,  @k $ ,  "@b  ؠ    @@   "@  >&ct`  >`0??"  ``2?   `  > c (㿐``2 `1@`` (  7 @ b`$$ ($ $`0 @< (`8$ 0`<$ 4`@$ 8`D$ < ۺ     `` $ @X` `, H``$ \x ` ە㿐' '@`   &@` > 㿘 'P@`   &@` P' 㿘@pؐ  @  &@  `> > 7c<@' ''ܒ ݝx > |` #> b      "@p   )> 7" ;> 7 ;> 7b >  > b (( "'b"%"d*  'b _%"*b d> դ ` 1 R"%@@FC• @pb b @@Ő ,$  0X<  8<  @< ( H< 0 P< 8 X< @ `< H h@< P * ''''쀤 / @@  "  C @ A B#\ D#` E #d F> #h G@E#l ">  (> b|> 7px@@ 2> 7> b  ;> 7 b @3 @b ,$  0X<  8<  @< ( H< 0 P< 8 X< @ `< H h@0< P 2 > 7;x0> @ @@ `@E` &@!> "   "Ȣ ? `W =$ 7X`W7$ X+ 1  X  `??'?''''''''' "ê> bĪ (( @ @(`ct&@$&@ &@㿈`E `F ?V`1``9`,b5 `` ` 6 ,`$5  "2   (&?',?``#\ @   ٺ   $q& ٬ᦒ `(ϐ& P`Ű `  -?`ݳ ـ  1`` ,b `,  /> P `$PƔ   ''''؄ ='''?'@xݔ | t  '-'(&q> a  ^' ''  '''''?@x I"v`!  ?''''''''@x /  L@`2` `"`@2N@`@% @&@''ܐa @Ԓ    ',@  `&'`x' & (ϰ 'b Ȱ & 㿈   "`` @ΐ >` &`(&`, >`  `  >`0  @ >`8 $  >`@ `  >`H P  >`X (&`d , ,@`&`h &`x @&` `&` `&` ` &` `&b0 `&b4 `Ԓ` @ 6` `6` L#&` &` &` 4b@&bX >` >a >a P&` T&` < >a 8&a!&a !&a$ $` a&a( $` a&a, 1 .a0 b8.a3!l6a4!6a6@!0! @a8a``@ ``"````&```@"``N 1` 1``8  `" 1`P>b@ 1``M  >a!&a!&a &a8`&a &a8&a &aă8`&a &a̅8&a &aԃ8`&a &a܅8&a &a8`&a &a8&a &a8`&a &a8&a &b8`&b &b 8&b &b8`&b &b8&b x   |Ђb??/&b &b$??>bH &b\4&`l `"`@`4&`p``" ,@`4&`t ,`C?` `"@&`|`p&``|`?`&`|` >`P 1``5(`"!L`X&a `&a h&a l&a!L >` 1.a0 x &` |&a&`!.a1!.a2 t`aP@  X P>aX&`|&` 1``σ(8``  @4&a㆖ &a&a&a&a X&` \?&`&bX `>` h>a p>a av`&``㿘'P `    `"` @(@ "` E > bܤ   ,`W N`1`"O``IQ > ϒ ,`"<` ` `"7``p@23``,@@&` o ڀ%@"`@&` X À%@``2N`1 8 > " "H@`"`,`@"`,` ``"`@`4"`,`@"`,``4@"`,``,b`$P@z x P, @r!0 \@y!`l&!| >V`& `, & V` & ` & `& ` > ``& (``& ,` > 0`(&   > @ 2 ` > 8`0> H`8> P`@> X`H> ``P> h ``(`>h```? ?`> 8`a`!`4 &!x```&!``&!`4Ђb@@&!H@&! ǂ & &  & `(`4&!t`(`&!l` &!p`(`< >!``@&!h`(V@&!V`&!` >!` P`&! ` `&!$`Lz >!`X>!```!$`_`B```  >!X`2`( | > p 4& x & | 8&   >  P  >  P`` @! ` `@] w`& 8`(& > 9a0@> & & d& `D >!(`>&!0`,&!4`0&!8`4&!<`8&!@`<&!D`&!H` &!L`$&!P`(&!T`H&!`D >!(`>&!0`8&!4`<&!D`(&!H`9&!`P`??>!㿐'P` `(  a  P@ `  a!! Z `k`B`   P@P@? @  > bȀ` ` `"@*    #\ 2@%@`2` Ɛ> b܀`m  `,@2``,`&`N`1` ` &4`@".```2`,?k> b܀`E  `,@2```,&`N`1` ` $Wa `4@"Sa ``2`,z   񀥠``< Հ , `" `,`2 *  #\  4`% ظ`%   `*"?  #\Д 2% *"?  #\ 2 % *"?  #\ 2`%``< *"?  #\~ 2%@ , `" `,`2 *  Z#\Y  4`% ظ`".?  ;#\: 2!%"?  '#\& 2`%"?  #\ 2 %G V ,`,`@P X @㿘`@@  @ ``  &@`?``ؓ 㿘@h * @ @`  \`@$`?&@ `/@\`Ҁ ? @&@> # Ղ`?㿐 #\㿐#\㿘`@` @  &@`  b `? `S  㿘`@` @  &@`  > `? `/  㿐`$> 2 `> 2b(> 2( @@`"     " `< b`'`&`<  \ @` (`  >*b( -㿐' * '㿐` ` `(` ->> `$> 7bp> F>=w0> 2b\U>>> a( J>>> Ăa`` "*<> a\d N> 7bA\U  ?> 7> b(`(`##n+ > b > aH`@ 3> `,`y ;> 7٘bh  bh`dE` d'bh `,@bh> aL0]> a80W>> > a"(  >>> !Ăa``  ( > 2Ib`> a<05> `00/> `(0)&'bh  > 7"> x> c<@' `\?`> (` @ > Ձ>  N)  ->i b ܰ հ> >9"̰> >0"ð> 7'#P  @$> 9  > 6b > 7"l> '" }@0y> 7ޘ"Lq> c> Ha`"-?`'= _ VW!> 7#$#$ L#$@I@50E>  => !e# 2 /> - a@> '"$> "> '"> 'v" 3> `$'d찒  `$`쀠@$&`$ 4`"&`$ > ! 8 ݰ >  ` !> !D':$!D8Ű@U\7a> F> 8 #> 8#> 9"h> "c }> b> c> b> "IHk> >Ϙ"b @[Y @aP }I @ @ Ț7 (0> b̐ @e$> 7b> 'c> 6b> cl`a"   @-!> 6"'j䰒 䀠2 @c4 $" #\1> > & # # # # `0     $@  ``2 3> 2@e!b\$ 2  a!& hf> cl`a2  !> '## #`UQ> c$#  _> x>  ph>  `>  `5 W>  ,\N% GE @ k PR@>&`$'@##6 ; @a  @c\ d@ > 'c> ( X`'```  @*ђİ Ā` (` ->  "`>  ``   l`: !> 7 K"p 逥 "0> a` ``H2 K"pг Ȁ` @>, ֢`@> Ңa0> ΢c>+ ʢ``> . Ƣat>\ ¢b> b````#\ȟ@`` 2> 7~"p ` `^ @k> 7 `@`@l  "c"p> aPd @ ``@2 @ X"     ? @"" X" 0> aP 㿘@װ 㿘Ho6 (@n6 > aP)> n+> d `2 Hp@ 1``1 X@"$ X`$ $` ? @L 1$$  |` @  $ |, 1ݲ$ ؐ !HȠ %c%# $*`> Փ:`@9T `㿘> 7bl`@ [& `!  `   D    D@2  D  & D  &  &&>/b?㿘Ho-4 X(@n X`N 1`@ ,H`d Hp@@  ,㿘 >`0 `  $` 2 $!" $`  `, !$`   $`  $?  (@@@?㿘>a`0``&  ,H``  0`"! X` Ґ , 1&  &  X`& &  ,h!"퀢 逢 㿘>`0`,"p,H`{  #` @A\`>`0`>9a \㿘 >`0,``>N 1`>>  !(HHp@ ,H`  `8@ ,` `  Ă`. 1& > 7P`> Ր @Ւ`@ RN 1 @N 1@8 x㿘>``03`L 1`2>  `8@2! , & & & Ho(@n&$ t,!$ X$ |$6`> aP$  @ `2  Q ۂ > @7̐ @7ʐ 㿈> 'bȒ> bLH`> ccԃHp@Hp@ C H 쀦20㿀> 7bl@`  [&  ` X   "`& &@2쀢 2& `8 ,`"w쀡eg `耤` > 7 Đ" 2& #&!%@'䀥`a'> 'b(($> 'bВ8@^88`, B @a@ : D6'` & D> 7 "  ?`   ?& D &`  D` & D& D!2> 6뀢?  π`̀`'ɦ> Ր` 'b@'㿈Ԑx`- `Ho(@&`@= qEϐHp@  2n&`@:&`P$}xa(  沂a  }xa Ђb?  > 'bԀ"    `  > 'bԀ&"  6   "@" b@"   `"   "  @"  Ђb@" "  `2 "   㿐   @0` @ @4&@ && &@ &@ 󀠠@   㿐ǐ   @ @@" ` `& & @`  Іb@㿈  `  Ā 2J & & ́ Ȥ?/b?  @& & Ȁ@@& &    $  `2   􀠀` `"  ? @' '?`$  ,`@!?'b@'㿀@ Ho)(@ (@`?`?Hp@`Δ j (@`?`?耠 `''耠`􀠀    '耠'?'b@'㿐@ `@   `8` ,` ` > '"t > Ֆ ,``㿐@``" > 'b'@^"`'`  T  `8  ,`> ϖ `p@` 4 O `82L ,'@^˒#'0 2V `ސ  ِ! > v> Ր#4ڔ?P #2`#{܈ @ 'J' @ '耠;'耠`&5'  " ` > `'@^x#'ݐ ` `8 ,`> ϖ `0 ''b'?'b'㿐`` ` J 7 >`@`@!#@' '  @ 'Ђb?'`?/'a') ) & @@(`& 'b@'㿐@ "`a   `8  ,`> Ֆ `㿐`W @]#> `$W> << => Ho(@ j` @$>   > a"`@''# Ђb?"?/# a"> > aP THp@ @ `Ȅ  > a4> Ւ"@!@@2 > հ @2!Кb@㿀 `@ +`Д  % ǔ  `(( @@(`''q   > ' bb `㿐  "`  @` L㿐` @> > 'a`В@Z8` ? )`& θ  o  Ho)4> '(@j> 'bЖ@YN8> 8a`Hp@㿐@ D`΍ "B  (cY7c> 7b4k> ' @g> 'bؐ@^  @\˒u & Ho> (@j> > T aP THp@`Ho(@> aTHp@` !А@\"@"@'@^|' j> > 7) ) ` ( @@(`@ @6`6> 7@> 7b1 b؇((x@ `H```ؐﺔ  <  ''̒ 1`.  *  $`"%ÐHo)؂(@j؃,`@8``98`Ȁ`9Hp@  @ؐ`䀠`0@Ђb???/'a'ؐ <<ȁ@40@L0> > hh> h `h!!  2! " " " 㿐2> h&880`@> ե8`p> X` '> '  @1"@  ?   l`'  @1"@2 㿘> a> @0!> @0!> !h> > ahh 㿘 /!> 7@"> a> h> > ahh " a @#``@ ! ?`#` #`#@ @"2"a@"㿘1> 7@א"9> > > ah!hh%> '@)@xp"!h@D@`?! `#` #@` `r@C@aZ0(`@`#` @C@aZ0(`@#@ @$@aG0(`@` @` @@a,0(`@ `!h@2@@f"000 g@ `4#00 g@*00 g@`#` @Àa@4 00 g@g@ `(`@g@(`@g@(`@ `g@(`@`` ``@$#`@@=s!h㿘1> 7@7"> !> h(`@#!@> @h` !(`  !(`@` !(`@ @#` !`W(0`g@@@ !` !(`  !(`@` !(`@ @#`  !`:!(0 g@@@ !` !(`  !(`@` !(`@ @#`  !`!(0(`@@@h` !(`  !(`@` !(`@ @#` h"@ @@ 㿘#> 7@b `  ?     & && b& @㿘 `2`3!> 7@"  > ! @& & ! "@@>  #`h ?& !& &  @@U"`> & ah`&& ` ` @I"> @/ϐ!> Ւ@/ː!㿘> 'bԐ(("@@@YГ*`㿘> 'b@YȐ㿘> 'bԃ6`.`>`* @ 3`8+`+  @` @0((@U@ c `㿘> 'bВ>`@V8 c| `㿘`> 'bԃ0( @ 3`+ +`@ 0` ( @(@ c@ C 3`+ @@Ym@: 8`> 'bЖ@VT8@ DE㿘> 'b`(("@@@YI*`@: 8`> 'bЖ@V08@ D!㿘> '`@Y*b@: 8`> 'bЖ@V8@ D㿘!> 7"`> ؐ!p> 7"b > 7  b$"> 7 b㿐#> 7b` - !  9> 7" "`>;> a`G> 77> Ր"X'a"`;> 7p;> 7b'ؘ ܀ 7> 9> 7p> 7bb"`'b;> 7b`b> 7bb> 'WbГ2 @p:`a`7> > 7 "X>: 㵔'a7> 㿘> 7b> 7!> 7b"1> > '"b1!p2 @>`k㿘> 7`> 7 b > >:!pc > 7>:"Xㅖ > a㿘 @  > ` `2  a   " `& @`&  ~ @ & @㿘> % aŐ ``` @@  @# 2`v㿘&@&`&` &`  @&` ` & @g B> 7b @}&` ` & @X 3㿘 @n   &>;> <c(@B&``  L@V 2` ``@/" > @-"@& ^> @,"(`@&`` 0㿘`> `?!@$``   @ 㿘 @@ &@@> ` @-v"` &@> ՠ`bPJ  ``@ְ 㿘  $b   " " "" @  >;& & "<㿐   !>  !#\> @%b`!@%  > 7@"> 7b`1>; ` ` }"<㿘> Ւ@-!"p㿘 ː @@㿘> 7cP > @͒c   LH (`8  .!>`0 `H@ > n> d 㬁㿘>*> 7b0P L`,> Ր @cP |,@& Lȁ & |`& |h` & |톒@W 2 |& L㿐#>`0`@8 L 1`'> 7P`> Ր @rc@`@@@"h`j 2>`@`@!#@' }' Ђb?< ?/$ a$ rX@8`1>HH` 15> ` P> n c> Ր @c@ >`02I>  D /@`@u >@  2 , 1b @`@<@2>@(>8>`'b@'> > > Ր b@,V!e> > Ր b@,O!㿘>*> b0쀤(> `耤q> > b܀`V'> 7(`T`|2 &`T``G`x`1`&`x`|`T &`|ԑ2 &`THo-d(@nd/`T`P* * * @Vx`L&`P&`Tt@Vp&`La1N`1`a.aHp@``2`x@+ > y"P `P00`".aЀa.a0> > Ր b@+˔ 㿘1> v>=#8a> 'b@U > bTo#8㿘Ho-4 L(@n L``$8 $& LM!`1!.!Hp@㿘> 7cP > @ c0N 1`!`> @+@" `,!l`!H`@( 0(@@#@X g. 1& Ѝ |`( & |>`0! `H@ > n> d 㬁㿘> `0 `Ho-(@n! .!. 16& \ Ȃ`(& ȃHp@> @*ܐ"㿘>`0`Hom(@n ! ,!9, 1 Ă`$ ăHp@> bT ! < `" L ` H``  L` > n> d 㬁H``> > bp hbph> `` > 7b` `!  ` `㿘  (@` -   ?& (  & (> X` X㿘 @` @ ,`" ,㿘`6  @.`  (` ,`" ,>`p 㿘    "4 $@2 `/```" > Ւ #`@)G`'`2 ` > ղc $@  ` 2 $r٢@)$  > @)#㿘> X` XX XX> @)̐#㿘> bp !bp ` `$` $` ? @  $$ \ `2 $㿘 $`!!> "p  @> 2    "p" " "`" ` `@)} 0> @)z#> @)w P㿀> c<' +> 7@b'> \`> ֢\`bܐ  \`b@$\ @l   (`0``>  `Ő " `> @͐b\\``$\@bܰ > ց `;@ ‎`  > ք ` $@d  2 $q> > (b`!@  " @2  (`8"LT 8`2 T  ` 4  - "D    ? @& &  @(``0 ` 6@` / @ > '(n $@$`4 > 'bȀ|`ג0w @'  84 > @'ܐ!H0> bl @(!> '@p#@( @( 㿘> bh @` "  $@2    ` 2 $ 㿘@@ /m` q l `$ $$ (V` `"1V`V`$ `   > @'V 8U> $ $ `&@` .`6* $` * G I`22@$@ @(@; $ ,$ V`6```̀ʅ) @@ ) ``@$`@@ $ V`@4``.`檒@ $@ > @'!X@'!> @'!p> ֒@'"> a> ֒a> @'!㿘` ` ` @ > b`2``"*T` ` ` (`0``(` `(&` ` 8  (6` ``2T` 29㿘 `@%> 7؀`2-``" @  @؀`4  `" &   "& 2 & & `(``2 `> `@'o"P> `@&"0V` `"> V`> @&" `> `@&"  @&"H㿀''''䀦` ` ` @ > b`' (' `" V ` (`0``(  ` 8 #(6  `2V   2> 7b؀ 耠`> `@&?"] > @&2"㿘+> 7@b'> \`> ֢\`bܐ  \``b@P$\   ` 2 _`@  (`> V` `i 6` & > bh` & ` [ ` b > ƒ#@%ޔ  > b` &`   `" 2 P P `+` 0 `  2@֔@> 'bȀ" @b\\`$\<> 7@Ґ"܁2dž `00V` @`6`> ֒@%#X> > > > ֐ bЖ@&!q> > ֐ bЖ0@&|!s> > > ֐ bЖ@&t!r㿘ض , ƀ > 7* b@%M@0㿀> -a|'()a|'''> (''b(&8 @  (`0``@i ` 2F(8 㿘 ʴ   > ְ @% #h X "V"`X`@ @  X""`X@ @ * "`X"/ X2@"`X! X X @@:`4+ X"#``X`  `@ "``X`  "`X! X`4"`X2ψ`8"`XȈ`(`X X"`X! X" X (``   (`0` (a8 p"" ( p < @2 8?c" <2 p 8`) "   2 " 2 " 2 " 2 "  @ 2  p <(`0` @ 2 N@2 r" 2 " 2 L" P" T"   p < @`" 2 㿘`8`U D  < `(4  @K   0 d& 4& 0& @?@PO  (```  @B @K(@ "& @@<b'< "@ `` 4   @@KΐB @`8B儐 @M& @  <@ ـ& @*` & <`(> bb> ` |>  b> \aa"@㿘F > b2 0  2I 㿈> c<' @fǒ /  ? a> ׁ@M U 2?N `.2? c ``8?''  І`` B1 @8`@(  (> b ɤ  (`"   @@g  ( 2 ("? > c> *a,;`> ְ @#0 c'#X``1 㿐@0?2   (2 ?c(`@ˮ  >> ֐@"Ё`0 @S? e `e@ߣ? &> @"Ŕ >`0` @D?@> @">`0` @2?@Ǽ @)?@Dz 㿀> c<@'   @f  O?@ '> ׁ` Ђ`` ((H`> \a`a . @`"?@f 2 . @`9#h㽘> lb> <' R d , (@ @ `  @  ~>` bT>t` a>`c> @"j p>c@ > א P@# > #x㿘`DH`B> bh 2 08(   3`` @f H``2 ^   ((@?c(&@fb ւH``2 ?& `4㿘 (> @! > bh > > `   > `` @!`2  @!  2> @!ِ Ё>cА >`X  >a 㿘 @  ,``& ,@ `t@㿐 @ ,Q& ,f ` d C @ h l@& hЂb?& l ?/& ha& l`$> `2 H P 8>`B`C > 8@> PP  0>`B`C > 0@> HP  @@@> @P Ј?b@ > @!] 0㿘%> ]H`.`> \ aT`@@`H @4@%> c `> ] `L`@@`0  @4@@ H@  㿘` p& x (@(& p& x p (@(& t& x> > > א `@"#㿘`.`  @.`@`  p& x  p (@& t& x   (@& p& x > > > א `@!֔#㿘> bx`@? 3 "    ? @&& > b  b>  b|> b> @!e!0㽘> b> <@' 2 $0  $@2  (` `$ (#@ > ׁ< d  ( `$ ( #㿘> א ےaP @蘒  (`$ ( 㿘`(`B! " ?&``X> &@ > &` " ` !"> b|&` ?&`$e   ((?c(&`$`$>H $ H > bx`@ !> @ Ԑ!X㿐 D?`@0`>h@`0`> @!c>ic 0 > @P> ךa a> ח*!:ŀ < d  > ׅ? F!ŀ  <80`@8` 8` @  > ה !ŀ`> &> <, @```8 @@ D @Fג #\> ןŀ!`8 @G  `,  @F @F > גŀ!`(Ã, > ŀ#`x?? aW@ ?+`c @ (? @0`3` aWn .`@ @(`0@6`@@@a 7ނ0(``X(``  (``H ,  (3  0 4 8 < H X '*` ?aW8 ?3`&6  @+`(` @@3`@ @& (+   (,` 9 6  3  2 & ,(`* @2@ @ 2& 0(* 2  3& 4(`+ @3@@ 4 & 8(,  4  4& <(`, @4@@4 & H(, 4 & X`\?(0(`@?0@@#`\  ` p r`0`(@6 p) 0?c6 r '?`t 0((`@0@@#`t `  (`6`@.`(@0`3 1   *22` *& (`+  @3 @ @+`1 @  @ & @?6 & c ?`0 ((` @0@@#```@ (8`@4`+```0(  (`0@@@ 1 $` ) ( 1  $` r*К````() 0`0@4`4`6 |6 `p`< @@!`r`"?`%`<%`P%`5`%`5`p5`5`L-0` @ 8  2%`T@ (%`T  %`T5`5`NJ 5`  @  `  8`  (` 4 "`pk  5`p5`r`  ,` 4`4` `@`  E  ?á, 㿐`8`3`(`/a-@ aW%`@! "B'ޡ`?,`@@@   C` @B@      @ @C , ࠀ`    (@ 3++ࡂ (@''`@@`  %> 6`6`!I > b| ( ࠁ K  2  6` "6`  @@`ʔ  2@`Ô  "6`! 88'H'P'T`TN (  (`0`?c  '@'??    ')?' KF4  @D@D 0> ?(" & 0 00`@ & <& 0& 4H@@ 4  @D/  H ( ᾔ @(`?  ``  HaHa(᪀ˀh   `^ <p*  )  2   0` @   +  (0` 3 ;` ``  ``%`P P '`$.` + 3 +( 0`2 D# 3 2  * )  0``  3 \  ` 0((`@0@@8 ``" 8 `? 4=```- 0(01 (`@@@ D) ?  (1  @C ?P`220`2, `&0,`28 `?&,8`O ,o0I&8`G ƃ-`D` `?`P "˂  \`PP T(`4 C  @Eh@C 0> ?(b& 0 0& <0`& 0H@@| 4  4(4 `( Y  +  (0` 3 8I 5`5`7` PP H``2PH2P H ((08P2PP`"&Q |  `2  `8  `'     P1?/  .    6@&&6'T<p &P6L@@ @2 &T@(&T&TB6N76 @D  H ( > c<@' ?> 'L'`b )> %> '" ` $" (` 2 $`> ''!> "@^u  ""2g "5>  6> l‐> 4`>b@'> l Ӑ ;> lb?  4 Ƞ4 h  a> @j@D dD g `? ` ` "``:`1> l> @x"> c<@ 1> ׁ" @2(`""" @ʔ " W v``d"`2t'> @L"" > c >  $" (`2 @8 2 $> @1 T'℀2w `"' R Ĉ  (@) ?($ (``@`('``> l#> l b$bs`?> h`> `a> ׬ '\P0d  2S@@  > @" `\> .@ݐ"0@ېH/` /&  @\N& Hp@@] g`   @]@C`Hp`*(p ` @`=> > bP0> > ׺b8H> > `H`@@`@@H/` /&  @[& Hp@@]M  @`ǀ`dd`> l? '> l#> l$$b⌄  `? >@ >  > l`>FD`a > ג "@9> l @݂""?,#> l ↆ`?@0`@0`@?"S"1 `2` 0`@0`2` """#@ #> l#> lb2"> lb$b"?"b2  > lb?  > ח2#82 @ab?"> 2  > lb?  > ח2#H2 @ٖa> @֐ _> > @ϐ!> .?#> lb?l'`4` 4> c?#> l a'> l$b$℠ & @.  1> @Òb. ` `J?`dC> ld? 0` ?c(1 `(`'`,@ Ѐ '"@\  T"7(2(`"  @@\  2; ?R'`@L'````````> #\#`#d#h@H#> ld'`#```````> #\#`#d@"X> ג@"  ?    @" "  > 7 c  ? @" " 㿘  @ ?` ` > 7c      2 "& - +H`Hp@  и 怣     ѕ  " " " " " " "" > 7 ` " " " > 7"  @ 㿘 >    > א#@c   > ؠ`  @ 2 > > ؐ#@Hc>h>Q`b㿘> vcX  >hcLҒ  㿘 ` ```@?> ؄`(    `$ M " `> `?"@`  &    ? @&& 㿘 )``&` `&@ `$  "` `$ ޹ >  &` &@ `$  "` $ ާ1> @ S"@ O" 㿘  @ U @P@ ` { C  2 0S`2@I@("$ *SB @8 :@2 2  "! ? ?  | ` F&  !> ؖ#ؘ> @ 0> ؒ#@V `@   !> > ؒ#@ > ؒ#@D &   && `& > > ؐ#@3c!> ؖ#ؘ> @c 0> ؒ#@% 㿘# `2 @H @-``;?&`@&@&`  `&`& `2 &` @"( &`?@&`  &@  `'  &`"  & ! ?  ݐۑ & Ձ㿘 }p@@|ࠀ`>  @  @ (!> > ؒ @!H > @ > ؒ @!pr  > > ِ!@Ւ`   @?> ؄`(` `@ `  @  @  @ 2N֐  `& ޜ  F@ (@ @>$@Ȳ!> > ؒ  @ > ؒ @I > > ِ#@D`!> ٖ > @v 0> ؒ @8 > ِ!@4`@ "! ?  0   @!? !{ #㿘 0>  2 &`?  `2?      ? @ & &  > ِ#@ݒ`㿐 \ @  `+> > ٔ"@Ȓ`(P`%> vP`u` ` @X& $' (Ѐ`' ' 0 0 H    耠` `'   '' ' ' ' ' `2( a*> vT`:> vXb> `> ``2@& X   XX& M > > ِ"8@q`(a`& : Y" "  `"  `&  > v" T`> v  X T&  XX& !>  "   #\> @ b`"@   `$P ` `?A "" " " " " > d%> v> ِ"p@#`8 !> ٔ (> @S!> ؒ (@"> > ِ!@`( & p Ed`G>   @ 8*8&@ !> ؖ#> @ > ؒ#@ !> > ؒ#@"#> @"> ؒ#@ѐ"D\@ ` !> #> @#(> ؒ#@#X  '> > ؐ!@c `\@?a'؄   `@  ''' ' @  و @  @2  @ @@@  ̞ '''*C *@ ,! `?\@ @ @ @ > @  @! A􀢠=Ԑd %  @`"􀠠"'쀠@: ''' @@@ـ `%` #@ ł@`8 * \@`e>  `& ؖ 2( "c 0E   " ? \ @ @ @@,  @ 耢  @`"'쀠@'''> > ؐ#@c> ؐ"@c '''؀`f  c \̂@''' # !> ؚ#> @ː#p> ؒ#@#> > ؐ#@c'''> cl`a" ` (`` @6 @    > d`   d> > cd p  < @" @@ 㿘> cd> @##t!> #p` #p`> cl#p$#p= #p㿘` > cl`a@V  & `a&H`    > > ` h @ `〤 ݀〠0R` > 7c > "`8l"` cp`"` `Hp@ 㿘H``A> cl@ > Hp@ @XctHp@㿘> clH`> ٴ`H #>   ! @cp`$cp " Hp@Hp@> p  p`  @ @@    `$  @&`$   @Hp@ # b}@"A( b~@  `v@" b@`w@> c " > #p!   `!  `! H`> cl @Hp@ cl" `> p ` pp  p` Hoo> cp2 @2  ?" Hp@ Hp@`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`U`2^``2"`""`@"-"`@",`` ` ` ` `""@"  `` ` `  ``2` @"`` ` ` ` `ْ"```"`""`@""`"``㿘 3`$ $ 4 ,@ `, @   # `"   `2 "`"`"` "`&& &   &`&`&`&`"ٰ  `$ $  ,@$ `, @   `  2 $    `$ $  ,@$ `, @   `  2 $    2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2 `"  " 㿘`   @?@9Ϭ@9& 8 L@  " P" " " "  " " " " 㿘 > 7`P> ٤`h $ @  " @  2 2 $㿘@(`` `(`` `8``p` (``` l $ ( , d> ٟƀ  X> ٟƀ  0 4 8 <> ٟƀ  P @ H L> ٟƀ!   > ٟƀ!8    > ٟƀ!` ) `> ٟƀ!  `> ٟƀ!  `> ٟƀ!Ȑ  ">  $> ٟƀ!ƀ!@㿘 "   (  $`@2  `$``(`` ` 2` $`` $@`2`㿘 X` X `> .>`D >  a> .>`D㿈 X?'/?`/ ?`> .@Bc㿈?'/?> ?`a/ > .@Ac㿘`@@ X@@T X@㿐 `Q'` ``   0`  Hof4> 7(@ g> 7c'T@ 0 'T@(   Hp@   Đ     ѐ0`   Ò0@6v`d  &`dʷ0㿐 X`$ @ d lbH` 5 7> b> bP  * @@ \`$#\ d#`@ R`$ X  > @ G  d`$#\> ٰ @ ="`  @ @ d#\> ٰ @ .#> @ )  d`$> ٰ @ "   d#\> ٰ @ #X 㿘     @ @  "  }  @   q? @`> c<@' (< ``a> ڂ`> #\ > ڂ`(#`#d> > ڄ0`8#h#l> > ڄ@`H> > > > > > #p#t#Ȓc @ `> 7c> > ڲp`> > ڪ`> > گ< ``" 8>  @ epd @ Đ$? 88` @ 8:`@  ठ?88`  $8:`@ @ ਢ?@88`  @$8:`@ @ ଠ?88` $8:`@ ఢ?@88`  @$8:`@ @ ഠ?88` $8:`@ y <?@88` @$8:`@ m ภ?88` $8:`@ a 4?@88` @$8:`@ U ?88` $8:`@ I ༐?88` $8:`@ =  > a2bdX> @ . x a> c<@ > ہ > @ Td> @ #>  > > > bc> ڐ P@ h"> 7x 㿘  ( ,`&  `&  &&$&&  X`& &, lbA t |  x`& |& @& | "&($@@&( @ H@& H7@  b%> @@ !   !   & ! $ `"&  < `@& <& \ |> > > ڐ `@ #``>  p? > 7cP$ L> @` L`" d lb"N' X ` @y7b&@ v&` ` $  &` $  H L & Hu& L haB~ 2  @  8`@i&     @??$$  $  `&  $ "!' t+Ġ ". d $@ N>  ,@*7> > > ڐ `x@  Ðї& h     @?$$  `$  `&  $ &  d> @ !$ `$  &` $  H L & H& L& @' @ !> @ !(> @ }!H> > ڐ `X@  㿘 ` @@3 `$ @ځ㿘` `2  H `=>  H @ :&  @ & H@` ` @?&`&@ lb t < & <& 7"`$`&@ `&&`ے < lb1> #@ !> @ !㿐'@Ѩ `) < 4$@` `G>  H @ 0 @@0 4 `7>  H @ 0 @@  2 <@^ ! > c     ? @ $$$ Ɛ lb2V 2 > > ڐ `@ $/㿘 L`" '> Q  ` `%>  `2>   ?    @& &  > 7 c   ? @& & @ "(> ڐ `p@ Δ!> > ڐ `P@ ǔ!㿘`A`@ @   `@&  `(`4 @ @@@ǒ 2 @ǰ@ & @к  $@L( 0> > > ڐ `@ {!> @ 0"㿘 lb @> 7c$ 7b" 0> `#> 7㿐 H 0! `l  H 0`&  -     㿘& 0`   @?@3ɜ@3& 4@o H 0 @K@G㿐@` @?@3Ɂ@3} $# 4?`"  4`& `& 4 ِ   4 8 & 8@  4㿐'`#`2U H  N *l`"   h da& h э  L P8/ d2 " h ` a 2   `&  `& `" L@Ϲg@Ґ L P d> @5"Ѐ "t d H`s7b@2v d [   ? @$ $  L H& L& H 2 `P&   @?      `&    `  H 0۰ d> @$"> @#( @26 d  @?  `   `&    H  >  @``p > @#> @#P d> ڔ @#p> @#($> ږ#@ > @ > 0ct" p㿐\`> ` > ` `   ` ( @@2IIۂ & l& $& d& & & & & <& 0& 4& h& (& X& H& L& & & & & > & 8?& P㌂` & T㌀"> & & &  $`80`@8` <> & `& t@2& ,@2& $@2 $ & @ $@2$?& x& p& |& & & & & & & @Ϋ > c $(> 7> .c& 5&   & a:&  lb& l`& a` `|$` S$` ?u$` 4   #\> _`X > 7> .c& &  ! & > 7c(L@(@,@2;#@1 | 4 * * > a` 24` lj$`>[>[a$@#$`* > c@1t܀ >b>bc$@$`> @ 8@ h> > > ې `@!x㿘Hoo> 7c ~ Hp@㿘Ho&(@g X `> .@:Hp@㿈?`?'//?Ho(@g X `> .@:xcHp@  (@@ (( @(` >  T>^c㿐> v> c\T> > .`ب   ,@)   w#\<m  `ā  (@  (( @(` >  T>_c , , d L \ x 0 | x | 4 (  ,`2 `  `! `"> >^c!H㿘> bL> bH> 1 `l`.@ ``0@ ``  `> 1`l/`9> 7`. > ch"뀤 . : 怤 > 1`l@ ``΂ @8 Ѐ ̀> 1l" lƀԀ`߁2 ``cTǀ`> c<@' @ 6`'x`'|@'tК'`   '` M %# 2 t 2&> c<@  > ہ `". `.M % ?   (`''/:  `Z((`Ѭ /ؤآ /' 2 '"@   `  `?. /B ^ ` a`. "@" $ ` 0 `?.   `".䀧`.2    $c? ` 逧`?. Q?3 >`2LMU>  >'lƔBl>c!2'   2t@"2q@ @"n@` `/0   g 2h@"2e@ @"b@` `/    2\@"Y@ @V`(`8` 8` 'l4 lȚ`  ?/ `` `%> '( @  ``0,, 4`4  %`0 0%,' 'l l`/  'l l`/ @` H' '  ̑(` (`8` *4 '?Ѐ î M(`(`@@Ѐ  `'?'  (`Ђ M(`(`@Ѐ  '  (`/  (`@``'?' (`  +(`/  @(`@> ۢ  ` x/ N'  q(`@`'l @E ll"@Y`e> ۂ`' , 2@"E @@ ` "/2 /  (`: `l"T 9   @> `  ",(`> ےa' 4 "@ `?M`` `'> ے @'llL #   `". `. @ؚ`/آ   `/Ă  `/ `8`? 'l +l?'l 0#l?   ` 0 `?."> ? 'l 0l?'l* : l ?ր {? 'l l? ` 0^`. `.'l 0̔l 'lŔl2.`G>   ` , `@ ,, 4`4 @`%'l @* `0 , @*l  ` `0%A,8'l> b  'l) lؚ`@ @`0@ -`/ @@ `?"@` `  ` @ؠ L'lIl  'l l?̈́`  (` "M ( : ``M` N   (@'|'xx @ "&  @?`` ,`". #`. (: ` 2 `". `.  (: ` 4 À`v  2 q> 'l: lנ ` $  'x (@'| 'l@*nl  %> "Q@``'  N?!> ے U'll>  I؀ "%Mڰ `2 >.;㿐'`' ( ((@㿐'P'T'X'` 'P ('ڔP ('Ӕ(@㿘!> 7@q#<  Ŗ > bL@G#<@A#<㿐'X'H'L'P'T;> 7@Sc<H '  > bL@(c<m@"c<㿘> ސ!㿘>  `ְ 㿐> 0cLH'H@?'L'P'T'X'  v`㿐 L'L'P'T'X'h 㿐>'H'L'P'T'X`0` ,` `  H'  `  K x> c<'  < ڔ  > Oؑ*  "  >:  ʔ  *  :  >   > ہ !㿐 'L'P'T'X L `L @+F  L  '   ' 㿐#> bL'X'HH'L'P'T'`!> ,!H'> % > 7cH@@ŷ0!> v##"ǖ$bL!㿘> ۔!P> 7cP` `` > ے!p@ˁ㿘> ے!㿐'L'P'T'XH/` /JL'   Hp@> cd'  x H> ې >iba㿐'H'L'P'T'XH/` / H'  YHp@> cd'  H  㿘 a`%&@` `  @&I * 2`@ @ ,!H&!D`&!HH` @! > d c㿐 ,` 2 !&@!   @& !* 2`@ !u   7r  gE㿘` @#  Ho-4`(@n` ` @ `i Hp@ g  t h \ P D д ѐ Д  \ T X ϔ  0 ĝ㿘> (bb $1> 7> (` 3> 77> 7@&c\((`8&#`d(`@8&(`8&d` ``  (@` ?&#`> 7cp> 7x > 7!#t> !#tb(@> 7> 7tcx@ `> tb > 7(@ p㿘(8`-M 8`0Q ``8( ) 8`` ` а `  ```$ɀ@'(``8  `2 &@ 󀠠2؂```ۀ@?  (8`0  N`x`X    ``    `` (8``*".` @ ?Ђ``   ) ` @(8(8(Є?Ђ``  ) 8`` `` ` ` @?"@22  @  㿘> (. b>  > #( `(`1> !>jx1> "1> !V 1> }# ` > 7cX` ` > >hb"> >hb#Ȓ> >hb"㿘> 7c\. 8`@#> 7c`@$v1> > -@S@ . 1> ۲K"hc`@> -. > (8 b> >"> 9" Ta>  a `|/T T |V `L`C` > () ` @(`8  (`> '@ > ۢb8 @`(`8  1> "&@!> -"((> -a@:> ۖ@ "0"c`&@(`@> 1> "P"4> > ܐ"@ > א" > Ґ"T"V > ʐ"@1> ۝㿐> > ۤb> > ۠bТ>@@>1 (J` ` ` ` ] &@ޒ㿘> "> 7|J`5|> > ܤa p>j> ܨb@> > ܮa> > ܸ`> > ܴ``8'> v@%b@ o  ```2 (`b``J``T0Q0N0K0H0E0B0> > 0> :#0> 6#0> 2#p0> .#H0> *#0> &#0ĝ㿘N` E` C` A`  `  `  `> 7H` > 7cd*(> '8`̪?  (8`@(`@$`@? `(8`@-`8`&@ ?ц 㿘#> 7ch? > 7cl $ch> ʐ!$ch> Ð!ch, <  q`? Q$ch`?㿘'> 7d)> 7`%#h> '> c̢`  @ d@ ?,  ?%#h㿘%> -#> 7c`'> 7 $h  ) c`@@ ?,  8`?$h㿘 (> M1> h="x@$^"x!> 7> 7#tcx > "xbϒ @$O"x#t@$#t㿘> 7c\$!> 7> (b. P `C>``Q`M > D!> @". : א e1> !4#`3> -b4+1> ۄ&> -(a> ܒ "#`> -&(`@`> !1> !2> ܒ>  ". k: > !1> !"h1> !0 0  㿘> 7c\ !> 7> (b. P `"E 7``27> ܂ 0 > ܐ". =: s d]~1> ё #`(> -b4 1> ۄ&> -(a> ܒ"#`> -&(`@`  $> !̒"h1> "0 > ". : > !1>  > "01> 㿘/> 7\;> 7`='ch. .8`> (8b(> (> ܬ b@  ((`8.- (`8@(`8# `8@2`"@@2e'sdR"?'ch\ @ɤ ?iސڐꀤD怤ِ․㿐  ` `8  (`8` ` 8` ` " 8` `> "Xɒ > ۑ.`.: v:  (`"Ё㿐(`<` o` m` h`g  `  ` `<` @(`<` <` E` "D`<` ?> 7cd`C(?8`> '  (8`@(`@"@=s (8`@-8`?  s[  > ې  s` @(`"Ё> "x  㿘> 7c\S'> 7`K> -b@4m1> ۃ. 8`> ܤ">  knf, 8``y`Y`n`N, 8``y`YJ cؐ`!> -& "*`> %@!`&(`@`> -&(`@> 5"Ґ܁1> -"ȃ. 8`Ȑ> ܲ">  #&, 8``y`Y`n`N, 8``y`Y"h c> (b. @ l$  `` @"耠@ `` J> (- ` U    (`@`(`8`.`   B  3(`8 > '(`̠@8@>`(`8 > "22 > "> ";- Ԯ` .`@;5 " $ > ( `  ƥ- 1> " 㿘/ ?  c> 7 ch> (bbB..8`> ܵ8b@ ``4 `@!R2 @< 2 t2 T @2 T ``2 n dvfceif2c,`ב:  %> -`8-`8``> ܀> -`?a < 5> 72`  @#<, @@;Д  " `d"'`耤`c`e`f2` * :  @, <`c?> 7 ch n`  T ``2s 0 ؒl zh Nd ِ` 㿐?> '> > ۢb.`> (> ܳ>`b -> 7 (@9/L` ` ` ` &^ 2 L\ , > "h ? q Q֒@`@;? `a'2'{Ē   fp)> 7> 7#\c`''''''''.8``+> (b$  > ܀   @ <2@;    `> ܒ a#n? , Ԓ@.77> ܒ i#Д\ a.: ,: #\􀦀 .@  ?,` > (a,`> ( a0P  `0 > -a`> - a|P  `0 b5%#\?`1 `@@2@:w 2V`"V`2V&> #> #8> #X,`:: ?` `@}@2@:B 2V`"V`2V&  `Ԡ `@Z@2 @: 2 T ``2 T 4 4 㿈(`= ` a` _= ` "g @` c` a`"` @  `  `  ` -> 7`L@`  @-> 7|N` ? ?|,@N, @2@9Ӕ 2,@N, ;`` ` ` ` @&|(``2(`>  '` @, = ` ` `  @ >jX= ` '> Ր '`> ݠ  e'쀣`> ݠv UW''쀣`2u> 'C qP?'쀣`w'%> '` >  '쀣`]> ݠD Ԓ'쀣`2d> | 8'@K'> 7؀`? > c> ݒ`> h u'쀣`7> ݐ $ 2*> > 7'a cX`> ݠ( u dR'쀣`2> = J'> 8"E'4 xA'0 `=', H9'/5'ߒ > 7', cl: 2> WW'ƒ 2> L@`"p$ @``(8` !` " `> 'mb tvt T܃8` 뀠`> '` @``(8` @ۇ( <' $k' 2> WW4 f'і 2u> WW% c'– 2f> WW e' 2W> WW d'? $ 㿘> x > > aPq@5 (  1> c!    N - 2  * *  @> \!T@2  * *  @> ] L@> ca 2 `> c?c(> ca@ `?( 0`@?`@(`@@> ]`H2 `> c?c > c@  (@ @2(` ? 0`@?`@(`@@ 㿘> 7cP> ݐ @xa>`0at`> ݁! `E 㿘 ` `    "  㿘 '  ^& "  `" V`6` `$ V`@`@" &`@``@6`& 6`^UV`㿘 4@ &@) >  XbȀ2&@``6`㿘>  a'L'X'T  L@:@ 5 (` (@,o`(#] .  `$ 4` (`@ `(@%@ `$ ]Ԃ  ̃5 T> ݂a䀥LX @   @] " ``c7`a`>  ,b @`(W a,0 ` `$` p < : @5 |";Q}b{"T` `` 2` "T` "Q` `` `L$` `5   ` %|'T` `x t ^  "`  `'`` `v3~2``L'`4``` b~ `$` ]1` A v "`` 2` x `"'``@4``` b}{````w l%``4``4``(`<c%'`(! <`! @`U! D@(8 `/   $x  `W&   7 Q` '''''耧 '`'``@ = `@'``43 ``821, `\؀ 9 8P$ @?`>8B >P ;4 ` @\r `&  `2Ѹ  w ؔ  m  ?  #ð    |2  㿐@ [ْ  `2 ` `` #`#\C 㿈@ [  `2``'' ` #`#\ # 8 `/   $w  `V&   V P`''''' '`'``@ = `@'``43 ``821, @\؀ 9 0H$ @?`>0B >H 4T ` @[ `F  `2Ѹ   ؔ-   ?  #"ð  {Y ɐ 㿐@ [  `2 ` `` #`#\K 㿈@ Z  `2``'' ` #`#\ + 㿘 "dԒ  . `8> & $Ho-!(@X> bȀ"2H1,`@,H` Hp@nX> bȀ2, H1> `  "Ȅ6 `0Ĉ0ٝX @`@`0`,`ȡ,`,` "͔ ,`@Ȅ'Ģ'` i , "d`H`$?ɀ # H`` 2` ``" `  2` `  2' `8" ,```> ݔax``> ݔax` `> ݐxa `  , `  , "'` `8""` ,`2```> ݐaxS``> ݔaxJ` `> ݔaxA` ; t , [ `8 ,`> s  M ,VŐЂb???/'a'''''''ܢ'ЮԶ!' '' 9>  ,"̅H``@$w  ```%V|35 ?  '`.'Ta%> 'Ї(` (` ( ( @Hoo ,`@"̀@Hp@"􀠀φ ͆ U'@@'H`$!> > ǐ"PHp@ "|"0awr EX > '``@`@ ,` P'@  `@В    (`@0`D#@* *  (%@(( @@(`''x  , H`$#" @4@;  @'? `''T a;>  ,b̅H``@$!`#U{13 ?  '`,'䀠%> 'Ї(` (` ( ( @Hoo ,`@b̀@Hp@b􀠀ц φ T'@@'H`$!> > ݐ"ЬHp@ b0M@ " U Ђb?g??/'a`' b}@# (@( b~@  c@" b@ c @8 " 8 "`@ ` @  @`4R``(< > 8`"`8 "`   > 8`"`8  "`!  4R `(<"2 @2  ?"   2  @2  ?"  !  4`(<" @`2   "  @`8 ?@2   @0` 4`(<" @`"  ?" @ 2    @a"  㿐> 7c(> #\"> ݒ Ha  Ř  @" @" @:@㿘> ݠa @b!a  & @ " @a & @㿘 ` > w> Ђ > B؂ @ @ H & 㿘 (&`8&`<&`H&`&` &`L&@&`&`&`&`&`&` &`$&`(&`,&`0&`4&`@&`D&`P&`T&`X&`\&``&`d&`h&`l &`H   >`8@ @_B?>`@ &`  $&`$ (&`( ,&`, 0&`0 4&`4``&```&` 㿘 (`A < @ ``2  `" `@``  $` ` @`k``@`@$`@ꀦ ` @ @a8… `ְ `аS  @``@$ @㿘 @`@ ``K  @`  8c:  b& @ @㿘 , @ D`& @> ݲaZ @`  & @  D` <` Đ`@`C&`@&`<1> "ԁ㿘 (& & (̰ 㿘 ( L> `D`$`D *@"A`@`` @*` s`` @ $`$`@ @`$@$`$`ڤ N`D`7$`D@aT8` `@`H` @a6`䀈``<!`@`$`@$ 2`D "`D$`@䀤`@` "@ϐ$`@@` @a&R` `D`$`D`@$`@@T`D #㿘> Bc@!  j> w& && & &  @ 㿘 (`<``@``D`$`Dq!> > ݦbh "S`D`@ @`   `" ` 2:`D` @"@(`@ 2~`D` @ @@:`"`  ? ` #`@`!$`@ 2`D`@`2\`D瀉  "` `D`4$`D@"=`@`2 Q`(@8"Ѐ`> ` @> @`>  "`D`$`D`@` א$`@`@` "@א$`@@̀ `ɀ ƀ ư D`D `$`D`@ 8*`"@*`@ (``  $`$@@> $`@7$@T/$`@` `"@`@_  ?n`D~$`@@`` @$`Iİ@ "Ђ`$"#> 鄐"P邐"8> "㿘& &   ` `& @& <& D  Q/ 0 0 4& (& & ,& $c& 8㿈  !> "Ԧܤ   א"դ  ,[ B 0`> 80 `$ ( `Z찒 *0`0  `( $`<$<, , `, , , ` @~  STk 0[D[A0S@S|8 p  X  X x  <x H ,XXXXXXXXXXXXXXXXX T    L|||||||||||||||||00000000000000000000000000000`  ''''''؂'' =?` @ 耡  (``@ > 2=c@8 @C =c @ &c=c㿘 ``@ے @`4> `,@@?ݐ #`,a@`42`,> `$ 㿘` ` ``,` `P`?&`P@%@9[ P@ #` #,`,@ # $",  , >H`Ђb@." 2  &>b@h`L1`o@ $ &> 甐"j 2,0>b @hy`@g` ` p``"?`4Ђb@'` ,bWhH`@C @`4@>  &`,H`h ``4$`D "`Lf`L`"  &` `L ` @ `L1"` ` ` O a@"@`$$& ` u ?/!~ڐ@ F ,B @+} @ϳ`' `  `'Ȇ  ? '''''' #'̖ `,H`h ``L@ 4Y$`D" ""  ,b|   x!`! <zQ `Ђb?4` `0`2` ` ``D@4" $`D~z "C> eS$`D`,H`(!F`L`Ђb? `0`2 8&` ` ` `0``4`L@@ `L`Ô `Ђb?4` `0`2` ` u``"`L@ "`L`  'I ,b    x0 P` P }@w,bݒ   x P@ e`t P_` `0`e  $`H,b Δ  w!@ݒ @`O!:` ` '``H'C `Д 6 ؆Є '? '''''`'+`> *w $`L'0 (`'8`D   'Ȣ` @'ܐ   ''Ȗ 'Ȗ 4lHo-(@n$Hp@ '@*İ  *wl $`L `    ''ؔ . ('܈ @ 'c8䚠 0> > > ݐ bp}"f> > > ݐ bpu"?> > > ݐ bpm"X> > > ݐ bpe"K㿘 (  @P$ (㿘 ( 0&` &@&`&`&`&`&`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D&`H&`L&`P&`T&`X&`\&``&`d&`h&`l&` `!$2``&`&`&`  `   !$&`㿘 (Ho``A(@a`A` L`"^  ``    ! < ؀/ "F 8`  H`"  `. Hp@4  `4 Hp@`@2… 2ְ ` ΀ϰ ƀ  `4 ֐`2` ` ` `T 2`` 8`" `㿘 @Q (@ ~@0 c@}@"12``iS`rM  ` b@-@2 0``& " <`" @`" D ` a2  `   b2 2 2   &  <& ~2    }2 2 2    @   @  (   >ҁc4 㿐 (#\   @IϚ 㿘 ``` @;  ``@ @1   `  `@@@@ > c?`c 2l d@"dl2``@? > c 2 0  @2 l d`  t `@  0 @  `6 4 ` $ (@" $" (` @4> " 04" 8"`  x"` x " x` $ ( @" $" (@> 4" 4a4" @`  ?` ` @"` "``" x` ` @"` "`㿘  u | ?> 㜀   ``$  l & ` `@4& ` l `& `& ` > &`& ` & `& & #?!#(> 6 p> & ,4 t& t& H& x p& l& p p l # p> `  v| & l l& p @ > ` 㿘`  ` > `h (( @`` t  ((   vI  & 2 > c"`(`(` `"@`$@ l2` v#㿘 !ؔ  @&  `   @  Ē " > H"㿘@9C > ͐#>  㿘 I  @` ``@  " А$`` $ `@$`$`@ڤ @:   @9((> "㿘 h`$  t> ! ?    t  & x u >  ǐ"㿘!>  E# d`> ` B# 㿘> c 2 d0  d`" l}$ d l 2 d㿘 ``@> "`h%> !`l `  ` ?(c&  `2  &f  ! " `0㿐 ``@'``   0! *>  h`($ hא!  `h3 d`k$ d 2 h d` Y h`$ h d` hs  2 hېː d`> `&۰ ZR &$ d> 㿘 @``S F  ,@B'> h@> 8>  h`h$ h(%> ->  , $ @!@  '` h! 4 d % d`$ d 2 h d`" , Y h`$ h d` h  # `f 2 hJ d`2 `" hk Y hf$ d d8 `  /`hC&`h*0  2)`h`l "m`p`p! p`p? `d`h`&`l&`d&`p &`h5> ݐ`h0  f! +`h`&`h`d``h  m 2`h ` 2`h`,>  ` > `hڰ @ ``h԰`p'Ć"`h`&`&` a> >@&`,&`4`h&`H> c`l ``@>&>&#\>cct㿐 ( > ( h   ! h > 7 c(> #\#    > 0c8> cc> `> ` > > c '(((H)l'''''t'`00@0//h/..P.-L㿐`?`  .  ->  -. > 'c@> 'c<> 'c8> 'c4> 'c  '  @Ԁ$Ҳ $ > 'c  '  @b?c4 $ > 'c  t'  @M?c4 $ ;> 'c `' c @9?c4   q;* #> c aX*ϒ  q/* !> c  *ÒaXr˒  rȒ $aX$ r'c > 'c  +' i e4c a$ _ 㿘> ` ` @2@"T  2 $> p > 8` `T `%>  X( 7  (`8`4+`8` (( @0X`T @!X (`    (`8` +`8`` ((  60> ޙ#H> ޖ#h㿘%>  M>  `'> 8 +`1  +`8@(@2  (`P@2+`4 (8(``?# `# 2!   +`8@܆2@"@@$@`$` 2 (`%`P '> '` ?c `+> aX,  9  @ . >P &  * p  `    4 " `@`\@@@  "@q # &   `$  "! 倦&  . . @ '@!  `̢  `@ƺ`  @,` ŀ@ " ݔ! &  {. . @'@ɔ! &  g. . @'@! &  R. . @'@! uŀ D i\@ D b $ a@$ $ > 4$ ,w M> 8` $`$ \  @ \p > Ҹ!\aX%?aX.. @0aX`   )  @ 3@ @` r?aX㿈` 8` (@cF2` `@>&>&c\t#\#`P  "`㿘 @``?`!> '# > 8\ @.  > G!\, , nǐ"&% #  X` 5`"7%  ,   ' pP > (!\ !> '# /> X  ``@; 2ǰ "ְ  />  % ` %`, % `> % `% % `? (15 5 % $> a4% ,X> 8#\@ \X@?c( @&    `   f  "X o > ѽ!\X 㿘> '#> 8c(`` `%> $`` ҡ  > & 6 &  Ҕ>  "  @2э``$``㿘@ Z  (; `;  @5@2`P@2` " 00(``L 2 (`8``F@ > 2L@2 ?"> J > 8` ` (; `  2 `(`0`0` ` y  2&@> ` 2    @2&@ `(`(` ` `  X > '' `@?c @ ` ;> aX- @`;``@   "&  ,,Ġ @` Ă''7` (`1 Ġ  `= ` (`1 @`T 1 (` (`  " `2  @ 0  " '  0 (``2  `2  @"̖ '   ` (`(   @0   h) #T `2 `4 aX!$@> ݖ aX'@`{`V@?@2  YT `2l 4 "} Ā@ng ,  @ l``3   3+  @"S  "  " 8 ` (`(   @0     @` 4(( @  > a4 $`$&aX<@&`44 Y,,# @@"?T? "??H ?> ;#㿐 D   !> 7> #(!\#\> ҈c  #\ d > > ݐ ~c!> '#   l(* # >   aX l!(> > ` ?@@P@@??x> 'c> b0 * @`" `@ * ?> 'c?c  > b0)  ;  @ 2 0㿘 T`) @ ,  kڐ&`T Tp@`?`c >     (`0@@ (`0(@@  &`T㿐`?`  .  ->t  -. > 'c  '  4 $ > 'c  '  @Հ$Ӵ $ > 'c  '  @À$ $ !> 't#  > a# ``#  (84# 0> 'c `'[ `@?c   k5* !> `"0*ɒ"0lђ $"0  k%* !> `",*",l $",r'`㿐> 7c(  #\ @ > > ݐ"4Zc!> '# `  k* `>   b0 j(> > b,# > > b$$# > ( b 㿘 ``> '  i e-> (@ ^ > +> ab `` (@5 P %b %(@'> 4@ :` "^  > "$`C`!"$> b0(@,`?,`!"$b0 @@  $ <`$$ `> $ $ $ b,,`?`(@04 $ ` <$  ( `44 ($ $$ $ 0$ ,> a4$ 8$ 4?c @@& )> b0`# ``b0`@,`> W#ِ4J?4ڒ(b `5%( %b  # >  > ݝ㿘 > `0.k `"` 8 `ff ? (c@' 㿘`@  a `b    #"@㿈  `Tg@ \`@@?  T@$J ``  ` "`  `> ) a8``OMa@('8@ ,`@@#\*#` @* $@$ (@4> $ 44($,& @&!> '#   *  i  ` "  ? @   `T' @'㿘 8 !> ! @@(@> "4> > "( 4@ !"( @ X `Z ##x ? T (b$ -$ h! @ < Z  <  $ Ȃa@$ $ > 4$ 4> 0?> c@ $(`  ``@>&>&#\>`tct㿘> '`c?c@(1> "0,` !>  b@ @f*?> &`4 ($ 04 ((``$  b_"0> b$$  㿘 T  `  TjV & T  T  `"@@ `  @NOOOOXO\l[[[[[[[[[[[[[[[[[[[[[[[[[[\$\|\\t[Y[[[Y[̝㿘 Ѐ`@ @ `@@?`㿘 @K !"! ? 6 @h  ( `h* h`3@ 4* *  @@(`6 2 @8`> > c c  `   x    x@ >ށc!㿘> c *  * g> &c 2 p0%" l* $ (p"" (" H" 2 2 2 t" " |`2`" l* $ (㿐`" ` (`@e >> c+ + -iJ > c> b> c> c㿘> ` "    ? @&& @%[ @%Y ( H@%V >i> c$> b!㿘!  >gg pb$$" h h @%[  h (@%W  h H@%S > $  > $  # `!#>kc" h㿘d ꀢ / V 8`2?㿘Hoe4> 8(@f> 8 `' ( H`2  @( Ѐ`$@ H`& t2  @ Ѐ`& t!   H` t`ր`Hp@܀0㿘V Hoe`(@f` >`0` H Ȁ)'h`>> ި`0( H %> ' t`& t HT  a@Hp@ Hp@ p  >*b0 d, , , $4 @ d@p> ސa8 `">  |`"> `"> "IL`1`@ `1 1``+`@ 8``?`?``+ @ 8```?(!``?@ (@ |"|`|8*  `,`,`2l4 `L`1`T` `1``8c`  ` Xt cЄb?V'`?/'a'P'?/a''L`1> ހa `4> ހa`t O> ! @###\#`@-#d-"*  d* $@ޑ2 > #h#laa@6 L`L8 *U4`4$P @4' aH6 ah6 a6 a`2,4㿘_  t`  | ` 㿘V  H@ t`I  H& tO C>0a$ 㿘> 7cP > @"` t`@% d"  "  @# H 2  t& t @ ؀` @  t& t㿘` "4 >  Q 瀦     @?`8`? @2 > #@9#`d`` &`d@#=`H a> ݂c@?`!V`6`?#@9#`d`` &`d`H@#!   > V``#?(`>D  `h ` ` @k`Hoe(@f`H> z@$/#8> $ 9 @ :`d@&`dHp@` 6`  > #@9#`d`` &`d @"ǒ`H `l6`2j i @m @?`(` \?`c @``y 6`? r om?k >6` (> c \@8c`d`H @"&`d `4 ' ^ ! )+ )>  0]㿘`t` (&`  @  ^     ^  ? @ߑ ?㿐 ˒Ԑ Ho ((@f (@!ɒ "  @!  @! "  t@!  t(& tHp@ 6 6 㿘`     㿐`` (&`V`‣`$`>`@ > ݂c@ ?% > ؐ"`?6` `t@2@N`?6`w`B`?6`(@ `n@`2``> ސ `?6`Ђ? `?6`&`t) \͐@Ho4`t(@f`t`` `&`t6`&``@! " `@ ؔ ``t (&`(&`tHp@`V`,8` @@6`` , ` ߒ? `?6`  > 8>(`D h㿘Ho%`(@f`` (`< `4 t>(6 6 & tY`2  tHp@ r~((& t > ]`L H` H Hp@@"  t@" ( `" t0@"~0㿘` t`&`t  t & t   "    ؔ    㿘 t` `0 +& t  & "      c  r((& t > ]`L   & t & t 㿘 5 㿘` ,  㿘> 1l@" l   `& |6 ` & t&   > ř!H& t&  㿘`p *`s `hV`Ho%(@Hp@E> > b@8b`$>  &`$c ?@8cD`0`%. #(˒  5!`!@ !`!@@`t!((&`t > ]`L  c@8c`D>  &`Dc ?@8c` X (2``@2``t  2?2+`)!&`t2``@ `@T `@|  `@c `@~  <@`h`"`(@("``t( \ 7 (G&`t (' ) !? '" ``@ ` `@ `@ `2T Q"P`(2)`|2X`tT`tf@Hp@"> ]> `h`(@0@8`6]`t`(`$j`t`d" `` "`@`H "`t`@"X`t`؀`S@  O`t @L&`t`(``h@@NV``H@ `t!" `2```` > &`t(&`` 2`t"  !@ ע @2`(`a"``(@ `@ ! ^`(&``@ ` "ɐ`@À `@ `@``6`(`8``"5``t(``@2`t`"`tV`,`8` `8 `$`t ?  {`t `!t`3 `t`h ?4&`t, i`te`t"`?`( `2ư `"`& В`@0`|  D`t`@&`t`"``t!"H`r`P06i,`t& `|ْ  &`t Ғ В 2`t2| {`A" `t ^ `t&`tM``| F `t"K`․ G`(@C6` I`t"s```"`t@Ґ``tj`V`† R| ``6``t>)&`t@R`6`R `N`@  "?"`t@?  > ݄ c `@@?   ` `@@@u`t&`t  /`"`'r`t?(m&`t6`i`t& `(`@`%`@i&` ^"ް ~`Ӓ`}"`t`@;Q``{`tǰ }Ű |ð {`  x> 7cP> ސ @a   t      '' *@'''''& & & & & tȒ@   t(& t㿘> 7cP> ސ @|a   (   `  㿘Ho%4`t(@f`t` `"` W7Hp@   Hp@?? 㿘 > ރHo%(@f t & tHp@V"(㿘 >((> ] `L ((> ] `L ((> ] `L <Ho%(@f"& Hp@` 2  `t`2  ?@6  8 @0`㿘 >((> ] `L ] `LV`! > 8 `&`8&` 8 `&`8㿘6 ((> ] `LHo%`A(@f`A#` T``H@$ "`2 Hp@Ғ`Hp@b ` " `tհ ׻```"ʰȰ 㽈`>  ݂     )  H-> 'Ho%4 t(@f t   > 8! Hp@ ܐ`&`Hp@>0   @",`2 `$ @2&` HC`X`+ ` @i ?@"#6 6 @ $6 9  @ = d @& dB$@ @ H׀`+` D 61 H @ HĀ`Ho%4 H(@f HHp@0`" U@ HڦQ> 8 t`& t!`ࠀ"~` |"z` @"u`2r` $a2l`!@2g` `X | > !bP> 8  @`> @  > c<@ 7> ݁&`` &`Hp@`&`@ ђ `` غ`#Hp@ɺ Hp@` #&`#` &`㿐>`0`` ' '  ( Ho%4(@fHp@   @" ,Hoe(@f2W (> ' D  @   `G􀠀'`= t   @݀  > 8`> 8!( Hp@ #`2 # #`? ` 2Y " #T `ǪHp@  @ . F   !~ ``      ֢Ӏ Ѣ Ho%/(@ h@  @3Hp@Đ\ 2  | {e `ې> !bP> 8  " 0ρf h@Ғ  @U0̀4K t0Ð0 |`$a;a@7  ` {) > !bP> 8 c " G ( %`R2'  Z >`r '0>k  Hp@} #Hp@u Ho4`t(@f`t` "`p` "`"`t"`2`"`x}"`tHp@ P @ }@  ]> > 8bP#   @2  ,"/|*2) $a2$!@2 `z!ט " @> @Ȃe@> h@"Q b@"  }@y `@5 ]`r@O ` " ld " l `  ,` l(`> 8Ȃ@`  u@> n  `g@z> c@`8hp> n@ @T^@Ga@ ` @`" `` > !H``, ` ` $`$|`` H``! `r@$> R`^@> X7c@`8Sh> @ M @ > @2Fh> Z@eg@ c@`Ho%4(@fc@` & $`6(Hp@  @"V l wo@5b@mHo%(@f)R&`(> 1!> 1 l` " @`t`(`(ذ  @ '܆?> ΂`X'''''@^ Ĕ@` `@W!Ĕ@k @lĀ K$ lHo%4t(@ft ਀ $t -F$ਃHp@ @= @%@@Pv@^ ` [ ,`W n  @"$| @@b~@ؐ @F[@- s@͐H& @\>  *@    |44 4 x4΁ Ho4(@f&&Hp@  ` a | c & > 8bp  l@Ho%4 (@f l> 8(`Ȃ@`.@ 2/ l,lHp@` `ư Ho%4t(@fta"a r(($t > ]`L 0&  ,J Ho%4x(@fx@((@(($x`@` @$x` "x@$x`@` x@$x` x@$xHp@ Ho4t(@ftd$tHp@ Ho4ं(@f@&$ःHo4t(@ft݂{Ho4(@f`rt`$t6666  `Ԁ`@ t2 ( @"(($$($ऀ $     u6  `@D ਄ ! >O$ $(#$ࠆ& $n Hp@ l] l ]$t ਆ&  (`@0@7((0  ,48<@$$ $$$$$ $@$<$8$4$0$,$(-$ _   `@2fq aHp@瀠` ,`2W|Ob$tY?㿘> 8b4? 6 . @ Ѐ`   l> 8(`Ȃ@` 㿘> 8b4? 6 .  @> 8 l`ȅ( t$ Ђ$ t  8b4? 2 * @> 8b4* ` @``Ѐ`?   㿈> bXbX`` > c<@' ?7/@3 >  > .`-.`"@ #> ށbh@ p//@ >> ނb@/6`"`"0`(` 0`0`0` t`-/ 0'"0*  >aؔ 㿘!> 8Y" %> 88##> 8> 8b<& * Y" > f ë#6* ܐ#> 88b4Y*b4V̒ $8$b4b4. @` " Y  U 8 $|> 8b4$@㿘? 6  > 8b4.   Ѐ`" l >(a> 8$ ЄȆ  w$ . !& . s&㿘'> 8Y > 8b8   ?! " ? c(`YN > wa. 0 0@Z    4` @f_ @~ @^*P''Ȃ`'@@~2^ @`& @^0ם㾐'''L  `@ ,Y4'찒 4!谒 > 8--ĒXސ 0`> 90 bl  `(@~X'\'`''`-''X@Z( l P`$  `@^S!''^'l@}і^ l @~Ɣl <`( 8@~  l@gؠ  '?''X''\V'` h 0` 0`  `l `(@~lL " L` , , `Y , , ` ,XR7?b 5> 8  2 y,  ? 4@'''''Ю`"' U  X]X6 ,U-,O,Xh{0v@el,s㿘> ca `> ]`L>`L$`0  `@  0 2> b" > > w a㿘   > 8> 8 b4 8ԑ 㿘`    -> 8b8yr7> 8W !> 8"<L"< 2 "<4$"<> 8b8 $"< " W> 8b<yN0> 8b4> c< @' ?6 . > 8     ```t 2"!& "`t`@&` > @̒ > #<@ ~> ށ` 2?`(``ꀤ &`d  `(``he`aa `l> 8 @(`@```ؠ  d&vT `t` " ˪``(`";`(`(`h65`( d d @@8   v) `t`  @Ք֠ ~ ``@y&`w #6"@6`t` @Ð+g0> 8b4> c<'  ?6 . > 8@`  P t ` ` &" H `! 6 H`5!N " t .> ށ  #uy  ` `@2`,` `,  ,u ",` uc ",`!0ـ/ ` b0"Pd  H8 d@&  u` F@ 0 䀢d0u-Ѱ㿘> 8 p4`?`@0`@(` ` v ~r z P`㿘> 8b4 ?0`@(` ``@e6 > ]`L(( @><`i `l> 8(`Ȃ@` w `h"`"`  @u @: c@`( `b2 ` @:`2L `2 ```?@"Z `@"`H`_@`f@2 `l` `Æ`$  `2 ` `2 $` ʄ@ ߂`$ , Z `2z `h$` ` $ , H    aP`|` @0 @:2`H`p@2` `l` `l`$  @" f@2s` `@ , j `e ` $   c@`85 `l`H@{`H0 `lb@`w@2( `l`|   & 2, !  ߰ `@ , ``H& ```&`| w`|q ``אް  c@`8` `@ , @`$ $  $  㿘 p> 84`?@`0`@(`  ` (    @ ( ``(``u  p> 8 t4`?!@0`@(` @`  ( >bܒ 㿘> 8b4 ?>`06 `. `> > 8bP> 8 `' ( ` "@   @( , "% ( |"! (`$aa@` p^!蚘 "  ( `6!舘 " ` > 8 l(`Ȃ@`  (`` @ ls   (   #@ Z ( (㿘> 8b4? 6 . @> 8 l`ȅ(D 㿘? 0`@ /> 8b4, @ O t &  X  A t Ѐ`> 8$ t`` ! "`$ t " t$ t  c$ $ % c$ $ $ $  t l> 8(` R$@㿘> 8b4 ?6 . t`R ` `I `A"#`Ho4H(@fH`" ta   A `= Hp@`"` ` "4h(`?`2`   `2  !`  `` ? `: 2 !ð (͂  ʂ ਃ0`Ƃ`` > 8R`b4 ?? 2 * !? > 8 b"`8"` 8b$"`8 `>  @ 2`*`* @ :3`Ѕ+  @:+`@C  B ) `2``   {    Ԃ 㿘#`>(`(<`   2`% `/" ?@{ߐ @ @@- ,<``1 3 9  (`<``ߤ? 5  (`8`.R    K@/퀠9, , Ђ@*``*`@  (`@"< @ۑ: 5`-`=`*@ 3`+ +`@ ` 0((@ @c@C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @@B>@ Ǡ 㿘  & & Ԁ`& ܂ & &!l&!$ !&!l& &!$"X &!l&!$㿐 H/9   (``" N? (`?N N N   +`(`(??(`(@ +`@  7/////2`*`: * @ 3`+ +`@ ` 0((@ @c@ C3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ 㿈`(耢 $ !8`& |0`@*C*@ 3`+ +`@ ` 0((@ @c@ C 3`+ +`@!䚃@C3`+ +`@@C3`+ +`@@9 C3`+ +` @`@&"&" "#>"@> =& > ސ \b@6 H@`AQ`V2   & & &!l&!$&  H!`S`? " &!$H!``W`?  &!l4$  & " `} & 0N"$H@@."$``(&(`> ސ \cX@   `2" !"X"  !,!t& &!, &!t  &!l& & &!$> ><> ސ \c@Ɣ > ސ \cH@ > ސ \c@ > ސ \c0@ |> ސ \c @ u" v'x H    `*K`,K@= x> @Kch 4 "V ( N Ђ`` @ @ ``G`2+`-`9 К@  Є(` .` @ @ `怣`xH`*`,(@,(@@ `, ٠  9 Ʉ@(Є ւ`@ސx   㿐 `܀ $& b` > 8bP/@'b> 8`ܐb`> 8b/@c 'b> 8`ܐ a'b'ba,`84`8`'a3`80'a+`<  , ( + @0` @(@b@,B*@ 2`*`, 2* c @3`* + @ B+` b 2`B*`@2* *@B 2`**` B @2* *@ B* 2`B *` * @@ c@2C*b** B@2* @c "'a?b'a`x"u> 8a!` 'aa'b (`(` (]'a\> 8b @ :X> 8'b > 8`ܐ㿘 . lݐ!`e!x K> & , ,`> c(> 8`̟㿘`l`Y S S  I"(> (`  (!> Ҕp> , ` ,  xX$$`N$  $$$$Ԑ> [@c`Aࠔ  $$$,$$$ > @ cx`3 @c`'0$&`> 8`Ȑ K< &`܁_>c ɸɸ㿘N`U"N ?`:N `.N `.       .. #>. . . . . `  2 (`= `ۀ`/ق `?@֒x  @@O  , = `1 3 9 ޠ N`4,<*@ 3`+ +`@ ` 0((@ @c@C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ ̢ 5 \` " \ !( \>9ct"X㿐N`D"N ?`: N `. N `.      . . . . . ..     H` `/ `9 HH`JIKN @) (`(?(`(@ @)  7///// 2`*`: * @ 3`+ +`@ ` 0((@ @c@ C3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ 㿈"耢 dq  H`@C` m `S`&!!8`& D0`**@ 3`8+`+  @0` ((@@ c@ C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @@`&!@&!D!H#>!H@&> P \`1& HJ` "J  &   \`"/!(!X` & \ & \`   & & \\Pd8 \ & \#F .(d d & \& d> ސ $c@; G"X!X㿈!T'   H  ``; QH``;(@*(@@  㿐 &`܀ aP` > 8aT/@'aT> 8`ܐ`> 8aT/@ 'aP> 8`ܐa$'aP'aTa ,`84`8`'a$3`80'a +`<  , ( + @0` @(@b@,B*@ 2`*`, 2* c @3`* + @ B+` b 2`B*`@2* *@B 2`**` B @2* *@ B* 2`B *` * @@ c@2C*a@** B@2* @c "'a?a@'a`x"v> 8a!` 'aa'aX(`(` (^'a]> 8aD@ :Y> 8'aX> 8`ܐ㿘 . l!(]G  H> & 0 0`> c4> 8`̟㿘`l`A Po ;  FŐ!`> 4`  4 > > 0 ` 0   $X$\]0$d  a⠔ <$$l> [@c]!h$P&`> 8`Ȑ H6 &`܁\>(a`2J`*`/(`9&  H` `/`94? H@`2? ) `   (;`() `Ё?2?㿘N `:"N ?`:. .  ?   ? ;  ?怢 < (`(` `"(( ( @  2*:*@ 3`+ +`@ ` 0((@ @c@ C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ 㿘N`+`- ? c ?* *  @(`" 2*:*@ 3`+ +`@ 0` ((@@ c@ 3`C +`+ @@3`C+`+ @@3`C+`+ @@3`C+` + @>@N`+ `>@ \` " \ !( \>9ct"XX 4> ޠcqÐ ?? T!@o!m S7 ? 퀤@   "(@&"///// 2`*`: * @ 3`+ +`@ ` 0((@ @c@ C3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @> @ d Ģ!n`'ĝ㿀" ے耢??''H`L"s!& D @ @ 8`0`**@ 3`+ +`@ ` 0((@ @c@ C 3`+ +`@!@C3`+ +`@@C3`+ +`@@9 C3`+ +` @@`&!@&!D!H#>!H@> P \`5& HH@`6`8 & 4 \ & \!X` & \$ `9  & & & \  \`2!X!( "X!X?2! d & \& d> ސ $c@ 㿀!T'   H  ` `  MH` ` (@*(@@  㿐`aP` "aTaT/@'aT> 8`ܐ` 'aP> 8`ܐN a$/@'aT'aPa ,`84`8`'a$3`80'a +`<  , ( + @0` @(@b@,B*@ 2`*`, 2* c @3`* + @ B+` b 2`B*`@2* *@B 2`**` B @2* *@ B* 2`B *` * @@ c@2C*a@** B@2* @c   > 8aD@ |> 8'a?a@'a`x"r> 8a!`$'a c'aX/`& g'aPa'aX(`(` (O'a㿘 . ls!(Y  E?> & 8 8`> c<> 8`̟㿘`l` A M# ;  Cy!`> <`  < > h> 8 ` 8   $X$\Y$d  a⠔ <$$l> [@cYՒh$P&`> 8`Ȑ D &`܁Yl>(cc@Hoe4(@ f`$? @(@    @8` ` 82 (@+(   `@" `"" " Hp@   " Ho4(@ f   `2 @ $:Hp@ a @  @ #`9  @@ ` @8@ 0݂#`ڈ @ք@ Hp@  @Hp@ * :`9 00` @ 9   ` @;`" (@ @((`` (@  (@*:` `*(( " (@(@ (* @ &> w耠"  `> w a`" ""8``8!"  > w a  "@ "   8``8" a"@ 㿘  "   @  C >  "&   8`2:@ C >& & 㿘 >A  &  & @& && & &  >8` 2 : A  & @& && & & 㿘Ho%4@(@f@`P"$`` (@`` ` `! 8 @ (@@+@` @``&`  &@Hp@ `> &`&` 8 @ (@)+@` @``&` &@`&` Hp@ #$ `&`&` Hp@?㿘Ho4(@ f`3@`" Hp@ 0$?`&` & ` & `  & ` & ` & `& &@&`&`&`&` &`&`Hp@ 㿘Ho(@fE6 0$@.$@  @ @  @ m  @  &  Y @    & &@֢@ & $@& & Hp@  Ho%4(@ f&?  )"  "( "  @8` ` 82a (@*( ` " " Hp@  " 㿘`$R HoeG(@`C> && & Hp@& ` @ @  m   @  & &@ڲ&@fv $B Ho%4(@ f@ 1`"`!   `$` !#@ 4  @" " "@ `" `" " Hp@ " "" Hp@ >`0`,` `  @iϞ@ ,` ` `@i@@ ,`$`   a@q@  @,H`    >%a?㿘``,``  @j`@iO? @j/ 㿘``,``  @j`@i#? @j 㿘,``  @j`?@hĖ @i > c@2"@2㿘 2   : V`" 4@ 4*V 㿘        V "V 4V V@怦2 4V`2 42 4 " 4㿘> c@```:`  4  `@8 ``2`㿘> c@   @:  `$``4@ 8`$  2 | 㿘> c@   @:  `(``4@ 8`(  2 |ٓ!㿘`7 + 3 "+ #"2 < ! !-`($     *( *R @2 4 0` 4 @ * [  @@0 `0 0㿘!> #@> 8> =0 > D`h  `@~$#@#@> ?> ;c|  `$#@``"`@``: ` ` 4@`8 ``2`> `  > cD> > b, @!> w (">z+b1> w>!cz%" {!{ 㿘Ho4> (@g> c@`> ``: ` ,` 4@`8 ,``2`> H` Hp@> 8 b@* @  * ? ? ` 2  ꀠ`"2 (0``* 2 쀠 㿘א?* *  @@0`0`> > a㰂#@`1 > #> :a !# > > w c    `(`0`0`  @@*0쀣`    *`*` @@``) (``?> 㔀`> w \`@*`*` @@`(`2 ```) 0@耢`䀠@ :䀢 "`2` #@`҃*` 㔇) `?*`*` `0 ` ` "  T` 2 ` X(`(` 0" T % `*" `$   8 "@ `!   @" `5 ` @`2 `  @ ڒ   @   @    @ " ! 8 8` @ @ :"  "@" `  "@`   @`" " ` `` \@"  @   @     @ `"  ` \@"    !  @ L @ 㿘> ߒ@ (V  > > ߐ 8@X > ߟ@   > ߟ@  > ߔ @@! `2  (`2 @ L> ߟ@" X P> ߟ@# T> ߟ@#H D H> ߟ@#` ` \> ߟ@#  > ߟ@!(  > ߟ@!h $ &> ߟ@! :> > ߐ!П@ , 0> ߟ@"@ 4 8> ߟ@"p < 8> ߟ@" ;> ߟ@" 㿘``?  6 `c` ,6 h & @   ` @& > > > ߐ c%#㿘 2 0$>  \@  @ L@즒   ```   @ @엔  2  @쎔 #㿘'H`.&(> H  H0 H @ h$'H&> s `> n @k (> h "" "  @ " 2   `( ` ` ` ` ` ` ` ` `$ * <㿘 \"   ` ` ` \ & L6 ` D`>  @ L@ H & L6   X @(`(` ( > "0 ! x㿘V > (`H@`0` ``"> !d@ 㿘 Ho&(@ Hp@g 0㿘Ho&(@gHp@㿘`2`$ ` `"& \@2&G` `  gU@ `  @& `2 &㿘Ho&4 (@g > @ !d` .`> H@`0`Hp@  @2 "" "  " 2   `( ` ` ` ` ` ` ` ` `$ * <㿘?[Ho$;(@Ӓ > C `, , > &@@ b0(`"ǐ && @Hp@  @ &@& 6 ( @@`$& X& L& T& D& H& `& \gĀHp@  n  >  Hp@㿘Ho&4 (@g > @ !dm` .`> H@`0`Hp@  2 "" 2 " 㿘   @    :   $@  ` "2LT $V   2]  @$  & C  @@$"6 @ @eɔ $Ho&4 \(@g \ $\$ \\$` `` @4Hp@ @$$ $$ $o    @@$f@`$ $k & G 0㿐`'H` H '􀦠bH H  `b&` KH `@@ @&`eV $Ho&4 \(@g \ &`\`$ \`\&`` `` @6`Hp@B` H@ 'H @B& @B$D LT $@ @"  7 &` (pa&` &`  H 8&`  H`d@ †` H@ 'H @> !0'H 0`l` > !>  >  >` 㿘` "L  @ @ ` @ @ @`"@ <@`" 4 `  @$`  @$ ` @$`b  '` `&  @$ ` ` @&` `2 `2@ &@ ڐ .>` 㿘`@> @4V   @& &  `5 @&  ) `"? 6 c6 d6 , & 6 2@&& & @&!H 㿘   @Ô > a> > #>9a 㿘> 1> 'b0#> 8e\"b\֖ <"Ð`Ā@"1> !d㿐> 8b@@@!>    !d!#\> a!d#> .c> 'b!d> wc> b 0> '> 'a2     #\ `   > >Ð#sb`> j!h㿘 e  @  *` $@&@T`X h @ ``  @*$@$ ` 4@* $8`@ cϔ@@ "#T` @`` $($&8$`   ` 4%   $@$ ֐$`  `2$@ 7 ܰ 7 7 㿘;`=>  0>  @: &@ '>  @&@` 2  >    @8 @  &!> !> !!㿐('    `$ H$  '> `   ? (` @@$@$  @$  &@`$ؤ@ @$ $@  ( ` բ(b&@? 㿘 `1`E! @@A` @G&@ @``  @ bŔ` &@$`  @`h&  @& >` @0``S $@%  @ @  @ L@@@ @&@ʰ`  @@$ V   @   .  `$` `? 4` c`4` b , & 6 `2 `@$`2 `"$@Ԑ ͐ E``2 0㿘`G ``^> T`? [`(   '  `M`  `@$ |$ ``$@Hof*(@"Hp@ ` @`@ $`b    $`$`,4 $` x `@a $``@` $`4`$``$`\gHp@ <"Y "@"  `@2  @ "  @ 20 @  2 "  @㿘  " 6  o6&   26 㿘 @@2 ?"6 o    6 & 㿘` `4ޒ o " 2 2 㿘     af 㿘``!   "$ @6 @`ޒ  2 "&   @6 @`  㿘 'HH      \@ H@ `?@< @8C@`2|V V j  @   `ss& `2H & &'H ``H& @8  @ C F&@>T  7 `  ``]`+ &` `H`@  @`& `  ^` @&`  `&@&'HL      ܰ i` ") `H`@C@  @*@@"@  H`\@ @& s'H͐ϐ @    @&  `a`> "x㿘Ho 4 (@a ` 9`  % >`0    Hp@ `""  ` " " $`" $"  4`(" L` ` 2 8`  ,`" 0 ?@2 8 "    4`(P2" P2@ 㿘 < @ T= 㿘> 7cP>  @bܒc >`0    㿘> 7cP>  @bƒcp p` ~&`P6`6 & L    ` V 2`" 8@`㿐> 7cP' L>  @bc8`   0 " Ȑ +@`6 48` 2h`hl` hpq `   8``<  `"* X@  > > >  b˔$倈   (> @ B   2 (      ! 4H`  $@* ր @6 '  M G  @$@  @   @$$` @-%  ߀$`  $P``"  @$$`"L $$%$    `    H 4 $$H/(  ^5`@ `2(2%`" "  (6  `    ' e ` `@4Ӧ a܀2D̀ Ҕ B `    ' KX%@ > >  b$㿘 a PP @`㿘 aF @  ` @ 㿐 ` @V + `R - N 9`|Q  >`L  `H>`0`@B 7 `5(`6 ``>`6`Ho`4 L(@a L`";`P Hp@``)6` `6  ` >`0 ` a% #  e6 @E` 2 0`e6` `2Ǡ `  ";` +@- "`Ǡ `"+`ʠ #@ Ho 4 L(@a L`j Hp@  `6  eC6 06 `"` -`" 9> `& L&`P& X & \& h & l p>l~a`e  i `a6 b6`& l& h㿘'P?c@ ` `` @P"#1"h@ *Q*>`0`9 "  `( @ '4  1!"@ |#4Ӱ *հ  ` !?cÂ"4  ` `` @P#2 *@` 2 *`" *`" *" *``oP  `@` "k U2  `2r  @   j 7@ p 2e 7$ ̂(@4 2Z * ? `(U `8'@  ;  E 2> *N">  `28 `Pc4/ >6   ߰ 2d  \$  ȀU$ ؀` 2  @ ` 2  7 @  2 7D$ B4 `  @6 `L A6 Ho(@g@  `=6        ???????%4%%%% %%%%% %$%(%,`%0 & 6 Hp@` ` ```@@ ΐ@ M0 c6  㿘` `` `  >`0`    㿘> 7cP > @^Mc `" ` `@ S  P f@  L`` @ | ]1> #㿐> #\#> !c   `4R``( `#> 8> 8cd"`8> 8c"`8Ho4 ,(@g ,"` 4! ,`1 4Hp@ ct"`8㿘 L` - P`Ho )(@ >`0     `"- `(> 8@4> 8c@&6 4Hp@a >`0     `6  4`(````! 4" `" `8 ?@2 `8 " ` 2 ,`  `  ,`" ` 0    㿘Ho (@a  `  Hp@㿘>`0`ic`_T@ )?Ho (@a > ݐ#  2" " " " $ 6 2` 4 ``$!`  @$!`` $! ``$!`4$ $!@ 2  Hp@&@`4 Hp@ +㿘?c@ `  *`` @    " p4 "kV >"fV _"aV  *!&?"   #> '&` b`@ܐ$b@ƾ> '`[b$ &Ð Yk"L V @&*@%ń "   `  V  `&"' &     @&V ` &   ؐ @z& Ȑ @u&  @p&  8 6 8i& `e *`a]``YPP#lHo 4 (@a &` ` X8@Hp@ 7& P`"  L. -GV  `2 >  9  &` X  &㿘Ho (@a L <6 8 Hp@㿀'H'X` 'H 2'X  a2d& d2 '' ' `"` # 6 Ho`4 L(@a L `ע  " 8`>  8`"m `@`  @> ` ``T``"R H`  g H @'` `(8`ր8 "`a2b2`" ``` `O 2`` `" ` >`0  @ @C2X`X@@  `2  `6  `6 Hp@0``"``2{@`2T` 2 ` 2ߪ 9`! ؀!hԪ # `;6 @ Hp@ ", 00`"# >``0`     2~` ''(8``I 䀠q(`0``>   H6 D ?` @耠`=$&` "Y`} H`  @`& H5`` `"5` `(8``2䀠2+`   H6 à23`!ł$Hp@`N2'Ho`(@a$` ``2"O @ `π` ` ʀ`ǀ` 8`À` ` `@ 2'  ` `    ` ` $` $`  @ & r& @y'쀤`2` ` 6 Hp@ ` @& T```"  ` @&  & ```L & 耠`" @@& $@ 2L> ' " 1/& *26 :1 * @"* 8&`"` `" 8 ͐ `>`0`   " # `  } '@`"  ` `'.`(8`8`  ` @& T```"  ` @&  & ``"@`L & @& $`$@ `` "' `\'`2  '` `Tk`` @& T```"  ` @&  & ``2`LH`p @@& $@ '@ Y0S2@q` &  ]6 0 `  `6 Hp@( 0>& & ;& 6 ]08  @ L`&퀥`& Ӑ# 6 ]0#& `"a& `` Đ#X&  `@6 > >  b0"us6 8> #Hn #& A& > >  bh#q㿀 'P` 'H@    U``` P   {` `.  `   ` ``'耠`@?`''''P'` ``b #PԲ 55Ho 4(@az8 ~2) ` " H2!Ԁ`2ԃHp@ 9(@5`5\5P`F @#@4쀠2$"  Hp@հ (%  `@ @<`9 @ ̀ ǀHp@!P`|  ͒  쀤~g  V( `xP`Ӏ ($@K\$ %@P @ `C 耠`P`0``5Ho (@ag P`H>`0`Hp@` 5 'P  `8 ` C `ƀŀ`P` 쯒 " "  g4$@P`  @$  `ɀX ` Pq -?5; ؀@2d`Z5@?5Hp@ "iP8o @} "^PO8`> b,( @ )$ `q` `l`g` Hp@ 'Hp@ 58Hp@5[0Hp@ #㿘Ho (@a >`0`   Hp@㿘 ` -Ho (@ ` `  8Hp@a `  >Ő 2 8 >`0   0ޝ㿘Ho 4 (@a `h2   `   5>`0`   Hp@ > #㿘Ho`4 (@a `2O  `7  `"Y `b `"  a(>  6c'> '(0` TV !\ "  `> `0    " `7`86 Hp@@    "  @   >`0    Р  2  > # 4`(Ho4 (@g 쀠2  @2  ?"  쀠`"  Hp@1 Hp@!  4`(Ho4 (@g 2  @2  ?"  `"  Hp@1 Hp@!  `2 `   "0   202 ( , , ,? @" (" " ,"  00!  (`> 8c@0 (`@*`"  @    㿘> b0`P`L. .  d@$@ %'> w!> !d P d* * @ @ L@ '> w.  d@ !> !d P d* * @~ L@ $XX$X㿘 Ȱ 7 㿘 "(& $&   @&P` `"    @&  & `L &  2  `"& $& 㿘``h >  # u  `(    ( `  Q& `$ $ $r 㿘    `$ L  8V  @&R ``"   @&  &  ` L & H&@` " &  `2+& R ``"   @&  &  ` L & ) 2 &  "& $`"& $">  "  2& $&  @" "  &R ``"   @& ې 㿘 k> ` @`    ! 4D ? #@`I  @&P``"!  @& !& `"L& `2 @&P``"!  @& !& `2L $`"&  `& & $   #@&  $`2 `& Նh 㿘``$&` 2 &``&`(`6 2`(&`, @`  0 &``&`(`6 0`(&`, @` > = 㿘 4`" >  `2`26>  `2+>  ` >  ` $` > > >  `0PZ#:>  `0T#C> >  `0M#B> >  `0F#A> >  `0?#@> >  `0p8#?㿘& & 㿘 ް 7  `ْ  7`$`̀`$` $``؀`2`Ȃ($``Ȁ@ $`؁㿘`J `` ` @`"f $@`mP`V`"] $" & `2&"0&& ` @&V```"  ` @&  a& ```L& `@&@6``2``"91> @68&VV`2& `` O @ `  @& ` &V`` `  ` @& @"@j˲& & $P`y `N   P`5`"- @"R``"   @"  a" `2$L""" $!` "`2``2`F@̈́2P" "2!" $`4 @"R``"   @"  a" `2L $`""  `" $` "`2``2`@"  $`2 `" 㿘  $   & $> > >  `0"2` $20` `2Ξ@@>؁b" $㿘V`(`4` 6`4b2D<@B VL6`4㿘>  4a  4` `@6 4@? aW` " 4` 6 4 4 6``@> @?2 4 a(>1b` ` 2 @ `2 @㿘  6h0V 6 㿘  6`8U6 㿘> 7cP>  @PԒa@!> "0 P d(`(`"@Ð" L@(U4 U0U2) @S />  {㴰 "L @ 6< 66 & 6 6& <&!&!&!&! &!> @6 6  /& ̠@ & 6 & & 6 \ >`0`     `U6 @6 |. 㿘  {``6 k Um 6`S# X`6Tד 㿘@ `v>    @   ! 4X@   a  @`$` @L "$C$@  @&P``"!  @& !& `"L& `2 @&P``"!  @& !& `" $L&  $`"&  `& & $ @ 0 ۆ!0  "㿐` '`Kd   `82 ,KX `2`>  aP㿘 @`@ ``  @-    ` )m `0㿘P R ` && `"  㿘` g`@   堒  .( `䫰 7 $ J $@ (@䙐㿐 @ ( d  9 ` W` JǤ    ` Om  `    ``>)0㿐 @u "` J  `" ` `(1  `    ``ܰހ`㿈 @'7 7` `5`JQ  "``(`̖ ` `쀢" `" ` 'J8` "` `  'J 㿐 @ -`h  ` `  䜒 ``   7`  I`  `$ ``(`G ` j   ( `݀  7f ` 㿐 @ ``( ` >` ''  ''''''''؀```  '؂@`'؈   `82 , 􀠠`(#\ `؀@ #` `ؐ c؂$'`% "' '耢 IP O `8 ,`耦 &I<  ; `' `"!쀦`n ` @` &`I @`$@I$&`0@8`0 H8`@C9 H  `  "쀢 |m`2^ ̒ ,  xȔJR$  J j}`"`2` $ B  `> waPup` H  ```` `@'? ''''ԁ'؝8`ܔ H 耢 (1`'@'Ö "` *Hf @' ꀤ`'HY *  `'̦h ' O  '''''''؀`'`2  ',؂`('؈ @`  ``8"`,`2 `> ǒaP`"'  `  qԖ  ``8 `,`$`(ؔȖ Ś $؀@?  # 0ƀ "#  ,  PȔH$' 8 @9 8P8`@C:P  ڐ2Ӏ :g ̀8`ܔ G 耢 (`@''- *Gd `*  p````` @''؂ ''''''ԁ㿈 `, v M ! 0` 0 > 8`@ `@`2  `(, , ` && BS x@`` 찒 "@``谒  쀢 b]`, +  耢 J ' 0`> 80` @ ` `(  C0`0  ` `('ఒ +``!` F   , , `( , , ` y谒 "` ːv'Đo'0㿐 @9 ``( ` ֒㿐 @! "``,   `82 ,`('߿ ` `2``> ܒaP㿈`` `F   C`@ ;Ho4  ((@a ( `  2(T 2>  6a`T 2`0 8(`2*4 8 ` "!P "T 2Hp@ `$ Q`2 8 @? 5 5 @4 84 80(`24 8   a`` ,` , J ْ  0  `0> 8@ `  `($ Ғ 2``` ` ,`o` ,0, , ` &&  6N6 0x> ސ!h㿐 @' ( aa* % `  8(4 80`Hp@ 4  `3  ?ީ?" ``  2 ``8`,` 2  a( ` ހ $q``> aPdHo`4 > (@a (>  6ap(0!`  8`(O " 0t,h@l,@㿘 /?c"& P`2 ` (@2`20`$  `$@2   ۄ > >`ؒb   , R `" ,> ` `" ,  ` >  >ԁc` 㿘+> `x`'> Ȃ #> %`x H$` ,$ , 2 ,Ȁ => 8>c0$ ,`$` ,T $ , ",` ,2 "2 "T $ , (" @2 `"P  2 ,``2> bĒ &*  Ȁ? ? 2 ,`2 #@ ``  ? R `  ( ";<    &%`x㿐 ````?c"@  @2 +> `> 'b0`@   ,  `    D: (ݖ  `e  D-  |$  ߔ  $@V& @`   @"G@"CP `"CDo ` ` `1%` D]O' נ? `DH  `  `%`0q @ 70l i  㿐 >@`0``0 0`8E`-  } `` `B w "9`@ 'R `` ( 4` ``@Bu` 뀥`  , `'$]4`Đ , `ܐ ,  ( `Ԑ , 7  `@(` 2`C     ,`ò?<`/ (` ,` , "Ҳ  ,C( '@&   >  '` ``#`C '@&   `P@``"  `@ x@㿘 -& R```r$ n @`"> `"> @2  &  2  $  ~!x㿘4 8 ` $  n 㿘VV@ @ )` R```> V!    P` `# /` `iu`j  @ h  D '܂?'''''@ `4` &@(7 ` @? `|` =TT@ ) ` 8``ް = ٰ =`   沖 Ô&  ` & @& $@4& ` & (  % $`% $(% % (c* 㿘 `" `|@) &  `"   9 6  | `ک > ` Q ́M  `@` ``h8  `4 / ` @< h/ ݢ   j`A$  `(@ ?''''''@[ Ā @?Ȁ@'u@))X 0 R@)0H@t 'H(Ȃ8a'L@>ذ $" |$` ` $ @$$@4$@?$(㿘 Ȁ` ` !> 8> 8c#  <    7 "$  껐 4> 8> 8c 㿘` ( @ ` `2 &``.`> ڐ!>`  - ːƐ - `"  ݀`  倧 x ހ V```> !  (`8```> ! 5   &HV`j`"i ?& 2 4> |$ ` | 4 &0 8&40> >( & `"L& ` &   A `  `"?& ``";& ` &   `@  `"``2`  > 8& c @{ p l 8ho d ƒ^XRP  ?@&H C  0  @ $ 0 , @  $ ,1 > !˒ *X `"7   ` `"  "L   8`     > 8c`I D 7) @ Ϣ@ &`'8`,`  0`! &   , 0` Ȃ  &  o `,@ @ 2  9 `ﵔ 2ܸ  ` U  㿐> !%> `H#\> !hp> " > "H (> "h㿘> 7cP > @C ` `9  0` 8 > >  b ` 8 C?89 `b9   $? $ $ @& & $> b> 88@c:  $?"   $ @& & $> `    @" > "> `> 㿘 0`3> Hod (@ 0a > b I  0aHp@ 0b  0 }& 0e0 0d  4" 0> >  b$Ho4?Ȃ(@e?Ȑ d@<H  0h@? Hp@㿘> 7cP>  @BQ` 0` >  0` 0$ 0@X~"㿘> 7cP>  @B5` 0` >  0` 0`$ 0@<b# 0`" 0@=h@㿐> c@#> ' ` '> '` 8`@D @! d$> ,`4` b  0(( @ @@ d> a4*`*` d@8> d  d #> ``> &fa$`> a@Ґ`*$``?#\   !> $`!@ > x_c@!@xX `> ``` ` ` @ `> < 0`@8`(`4  @> 8`  @> $ a@> $> b 㿘> 7cP > @A` t` 8`M>  0`D!P c!> # !Pc!> # `0>     ? @& & > `> a8@  8`@ 9  8> 8@!`#a8#a8@ ) 1> u!@> #`~#> >  bH 㿘Ho$4 H(@e H` 8`>  0 0h& 0 0hY `> a(`@ 0`"  0& 0 @ d@Ɛ H`&  8> b> ``8 > "8 @ 8` ;` > `&  $ & $ 0?c& 0@ &> `C 0@FHp@ 0`H >  8> b> ``8 > "8 @ 8` ^;`!"> ` 0`2F@& `> & $` 0#` 0a,& (?c& 0@> `E  0@ 0(& 0EHp@  ` 8 > b`> 8 C 9 ` 8`@9  0`"& @`&& @ $#@& $> 0`{& (n> k!"2> 8!">  t`2M 8 0@0u ^  #`> >  bH~" 0(& 0EG @  d0㿘> 7cP>  @@` 0aZ>  0 pa$ 0 " ) `> a$`@ 01 @5> ``  0 0  0@2) ( @9  0`@ 0` 0@($ 0D 0 $ 0 0 ($ 0@> @9 (}#㿘 0` 0`& 0Ho$((@@Hp@>`0`ഄ F> ]`H ((> \ aT 0$ 0 0a$ 0Re0`㿘 L``8@$`<`0d"0l 0C M `0`"`0@($`0Dm㿘Hod> (@e> > 6 5 89 ) @  %> '/> $%@> & a@{> `&> -> b%> ``@7  @ d@ِw  `8`""` `8`$"S`> D"`8`)"#` Hp@` @`8``8`> `@0Հ@1> > ""` &"E7 `8`` @"Hp@@> 㿘/> 8 `` 'D-> '> b #> 8Hod (@e O> `> ``8 &` "`> C"`> a8 > > a```-> '(@> 0`88`B4  @8``  t < @+ d@   ````%> r@ f!P> c!$ 0$ a,$ (?$ <@$ DD` 2@< < D@D@`d  > 8##$   > `!#@8` $ Hp@@}> `> b8 4z> s> t> 0ncĀ`|P$c` D 8`> > `  DE Hp@ 8t n84@8`^> M> > %> `8`4 `2B> ?> ` @ d@e`8`)> `@8`#> > 8 0$ h$ $ 0u > 8> b@*@@Hp@q<Hp@ !> !c!@$cD> { 㿘    " >  `( dH)@ 0h9 > Hp@ =Ho$4?Ȃ(@e?Ȓ@  0` 0@& 0CHp@ ݰ   @@9 @ 0` & 0@SHp@㿘   0a#  4`" | P  2  x@: x@:  4`2 P |` 0 > @ @" 0 ( 8`C @9 (@79 8>`0`ఄ ఝ㿘`\ $`  " " ۑ.@ 㿘 'ȑ㿈 > 'b(F` @7` i`耠' a@@ *    S V;@. N? >@ $?,  0h 0& @2`>  @2i>  0 `D: " 0" L> > b "  ( 8`C @9 (@7?9 8>`0`ఄ ?.$0< >  ` (8@`>(C >8<`0 t@"0@ @ 9  x#`8#`< `H< ! t@ 8`x`@@ܠ @" > > >  b0z;""쀠X > >  bPz."#㿘> '> c4 ?> a"!>  H$!8$!8$!8A $!8㿘 d4`"Z|P 0@ `2 >  $`@U`"I p @9 > `` `0`C @8` 8`0 0 0?ނb& 0Ho$(@e">`0`ഄ  p` pHp@ 0@& 0@6x `|@C `@9 p 0`g 㿈>`0`> (@e> > Τ`> '> b> > 7> /> a )8`~ Ai  8`"ѐ@6Hp@ 0he 0`"s>  `5 0@1``- @ ' 0@$ 0Hod4`(@e`  8`8C <` 8@ <$ `$ $` @%`xॐ  @0` Hod(@e"8`@ ;Hod4(@ex@ h0~x `Ho(@e 0 `" 0Hp@㿘 H`t t`y> HoM(@ x& t& x& |>  8a88 R>  ` ,@D@ې ",> 0`2G> @_ 0 @=  8`8@D 8`4,@ @Hp@,@D@ֲ 20> > >  `xv!Be>  x& t& x& |a 888 > Ӏ>  > >  `xW!C> > >  `xO!7> >  `xH!8㿘 8@ H@@Ti"@& 8㿘 0`>>  H`A> Ho$((@ P"- T T T T? @& P& T> ``p@8`p H 8& H@TB 0> mU!@Hp@e P2 T T> bH P> >  `0w!>  `Pw!㿘> 7cP > @9^b@ H` >  P"i T T T T? @& P& T> ``p@8`p`H@8`H 0 )& 0> "Lb, P> )> "D > !> "0ah#> "0b(`$"0$b( ? "D "0k>  8`8@`"& H '>B x, t@C @Ò ) 8` ,@` 8 8@@8 x& H> ``H@8`H 0 )& 0> bH P``p@8`p@!"L> > >  `w` 㿐> B> bDbD> ` #\5>  &L#`L ?@v? L6 > `  > 8`h8`p> 1> !","4 bP@} > v!x㿘 0`> Ho$(@e 0`& 03Hp@> >  `0w Q㿘> a @(@@J>  t`M>  H`O> Hod$(@> b D)8b !> "P@-  > ``"P4@@C 8`& 8& t> xHp@e> b D8b > !> > > >  `v!%> >  `v!>  `v! `v!㿘Hod4 H(@e H  & H 0`P>  8@R t`  J 0`#& H 0> & 0 0> @& 0bDbD.& P> bD P T#bD& T p@9 pHp@  P) T> TbD T @?& P& T>  p@9 p 0@& 0bD& P P#  H@9 HHp@ > bD#  P㿘 0`I>  H9Ho$)(@> ``H> @;`H& PbD`> & T` P!`p0 `@;`p 0 0?c& 0Hp@e H? <"00 0 > > >  `u > >  `u `"0`2, -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ʒ `"`"7 ` ; `!  !   `*#` @"@  ! #``  ``2"``@"#`#`  "!  !   ! "! #```  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`U`2^``2"`""`@"-"`@",`` ` ` ` `""@"  `` ` `  ``2` @"`` ` ` ` `ْ"```"`""`@""`"``  2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿐> cc> ` > 7c( #\> > "XbH X  k 㿘> 8cȀ"&@ `> `(  "` `, L"`8` `2`(> c `H@8`H&@??K@b> c `@@8`@J`8 @ *`9&@ "1<&&@ > r"P> r"x㿘 0`"U "`    ? @&& > 。  (    Ē ( `  0" 4L > hU"X '@4`2> N 84 N :`.2  N 9`.">  " $! $ $? @& & $"   ? @& & >  > c> c   㿘!> # "!>  (`"`P@ 2 (!> #  (`" `P@   2 (i#e#㿘 " \  > R > ` `& L  & LJ 8J`8" 9">`Ȓ`9㿘     "   㿘  Ր &   8> c<' >`0`&@> 8cȀ"`ĕ(`/ԕ:0"ՒՐ >  0 " 4 L> c `@8`٤?    ? " "> c`" ` ` 0 Lm @.V@& @ 0>  `@2  L @.Ɣ (& Lx> @> c `@8` `@?0 @."@&> c `@8`@.  ?(&`A > c `@8`      ? " " > c`" ` s ` @I  `@" L @-@&> c `(?@8`()S&?(N&> c `@C8`c  @8c >&@> C"@Ð{ L> c ` ?@/8` @0+㿘  $ + `"   `2 &`&`&` &` && & 7 &`&`&`&`$, 㿘> 8cȀ2`.%> '> '䀠> c &> #>  g,bX" 0  L" 4 L(&`,&`(.`8:/>`9 `0   fbXc > p"3> c`&@&`  `$ >  4`"N`8#䀠> c r@ ѐ 4  N`:`. &` &`$ ` > $ > &`&` @ > #`` !# > N`9`.2 #㿘` `` + @ - ; "  " ` <`.`D X`, @$  @ $ 㿘 P`8 \ `=> `D B ` a  0`梄```2ᢄ```{ E  0`VioŐ"㿀   '&`&` &`&`&` &`&`` "  <``E n@ <@P@a`8?&'`D <@>@  @,P ? " @&` >`%>` >````` @D '<@tK@#\#`[  <<@b耢@  @, " &`  >`>`>`>`O>` >` <` < @ <@  @2@`< @ <@2>``E 2#\@2#\쀤$#\ܔ  (`@, ")`` 8 +` <#\#`2j0Ɩ #\#` ۚ`&` E `>`  : +>` >` "   `"  8@ `2 @     P`` > 8 c 8   @`@" "  ?`2  㿘 @d" >  d#>b㿘 >`0W` 4`"? | 8h*a.a& 8 h " ~ |@     | @2 4 42"@ 8 h 2 | ~& 8@ b& 8  >  6y " 8  @ 2 8@'a  8> n("㿐$   > > #c > 7c(fu#\@> 8c> 8 c  @ `@ $8$㿘 $2,0  00  @? ,4< 0 $,0& ( @? , 04+  $2,㿘' `Q` `  & D'2  "  `  7)#@4   I@ 0@ O@ }}= 8 ‚ & @  ̀2   ր@ ӀրҰ   @   2  ( рʀ   @ >B     "@ > m5#(逢@ > •%   # > † 02 Ԁ0ŀ08t2 Ȁ2ހ >  㿐 '@ `V `    2T  㿘   6`6` >@   @ ` >` 8&` 2 &`&` 6` 㿘 4B 1> " bA `㿘8 ` ` > !  `c' " 4  > 9`( 0> 9`㿘 `@ "  `"#  4Ւ * @`&` @< ` $& C?$ ,> $ $$ (@ 2 `&` @> `2 4 &` C?& > 㿐 @ '>a } Q  , `   @8`  @8` ' ` e А  @"    `    @:  㿐V  `)> 9;> 9`   ,( "W' m @"`@  ` X t@@  `@  @`  " (V %  (& & ,& 0 @$ (`3    , 0 0 0 @& ?& ,& 0  (J6 6 > a  Ƙ    * @ɠ #0` @& V `j 1  0`"  @&   @9 o0V `":Q  $ 2 ,:` 0 0 @ (" " 0" , @ ,$ +& ( , 0 (Q V I  "7 @ 0c& !  @8`'4 `2 $-`  @ '& [ }` Q `21   ʐ @ & @8`< 0%㿘W`>`0`B\=@ ;?` ?@@41 Q@`Q `` >` M `@> > & & `& 6 & $ $6& (? & 8  & "@ C` @4& 8ސ``Ē 4ϐ8ݴ   7`㿐> 7c(> #\ `>  @c@  bΘ 㿘@,&@'`H`us@%  "@`4`"%`? 6 /`@`T?@M&@@& `@"> j(# P`$ݰ @ ؐ@@ Аˀ 2`P`$  `@ʰ 0"P`$@& > i#H> i#`> i#㿈 , (8  0` `'耠: (`5 b& & '@+@& ,@&` & @  & #& H`/? ,c @& ,H` `?@& , @@`& ,?c @& ,@(? @`\@"& `8`a?`P@ `@ >@& @`\@"& `8` ,a"'?c @& & ,& @$ 2  D ,?c @& ,   & D @& & I2 @& , `4```| a@ W`4` ,```@@2  @2 @2f   @& < <& DI`"f& @`/bH`G`/ & @`\ ?@ "& H`/" , @#& & & ,H`V`@?߂c @ @`W& ,I `.T?I`.P?@P& , @% ` @28 @ ,& 2 & & @ ,@"   (`쀡  @2~& 耠`v ,`"J 2@@c @& ,] ," ˲    @@P@` '@ & H`/"  & < @& `4`q H`2& D  2 ,耠`e  , & @& ,@6_&  @% 0Y`J?R ,L 쀠`3   P`$2- B @& 0>@$    @   ,@耠` `P`$ 耠`q  P`$l    @ & & @ @& ,> h#p 0 (`{& 4y>  (%>  ,`dW `"\ 8$%  `2D 8 `"?  0 `8O ,V , 8 @@8& $H`/ !`/ @(H& $ `& J@`/"  "4 U 2R  8 > ]># 8> ]8#& )>  ^(# `& 8 8$$  8 0`,> g#  ,@G 8 > `/@ P`z> & <&  2o 8 ,s`@@"G  $n& $ `:]  0  4' $'''''''''@#Œ ^ࠤd  cb( 8 % 8\ʐ& 8  @@ N&  8J@`/ @  @ 8 8(@ @#Ք $!& (V 8> `\W& `2b 8 ( 4`2] 8@ΐ 8@ʐ 8 8> \#0[ \#0WS& , >)>  8\#@  @  H&  )> \v# 8  ?> f#fސ#`"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@M` 2V``2   "`""@@") "` @"(@@9`9 `""@" @` ` ` ``2`@"@@9`9 `ݒ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2 ` ?   @8 00㿘     "ڐ  㿘  Ȑ &  㿘  $ + `"  `2 &`&`&@ &` &&& Z &`&`&@&` $O  @ > a$a$ "  "  @2 2㿐 > ]`H%> w`& (`& ``` 4``> $'?c('$`@ `'  4`& ???" `"" " D" H" @" <" 8" 4" 0" ," L" (" " " " " : P:  P` ` \ ` ` ` @?" `" \` " P``" \` \ `"``" ` D`  H <` T" X X X X T @?" T" X> ," X @  H" H" H> a T㿘  P@\@    P@"\ 2P㿈>'''`۔@ . : > @`?(`2| " | @24@ 2"  |` `8h@ | 24`42`"  㿘 $  (`@``" `@ " $ ` $ 2`"  -> aĒ 4`    㿘`  `@i 0@x0p> P> H> `& l&> @& h > X!\ Z  Z!WtaD!T l㿈 $  " > >  ƀP    > ƀ  4 @ H 8 P;`#\> ƀ! X ` h#\> ƀ!H    > ƀ!p p > ƀ! x > ƀ!Ȓ  !> ƀ!> ƀ"  % > > b0(> *`ƀ \ "'> @ " \ \`< @ ƀ \ '> ƀЀ`'> ƀ"8  > *> `P> bHƀ \  \` @p ƀ \ 2 \ƀЁƀ \ƀ \㿀 D 0    , 4#\> b#h#`#d#l> ƀ"X L 8 < @ ( H  > #\#`#dƀ#X    > ƀ#`@㿐 > 〢c*> 9a@ 4> 〣 c+ > 9ad@ P |> #\ƀ#  < @ H p> ƀ (`(> ƀ h h "> >  xƀ  > ƀ  l >  xƀ  㿘%> 8 % `  @ 2  `  $@`  `&` `2`> 8 c܁  㿘 `'> 8cc  "  @d    > 8#܀4!#$ `(` @> `f > 8㿘> 7cP >  @"bP !Pc!     @& ?&  0`2 D D h@`& @  $@& ` l 4``" |> 9a@ W@ l`2@ t$ D x x x? @$ t$ x> 9aȅ08`> 9a@ ޒ㿘> 7cP>  @"b``> &` 4`?&`D h`&` h` & h h&` |` &`D` 㿘 H& D`& H <` T" X X X X T @?& T& X> & X @ > a0 T> `{ 㿘> 7cP > @"3bx (!P c!     @& ?& D"& l`"t&   Dx! xx? @ t x& > `D 㿘 < >  4`& <`5!> `2! 㿘> 7cP>  @!b`  p p`  D`(R$ D " p㿘`5> Ho$(@ >  ֔8 l`Hp@ @ 2Ho$(@ p`>  l`_!HHp@> ` a8%@Ho$4 h(@e h/` `$V``&0`/fː0``80h&03倦` h2 l M`2  2ր`Ȁ $ `  0@&0' " hHp@Hp@@|0Hp@ e >  +8 l`W0red pဠ> _I!`㿘> 7cP > @!b   p & p D`& D& p> _)!x㿘> 7cP >  @ b`  0 a"`pB     @?!P& c!& `&`p`     @` - > `$ > 9>*b(!\㿘>`0`> b @  "c> b'  @a+> 8c @  0 0@`f?" Hod(@e`ŐHp@F   ܀  c > ]Ő!]0 㿘`` @  @.!`@ @ 2 @7 !`` 2`(@`  䀎`I @ !( 2(`   @a 2`.@`  㿘>  a    @ߒ & ``% 㿘 ` @  1Ͱ 㿘\`{`89 d <`: 8@ 1  \X`l 2&\ `@4,`d.  $ , `3>  @ @"  1 1 $`0`4 P $`4 \`/ 2d @4, c@2װ 7԰ 7@2 `"$`@, @`2  7 $b &`0`4͔ P &`4 $b$ $ 㿘 d  $a& $7 $|& $㿐`-\" > 8c2 -2 #\`, `` `> 8 -cܰt 7>  x×ࠀ`> 8c` `@2`   @ ` `2`0ے % $ $$$  $ P> c<' "`4> \5 `4> (``<`@`H> \)!`8`1/`28`2>a2DbJ> `D`2O`2U`[> `8h`> O`2e> ``"i> > \"H@ a> >  @@a`8`΀`>  @@a`8`Ȁa>  @@גa`8a€b>  @@Βa`8b"`D> a@Ŕ @`D``>  @@a`D``>  @@b`D`"`8> b@ @`8hO> b(@ @O`"`> ["8``2> > [ 0/9"H㿘Hod4`<(@ e`<`;> `D9`H"`D`> ,`4`""`T `T"`X  ! Hp@ > a`4`2"`T`"`T`T X!"`XHp@ `T!! "`X\"P>  "h> \ "㿐@ ?(c`@@* @` 􀦀@ `㿘> `0``<``&`<`@`2@f`<``D`r @z > [Ɛ"> "> ["> "> ["㿘 < " 8 & < 8aPa & 8@L@ʐ`2> 5`)@*@2 <  <`& <8> 9c & 02 @ 8& & 8 H`#> 0 ?@Ր& 8"K @Β ? O  > [\#> [Y#([W#@㿘 8a b5> & 8X #   P` 4`(<|< -&4D`+Ho$((@H`v> a@aTcX XX @?&T&Xa`T&T> aT X#a&XHp@eH"<@">`A> `|@` 8h$|@6   | @ 2 442 " > 8w"88 w&8x &|T#a# &X# T 2 w8Z#> Z#p> Z#`>`0`T@㿘 8h% |@ $   |` ` 4 42 <`" 8h2 | < 㿘 <`  㿘@>`0`` 8` "  < @` 4`" < ` " ` 4`   `&`  > 9b& 0w 0㿘> `0+` <`*$ <`  @`) @V @ <`  D` >    > Z#> #> Y#> #> Y#㿘 8a`  b$ 8 > ! "  D <0`(`"&Ho$4 H(@e H`, T"4 X X X X? @$ X?$ T D$ DHp@ <$ <`ϰ @ ʀ <$ <`F" X X X X? @$ T$ X> a0 T> a T㿘 4 `>`0>`>`> @`?(`@@ 2 |3 ( 0 ( | @2 4 4@2 <`A n 2@ `2 ( 4`2 ( @  0 & 0& $ 4 K $ |"  | @@ |  |  | ` | $$@ 8$ 8 8h& 8= Β@㿘> `>`0> `8` v q > w"\'> `"08 !"\!"\Hod4> (@e> ba> aaS 0j h@1 2 T <`{ T n X! X X?  D$ T$ X$ DHp@ 4`q `XHoJ(@ p`2[> Hp@$ 8$ |X$ 4$ $ 0& $ $ <  > w> a,a,"\`Hp@>  O!4" d" "  " `$Hp@>  X P&e p$ T> c H> Xe X> ] > X_ 0X] p㿐?  > 94 &@&@ $ 4 'V&@>`D >`D >aH 㿘 ` 6````` `@0@ . > ʒ`6`㿘> a$>> 0`> > `+   Ғ  @ @+ @ W* @ W!`W٪ 㿘Ho@> W !> bL    "1> 1> V!V!( > @w"0㿐 [> @a$a$@ > a07> 9 y` "%@&@ ``"Vϐ)'P@\ (  ' P@  \ `  <6ƀ%@&@. > b(( ( @f&@ 㿘> 8c`` `.`@c 2`   H"   $ $ @ $ $ $$ ```$` $>( $ $@  /, ! Y u & 㿐> 'b> (> 7 c(> #\!4    > Oab> > > ,!$ , !!$ ` @ 㿘> > a`pHod4 l(@e l *` 0` 0 !`0` 0`4> ՁHp@ @`a00   l` Hp@0Hp@V!H> 9> 9a> b Hod4 D(@ e D t  x! x x @ D??" x" t" D?@4> wbp@ (@@`" t@ t x"@" xHp@ 㿘>  U"㿘 ` P > 9aȐ  `$` ?$`$    @`$`@$`$ 㿐 > 9ذ $   `@> w `4> w"dh#"d> wbl1 0`88"h#blbl#"d"do$ > 9aĀ"d> wbl1 0`88"h#bl> 9aă0"h@8`#bl㿘#> 9a!>    5" " > w` p$aā㿘 <`"(  P `Hod(@  t " x x! x x?  D" t" x" DHp@  " @e t @` 㿘Ho-4> (@n> b >  XbPHp@> 9 > 9a!̃0@8`@  > 9aІ!! aа *.0㿘>`0`> '> 9 b/> > > bP;> w9> 9+> 9-> 94HodԂ(@ebp!Ă$ԇ(@C ) ^ ;Hp@  `@JUHod4(@e" l ېHp@@ ̀`#%̀`" 4~a&w `> " P> T<"> T"4@ (0 0  ("@a0(㿘  R `   (`4"  `" & 㿈@ l "" `" R `"( 4`"  8`2 `? `" ``#`#\bȚ  4`  㿀@ 9 "& `"" R `&(`4`"# `8`2 ```''􀠠? `" #`#\ b `4`  㿈@  "" `" R `"( 4`"  8`2 `? `" ``#`#\c?  4`  㿀@ ϒ "& `"" R `&(`4`"# `8`2 ```''􀠠? `" #`#\ c `4`  @?' @''''' " `H@  `T `<`@Ғ `8h0P@?' @'''''뭐   P ` ```h   `  ` (`4`  `  ''?''''ؐ@`` ??`  @ې8`  @ ؂&'@㿈@``耢 ` 'Ɣ 㿐@`` `  0  `@Ұ #T `2  ( 4`"  `$ ` 4-` `$  @ 2 D`"< & < > @  @< @ D `''''''֐ Ā @bȀ H 'H(Ȃ8a@'L@ذ  ā   ``>a@ `@>a? ''5''''ܰ B`4`,,' 'l'h''p'xh 2|  `4`P 4`"  @" @P6 @D "~@/-t*9> G# @֒9>  GҐ#"@f|Ė@dӶ`@  ?  ` ``>c@ `@?>c?㿐 @# *`(@<`` @  `P`  `$@ @ ` ْ( @  ` `  `"  (`@`4` @Ր  @fڐ?`@ \( @`` 5`(`@͔ P$` ); '> 9a\#?`'''@@ * @$ ` _ڐ``@  s@в?@'?''''``3' )`@r P$`  > 9a\H?P`'T'X'L@@ ϐ12H`H`@  Ls@ܲ?8 ``?(`'''''' )`@ P$` /?쎒 > 9a\H? 'T'X'L@@ }ߐ H`@ c Ls@?2Ԑ۲H㿐`@``` #\㿐`@`#\? (`?2 @ +`(`@ `P``$` 쥐`o'@ $ @  ` Y?!? `?(`''''''> `@ } P$` W Hb`'L@   ` ``>`,@ `@ >`,?( @`* `(`@ C`P``$`  @  ` " 럤  `@  `(ݰ  '`@ аΰ @?' @'''`''  `@ `P$`  _H  `@ L H` 0뿐 '`@ @@?' @'''''n `@ `4`  ` @  ~@| H뇐`?h`@ 㿘>   4` \`` @@ Ԗ @  P@?' D''' '' `&`P  Ġ "@?' D''''' `  `$`$` (i`827, "F``E"R&Y"$@@V?@ ``P$` `@''''@@ iː`ˠ!> Ք  ڐ Ֆ ʐ2``&Y#`2&2@$@`2?&$@$@$``'&&㿐 } `(  ` fF㿈`    @Ӗ?''x`    '؇) )  @@(`''܅+`+` @@ (`'@؁?''P?  `?(`'''''' ā 㿈`   [  ` @`՚?''x` ! C  ') )  @@(`''+`+` @@ (`'@? ?''( ''''''嚐  4`  ''@`'''''''''Є '@@   ` ``>b@ `@`>bܒ?P@?' D'''''[ `@ ?İyā?6  @?`@`''''''= &Ĕ@@ [Ā  2'  p  `8  ,`> ϖ pX`P `@ >`4?  ` ``>`4@ `@ >`4?P? D '''''' $   ``&@ ( 2 @@w  Fb `"  ` " @ ߐ  ` ``>a@ `@ >a?P! '  '''''䓐 8`Ȱ @ Ȁ!4` Ȓ@Δ؁@ᨐ@؁ذ 0?0@ ?>b   ``>b@@ ?>b  %> Bؐ$  g  A԰ ''''''+ Ā`@Ā D AĠHF (8a'L@kǠ  ``>`P@`@ >`P?P5 `@ (`''''''ސ %`4` '܂ '''''ذ Ā`@XĀ @ĝ㿐`@``` #\㿐`@#\??   ''''''㌐ Ā`H@Ā XĐ S0笐  'H(Ȃ8o@'L@0  ``>c@ `@>c?  %  `   '''''ز >'ܰ Ā @ɒȀ)WH_ <`('8'Lݰ  'HȖ@؁ڀ'H 'H  ` ``>`@ `@`>`?p> c<' 榒 " @ -> ؔ T ° F `` ԰  P ` 0 > $($ 0`7!Ѱ#H> c<' e " @ '> ؔ  恰 F `` ԰ Ԕ`@Ԁ ܐ` pװb#X > 'Ь<' ` %  ```@`b , @ >  ̰ @'ݐ0쀌@"@`(@ؔ  Ԁ`Ѐ J0  F`` а ' 4ް -@`װ `bdd 4`Ͱ  @ @ а ԀdРH%'h'l@ Д@k Ԁ` `@` @Ԅ `0`Ԇ 0 > 9bl Ԁ`03 `(7'''` @' 7Ђ ` ` @uР ?  0@ "'v#h!@I nd@ޒ`@0В @P&, , `? 0:7ĝ0> c<@' 2 " @@ -> ?' D'''''] ''''''' P`? P`$n ֐`Ô Ѱ)#x `, 1@"`(``(`( @''''''?O$@ *2/ @W  "@?" Ґ}ߗ$@0 0 > 9bl 04 `(7''' ' 7 ` @ ? 0 @̖ؠ "H0ˀ0"  @`@00`  P$`  4` @Ґ (ܐ'H'L`@] "@U ` % @G'@, , `} }0xpɐ h?j'@7  ` ``> `@ `@`> `?㿐 @ BR ` ( 4`   @$@w`` @@Ѩ  |`  2 |`` `72㿐 Đ  '' ` " w!``r  `h hl!㿘`@r!> a$a$@E`? c@!ﴒ  2`:` 0 $@$ 0 "a@`8&&  ` " $ʀ@ y 㿐 @ (`P    `   0` ` > $($ 0`_e P@?' @'''''Q "ā( P  0` > $($ 0`3㿘> a$   " $   `  퀤@$ $  ` `@ $`@$ $㿐 <`= | ` %> ?> ܀`2 `)!> @``"!> ` @2 $  2 @2`$ 2``2`!>  \$ \0Fϐ#㿘 $F& $    &  $`2  `  A ` "  @"& $> a$0   @"1> @ ?$ $ Y" | ` ` "> Q / ``BB@Ȁ    @>  a$Fb#0P@?' D'''''C ` P` `$" 8R `K   `]<p> 9bh> <' `Ò  ` Z$   D ^>  'd?'8'`'h'@'<8 @ L 8`I 0``@ 7``@გ *}  5 P$```  娚  4`Ȱ 0 { `|Z 龐0# P   $2 `鯰 -0髰 0` @8 2 逍K  @ $ % $i  % $ >߂c  ^ % $` `@ 2 $> a4%  $@"$ |f $@ ?% $) % $% $ 2@  `f01  > `%!$%% !$"!!$ @   @Д $`#  0` ` Ր0" % $ "% P% Ő0@   G> 8c2PM@ 2  |`  0  ڐ"  쟨 $% % >(% $ @Y % ` $` `G% 㿐 0'`` -@㿈 0'''`<` -@㿈 0'?'`$` -@㿈 0'?'`@` -@㿈 0'?'`D` -@㿈 0'?'` ` -@㿈 0'?'`` -@㿈 0'?'`,` -@㿈 0'?'`|` -@㿈 0'?'`T` -@㿈 0'?'`` -@㿀 0'??'`4` -@㿈 0'''`L` -@㿐 0?`` -@㿐 0?`p` -@㿈 0'?'`(` -@㿈 0'''`h` -@㿈 0'''`8` -@㿀 0'??'`l` -@㿈 0'?'`t` -@㿈 0'''`x` -@㿀 0'''''`` -@㿀 0'??'`X` -@㿈 0'''`\` -@㿐 0?` ` -@㿐 0?`0` -@㿐 0?`d` -@㿈 0'''@` -@㿈 0'''`` -@x 0''''?`` -@؁㿐 0'`P` -@㿈 0'''`H` -@㿀 0'''''`` -@㿐 0?``` -@㿐 '`0` -@㿐 '`0` -@`\PD8,  8`" 8㿐 #\ "@ `?>%a| (㿘@"`@> c @b & 8      8aT  >%aH (0`D  &@&` 4` (`>&&` &`(&`0 &`&`>`8&` &`$&`(&`,&`0&`4&`H&`L&`P0 @>`@0ڴ(״ԴѴδ ˴>&c (0 ( 4  (@``V `  b@a@`  `a@`  "&&ؐ` `$ @&㿘 (`4`6  2 2  `P``$`2 #`@>  >@ @&@C >@  ̠  @Ƞ Ơ 㿘 ( 4`@?  `  #@ߒ`@> 4`  `@ Y*@$@@C >@@ 0ٝp\l`?''' '''''d 'h /Ѐ`&/Ѐ`  ` " `׀ 㿘` @& @u`ŖN㿀  ( 7''''7    *`ѓ:`㿘`& 4`    ``   b ` " !&` "&`  !  8꒢  㿘 P`$ 4  8`  (@`&  8` @  2 0 0``wddsbK a@?`@`& (& ,آ f`4\ -Y >@_bd`t`d4`I  D ' =d4`u 08d2Z`.@`&@ & (i&& ,[ ``"$``(``/r$`h` 4} -f  L& , bj'h'`'```( {`$`! Հ`0{&8$` &ʒ `ƒ `:'' 㿘>`0`̻  ?( $&@@ L` 2&@L &@ ` "&圐$?  `@c b ''(b' > c@' '''' Ki@h"X" Ѥ    Ȯ ?''''''' ''`  Ѐ 6 +؈$ $4 ` ;@@ ! 1@"!  p%@&@  @  $  "%@     `"  %@ %@ ђ&㿐\'D''``ސD!D N .D'D` @D4`|`"81`8`;@"P` 'DD "_ޯD " DD'D& "DD 䡐`d 4D!@8`ɐ?+ $D`;:4> 倠`' /(''D@? 4` `z> x`\ ŘѰ ' /(>}#> >z#㿈`@)` "0`@8` s ?',?`#\ 3   $&@(ߐ0DX㿘4`"| `E `((` > ]`L 㿘 -`|> ] `L(( ,`  @㿘 `  D> a `4 @4 ((> \ aT  ` (` >+      c  "          㿘  | `` ((> ] `L " |  |?@`00   (@)y( 㿘  U 㿐`|  @D9  ` 8@`2  (@ @5+` `| ?(`# * E "  '`|`|(` (! > ]`L@ `  `| (@(   8 @  8X `" "`| `8$`d$`8㿘> =<#㿘`4`| (`> =- (`   (`> \ aT     (`> ] `L 㿐 `|    #\  㿘?`|> @ ` 2 <0  8  | ` >%` 㿘  8  | `  ` |  `    }  8  | ` >%`@㿘 | 4` > < ( 8a"R     ܑ  8aA`+ "C > ]5 `L(($@`( $ 8a $@`  @̐ 5  8aЃ5 `(`(`> \ T   `` `"> ]```"> ]` `> ] `  `㿐 | P ` $`y 44`/ > ]`H@j> `$` ,`,`> \ aThݐ ,`,` > \aT@> ca @?*> ]`&> ]> `$  ,`,`> ] `L$< > ]GՐ?  ،  <`0@b &> ],``L,` @$`" 8(` g  @` `$ 8r p `````>``z4``v> ; ``0`"`> ;} P``d ('|> ] `H (> \(T @@` `  `h@  w|`= =`?;| `ؚ@,E4 < @ J v| 8`m`@@aԕ=%%  8`H֔ V` ǀ   | `` ((> ] `L2`@@ C  ?#`#\ ` "|  (  2  @d( ` `2y| "v|"s|m'S> : @㿈  `  ` >4`'` > : `0`"4> : S | `` ((> ] `L Œ` `  ` |> ]`HB` (?? (( , 4` < @ f@@a&@ %8H@@V L ` 2  ) ) > \ @T@` ` `h@  2  ` "   (  2  @d+( ` `2  " " ɒ : : `> 9 p㿘4`M> > `ȃHod4l(@el "!  0` 0 " 0` 0`,> Hp@f0Ԁ` َ l` Hp@ܫ0Hp@ 9    㿘 8 > `& 8 ɖ  8 㿘 `    0@㿘  `04㿘> 9e 㿘  > 9Y!㿘 2 > `8` ? 9H! 㿘>  8|!0㿘 2     㿘 0d 0Ho$ (@Hp@ e0t 2  `` `  c      "    - `|P  > :`H 8  `<  ,   4! ,` 1 4> :`8 8 <ഀ2 @2  ?" ഀ`"༁0  <" `  ?@2  ?(@82  @0` <쀠2 @2  ?" 쀠`"0  <````! 4" `` ?@2  ?(@2 `؀  㿘> 8]!H |> ` `>hb!`㿘> 7! > 7 Ё㿘 |  )'  & | 㿘|   ` ` `#$  `"  `$  `"  `   ˾`$|   `  㿘   @ ` `A|@ 0| `'  S|@0 a `|`  R'Ƞ@  b~@   `2`  `|  S`'ȁ `| SW'Ȁ  㿘  `|#  `2  ?     ` ` ~4 a4 > 7r!㿐  `|0  `#  `"a4      #\V` ``#~4`| ` `#> 77!㿐| u `  ``L$ ` `K :  `   `$ ``  `%  〠`0` $`֐ `Ն!  > %` X`` `i `0` $` `~!  > ` 2``  Ð $|  0   $ & $ 8  "$ $  `` h0|z? $|㿘> 'b> c(( @ @%> #c <@a3@aϒ <.* @a-@aɒ *  @ađ4`> T0c@aa> $ '  `?am:"> 2a (@*  " %> (`'4> c6  , , , &%@`<b.6@8D(` 4> τb ?> `(@"*@> b(@*@> > `((``  `  `*      @@@  .> ) >  (b(  @`  `` (  (㿐  ( 2(.` .`?`t n .   e` `.    ? ` `.n?   >  c(  @ @ .@ 2 `2 +@   `H @S>  c(@ @ .@ 2 `  )  5@ ; _@`  6 ` `..`.@   ..@ "?$ `2 $`2ɠ Ȁ _.@@`v  0 .@_Ґ@ !`2 ` @   @ ~&`@ ~@)(@0`  @ ."`g "C&.@ ` `.2** @ @ ?(  2( "@*@*  * 2*    ((??  ((  `@*   ((??    ((??   ** ܆ *( `@*㿘@ ? ? @??(`(` &@`$? @` 4?@> b(  @ @ @``ݸ ` @`2̰?``2Ȱ?  @  `` `@ ߺ  2?` Һ   "`? `? `a`@?" ` ` (( @@*`?`` @`? (`(`  (`  ` @ *`@ꀢ??`/" ( `֖  (?` (` ` @*``/*(`?? `(`  ` @*``/")? `` `( ```/")?`2??  ?0 (?㿘`?` `. `2?` @] ` 㿘 > &&$@7> ?b 0` w0$!n  `?m> 怉 La !0` O> 怡      @(` (`> !) b ( #c > 'c (`(` d$@]ܠ6` `(`(``!g) 0 @(( @@ (` d@^d&* *  ( @@(`@(`&> b !0`  >  2/!Ȃ @(` (`> !) b ( #c >  b>  c,  $> (3 @ @(`@ @"!  @2$220`" ""     `" `  " "㿘 h`㿘> 9aX  <`> ڐ6 "R$ 2 =&  v!(0㿈 `P$ 0 `` ` `&  4` `2`2& `  h&  0`ݐ@   \  d`  h (`  (`  i(`  j( j0`( l( l0`( n( n0`( p( p0`( r( r0`( t( t0`( hC(` h`: ( h`2 ( h`* ( 4`x: (` 4`x/ `(`m&  r pL  h` m. h0] x y xǃ0` { l j8 i f&  n 0 [  t u㿈 ' 8` h 4`xc   $ >  0ؐ!P @Ţ x@s`>  t?$ t''`d`X@x2@$ x `$$     fB 􀢿 @+? `X$ 0$ `E`x2@?@`d`X@ 2@@O "`X`d@@12@`\@"!`X`X```H``d @(  d찒 @X`` `d 6@(@< `d`H"@s > |㿘> 9aX ``<`> \`   0`$`P p  핔 \`hԐ! \`$2   ? ?, \㿘 `8  4 xc  h`  x%>  d X@00@@"  T@   @H  2 x & x`$&    00!㿈 x'P>0@f>6`0/> ;>   @@,c( (` 2   " @2 $2 @2 0`"  e ,P @  > :- 1 = P    < > B `$ $ $ $ 8  $ $ @ $ $``I "$ 4: " `" @>P @  $ `$ 0 xc"  @@: "%@c 8` 8, h xc" @$ t  D$ x !4 j, i4 p4 r4 lI4 n \  d { ` , h` , i(`@4 j(`@4 l(`@4 n(`@4 p(`@4 r(`@$ t((`) @@ @$ x 4xc&" h`  4 t ?H P @  `4c @  X(@$ x``(($ t$ t> .!㿘> 'b ;0 > : 䩖,> c( 㿘 l p@Z   8 < &$@8(` &  l@Z'  | 8  `) @( ) `|  2|`@"`" |@8 ?" | @8 ?"  @ ?" 㿀> '` 4 @̤ t ~'  d''&@ '> ` @  x2?c @Y q쀠䀢 " G   y x@>H `(' xo$  ' x3'@ <' x3 2&  $$ 3 ' x h`N &H (`() @@ @'(> 4`{   x3ǀԐ  ? H X ` @(  >2&$$| 䀢 Ű   X x.@@   D ` 0&   ` @ .@ >2& x d X.@ @8' 㿘 6`)  `?(@@" P @0  .`  0 ` ``   "??0㿐 |2: 4 * `& #ݠ  @$  8`<     `<' H8`H @  @4 8  $ 2(@   T`H( T0`( T( T(  b & | 㿈` P@'?c?/<;<Pp@6@8@` P@ |` @W И`d  K c T `6`$ T( (@(  x€`H`() `H ( x`H```((`H+`( `H (+ `H @0`( x`H`(` @`0`(0`H( x@`  7 㿈'T'X3`( (@  T`@ $T`[P@@V?c+<6@W2  ?x@@Ho*쀢耤 j蠄?`x@3``H( H@(` ' 2O  ``H (`=@<@ o@)0`H ( '`' @`H  (`() @@ @@@+ 3``H(3``H3`(`H('`+`dž@3 $hT`T X` @e㿐`ܔp.` P.` "* * "*  `9* `" *  @W 2 ",  ?@ (R8, ?= P @2 , "  2 ,  ? (@@/8, ? @8  `  @Ґ 8 @㿈 >  *v"   `P( `>  *a"@ߐ@U`Ș` L蠒 4``xc0 H/(`{@@ 0@ (&  `x?cac7"! H0 '&`hj0g H(`() @@ ΂@ (`D@ `/ *0`H( H  ```<() (  + 0`H(0`H0(`H( H7 (H@(`耎20`@ /< @@㿐 T 6``(& T (@( $)   $ T& T&㿐 t  4 h`>  )"x> `   & & `  t `('?Z ဦ&  t`t & t & & @ t`"' `' ' h`"!`````H`X @ `'(`d   c  H <@lՒ $ @&۴ `X  `d-  K `X`` `  8@   ̘ 4? " Ԩ 2Ѩ > )"  ) 0 8 (@@  j  `"c > c0? c0c  JR ?<  0>㿈 P' 0`` ) ? P  0`@8c$T c8   Kx/H/ `(4@ 2PT`5 $T( (@( P @ '@Sl@T Ēx2HH (`() @@ Ђ@ 2̓0`̀@  㿈 4   *`. $ H* 0"  `  ``g c ֐_  Y 㿘`$ d X ` D!  0@(@ @80 \ @ 6(@ @  2  \`H' X ` H  (@ @Ҙ 耧 &( і@  `  $>@b 4㿈 4 `` H  r 4  1H: ` 0@ ` `2 @k" 2 Ϫ``˦̐ǐ  ``  㿈 4> > bШ   <`J 9H$  @ " `@j͔ " @jƔ " s n Ői  `?_ 㿈`0 ( 4&`0  X6@  ˜ 4  2 \ H@@ "` `(@"` ?( `  \@ `?  ` \@`2 X 㿐''`h` h`2 t > &# `ˁ``t " `44@l`xcR> bШ`X```H @`(`d  { AH` ` F@j 26 ```x(`!@t@7 )`@@#4`'  `h`"`t``(`@(`ܠ`@>    >   > &"㿀`(`x `4`d`X ` "@ 2@ ' `X`x`((@&`x`X1 ˘ ``(`\ ` ?`@ 'c`(`\`H\ @d <  h , , i, j, j0`, l, l0`, n, n0`, p, p0`, r, r0`, t, t0`,  h ,  h` ,  h` ,  h`} , 4`x , 4`x , `,`I   &`(^ 7`,?`1&`,`(`\@c s `(&`(`X"1  i`O䰒 _`\`(`H) 2`,9 M h`Qt'`xcA F C`x ?5  x y,  h` } xx0`,  h`q  y {,  h`d xz tp uH > c<@'  ''  ,%  '`4&@`h`  > <@ &>   5 @ >  & 8 ` '   ﱒ耢     '԰   '̮ `2 `?/`?@'     @` `.2'ܬ'''Ȥ ?ȐЖP M~؂ @آ  H @@`?`4 `` ?`  Ȃ`' ̀`2ؒ@g '`('`,  x(`@c䀠`"`'䀤c ~؀`?xc`t@1`J܀ A`  y  @% `&@ "> @ > P`'?8'Ħ Ă%(`'`   `@ϔ `2c`  YZ#H   ' '`("i'`,f'`, J`.s  2@~  @(`@(`` Z  tc@M   > `t@`ܰ ``&@  @% N Ic@"  ߹ u> `t@wܰ i``&@ ha% ฒ \> Y U> QPl J `.h'c   "N `0`"J   u 1> İ?'`('`, h%%  { @% 6ܠ & ` $ (% "f&@` \[&@ʒ`  (% ܰǠ`>    2@  "`$"`㿘"`n  4 0&& 㿐"``ۖ &`&㿐" ʔ `&@㿈"'''' h` `&> >FÒa(` k` : 2' ڒ #$#X㿘 4` ``<" l` `@   `` @ 2&`@ ߴΐ `` `2@0㿘" 0d&`d&`L >`T  >`T >`  &`0&`, &`4 >`( `} Z!`y Z!taDu | `` @fc 㿘 6`e  "``|` ``?8 :` `4`ƽ`T <Q ;$$($$㿐 |d`  > c\@ ߶` `  e # `$`?@? `` լ'   *`| ` ߁`?@? `Β` a " < ;&b!0 ;` 0 2`H "   (2   ((`@2  *   (`@2  (2 "  (`@" 8  (2 (  (`@2 * 0* $" 4 " O) 0``@8 O+`0`2   ) ((`@@ @ " , (`() @@ @" 0 `2"`2t 8`2p   (`@`2i  c $x$$    ((`(@@@$8  (`"`$+ `"J @2F r@2> 0`": 8 "6 F44$0B,4$,>49$84$<4xcغ +.0` $@a0` @$D$H0H` @@L8 (` $L$t$P;?/  $x$$/ 0(@$l@LtP 8 l?>  v#p$Pl-` 0` ?$p $d$`$\s? (@$XҰ Oа @$ " 0(`@L" ,c $x$ $@$l'|234P`0`  ?@K  ,  <  $$$m 2`|`$` @$/  @$` &b&``&``| `$ 2(@   2y`|>  Hc@c   !$| 0h& 0I'$h>  @cc 2$|!+>  @cc 2$|#c@c  $|@P/  ! " # $ (((`@@@J$@4$H % &* B $| |t +@ $) "``@?    $ -``Gt`  `ʔx  W Zt Y^    Z  @ &,?&(&&0&& 逤4`"| ߀> ]`H t 20`` ($` " $ $3` `   ?!ۊ ܞ $@`@W ` !`k "`0y/"`$` $`$``@$`$` Ɣ Y Z  @b$@ ! Y@c $@'@b!t? |0G`xc2 $`Wƀ, " =`s` @@$`É(T(t(T(T(((T(t(    E  `4 (>I     $     @  ` @?  㿘!#8#В@cC @F,,ӣ('@(00@ @F1   P  > :a( 8 <  " > :a8 8 <2  @2  ?"  `@"  @ ?`2   ,@`@ @ " "  @ ?@2  㿐 `  x   #\ǐ 8㿘> ` @  t > 耢 ` 6 ? ` > 2 ۔  < > Ր Ё> c `4  " `"` @ `X @ "    8@  >:a  0(8(@ @   >:a  㿘 4`W  @ "  ?/`  | $ D0@@  `4```X  ;+ 83@(@@    : "" ??<  H <@a  $ @2` Hod (@Hp@e02`  2`  H>  `>c4 < `` <>`  ` >` <㿘 m -㿘 c -㿘 4`  "t `@n @  Ѱà ʰ㿘    t z  B``@  B : "2  2뀤 )   Ŕ ᐄ㿐 <` ص  $ `` `&  4`  `2`&  &  r p漖  h` . h l j泖 i &  n 櫖  㿘 > `#`"Ғ : > <' ` t`  ( x  > #!@ tdq  X@_u 2   ` 4`?` / 'l'h'd'''ТLh`"` `3'h`+h`9`'hTܖ 2"# c T  @Ĕ!h'hʔ ` /> '#Ɣ   h> k >  > <' ` t ` 4 ( x  > #@ >   ?P 2  X@_G ''hHh`"``` `'h`h`2ɐ`" Ĕ崖h'h```H`XP @`d`(    `d H@_  H> : @Ő XP H+`P0`+`+`ă0`+`+`ƒ0`+`+` +`ƃ0`+`+`ʃ0`+`+`ȃ0`+` t`xcC0` ) ) ) ă0`) ) ƒ0`) ) ) ƃ0`) ) ʃ0`) ) ȃ0`) `xcP  PdXE PPE H+`P+` t)  t) `@ @ 0  '̂ 'l'd'А/T P"" = T @ʔ ` 5/Z Ɣ  5h> #> p P   > ''Юc<' P`b> `0 ` d2P> R P!  ͐Ԁ[Ԁ U׾  Pި ۨ W` 2Ԓ '`h`  `"  @`@2 ``@2 `@'`  ' ` `(` `', ւ'В זttx  / / |  " h`c  ]Ԃ f θ 2訒 J  ` @$ `z3Ѐ w '@`('> _ `uА4 Д 4N`'`G0CD4> N H@._  {0 tԒݐ 2``Ԑ 2`` ` / m/  /h/ B `Ψ ېj ܔ6>  ϒ 0 ɔ`\ صر &(&, ")`0ؠ `2n!`1`X0@  `  "!` "А ֊`&`('`0 `"> Ő!8> !``\@'`$`+А c" `t B?`X```H @``d(  ՘̨ -̅4 `H) ) t`xc2  ((`xc 4 4 ) ) 2 2 ((̨ `@@2    > f!x㿘 `h`?  ``?ށ㿘 @` ` ```( `L`P"`T  `D` `4` `   d `,"w`4 4`"Đ " 4```͒  ԓ  4`"I`,`4`4 r pb h `  , h$ `?"`H 4``  ` 1 h, h ` $ `H?" 4``@ @`H h` , h ` $ `[ 4 `, n  `4`, h, h2 `,2 4`㿐 ` 4M `" ` `$  4` `2`$  $` hP t "x x$` h`@?m$` 4`$` h`  $` `S $` 4 `4$` 4`$`L$`  x <`  r p 4`2T n`4`8$`<$`@$`,$`0$`H h` @$`H$`D 4d$`( 4 x \(@ <`P`4$@  x`2$` `I  X ` H (@@*2  @?  $0`@ҐB $`@ ( @ (0`@$`c  @y$ `,   l j iz`<$`H r pU h` , h 4` Y` @ l jD i T$  n < J ``4`h  n ` a@ (  @ (0`@`4   > c X '  ''̀``4    `h`'Ԃ`d'Ą  `x @  `X;  ;+ 83@(@;@?`d `\'`x '`X`` D z+@''`@L`X``  ,48,0@,@`dؒ=` `d @ @@܄!@Ђ @  Hݔ  `3 Ԁ  P `$b``%``X`x  K+@ 4``  98, ''`dĈ #`#\a 3`'8+0@' ߘ ` z``w  2͇,8,4,0@'̄@'ȃ3`8+0@+@@BH'> <' `'`h'`' `4$  @Y! ' `{'̄ v ' ` ̒ 0 `.` @ `t0`{ @ 'Ć @?  `\x`dĐd$ @ ``X :* 82@(@@ @ " ????ȔؖG谒 `uఒ  H@ @ @8@g @`T0 2R?  `x(`@c" "     '/s ` ߒ/ ``7 (`0` Nˢ > `&??? H  D@@ ``2 ??? H  D@@8 M  $`\x`dĐd$ @ ``X 8:: '' @ "_]-Ѐ2Вd"?  @ ?  ̂ @' `x  `z @> <@ > `xc"q`@'''``2 HV `@B|   (`((@@@` 䀠`2'`X`@@ В|d `@* :(@'2@@`'2   2'V?4 > c' /!@XJ``7 (`0` *@ʏ ) D" `&  Z @`x@ '  / 2 > /c@@X!`@'쒄D8Вd e2 @4 Dv 0$> Ą  d`'DD  4D''`' `4'؀`l > y!Ԁ`"`x =] `Y @T ԐI L`x'܀  I D@@8`CL'dX @ @ ;+ 83@(@@ܒ@ 2@ $@ ۘ p'Ԁ iԆ'耠`"M`x?n #@`=%Ђ%(ؒ C $'`x 'F Xd܂'Ђ@'̃0@  ?Ԟ` '; ; & '쀠( `xD@`̀@? ``x܀@ D``w Ѐ``"@ 4, \ @ 2~d@C : :*8 2 (@: @.  68.0@.@4 d ]`x X@ d  ' < H@Vp  `@  @ "x  "h \d@ 8 < @ F`x  '`x@l@`H@耠`9'd@8X`Ђ`'` cX` U+ 8 3@ (@; P@(ddl 'H8,0@,l@À  U``(U`-2Ѐ& #'Ѐ@ 2 X`  38;; ''Ĕ   $'??8`p@8ZdQ "e '?$ 쀠@2'R+ ;(@'3@@'Ă`X '(Xod" `"`"` >  c `"" 4" " " 4" " " 0> c2h"h@2l㿘 <? 2  & :`"  @&  8`&6 㿘>  c      @2`   @,  2&@ &@  l  p! pp? @ l p>`p 㿘 X`"& X  " (   " ޒ  " (ؒ  ( " ,Ғ  , ̒ ́㿘t   t  > " h㔈㔀`" l㔂 l p " p㿘? 6 ް   > : XH`" " X  " H㿘   &   7    &    7& &  㿐 `   -;> :aL'՘ `$ 'aL;> :aH'Ƙ  > :aL4 'aH 㿘> c Cc/> ]>WLaȺ0-> c'> "7& D @%@ 0L@   @0`@2 㔀`2@`@2`lh R  㔐 2 & Dߢ 㿘  Q  > " " " " 㐂"   @" > 1!㿘 2 > 耦 >   ”@! 0>(`D 㿘 ``  ,@b),` ` (@`Ho&(@g"& (& ,?Hp@    `?   }  @S "Ho&(@g"& (& ,㿘 8`  `"2  " & . 8 @    뀢 > !` & > "㿘  @, > c   "  @2 @2Hof(@gHp@ 㿘> c @   @Sf 0 2 `"`  ( 2 `(  `&Ho&(@ @ `qksHp@ g  & 0㿘 D` H`2 L͐ \& \ P  TŐ \& \㿐 ` 4  9 & & & & & ̤  @N&$@@$ $ 4 $  :`!&  $ >  @   & & & & $& &  4`& 4 $㿀/ d'7'' d @  !>b  0 =`& 0 (@ " 2 0㿘`1   '>X` ! 0 =`& 0 (@d "Q <`"``6` 2 0p`` 2`Ĕ ǒ` ``&7&` ? a7&`7''7'А`` ``@&` 6`&`㿀 '''7'`@6㿀''7'`@6㿘  $ >(`D  0 =`$ 0 (@ "Ϙ <@ 2 0㿘` _` ``" .P` `i`. (  E`*.`F` .e $" "    f(`` 7e{$` &`) `@8 ` 2` !k  !"`k$ .. .   .̰ ` ` @$` $` 㿘? 6 Ho&4 (@g `rHp@ 㾈> c<@' ? 6 l    \` 2``  @ 5  ,?  l @(!<d (" ( @ /Ho 4!(@a!@ Hp@0> "0㿘 <? 2 Ho&4 `(@g `2 @2  ?& bHp@" `㿘 ?2 V` &`<> :aP&`8Ho(@ X ``" X&`" `Hp@ g X㿘? 6 Ð `)`A&`Hof4`(@g``2 `:`2`` `$`> a"`$`\Hp@`"` Hp@㿘? 6  ;`Dbk@"   ~@"XV  w@"g0bf@0b{@ bl@ s@"8 HPb@>wxn@Vo@M`w@2  L & |@8@j@dqv@f@h@Ð y@"r}@3}@,z@  `!v@ 7hj@ւq@΂f@2   &o@hn bp@m/ bk@f  "  h~ @|@xt@2u  @ q&@i@k  `gHo&4 8(@g 8` Hp@0Q@Lm@5 `v@2H  & L `& P `;& T@`u@Wp@22  .. :@ b@`w@  Ɠ @ . <> '@6b> 'bР & `  &   = & < &  ` s ` > :aL8& &&   @ & @` 8֐ & HӐ   66  "ʐ   & &`"`& ? &  . ;Ho4 (@g `  Hp@ & 0 & 4& !> '@6I"&"@6 > 'Db&  & D `. =Ho&(@gƐHp@p n @I i /a@`A0a` bm@90b{@6V   @J`  . 8㿘? 6  `b ` ] Hof4 X(@g X `$ X $``> $ $> '> b( !`# `"U  :`"  2  1 $@ + L  $ $ $ $ $ Hp@  Hof(@ $ $ $ Hp@ ,?) # ` g a$ $2 ~Hp@ tHp@ jHp@,ttttttttttttxtttttl tt(tttttttt|ttttttttttttttttttt0ttt(tttttxtttttttpttt\Htt<ttttttt4ttttttt(ttttttt tttttttttttttttttttttttttttttttttttttttttttttttt " '"@ ( `@ @   @ ` "` `"& @ ` `(`(@(@@ " @ ` ` `((`)  @   ((`)   @ `(`()  " "@ ( `@@  "  @@( " @(`a2` > :>^aL8`' (``@"@ H```"@ j``  `0@ ` @  ]``ރ(` `@"?7``퀠`7```倢@ 0`  ``0`@@@@@π@ 0ˀ``!`P`pƀ`΀@ Ĉ "`DŽ@ ` ` @ 0`@@݀@0@  @ 0*`@`?P @K˔ @ ?>^?cX   `((` @ 8 2 `  @`2! `!` :@``ڡ(`ؐ֐ ԠҐБ2 ͑2ˑ* ȑ* (`@ (`@    8@ `  @`2 0` ` :@`@"   (`"  (` `:_@ `"   "  ߃(` s `e@ oX`"e h *  Ń(` "_ @2V  8Q@T `  @`2 0J`G ` (@`;@(  (`’2  ` @ @ (`& *  (`@2   (  }(`ȡ   `@@ @ ```) (+` " @"a  f(` "  (`  (`@  (`@   `ԡ(``"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@U`2^``2 "`""@@"-"`@",@@ ` ` ` `""@" @` ` `  ``2` @"@@ ` ` ` `ْ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2㿘Hof!> :(@g!> :! )!    `!?! ! `! !   $    `!?! ! `! ! 2 Hp@> :pp`"p ` p" > `    ? @"" > 㘂 㘁 p> c<' `  \ 2` @`` " @  > 2 \! 7a@ @`& @ \6 \` ש"@p> c<' Hof4 \(@g \Ԃ`F!76 \ a  2 ` " ``" ``2 @Ḑ  2 ``> D`"'  \! 76 \aHp@ (> !76 \ a \@( ـ@= @@ π@ "ɀ@M ŀ("P㿐> :?ϐ!d 4> > b(.`2   @ 'l ` g`0    `造`@ Y ` T`0  2 Y @ D 㿘Ho"(@g" @F > c@``,`@@, $"``2`,Hp@` "`>` 㿘     "  㿘  Ґ &  㿘  $ + `"  `2 &`&`&@ &` &&& װ &`&`&@&` $̰ x''''''''<1> :'!d؀  @@ 2  > Ґ#!d`"> > :!d> 㿘`` `? @@&`&`\`` `& `㿘 > #<" " " " 3> :gad   `2 ad`2&Ӓad$ Q㿘@`&` `&`  & @˔\``  ` &` ` &&``& 㿘`U` @_`> "`  \       - H >!b  D>*b( @ >!b㿘> :ah $   @E 2 $    `$ ! `!`!@@`2`  㿘> :ah    @Ew 2 $  &  㿘> :a  0  0@E_ 2 㿘 `#; ` 7   "1 `@2 " "' `\`2# @ 0 ` `( $@ @@@(``Ԉ ``@ 2 @@Dϔ  `Ô@DƐ 2 2 㿀> :ah> <' 2  @D 2 $ `2   "  `&  `   &  ` ''''  `0@E   ݢ` ؐ > k"`㿀>  c<' ``  & ``  %`  ''''@ @DÐϔ  ``ޠ?  ِ > *"xp> @c<' '> :a0a"y@@`( 2&@  w> > :al`i0 aԸ0 O"@. @`7$` k  " @ @ ِ0@ &@R@  `7 @ ڰ  5 ϰ &@''''& 2@è  &@ӄ"㿀> c>  c<' &`'   # (> :ap   ''''  @C    ? 2`  ap ܰ > @" L" L>`p 㿘  2  "N @Cn 2  H   ? @$ $ `2`"`@2 6! ?  ؒ ``#``$"`(`( (?($ @ ( `$H   &  > : al#` 㿘 & &     & $" $  `   & (" (  `   & ," , `> Ґ#0㿘  ,ה   @C'  & & & & > :& $h $& ( @ 㿘N@`@ 2    @B 2          -?  4 ``$ $@$$ $  @$ $` $` $ @(@J?`/`9 > :ah 0Ԁ Ґ@By 2 $    h> :ah> <' #> cP "'@BY 2 $  " 'cP Ԓ 2 '  '''//@< > cP < "d@ْ 2 <Ȕ > 9#@" > cP < "J@ 2 <  > Ɛ"㿘 ``  1> 9@A" `@``"@A   `瀦`@```p㿘 (@  ` " !&!U (@ 2 ( " !&!㿘  "@`@ ` 2@2"$$`@ `@&`@Uo `H`&`H$㿘@=> :a <2 "`  "`2  㿘@> :a` `" a<2``\`"`` "` `  "``2  `@@ @ 2 x''''''''@ܐ' > :L!d 2 㿘 "`@`$` ` `   `& `@ `" &`@ >kaȀޒ @3&`@㿘Ho&4> :(@g> :a`V`Z`Z` 6`Z(``2 `a`@``2V`ZHp@> 'b͗㿘@ڐ@# (s 㿘> 7cP>  @Jb \ ܂`@s4 \ T`" H@I H`@{ @ ``@^@QÁ㿘> 7cP>  @#b \ ܂@r6 \  " !Pv   2!`2" ؀ 2 T`" H@  H`@zɐ@w@! @  T (`@ a" !T!&!ք a" !T&!΄㿘 @`M> :a F  U!<2  `2 @ ``" @ @2``       @@(``    @ @@(``ܚ`  8 "԰@I  "`Ͱ > :> :at> :> :a|(`> :ax㿘 L`    & L>iԒ`(> 'b L@& d̔㿘N`Ђ``    L` Ђ``  `  - =````0"EL > :ap 2 0< : @%2@?۔ 2$`# ?Ђ`` Ղ  @ / ?Ы- ``` =` $@&L --`@`Ѐ`&@`> :0㿘  % а  ` - \`Ho&(@gHp@`㿐]    " @   + 㿘> 7cP > @b!䀠`! * ` \d ``"! "4     @ `?& & `?& !@`"& `> :& ` & > @ pH`` > `l@> : a 㿘> : Xax( Ho&(@ @ &"Hp@g 㿘"` 0ې 0@$ i `1 h   ]  * (`0`(, ,  i> :,  X`4  h, x X>k(!&` &@a&`&"&` ,`?,?9``(`(Τ㿘%> :| ?)> :'> :!tᐚ c$$ᐃ("$ᐆ ``o ($!> :6 X!x`|`!t2 !tR> :!t** 6* %!t**   !x !> :!x !t$!x*  ܔ | !> :o!|w $!| & & >  ` |(` !䀠> :!&!`&!&!&"&!> c@ @Ba`&! "!t'> : )> :$ᐂ > $#X㿘 h`> :2h& "& h`2& &   N T&  &  @N H㿘l> :ဈက` & ဂ   & 7  ! & 1㿐    #\> > #cp1> w>k"tbq"tsp> c<' Hof4> :(@g> :a %    \`"  \!4 \7!@  2 \Hp@ > Ԑ"(> c<' 0@ $@ a@"0 b@`'  az@ > @@0ax@j   aF@`\@{0 @"T2@I1@:@+@@[  @"10@y@v @"t @b@ 8 `\ (@a%"`\6`\`@n`````\`Ho&(@g@=Hp@0~ zv\rnѐj@"O@"H@@ aJ@2 ǒ Ma`@`\?"Ȁ@|p @j@Ȃ@2g  (  `\@a@`\z4a@"a<U0 @3@+@2A a  @ Д @<% `\V@@2& `l` a`$@`l@8:`\@~G@:a5@2 za@a@2 0na@*0 @2 iaa@ @@;ِ @`\  `\$`p`hԔ `\ &`\͒ `\  @c 2`\a@ @ @;.@; @`\`p &`\6`\ΰ  f `` Ho&(@g@wHp@ ``̀ +`0`  2#`؃Ho&4``(@g``a`$a$``>Mb$aHp@``  +`0``  "``C Ho&4 a(@g``a$``@ Hp@ ``# `!Ho&4 a(@g``a$``@ Hp@ `` (`8`@@$``/`\A  8ð `\#,a5  8 @_ @M2 a<"XaHo(@g@@3@Ɛ@```` :$``> ``4`  0i 4 4 4? @$ 0$ 4  `X$ $  l`\``.Ho&(@gHp@`\`2aHo&(@gxHp@`\a?bR @4`\ `\  > :`Xx(``" @" `2 `2   `h` `` ` " b ``2 bc  ]@a @a 2E`\`` 6@`\ a &;`\M Ӑ Δa@+`\@2 `l &#`\ -@ aF@2 e) a@ `\a6@T0aK@2 Oa"`` 6`` [@" "P @2! @ݰ9 `\`E$``0 2T`؃Ho&4``(@g``a$a$``$aHp@: Hp@a@ "H`\$a<`2 . @@2%#Ho&(@g@ߐHp@``ۈ @K%` 0@ 2@Ȓ^㿘Hof4> :(@g> :a   Hp@㿘Ho4 \(@g \ ,>jb6 \&!>d>da&!&!}  h` H`" T@` T` h`@!`!`<!@@J@ݐ@ѐ$> ےc> ג`>4Ӓ` "    ? @ `& & #> : "    ? @& & #> :> Ŧ``  .`" 0 Xax(`"  `d$ $   `2 X 0W 4 4 4? @$ 0$ 4 `2@ Xax(`  Xax(` `>" ax X ( @ $ (  , > c@  0 (`@b`"   2 0@~  X> :|(` Hp@@7 $ 0@0ax!C!> : ao > : a\ @! Hݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨ|ݨݨݨݨݨݨ`ݨ > w> bp   0` (  :`( (@ + >  `0  (`@0(`@0 㿘> > c  6 0(. 0@(`(  >tc? >u`?㿘"? 7  @  "2㿘 `A``  /    `2 ` ` ` 3 > :!> : !  3.`.@ .` .` .` .` `  > :!> : !y  .`.@ ^.``.`.` .`f 㿈Ho (@g   b Hp@ @6t  "   @6j  2  Hp@`$  "    ? $ $ # 7b&b@6D  b&bHp@ 4㿈Ho& (@g ( )` Hp@ `b`2 `@6  2``@6  2```$`Hp@  7!  + `  $` $`b$`b` &bb$`b`&b@5є  b`&bHp@ 4Hp@ 7 2  1  P\`  -8 l  @ Y@㿘? > w."??.".""> '."Ȇ` !"@4: ."." : ."."㿘"`  !8. i. h. j%>w& l`&!&!8" i `"`@ &" ' D 㿈!<`(@=" `h`(@7!<>  0# `h``\`A`A, 2`IG "`\ `k``(`\a<) " `\ @2 `\@%`A`A`TӨ 4   h"+ 04$" `> @ @! *0>  /8#`>ta4(@f 0<@r $ h  4 A` ` 3 ``"  A v p  7  K 7 z `b ^  W @"H `h`ݒH` Nu H Nm   @4m  2``Ho&4(@g` 䀠`<&`(`@a" a (`@ a $ఙ<@ <`@ <`"@<~Hp@@ d? bz7@N V`a (\h(`;`g( a7W `װ A  `cP? `HM7`(@   A 8 4$ 8" R@   N  7  H M @S. @ 2` .`<᠟@ "p`$Gа 7@{$HY`< `G7 沖 J(7  @#㿘 E!<`_&( h` @&   `h` G`\@`F`@C @<` @C > > ` pp`ͥ+`4 `?`  ["@q `H`ǂ6 2`Ѐ L4`І@<`GMEM  h> :` " ` 2  `   @3 > :!@2  a6`@@<` `@>   B<``2`H"`"``T` ( `h`2r` `U(0```c`\ab \a@2  PHo4?݂(@g?݂c4"!*H5b GH(Ҁ(  %`"FHp@ 4H``%&bx6@_! 5`@{$  `h` N` c IK   > ;bу4"> }c@> }`lH`@%> @`l @ D6 H<&(`@"$ (`@ ` @$ @`@C <`H``%> @`l>Ѡ``\`dH`@%> @`l> cH``%> @`l> ``\`9@{07H`@@%> @h`l>4``@2&C˒  H   @0`0`0`0`0` 0 ` 0 `E$ H L`0@wV 6_<Cϐ@v .4@g0 ,dt dp| X $0<HT"H#("H""H""P"P"P"&@&@&t&P&t&H&H&H&H&$/(L(L////(L(L--''. -. -(L(L-----,,-0(L(L''--\'+'-(L(L..''..x.<.,()$* )),(+***l))l3h3h3,3,2 l"#"$ "#$"#T"$"$"#> 'І "$"$ "$"$$>  c `  )  "`  㿘# ` @ M"#X"$ "$$"#("#\"$4"$8"#,$`"$$"$ٞ@ "#d"#4 "#`"#0 2   `2""`"  2"`2"@ >  `(>zx> `> `> `> `> `> `> `> `> `> ` >  `(>z> a0> a> ԁ` > a> a 㿘 \`>  0a@튐 @ '㿐$$&$0&$,&$$ \w   0`$$$ `&$$&$ " $$$`&$>  ^aX`&$$$`&$㿘 \`)#  k`` . kHo  (@THp@aFHp@0y# > a ! 0# 㿘 &# >  c`'  2$ @ `2 $,`@" `" @ 2$@ـ 㿘&# $|`@㿘 &# $x`@㿘 w&# > c$ `@ `" `@$,"`@ `2` @ `@2$㿐> w6 6 6  #\ `" > I㿘.  00` !> 造a(  #> 造"# !> w> a`! !> w "*> 2""> a㿘>   a !> w "> " > aȝ㿘>  a> 逢 a؀ !> w "> "> a㿘  *!> w "> ">z> b> b> b> b(> b8> bH> a㿘0. #6 # `!> w #> #굔> 逢b`> 뀢b> o> b`> obh> 逢bp!> w> b> o> bP㿘  *!> w #> #ꂔ>z> b> b> b> b> b> b> b> b> c> c> bx㿘?> c>  c(``^Ű (0`@㿘> 븐 .`` >  c0뮐 (`㿘 \`3+```'``0> c0+`2@$4&$4@& ` `@`"  w ` 1> p >  c89 0ˀ㿘 \`\T````> > `xx> ch`3 `@&< ` @`@`2&$    &$ (`() @`@ @$$`"@`$`&$0&$$  B$$`"@ꀤ``1>  >  cPє 0$$㿘 \`/'```&`> `x0+`2@$ &$ @& ` @`" R Ґ ` 1> >  cꔔ 0π‘ Ё㿘 \`\G````D`A> > `x> c`"$#`7`2@#&#@&)` `& @B`" " ꊐ `†`#``$V``$#&#@&4ݠ`1> #&#&#@ W@b0>  c* 0X#&#R Ё㿐` 2  l# ` b b` " { b$H$T` "  }J   {$`$ 1 }9  ) 00 "}+  "$}% $$$$`@+  } `#b# }  }  "4  4.!@u   {S@, "$| $!` !`ʐ  {< *$."@S   {1@, "$|͒ $p> ''''''''c<@'   2 J  F `2    `2  ``2  `2  `2   `2  `"     }    `2  `2   `2  ` e _ `Y @ > "㿘 <@" @  0` ` @ 4`: 0㿐`   b @bA`/ " z bHT @+V"@4 `4 `` >`0`  ".``ɔ" , |   zV$$$ $P@*| $\@*y  @*v$h`$  {  @+!` {ذ x> c<'   ܂O/`܀"@//`   > 88//ː"(x>  c<' 0+) `2 " `2 ``2 ' ' ' ' ' ' b' $  > "@㿘> c @ " ` @ #" `a 㿘 (`  `&"  @& @> (` 2 (` `"  @& @㿘!`$ (@  ` " !&!>] (@ 2 (" " !&!"! @ "㿐# \`     / 0`@  @>  ? $`/ 2` $`$` #` 7`?0`(@ (`` ,,2` 448.`""􀠀6N! `<$`(`@b"Z b (`@ b" \dF&"` `# @C > 0@` ,,2` 4"".`2 S #\ >  0!c > M"p""􀠀& `<!`=&!  \@> d !@`y>  ` $4c<'  Д    //<  # &#.#:`W  H > \"X㿀> $ c<'  $$`$$0'  ///00/0// # &#.#9`!    >   #"h㿐'D'H \   xD V kDHm`GD> > `xH> `8 `%`0  @$@`. `$ @4""  怐 `ဥ`  ` " o k  y?`> HD`-` 3 `!  y~ >  ` `0H> D$`D,'􀥠DD `  `"  K @$@`P `L "  > " `2    (`((@ @ @   D$`  3` 6>  3`-@3`-3`//@ D$ ,` $ '> Ր D`.`10`HD`  `!`?x > 帐 D$`  ... . 0`..> 垐 > 囐 ؃.`͙0`2$> HD. 3 `! ư 9>  ``R`0L H Cz 8Dv PHr H㿐  \ v = > ```/`,> > `x8 ? `"-`&``W` > ` $@`T ` @  xW?% H `ހ `  `  "     `  (`@0(`#0`@"2 H`2) " > !( ـ  `ӂ $@`4) > `-3 0 `! x `% π > Ð!  `䋔0\` >  `'"[ ` ʐ '%v@ ``r` $ @`"+ ``倠``H`2 ` ` ` `(`((@@@@ s 2>  w!`  @> o x @` ``4` ````1` ``. ``* " > T!x `(`@ %> I! ` `H(`@(`0`& S0`-`H-```` 3> ,,@./`/ T`@ I%T q> `>(0b#2t `` G c-`R> 8 `500-`-`0-`U-`!, 2C> %T5`.3 0 `!& $T!> ߐ!Hې P` 2&> `(`3 0 `! > Ɛ! -` А > 0㊒a@㸐!h㴐!%T㰐 㬐!㿀J \ :  <  " " " ?`5(0 ??(0  `9 0'0""􀠀65! <$ (`@b"9 b (`@ b" \d)&"   # @C > ?0`#\) 0`#`#d>  b" 0""􀠀& <!`9&! \d۠ !@׀  <㿈 'T'X`\:  i$`c` \`? ((0 ,,TX' \' X  0G 'B0@ '   @$`$` 14bb􀠀6Fa `<$`(`@b"N b (`@ bb`\d>&b``c`@C >` 0``9J   #\ > `0⌒c #/`> ⸐"pbb􀠀& `<a`9*&a``\@>`dƢ a@€` `<    ܓ2`> p#$P`&#@ 2.#;$L/@ -  #\ /#`#p#l#t `#h#d>  #̘ 7㿘 \`>  b@6 0Ð##$$$@P㿘 \`>  bP" 0#$$$@>㿘> w`6> wc`  @2c# ")> w .`.`"#h``.`#$L "$PuR $P "$XuL $X "$\uF $\ u@ k# ز 㿘 d) @c@  $ d) ) 6&#h@q㿘`\` (`@c$ݐ  > `0᭒b` (`@  c$ (@b a (`(`&#h)@ (`(` |`#0` > >c#́㿘$T0`#" #$H0`#`"$H$> &#L#̒ $H$##4` > >c 㿘$H0b#"#`@̐$&#P 1> y 㿘`\` (`$` (`>{dc c@   &cW (`@?c$ >  bp`0 H D  dc(`@ c@ &c f  ,@,  4@> >b#> >b#T> >b#㿘`\` (`@$`"#`*`  0@ (`@c$ >  b೔`0 (`@$`〠` @  8@ە p$8> <@'  \&$8& 䀠`耠`$8$4`> &$8&$4#@@ > `2$8`2$8  0>  hb0"x> >c#T$T` #`"##"#> >c#"##"#> >c#㿘`\`# (`@c$` (`>{0m  ,@f b  0@[ (`@Cc$ >  b`0 > >a#> >a#T㿘`\` (`@$``3 " @*  8@ (`@ c$ >  bݔ`0 > >b#> >b#T㿈`\ `2, + * 2 $  @<>{ * `0 3> ߖb  (`@c$#\#` > `0߁c }?> ߭"p؀ ̀ (`@c$`"&y `8u 0`!0`! 2 1> 0y  c8  " > 0j#x c8 (c$` 8(`>{0`!@h (`@c$ j"l> 0B f > @(` 7`@G2  @ ` 0 -  9  (`@c$7`#d> #`#\ܒc耤 "   (`@c$""  (`@c$ 8# (@c|`"  (`@c$` 8(`>{ (`$` 8(`>{" > 0ѐ#@ @ (`$` 8(`>{t">  cނ0 2~   ߛ  c@  ,@  4@  4@  ,@ 8 |  8@ @ 8ߔ  c@d 2  (@X  8@ c@M    w 0> 7!Q*`v2`> >  c00 + @?_ (`$`8;(`>{X@?  ²@?@? c@  8@   > X> `̢@ 4!1> 0֑ @ $@  7> ``@`((@) @@@24 `@``((@) @@@%3`/@/`0`/`/`?/ 7 ە >  chi0E (0ݖ `> 0ݐ  > 0`xVw㿘`\Hof(@g2  (@`+ @ (`@c$` (`Hp@>{D, K#$#@ >  a `0 (@` @ (`@c$`A=``ՒA  4@0ΐ& 8@Hp@+  8@Hp@c` `  &cGHp@  4@Hp@> >a#> >a#T> >a#㿀 \`` & 0``@ @!D  0` > ܎b8`> ܺ"p @ꀢ0>  |a@# 2 Ho&4#(@g#$H0#W&##`S$`OHp@` , `  %   !4 /$X@” "$\ /` > a  #d#`#\> # 0  #`` 0 > ap`M> B"pHp@#  0 > b` N@ " > > $"P, `J2`>  Ё>  b `*`V2`U> >  0ْb` N@ " > > "P, `(2`>  0T`*`;2`> #0 0敖 #`` 0#\ > ۱a > ݐ!А> א"pb@( i #0`` " ` > ̐#@o /` > a#d#`#\> #̔  q#0x $` #$L  /.#<&#@C #d#`#h#l #\>   S 㿀> #c<'  # Q  /2 //2 2 ///  $  ( (( 3`( $T@ (0b#) 0 @ (0  ((#+ &#.#83  0 `! > @ (?„  (( #(#&#"㿘 \`J````'`$> > `x> a> > b`: `@``C`@&(` ` @ꀤ`@`2&  (``P@?"@(#&$`&#@&4ޠ`1> Ց h А `ƀ``%@#` @`2&    #(`((@8@ @ `&#ڨ@ڤ0>  bhl 0{ڙ?&#@ڎ0> ` \c<'  . 0 ;> ``@ @ 8`   C  0 > .cH`> > Z 0@  `>  b0E>#4`#\ 0 >  ``> 9"p0 ?$@ `#< ŀ 0>  c0l Ho&4#(@g#$H0#K&#Hp@컐0` ?$@ q2T @|2`@Z $P@@R@N@$L @/` #d#`#h#l#\>    0Y>  ١c`0TА"P`*`2`o> #`$`Hp@0<>  0لc0`w> > ٰ 00i"#`` 0 > rb, ʓ2`> ٜ#ޒ> ٖ"p 0L"#`` 0 > Ub`$K> `*`ē2`D>  05"#`` 0 > >cx`$4> $X@ @R 0 > .c-`톓2`> Y $X@* |2`> O Ѐ@ʔ 0>  `H 0"<"P`*`a2`> )#4@0"#``#\ 0 > `-`J2`> #^> "pˀ@f  0@{<` @~d$\@@~\ @~X$`@~@  2`#4`` "``h >  @0`  #\> > a w0T`> #\a>    #4p>  \c<' kb```"`> > `x> > `ШԀ`G ` @&E ` @` Y> @` 2&>'7'''  $4``/&$4$8`"@̒@Ĕ  .`"&gb $8 [ `> T 0>  ` 0@vG$8Ԓ$8`&$8͒`"$80"`> c<@'  \   i g z> `|``x``ig> c  `'` `2> $ $@`* `& `G@4F`" T  `߀`` ` ` -`" > א!  Ӑ!0 0`"`> ɐ P`- 3   `W j > c<@ > ր`   jװ?>  aq`0``r>     `   ܀`   $@`? `:`"  > q# `2  ''''@ Ԁ`?`J>؀`F>܀`B>>`??7Ԁ`+  $@`4Ƭ `[ `n`-  3 `Wkp`?+ А 틖  > `0a8@uԠ > !X ζ  7'''̀'Ѐ, ,, , , , , ,  `"s @uYԠ> !Xg DĐ̒  ꀥ`` `.3   `Wɐ > ϐ!h`@u*Ē> Ð!x`"㿘$$` $$$L  >( "$ 0> ]!$$$9㿘  h#  $  ] $$`"$0 ` "$,  >d  i 01> /!$ $ $$㿘 \`A`@r>  c`P  2#` #`J  &# Ѡ `6  2# `; $ @ `" "$$,`@" `2 @ 2$$`"# # @# `"@ʀ @ &# `   "$` @ 畁 \`"> >  b 0> 㿀 \``  0 %`@S* 0  0> Ԑ"x>  ՜b璖􀢠 `@`#\`  0#``> #d`b8#h~ @06# `#@&# \`A`@6#׋  0>  eb#`6#&# >  0T`x \6#` הf"#㿘#> wc`9!> w 2&#$c&"&! >. hc>&!&$p>> c6#6# &#&#&#&#&# &$t , @, , "#h  2, #>|`氐 # >`# % c㿐#` \Ho :(@  . kHp@ l 6# &#&$6&# "&$&#%ܐ<\&$ \&# &# / #$@"6 \ 2-> #`j&#> #ał #$`2@V6 \&$ "> ڐ >  0Ԣb \А"#㿈Hof(@g<> wc ,> > bȨ'0#" # \`@"#2 # # `(## @`$4# # `"4# # `8&## 2#Hp@> w x# ֚l"# 0# `ބ# $##'#! $#,$   좚#0 P4# e $|`"#@#㿘$ \&#LHo4$(@g$#`&$Hp@> c>  ch 00Hp@ց㿘 \Ho&(@g#L` &#L#0`> # Hp@#0#L>  bŔ 0#L`&#L#0`|>  #0ߝ㿘$$V&#P \A > # `> c  >  0Ӟc($V`2,> > Ȑ#8Ho4$(@g$#` &$Hp@Hp@# `UӠ#`0$ !!,# 㿘 \Ho&(@g%#P`.&#P#4` ` " $Hp@&#Pǐ > v Hp@X#4#P>  c) 0#P`&#P#4`>  U 0ϝ㿘Ho& (@g 2@ 1@  Hp@a@ >90:@N~@"I l @@ @  \ A``@`?`?@ \`?@#`;*``'` \#`@6 \^ @@ ``4%$Hp@ "`鿐0肐0" א \ 6 \ (6 \ƀ`"& l@ & l 㿘Ho&4 (@g b耢 # `""#`"` !" Hp@!`  a؀ 0"!@ 0㿘Ho(@g 耦 ?2ې "cb`"aa Hp@`b`aa`  ba@ !؀ ? (@ a& a$a (`@ b& b$bHp@ b& b$b aHo4(@g` `?Hp@㿐!<@qC`( `(@q=!<>  0К#Ho&(@g9% \ &#(MHp@ 2  @@@"` #` /B"v#(. @> Hp@ސ /`(#``` ` `2#(Hp@ ``` Đ 1 *ߔ  2# \`h>  @> Hp@ 7#@?x!h J4`!`T`!!䀠g`<&`(`@a"n a (`@ a!&! \d"V!#  @> Hp@x ?ဈδb̴ W6 \Hp@Ho&4n(@gg *x  " \`0@ c 0  .`<"!@ " \ !膀`@&!> Hp@05'x 7@#` `,` ,@7`< ?,`,@/㿀>  \c<' Ho4$$(@a$$`E$('  20/  ,`2   !''' @'$$`2'耈`$($` @ mHp@ >  T   $ 0 0 > Mc0Ր"p> c<@'   `\c Ho4`(@a` 20C  @`2   5''' '' ' ' @D' 2'耤 $d('$$ $ $  @| Hp@@ > `$i 0`0 > Ԓ`0\"㿘#` \Ho (@ . kHp@a > l# \  > #$`# \&#6 \&$ف> ސ#$# `xύ 0#$ `@χ 00㿈 \`\``8!<`a   Ț`C @> > &&`(# 2!` `$` `@ ) `R`a`"O#`"   >  aL 0  /#/ ?//` `@ : * 2 `>   Ț`C > @> ȁ`# @C 6> &# 0> `  Ț`C @> > %#`2$ `"    >  ah 0 ``#`"[ `"x  >  ` 0  n  `5d!b݀ e>  І@> > pH/`@@ > @`l>4` \`"E Ho&4 @(@g @ D&L`< H`$ HHp@`q>  L`2& ћ"  `W"j# 8O0W`!!"h#(#$` "#`2  І@> В%'pH`` > @`l> `&`(`@"$ (`@ ` @$ @Hp@ `G 0 #e#[!2#$> i#$ a. 0 L`> X#0` 2 > pH`` > @M`l> &#L# `> 5#T0#,` 2 > pH/`@@ > @(`l>4&#'# `h0d# `a-0]}`< >  a(Δ 0L 0`!&#   / =`` a"`\㿘> `` ׫a  㿘"  __ , 0 > OHa?`$a a$`l>a\4`\$a> d,`h$a> b\$@,`i,`j`$aҞƐ`D  ݰ !> Ҽ$ ` `l0㿘1> : !!㿘``>  D  \`2y&`4! c  `C > `!8 @ `B> !>b\@  & 7 3` @Ho&4!(@g!`h !!䀠o `<"`(`@a"r a (`@ a! &!!@Hp@"`2!!PJ 0> ې#Ȑ# /0#4@ `@?A >4 `Ho&4@(@g@D)H`#t HHp@ 7*`<"!@ "!!`&!#] 7!> Ś ҆`> Ά` `<`<&` (`@"3   (`@ `@ @> pH` (@ @ > @`l  `C > `8 @ > Hp@j  P`<㿘 2@1@* /- /@" @Hof(@\`@^0\Hp@>c& l g\ 㿘>4>`> > `p!)> Ho&4b(@gb`͒ Hp@  @   u !p )> ې p"a` nb(@  `r & a$aHp@ 2  Ho&4 @(@g @ D6F H <& (`@"6! (`@ ` @! @H` (@ @$@ l```C <` 8 @ <`Hp@0o  `@ 6  <@ q`"#! HHp@  " "" " " " " > :a؀" a  @(@   @`㿘 2 00`@  $ ?  ^ 2& 㿘  8  @2 2  2> 2 㿘 {`yw0a5'0 a6! ` `k &`&`&`&` ` @``` `" &` ` F`C&&@ <&&@5.  \e  @ "`$ "`$  ( @@ 8 `$ " ] &`   Ͱ㿘  \0  " > " " " " "   &  㿘@ "& 8 > >!``/ 2&   Β# 2& > !0㿘  `` ` ` `X@? "P a> '<a'  H !5#<' H2 Ѐ  L @bQHo&(@g 쀥`2`"` Hp@`` ` `'@`` ` `"w \`  /`  0 H`o``  `@ ` ?  %  i 2` s V  @`= C }=  $  < @C=  V ڐ `ۀMb    @@ =  A0ş@ H4T  U> @" @@} ,@ @ = `  @(= !` #"?G؀`"?`) @ a a%`!7%!(`@ b%`"%" @)= @ $ b%`"%"!H㿘l ܀`. lHo(@8$c& cc4$c$c$c`$c Hp@f$c& cc4$c$c$c`$c  Hdc8c40> > ; `d>da !(㿘# aZr  A $"`  0> _!!(`$ l$! ?`, h4 \>>aL$!$!  2$"$!ͳ$ېa  Hof(@ >  da$ ` da d ! d$Hp@  g > Ho& (@g 2@01@   / `  /Hp@ a{@"" Hp@ @9@ `2 /  `, ` ` ` ` ` ` ` ` `$ `(ଚ """"D" H"$L"(P",T"0X"4\"8`" c@8c> `ܲc<@' ?"  t#`$#@ #> `2   "#  \@< ` > $#$4$#   ܀ ")### :#($#$# 2##`2 #`$# @< #@$#`$#$##`2ݰ #`## @ $#aה # `@ʀp  \#" p2 '$ #@{#< $  \@4 \# m  $#  (# `` L @#$# $`$`$` $`!<$`(`$  Ô  `*  Ho&4(@gq Hp@ ΐ @!< .-Ho4> ł(@g> Ű` @ D6f H `<$`(`@"p& (`@ ` @> p& @H`` > @`lHp@;#$#6$##$`" # #(4`@$$#$# 4`@#$`` $#$`0B!P> a4$#(4$# 2: \`O6*#@z#< 4H# O$#`& H  Ȇ@`C < A<  L`ɍ0 `<㿘#`  Hof(@ a a  ? $ $Hp@ b YŒ g㿐`0> =!X`А /@<`Ё!<@e`(" c`(@e!< 0> $#c2t 2`2 `\ 2`\אܐ A `` `ːА 4Ho%4c,(@fc,c`HaHf4a(ga`3 aa䀠E`<&`(`@a"C a (`@ aa$aHe4(f!,@c H`%$c,Hp@~ .`<ba@ a`$aHp@`@g<`^ 70`<,aa@@  @0` c0c`u$c00㿘>`0`` P`l`L> `d`"H c` c `"c @`2c `S cL@c<$c @`$c@{x$c&`$c`ă8$`|$`xHo+(@`td &`tHp@ Ho(@`LbQ$$c4$c4$c8Hp@f`LbQ4$c4$c4f`t```H@ $c8#xؔ 0-   $cb> !p`\4`\ 7  W(c"b@`2Lb$㿘$ "$$@&$$ $ @&$㿘"ԟ@> c<' p * > c0 `  + ' >0` )`  )  `  |)  2 )> É `  >  >)  ) #㿐` @`` `` : ``` ``(`@@: @"@1> M!`(`>"̀ހ`"h$$ $ (@Ho4"̂(@g"(&"̃Hp@"̂`@q```2E$$ $"` @  \Ho4"̂(@g""̀JHo(@?c&"̃Hp@g"̀ s-$@ g@$ ""#\$ Ho&4"̂(@g"0@(@&"̃Hp@㿐  2"`!!` ؀ ??2؁ (`@ c& #Ȃ$##`$#  ` `(` @@ `!-` `Y0`! ` "$ 2X'`2 ˀK "| & & "̀"$$,ݒ` ` "$  ` `2$0@w  po b !,р0`!  & & "̒ ""!@  2# $`  l` """̀` "  `" ) @ a& ![$! ʰ((  c& #ȂL$#  -,@,`,`` -U, a / /O,㿘> 7cP>  @7cX  \&"Ђ&"6 \  T2  p W2p   "#  (`@\ c" #Ȃ@&#<&##܀ 2 #؀ 2&#$ &$ &$Uڒ &$ &$$( "$,UҒ &$(&$$$, Uʒ &$, (`@ b" #( &#( (`@ c8" #x&#x b" #(&#( c<" #x&#x c" #Ȃ&#㿘> `h 8"䀠@6@"22"Ѐ &"Ѐ`2$$"$"$##%4" ` ` ` ` ` "SÔ  $$,@x #$$$$$$$#$#> a4$$$$ > > ; `h>da !`㿘$ S  H $"`  0> %?$ l` 4 \, h>>aP4 > :$!$$! >, jc$!!`!$!!`$#|!`$#!`$!$#,#  Ho&(@> hh`$$h$ h$$Hp@ g> 㿘Ho&(@g"> (p&"̉H/`@ > @`lHp@㿘Hof (@g 2@01@ % /`"  /Hp@z@!{@H@"; Hp@@@t @ `2ٰ /װ &"`"`"` "`"`"`"`"` "`$"`("`,"`0"`4$ "$$`$ ,$ `4 0 $ lHp@& `4 ` ` ` ` ` ` ` ` `$ `( `, `0#&#&#&#&#& #&$$,` `&($,` &,$,`&0$,`&4$,`&8$,`&<$,` &@$,`$&DHp@ \`@6 \h 㿘"Ѐ` Ho&(@$$ $? @$$$$Hp@ʏ S g$㿀> 7cP > @c(Ho4> (@a> `h!> ?aȰ7  !0`Ȁ`8Ho (@ğ$̃Hp@ԟ@08(`"Ho&4 (@g (@耤`(Hp@`"'̂`$ @``  (`@  4`Ho4̂(@ğh$̃Hp@  ̀2O  `"S ̀h -,  @t Ho4̂(@ĝw$̃Hp@ - /. 8$```d $`$`<`$`(`@(@ q ( g "`> a4$`(@ ؔ  !Ò Ho&4 @(@g @ D& `< H`$ HHp@@+> Ȇ@< L`.`$(@`<2̃Hp@`` $`($( W8@@K  `, -@̀9> Ho4̂(@g̀h&$̆$̃Hp@2̀` , `  #\ @r# ϐ   % %``8ג ``"   `|ה ,`$`4`  !*@*`*`*`}4```% ` $$`?$` ( % ! @ \``"`ku(`` $`$`$` H`> p` > `l@~!> Š  `0 `2 ̀` *, &` #\  p@q U ! !,  $`(`@"G$ (`@ ` @$ @Hp@`<C <@ `<؟@ (a    ]$  ("XȆ@< L`50@> "0 `<@>  "(0 h(Z`:$`0 `` |c@  ` @% :%`"(`  (`@$̒ې!0ŝ㿘bЀ` \`@` 22<` 2<@]^`(" ``(@]X<> 0#`(6````(   ? 7 Ѕ<`(@(`(`(``b̀` 2c` (d f " d( \ "`> a4$d`(@c ͔ Ho P(@ [`xa`Z cc̀&`<`2c`<&`(`@c" c (`@ ccȄ$cbԟ@`=`C   /'!X0X``d P a 0M6`a 0>  "N| c` @&`$c.`<ba@ "ba`$aHp@`c`@$c<`` aa䀠`<&`(`@a" a (`@ aa$a 7a`<` 7$c0`<> "p  ! p> c<'  Q@\ S@"R"WZ@`J@V@""Ƞ? G@F `M@0`L@K@?`!;0 @*R"ݠ *  J  `G@$$$Ho4(@g  Hp@  OȒ 0`N@b@2?#x &`L@W $Ho 4 &$(@a&$`d> 7cP > @}cH#ܢ#5! "z" ``(!"$ $@ P" !`7 ##̀6# <" (`@c" c (`@ c#Ȅ&#@ T&@-Y@N?WW H` Ho (@"̀`@ @Hf("<?c@&"̃Hp@0%W/  >:$` (6"0Ho o(@$> 4 &$ &Hp@ "̠ &W   @4&"V ` 8 Дx р> ;a@a@Ѐ@j @"f `2@"@Ғ 0>  X"0 &Vǒ $, Ho (@a$,@q30{a$a^"́ge"$ &  LxQ "N 0` ``  $@@   > #`qHo4$(@a$ "$@&$@ &$Hf4"̂(g"(&"̃Hp@09* <" @ "@!`&! #`@&#> @!` !!䀠P <" (`@a"a a (`@ a!&!@&#@0 ) N  0Ho4$(@a$ "$ @&$ @ &$Hf4"̂(g"`,&# (!"@ 7>  0X"0"@n 7>  0N"0hV < <㿘Ho&(@g"`<`@6``<&`(`@b쀠"% b (`@ b#(> p&#(H/`@ > @zh`lHp@`<㿘 > @z~b>  `l> #h㿘> -`p+@)%#p 0H`(@%> 70 )"   p&p W y퀌 @%,怌=߀@6؀@р @ʀ@À >  ` @* 0@`(`0`@ * 2 > c<@' p` p> @`s !@ * @ > `0` @ @, , ,  ,> [ `@ >  , 㿘`$|(dj&$|`   0> :#$|$j&$|㿘Ho4"(@f"``$X$@`   `2 L`@?,$@`4Hp@*   & ]( 㿘 Ѐ` ܟ@!` H`c` t`    "Ѐ@ 2 t Y0㿀>  tc<' e l`: "7 Ѐ@23 `l`,*9``n  =$` ``$ e $$` `c  (0ݰ ( )>  `" " /`v `` `"`"` @ ް*0   0 㿘Ho%4$T(@f$T "$X&$T$X ""&$X"̀d""̂{&"̃Hp@㿘Hoe(@f  ܀ . l& "Ѐ@ Hp@ XHp@ 㿘>`0` St iHoeN(@`l`"S` @4 2 "܃Hp@ `@">Ԓa$0$$44$d$$X ` ` ` ` ` `?$$0>bp$$<$">>a0$"$"$$P$"$$T \`@4 \`Ē $ |8$ xv&`܃Hp@f`l`2 `܀`" bЀ@2 Hp@㿘`܀`" bЀ@ >  #@9#c@`/&cb@@2> @2 Ho%4 `(@ fb`c솀@@`>`&b&cHp@ b"ΰ   b  @ @ Ho% (@ f ib@&ḃ> > (`@ (`@&b̃Hp@ b2k ~lb̀N  dP(@@2 Ho (@fb̀  } Hp@dd(0dX z! dX`퀈`@! &d\ ?&d` v6dfb̀`"h(@@b > `0#єZb@@&b̚@&b̀"? r t Ђ~4" t 01`0#=be ~d|dd`6dd[?b 0@ , 0w<df`sHo%4 (@fb@@T&b@@2df`c솀`@&c>`Hp@  (dd&d`6dd `! dd(0`n 0` 0` b6dd(`0`@@b̀@ > `0K Pb"  ta2 ra((" t > ]`L  0+@&b̚&b̃Hp@ 4Ad\@@> Ho%4`(@ f`cb̆ @>`@&c&b̃Hp@    )&b@@b̀@~ > `0 vb> `0#e` ` dX@2&d\d\!  d\dX&dX b b̀@Ho4 (@fb+@&b̃Hp@ "Ubd`(@ddd\`&d`6dd ` ddB(2Ebb@@% d`> H 8*`0 bd\  $+ > `$ d`)df (0`(`0&d` 6dfAdX 2! b@@ > `0f#b̒`0a#0C&d\ `@ &d``@ &d`2&d\b@@ > `0= hb̝㿘"ЃHo%(@f"̒ {4&"̃Hp@㿘Hoe(@f"А   (MHp@㿈"> 7?c<`H' `Ha $T c@@ @ @ @1 (`@d0 ("`@(Ho% }(@f }Œ 8  0Hp@#`&#ɚ)#$@&#$ή `""$h  "&$T$h`` 6$hHp@`?2%% &$Tz  8;`(`@d0(U$h`  }//(088;`(`@d0 (=  }*`  * ~+Hoe(@f 0 ? " :  8?  Hp@$#@ &# 2$h,&$T*ɘ /|  `H`2 # ~`&# u6$hHo%(@f  ` "̀d" "̂d&"̃Hp@ >  㿘 ܖ ?"Ѐ@2?`P@"0$0 U@^X@"X$0   `R@JW@; `O@T@O  6$$P r  O 'Ho%(@f$0q $8$$4($$8$$ 8` )  "А!@,  l`(#x`6 t  @   ""ЃHp@f> 8Hp@ Hp@ # ( p`&2pHp@```  ``  hl " 0`(`@ c8$`#x$#x c<|d 0 `" 0!" (" " $ " c" 4* " ,㿘  , "c  $2 "2`& "@& $   c & ,`* @+ (@ ϰ  @( 2 (& ( 㿘 @&@ <&` H&` D&`  8&` 4&` &`c  $(&``@`&`2`㿘6 & 0㿘@`"` ``6``` @``"   L! 02 L ` (``L0@0`* " " \` *  㿐 #\#`㿐\#\ #`㿘`   (` @?߀`  4 `& 46 `  ` c   X2 (( TP*` + P@ J   : (@T`PP@ 2  2 @ Ң@`"* $``   (@ , .  (T@"0T1 3`#@ L * & , `1 Τ ̐  @0& & $ΐ 4 8 < @@& @ & 4& 8 (@@ & < @ `. x'L  &`` @``  *     `2   @``` >  M" 6 o  '"  @ @ ' (  ,, , !'? X ''ܴ '''؀2 @`` `' ܴ(@'ܨ @ 0!ނ` @耠@    L,`@ @@'䐢 h@`,`@`V(Q(R`,`(/@`耠"F @:B ,@@) `TP@    :! ) @T`P@؃-``(T@?03`,`@  L`(& -` (@@ 1 @ .  @'ܴ(@''b  '@H | % @ (% Ő,q'c0T) `] > [#@ >  T#p'@  $ @& $~& " H `2<  H @ D <@& @& H & D& <L @ 1@`` @`* `>   #  `>   # > # H `2`   x'L ` `(`@?'H` '  H '  H '쀢   "  ` %' @- `?,,, 0`, ,  `'`6 L`   X''  ''؀0L@/@,`T`'P/ @*@P@{`  @ @:$@,`@T`P@P@2@ ՠL@`e'L`` ''ܦ$, - &?5 `,@8 $ % %   ," '- ޠ? @: (@@*؄'. ؃.`(T@5`0%@`& u  p(m c0Tܢ$,@ `,`&?4`,@8` $ % %   "  5'`,`ި? $ @& $`& & $ 4` ܢ$@ !(@@`,`&?4`,8` $ w% %   "  '`,`ި?` )'` (@@0`,@ $ M% % "  `(   Ԗ( Đ%$%  (@@  @( @ `.  @ <@& @& <`@6 DH " 4 H  4 8@& 4& 8^' H`& D& H (b   (E   ( 㿘 L A A 㿘`4 `  ` 6 ` `(`>$'c  ? ހ (@& L&& . & . Ӑ"`ϲ (` ?  & LAG  b]8נ Fc)Ѡ >bL >bL 㿘 X&@ \&` `&` dc&`  h@&` l&`&` +`&``@ `&`2`㿘`  (`@9 64`&` & &  ,>  c`" h`& ` & ` @ @ "@ ` 8 1> c# X \@ & X& h& l& \ & & > c㿐&``    @(`?(`@  `2   @``` >  & ( &H    (% z%l ^(((& & @  `?& ((`& ,   @  22 ` , Y  ` ` `& ` & ` @`G  ,& ,`ۨ . ( ,& (& ,@ܺ Ԁ` `"  8? >  X| % "%  x % #  ( @& (& , $%  X ` d@@ & `& X & \& d& H > –c">aԐ 㿘@``"` ````0 `@`` & & \& & &@# 㿘@ ?Ó  >`p 㿘lĒ > 㿘`" `` ` ` `0`` x =  >>ap&`(&`@&`D` >  @@  `X&`&`X&`\ ` ` ` ` ` ?u 㿘  (` @c@ ``4  &@ "  ` 0   ) ?) ) ) 8`) ) & ,& (``&&   @ @& Ѐb@ `?(`@C 27 8` ,9 ` &  & " K $ Y $ D@'`D"  & (& ,@ π` 8R> > n "6@ ,$@/$ ")  ` d@& `& d X \@& X& \&@$ x" (0k & (& ,  ( `2 `@ " h&@ h l@& h& lϐ& (b@ & ,` c">ȁa 㿘@``"` ````0 `@`` & & & &@ ʰ 㿘@ >g 㿐`" `` ` ` `0`` x <  >>ap&`@&`D&` @> c#`#\`?   @   `X&`&`X&`\ ` ` ` ` ` >! > `t2"耠@2" \ `A2"{ `2 \(`0`` ``"5  T`` ```2"H ` `` 2"@ `"A``"=2"`2 `  ``"+2"` " ` `"2"   2"2" ń2"`ڀ`Ղ``" ނ (`" <"  `l"  "` h@? k@>kcH* k㿘"@" 2""" \"yp6""㿘> 7cP>  @kX`"h2"!`"`"! l!`#"h  D "   @> ` `  a؀`" @!֒㿘@7tbH/` /bb؃Hp@Ho&4b(@gbb b? @$b$bHp@bhn <а 㿘# ;#  O $$"2" > ֐ 0V>ÂcL>$!>c4$! !$!8$$!, k> :`$!䀎0$!"?h4" 4 \W$ U$!Ho&> (@g> tt`$"t" t$"Hp@ @9""%܂w$ l 4"4 \? , h, j&N D f $!㿘"h   ` " ``  2  >> ;w"@ %<;  :   @ܔ   `> ;T"@  -L`` ၒ`2N@ǀHo4"(@g"{4"Hp@ >a@ 㿘> > ;"@ `t@7㿀> c<@'  ?6  * ` `0Ho&(@\`@D0\Hp@ @  g\> zѐ > >  z ߐ {0㿘? 6 k  Ho(@Hp@V`!  g0> ;"̂b &`8&` ;"؂b0&`8㿘? 6 -  Hof(@`A `"`!j  #`2Hp@g`A"`"!` a؀"Ȃ`߰ ݰ"!@ Ҁ 㿘? 6  ' Hof$(@ ]@")@8 a @"b8F0v@ `[@"b@6Hp@g ]@```.`\c3`\?`53`\`\@"F`l% }@G~@ΐb`uba 3b @!@bbh~bHp@ b@`w@bb&Hp@ b`Jaiْ  "& && `h6`\6`|&`0b`3bhȐbeQ 0҂cҀ#`l`\+`h?` 3`\ ;`x#b `#b `#b3b~3ba`  @a؀ @&ba@  e 0㿘 \`A`A\ @`s )   7 Ho4 D(@g D ה  ` @3u F!`+`!!䀠E `<"`(`@a"B a (`@ a!$!Hp@  @@< <`CP<   *`<"!@ !`$!Hp@ @< Hp@  7v `<㿘 (`&   (@g> ` !"`"`!gF `4"!W @4"!lZ ""Hp@!` )"ဈ؀``(`@< a$`!$!Hp@``   @< @ ` @8`2` 2`倦 Hp@ #Y~ a㿐? 6 Q  ` lh@?    `!| 'h2s ` @8 YF$ $@  "@<` @  ` D "Ho&s(@  Hp@hN> pH`` Ho&X(@ Hp@@< C   7`!   ͖( `j(``$   ( `(; 7 ( 7     < `(  ; /gDg> Ś `Hof4 @(@g @ D" H`$ HHp@@< L` 7>4 ؠ` 77 `<(`@"$  > < p(  @`$ @H` (@ @!> @c)`l@<`8 @ ``B @> Cb>``@>` `6``@>`@8`C>` .<ba@ "  a膀`@&a>  a膀`@ 7&a>   ?77&7  ]     7@> <    6}㿘 "   . 5  " `& &   5  2     4   `& &  4   2 㿘 %b쀠" `@ 2`@? `2 $   @ "4&"ڄ H )` > ' b쀠2`"`@2!0 @$ `2!0@( 2`@  >ȁ` 㿘 %b쀠"``? `" ``@ $   @ "4[&"݄㿘   2 '`" _@ `( _< ` , `!, N`.`4  $`, ` $` $`, ` $``.4 㿘* "쀤 2    @:  2   ? @$$ " &"3  㿘 7 `"" `$`/  ) `" ``  @ 2 @  2 ;?  @  "  2  @  2 h`> c< '    0̮ܬ7b쀤 *,,"!'&^   0^  ^  `/ @ /]D ( ,`&` ܢ`(`@҂,,@&` > r 㿘 #b쀠"  ``" `$?`&`  @ "3E&"2  ߂"Ā` `?( ( o"㿘"""" %b쀠"` ? ` $  @ "3&"""  2 `@߂㿘* "쀦 2   4     @    㿘* @b쀤 J" @ޔ   !`2"" \  " , $    `2 $  , "":   0  ސ`]  $`M,` ,`  $@$`  @$ "`&"":ȴ   0֔   ]k  $ 1, , @쀠`$ ` b$ "&" 0  `]M  $`,` ,` `$@ `$`$"`&",` ,` , 㿘 H"耠2053@2 +@`'``````` `````†  . 㿘bH 5沖  @`    9 \ޔ `+ 膀`@&> @``\`@"@ b `䀠6   @`2` @> 㿘`  h > Œ 沖 a "- &a<`&(6`D  0 `@>```2 0 @20 沖 7 2& @> 㿘 H` ` `  t 7 C`Ho?(@`\`@D`D : @<`@8`CM< `+ W "5`$@b }Hp@ tHp@ g`\`@2`D  \`@VHp@ 2`` b耤 Y -!䀠&)`!膀`@&!<` F`  \`@"   `†"2!`c"!`"!`3  ~  ' w  `2 `  % r0n`@<` 㿐 沖  f`d\@ؖ Z  $ $  `,` @&& 4 @[t"@4 @&&  <)@$@4 ?4 , 4 @[[4  [D [@[<    i  [0  _   [&   xtp㿀0`` ( 0a"` .(<T`؀``l@Ho(@g9Hp@ /  `8/  2)`ƀ  }*0b(0`c`h    `2C`l`l@ L1    =Z    3Z{ Hof(@gȒHp@  & #\ #`#dʚ 7> ńhD` DHd> 'c<' `d\`#\#`̘ @ "M !@R! O `Ӱ 2H; `> =a"{ v ! ro> a4!8@ `  #\#`#dm 0 ` @`    ΂``T l"R'ذ @ > . 0`․`  ` @` ΂`` l'؂ '/'''''/ؒ  p 2 3 l2 `֒c ֖ l'*  !@   @L 0'؂ '//'''''  C `2^`3"``l Ho4a<(@aa<@آ _`$`[`W``̀2*> 4$`̃8`$`'``؆@ C B<@@ '`$` _``І B ,&@ '`$dW``@Hp@F ` ޺  `ה  2 ݂ c'ǂ@ c'ăHp@# m5 `В`  3 `  x ` n'Ġ`@j5`Ġ`pj-`㿀'T `  (`4 !b݀  `   4 !b݀+T Z  i*0b6(TT `뀧  ` <@> ńhX` X `'4 ```<>0c`@8` `ǀ b|@ @9 T0`cT`(`4 h@ T  4  p ('T ʸ>0c` @8` \  T˘ T  ` b  ~'T  X(T V  r'T  XzT6 'T > ńh  `O 0`<8 > ńh`Q [ $ \> ł`h`t` `t? `> 7 $ht` t  5T @2 @6  \ @2L"@'  T ` \GT T\ T "  N `  4 @WT4 T (#d#\#`k j ’'T % @W " > Th`  \#`#d #\B А > ńh ` 'T  㿘> 7cP>  @Za耤  )a䀠+a膀`@$a< o `X`X@"  `†2`\ c"`\`@"a`"a  ; 2 7 Аu`M  ږ  K "Ӗ  B`2`.  & " `  `؀` "`l@Ҕ 2 32 $˶  @s<㿈 \`@e  `@> `"蚃@8`C > 0U S @2 `"` `†F`` B  T `"` `†-`cĦ b"*  \ @  `  ` `^" `  ` `^" ` a  ^  m  c2c "` \`@"耢 2 y "v @2 `"  `†h . a = a` ؀` "l@QHo&(@gN Hp@` ``W  N @> Hof(@g[Hp@Ӓ@a8` 㿘 \`@fސ"̐+  \6 \㿘 \`@""`@@6 \"Ā`gX" > c<@' ` 1  H`5@2+ "耤`2`% `" `2@`  @``@`` ` (( @ @(`&` @ >  @   0 T n ` &`  +n @r n` `mg @``0@ܔ  / / 7 7 7 7 7 /7  "`$ꆒ`$`B- 0- @ @(` S” n ` &` 3n @. n` `m# @ٝ``0@٘  / /777 7 7/7 "`$B`$-- @ @(`m&` -- @ @(`f&` h 㿘"`" @`b@`"`@``` (( @ @(`&` X  '  b耤  `0 ` SG X n-`&`pX$$ $ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T``WV @`0@   $ X, $ "`b@ , % `, &`$ ( `, 0 `, 1`$ ,`$ 4 (< H 0$ P B$ T 8< 8 @$ @ `񀠠"` `$ ``" ` ` $ `ꀠ`"` `@$ `` "` `$ -- @ @(`) &`b@`B--`0 @  @(`@د` `0@ت` a$ ` XX, $`R օ-`&`@`ͤX$$ $ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T` `Wɐ-- @ @(`㿘` `` `H`@` ` @`?&@&`( @`` H耢`2`0 ` `@2@>ԁax> > ; `x>da "X㿘# b &֤  @ $"(p  d $"$"Đ">Քb`(b$"$  b²$"  0> %>Ղa$ l$!>>Ƅc!$!$!?т , h$> :, j`$!$!  D 8 Ho&> (@g> xx`$"x" x$"Hp@ 㿘Ho (@aHp@㿘> `x 9Ho4(@g ؀`2؃Hp@`""0`(`@ a"`!$!Hp@`"  ap> c<@' Ho (@g H@>80 a@"~ \(m =@> A@B@?@T> S@.P0 O@t800aC@D@w >`0`/q or "j H`5@d !"  XZ @S M@>A@F@N@F >`0`/@ >A "9 H`@",1 S@;P@=>@@bE@" >`0`/  > 'b@r# $` cɒ@ Hp@@ > b@` >`0`.  0>@SB@0aX@ڰ  H`"6 ``X6  R0`. V0. T0`. d. b6 L. (> 0&$ B6  8>(  &4&0aG@<@ >`0`.  "  H@` b@`>   H@ 耢 2 0   2 &  `X.$ `"n @.% `.&`&( `.0 `.1`&,`&4`>8`&@`>H`&P`&T ``"` `& ``" ` ` & `ꀠ`"` `@& `` : `6& `0`.5 36 ".  H@2* 耤 2 $  !   2 ?c  `2 @ 䀢 $  $ 2     2b2 h" h2  +`0`-ݒ 耤   Ұ   0@՞  2 ް>`0`- $&&>`0`- ">`0`- b      0@`  2"    ? $$ % x>`0`-v tw "o  H@o`2i b2 $ $2X `0`-S QT "L  H`@2F 耤 2 @  =  2 ``(!1 ` . ``$Δ ;`h`0`-  (z$d5!c \`20a0 `8`2  $ #N y " " " "   " " $ H耠`" `$"  #5 }! "  " " " " " `" `$"  \`9Ԓ @l \`4 \7!/     @W \4 \7!  $ 0`"$ @  $  @ [ $ Ւ   $ ( {P! h`u  0p㿘 "耢`"耢`b?   @ $M 2Ho&4"(@g"" "? @$"$"Hp@"@װ Đ$' 㿘  H``6 H\`@耤20@2D  b  c `"`†g耤`1``@`,` h`2@"@  "  T @ݔ 2 @  b``T ܒ@̔  "@V ܔ  ? N Ho&4(@g䀠 <& (`@a" a (`@ a&Hp@> pH/`@ > `l@PR >  @Җa 2  ``݀`8 氰 ``† 沖  ޒ v  ِ N= Hof4(@g䀠 <$ (`@a" a (`@ a&Hp@> pH/`@ > @O`l h`耤 2 0  h`2&  a<& ( `D ߔ  `6   `@8` 1Hp@ `B ݔ n``D  - ``@8``C > 8 @ >`& `<& ( h; `6 `D Hp@ <` x  > ݐ!(_ <@  T|444XP@tX㿘`` ` `(`` ` ` `7` / @2*`3` ( /`+`*     +     *@  >`````(````7`6 / @3`*`(          /`..+ +`@   ;````) (`@(#``(`3 ` `!(`3"`"`#(`3&`$`%(`3$``(`3 3`+(`` ` +/00`+)++00`+,+-0+*+. 8```  `"0+/ +/ +/ `%  뀠`2@ h`2 怠`2%"0 䀠`" ```"   @ ۅ(    䀠` @+ @& 8 ? ( `  8?`   8 ?@` @    (`?(`?㿘` ` 倠`   倠` p 82  82 㿘 . . `#  `"   쀠`2 . , e  (     * , .6   > > > > 6 "6 $6 && .   ".   `  (  (2(  ((2(* e  "``   㿘 `.  x   2% 7c(" 7 @ږ#  @*b@8 `? c@  `?c   2 " 2  "a@4  H & H(`@*`>܁bT2`>܁bT 㿘 h`  ` `Z\@.`6`ۑ h" . ha*`ғ2` `& " 2 2㿘`   P . . & ``N P . & 㿘 †@. `` `Ր 8 `&  `" . , 8 2" 㿘` `  6 (``  ``"``` ``" `` `䀠` *`    "㿈6 . /6`@. /6`6 . ...//66@ //////6`6//ѐ`?㿘8   `Ͱ ` @o`?㿘`/````` `   ϐ   ` ` `$`$   L `†` `䀠`  `` ` 㿘 ``> M !@㿘 "  |    |`[c h㿘> 7cP>  @M;a `  ,0` `. g . 㿘`Ho (@g o \`@k!` !!䀠b⫒  ] B` ....."*> +`+`+`+`2+`22`A`. 4$` &2 ` IS &`$`$`  ,`<``.`!􀈠<`!!䀠E `<$`(`@a"@ a (`@ a!$!  `>C B< < Hp@".> ސ!X.& 5$` '2 ` 'I ` ,`<"!@ " !`$!! ` aa``44 4  B 4 ///// ?//`Hǔ Ho&2(@``.`a􀈠7aa䀠, <$(`@a"4 a (`@ aa$a```>`C B<`<`Hp@g`a`$a,<ba@ 2a` <㿘\`@``@`` d```䀠`` .ݐ @ $ @ W ., 㿘``2`.`䀠` `"`h``.`@``&`㿘. ``  (`>ڄhܐ h . .  . `. / .  . $ `& Ɛ  .  h   . . . . . .    . . . 㿘 〠`S`#`" ``S ``W``O`瀠`"```O``  `? 􀈀 瀠` ``(` †`͐s `n ````†```^  `` 耠`R  `"`J `F `B `㿘 䀠@C `B `*: *`/`") .. . , e 䀠` (`>ڄ .Ր @. m! < `. e  `2 8 . . . X X*`2` , 8 . . .  8. /. x     R T V > (> 0> 8> @6 Z6 \6 ^6 X h& H  (؀ "4 倠`2  ? ? ? ? @'' 2 2> (> 0> 8> @ a6 X "6 Z $6 \ &6 ^ 2  2  (0*F % ( 0  < $ < 4 4  X 4 ( Z4 * \4 , V4 .倠 2@  2 (7 0  /  `" ` "# $x         0 & H`$ `倠` *`>@㿘  ..`5 *`/@㿘` &` \`" ` k" ``` " ``?.` `倠` `ϓց㿘``   & `".  . `߀ " `@".  .  퀎` 0`&  & & 怎`@㿘   0yb ` ` @  &   " 2   `b``@@``````|0*,`3`       ((@2`+ +`   * *`@ &`6` 6`">`&>`@`\@2`|`   X(o4 C 2 h` /`2``hWM `>`hbU@;㿘b@`"y  H@F "耢 2 0  2 `6   Z@"R0aP@"`b@aR T@IU@"j( @"pSP@BQ@ `L`   (`K4`V* @6Y@ ` 9``,`d(`@`2(` @"`T*+`VaS@`R0`. &`װ `, < 04`b0`. (`:b4`R  0`. b 3 $ `$ (`<b4`T`"` `,`L"`4`V .`.` `Lk> y _`X@`  6$ v$ 㿘  `  "  ( ":     @ ?& . && > ̐!h *`>` 㿘`䀠`8`(`>ڄ```2```2.``†" ``쀠`2```"``` `퀠` `` ``` .`.`>?``2`8``2`8``` &`.`#`*`0`†"&``8`"```쀠`"````"````퀠`2``쀠`2א``2Ӑπ2`ђ `퀠`"```" ```"````"```2``†`"` ``&``,[`8`% e`"c``뀠`2_`` .`&`.``퀠`  `` `` .`.`.`7`†`" e``X e`"D``뀠`2@``.``.` &`.``†"``8`JV] `†2````.``퀠`2 `````` .`.`.``"``뀠`2``.``"``뀠`2`.`h`v e`"Q`4`` "``X````  ` `4.`T`.㿘`h`  ! ?  .  0. & "`"` *`  L̐ ڒ X&  `& `$   `&  & . `(  >9q& 㿘 e`  `2䀠`  2 * ee* e㿘`` 3 * ׁ>ڄ,`2k`.`*`") .`)` .`-` .`.`+`" *.`2* .`*`") .`)` .`. e.`.`+`" *.`2* .`*`") .`)`# `뀠`(>`>`>`>` 6` "6`"$6`$& 6`&ܐ ..`g!.``".` .`.`  ".`p`" `&8 L ' & є 'A`pÔUp`` `%8 - & & Д &A`p6?/㿐  'P`P``2  P ;`P@ ?P  'P  AΒ`BP`B• `ހ (`؀ `(`  /`@ " .```Ph.``0+#` `PP"@P2PXPP㿘Hof4(@g`\@  Hp@l O Cb H ,] P .X 0 0v `",  "(G hE `C 8A X? @ ڐ8 H ؐՒ1 P ֐B* 0 Ԑ?А`\@ hR 0  Ґ / 㿘 h` HHo&(@耢`` `"@`@"`@`2` Hp@g耤`` Hp@0㿘Ho&(@g  0 "2 R2 V/?2 T2 b!#2 `2 N  "* d* L" z Hp@㾀"> c<@' `0"?`8 ?  a2  @-a@"    ? $$  "؀ 2 @ > T!㾀> c<' `0"Ȁ%"؀ ! 0`0%   ? 02??!@``0a??1@ 2  > 0To!㿈"Ȧ`e J⸀   $@S  2  @L  2 ؀`2` ``@2@ 4 ! @a2 @"`` `? $@$` 㿈"Ȓې 4N!  9 C` $`` $`@  2  @  2 `?E`؀$@ `$؂$`! a1 @"`` `? $@$` +㿘 \a"䀈`""ȁ "䀈`"{Ғ "&" {Ȓ  "`&" " kk `x* k>kcH: x㿘"ȀG"䀈`2K \Hof@(@"܀" "? @"$"܀`$"5("쀢``5,` . kHp@%$"$"$ l X> :x(@ `(`(`(@@(`(`(`(`(`4"$" g"ܐ~y6 \0㿘`h` +Ȁ@$`؀`"`l`l`\$l?` 4\`h`x`,h  :ax((@@@ `   *`*`@ `>@ @> 4҃Ho&4ւ(@g"`X> `|>  ,0 (`@$ ܂ (`@   (#@   (`@$`(>5 $`, >5$Hp@ ҃.0`v $`؀`2|`l`l> !$l0~`0`\?` u4\a4\p`h> `㿀> c<' >`0 `2@@@"{b*90!@n:@"Q7  > @u1@9 @2 bȀ`"  \`6 \`"x @  ۔ <ǒ O†`j}   `Ȱ   \`@_4 \0bȀ` 77777777bȀ 0 > ~+(b7< b = 0   ؀` l@-$ $ l bȀ`" |bȀ`x isq @\ 0jQɐ!ЃHof(@g/  \` 4 \Hp@0Ni \㿘`` Q`> `|?`&> (0`.`<(` >+``0` 8"Ȁ@2""Ҁ@2""ր@2" \`A`AN`` N&`6` D  o `c2  `\a"  \a-" @< ΰ  ` ` "`> `|`@6`&-  2 `@<` > `@3  " S ``6 ` ``&` &`&`㿀 \Ȃd 6 \!a"`"!AF  "" \`\`A`A"! D a膀`@$a>  "`2!`l ؀ 2 \{6 \ n `؀` ր@"iҔ _ 7֒ 7 <҃(` @7 Ô  6  | a`9 aa䀠X <$ (`@a"Y a (`@ aa$a `8`@C<` b" `@<` @> |" @v> "@ x, <b@ "  a膀`@$a_>   < ( 4 4 & (`@ a$ !W&!ԁ a膀`@$aB>  < a㿘 3  >c""㿘" i  ( ""$`  0> |U`> @k" ??a4"!>`$!$!> c$!$!? , h, j `4"֝㿘   > 2v>  `|> ;w"p   > 2i>  `1> ;w"> }"  `" Ho&> (@g> "#` 2 HH" hH h l H" lHp@ `?> (c`@2" @2p@ 2p㿘Ho&4(@g  2 #@Hp@ > #H> #P> #X> #`> (Hp@ 㿘Ho&4(@g  2  Hp@   ((@" Hp@ 㿘Ho&4(@g  2  Hp@ `" h#@ > #H> #P> #X> #`> (2 Hp@  l l l? @" h" lR `(`8 ?с &?*!*!?с*!`   ` *  > ;>*b("   >Fb 㿘!,`  V `? *`@Y,@ > > >  b8P|P+㿘V  !@Y 㿘 `@  > {"p` "  `  `@ 㿘 ``> {ِ"  㻈> 'X'P'Tc<@' {o "->   @>   b> b> b> b > 0|1"P'$z> |% `@ > |#(PNp"x㿘 `^ `UL  "u>  ? 2 &@ `'`%`"&@ `(`` :@ @4+ "b> `(`@`"&@`"&@ &@ `(``@(  @  "<>  `D``C: `52  &@4  2 0ԀbҀ`{т  `D ``C:ʂ `52&@ &@b`{2&@ &@> >  b80{S+;> >  b80{L+[> >  b80{E+L㿘  P P @81ֱ "Z>   `?`(`$`@ ` `쀢```0` 瀠`""@ ``40ѽ  2 0(`̈̓>`((`.`0`  8?83`ے?c 88@83`> >  b80zӔ*㿘 `  "cDcD`&cD=  "cD @``퀢 lb@&b㿘 ` 0 ` 0! "7>   `*  cp `( `@@ `(`0`+ 0`+`cvcr(6cv ) 0`0`+`+`c| @`46c| 2 0. > > >  b8@zm(> >  b80zf( %> <' @)@0Ӕ (> ;@0Βb@0ʔ (> ;@0Œb@085 > L̐"x> c<' ޒ !@АV !! ’V @VV @W!,`  ? * 8@ > L"㿘 @!0`  @&4$&!,!  786 ( !V VV @V  6 V !tIV @V  6 V !g<V @V    &!,㿘 " ؂` & ؁㿘  ؂`& ؁㿐```"   `-   ϳ(`0`" `> ?aL* @ 4 , 0`#5 2 x#j@"  x #@2 x㿀@!> '#<'  / > K"㿈>  <' `@  @ # T(`@` (``0`@*` @*`2`0> K"㿐  .@@?`` ` @ D  @Dy C>   `:    cl(`@(`@(`@@ 1 + +1 1 + + c!`4&cch  (`@(`@(`@@ 0`* *0`0`* * ct &ct2 r > >  b80x':㿐 `   Ö` s> ?aL* @ , 0`#J 2 x @ x #㿀@!> '#<'  /ƒ > J#x `   zܐ ` *`s`  0㿐 `    ] (`7 2`㿐 N`؀` .  @&`?x!> #<'   /ْ@,~\ > J#(x!> #<'   /ْ@,b7 > Jo#P㿐clc`@?` `( נ@ V  hc (` (  cl `(` @@+ , 0  +`+`0+`cj0`+`ck+``+``+`cl`2I  c2c 44`Ԑx& c``"R >t,` ,cXcP@`<&cPC>cX  ( c@ c0?( (> >P`] 4c#\   @ >cT`&cT (`h(`0`+ 0`+`cv0+ cw) cvcpcz6cv6c|6cp(`0`0`) )  ` ,, c , , , 5# c  @+K 4 @)h (4*  2#\?4#\    @j >cT`&cT*(0023 + 0`@@@ @?(`00`@@8 @4 $`6 $      & & ( > > >  b8xv'㿘 (`z`  e "cT   /6 . 6 . ?. c& cx"& ?  ) ) `,`) ` ) . 0 0) ) )   (``@(`0`. 0`) ct . ct. ct0`. ct. ctch`&ct&ch"`  (@`(`0`. 0`) cx&c0+@c+`c0`+`c+``Ԑ@ $    @Κ 2!cT <cXcP@`&cPC>cX x      ͩ( ` cT`&cT $ $ u 㿘`Ԑ @ch ̔  , .  @ >  Ё  ((`, 0`(`0((0( & |6 cXcP@ < &cPC>cXac@ cT`&cT㿀> `آc<@' !:``+? //>(("@ { 3ה````!̑cT`&cT@ > ۄ  0@' !0|00HL#x㿘 ͐    " " (`(@(`(`  #T`"cT 㿘 `" `h\@e 2   "lcT .0`0`, , bKbb`Gb"^(&bVbbc*@R<b(`0`0`,, 6b (@?o@(`0`0`,,  (@@(`0`0`, , @R8  `@R) 􀦀) Vb 沖 L " cTذ ή  2 cT`&cT(`0`0`,, 6b (b@o(`0`0`,, 㿘`Ԑ@v\&  D   e Hof4>4(@g>4`@D> <&  (`@"L   (`@ ``@> p#`@H/`@@ > @5`l  `C << @ < cHc@ `@ &c@>cHHp@H` H @< Hp@ "cDLcD`&cD <㿈` @ &  `W8cD`&cD "cD`؀"28 ``!2` D   e" Hof4> ł(@g> Ő` @ D&6 < H`" H @<  L`yHp@ cD`` `"`'@{>  0Ϩ  2`> > >  b80t!$U& (`@"F" (`@ ` @> p" @H`` > @4F`l  `C << @ < cHc@ `@ &c@>cHHp@'  b`o`m&c` 2l DWcD <v0> >9a,!0㿘1> >!0aHA > ;bC!0㿘Hof4@(@g@D $H`&HHp@  ~   !$ $  <& (`@"& (`@ `@&@Hp@> ;b@3Ű  <㿐`@  @9  8`@C9 `2 02` "cTcT`&cT|6 > L  cT``؀a` 2cT'a `"&c``؝p''' > /Ք/!> #<'  ?//''''' > E#x`"   <8@"'ܶ$u 2  $m   @ɐ ǎW 㿘Ho&(@g @b"> !H ?  `(`& @ ` h l l l @! h! l `!H`.Hp@ 㿘Ho&4 (@g `5>  p t t t? @ `& t& p d d d @ & d(`0`8& `0`"* x> c <Hp@" "ǒ  ð   @ 2 p> > >  b8rG"S | | |? @& x& | x | | | @ ?& |(`& x`0ĝ㿘Hof4& (@g& > c   Ԁ@  ` 2 ԃHp@s 㿐`` @` ` ` `a``" `` + +o^`D  `a`#В   2 @ 2 ` 2 ` 2 `2 `" " ` " ؈`" " * * `* " * ` `" ?"   @$ ```" a`` #/`` a``" @` #/a`@`"s$#h`"$#h`"o`H``2cTb`` 2ZTbt ؀`@N`0Hof4 (@g `2' > `?`(`$ p p t $ t>  `$ `  ` d $ d@`d ``Hp@ >  =ȁ` ``a`?@@"a  `0  Tbv}bx Tbbbd`@4#h`J4#j`D4#r$#l4#p`L4#v`P4#z`T4#x`X4#|4#t`\$#$#l`L$#|`D$#t`H$#x`P$#`T$#`X$#`\$#p$#k@ `````ڐ#> ?aL* $ x x |"$ | > Hp@ M 00~   @  2S Hp@ 4 㿘0 @8@ `@)`@!@  `@! `@ `@  @ p ʁ{  &ā4Մ 㿘 >  h> > ` H ! h !> @#` !> @!L!> > cT  > @0Ԓb> ; b㿘Hof4> ;(@g> ;b> @}!0> c &> > c L``"%  ` `#```"#` 2 @`2 @`2퐔  2 Hp@"ݐ #``@ "#`Ԑ 㿘Ho&4> (@g> c 2 0   `2 ` ` 2 Hp@ 㿘&& Hof> ;(@g> ;`! > ;`  > "@ @ > Hp@#В   " @" & >  @Ғ > ;> ol#㿐`) Ŗ ؀( )  W W% !  WE`,;#D `&#D`2`Ԇ҆ `܄&/``@# Ł``Ԓ ` @&&`&` >   > > >  b8o>$㿈 &S ?7(`0@?``2` @@*F  >)  0L(`I         (`"@"F `Yz, -`0`0xv#\#`+ 3  > ɔP "DŔD`&D O j ) 0  @     x(`@ (  `) 0`#@v#@`$6xz(0` $ (`6z8` h?r @,0`,vx"pt,0`, @6t  (`8`u r6r> > >  b8(nh((> > >  b80n`(3㿈 `>   `(`  ((00`(`` `    4 ` @ ` `c|(` @(`@(`@ $ ! ct%`> cxa c#d@#`#h#\ > @ "cDȐcD`&cD &c| `+`cx y c@  #\ > ݔcxK$  *@ 8 n`c|ctcx> c cl @0`0`-`-@0`-`-`]ctc|"6chcp00,,0,,  (` @ (` @ (`@v `) h`cDcc$0@8`&cx    %&cp00,,0,,@,c| $ ct> a`> >  b8mz&Vcl@&cl㿐 ` Ç   cD`&cD > > >  b8mS%w㿐  h`؀ `d ", , ?$ 2   !$ɸ  ! @ !T WE ``d> ΐ,  "@  `π"`Ԁ "cD÷cD`&cD @F@`D `h`"/``Հ ђ` Ȁ `؀`@ {1] ђ> >  b8l$<㿘 `@ ".cD (`@@)oV `(`0$00 @4``` E >  f 4cD`&cD> Z (cD`&cD `  2 > > >  b80l[)``6, `-` 1 @  `o6``怠@  b `e `?V``*`@I @ #D  @I#  2 ``o6`ӕ 0`4-`-`1 @1 %p(`01 0@  ؐ o$@6` ``" Ŵ`V``a@HȦ #> `֒ 0`@  `ܐ`.&`0pޠ V`> > >  b8PkԔ+㿘>  bL-/> +0;沃Ho4 (@g (``C(`Hp@>  cHo4 (@g (` a2(`Hp@Ho&4`@(@g`@`> ;@`> ;@+bHp@``b$$`@$@Hp@$ D `@G  2 `09 ` 6` Ԁ@2 ` @" `b Ւ "C#T; ` `/$@$ `@$`@Hp@$Ǹ %  ؐw0ؐ  T> m   `$`@$@ `$ `@$`@ߤ`$#T-@ R ` @("  R `6  R `  (``"  (``"  R `6 㿘@ ` &@ @((`9 8 @((`9 8`@? O@` `@N@`` &`?8NN`  ` ``+> w @#  @ @ (   @@@(``    ` ߂c@ڂ㿘@` T``&`` ` ("``T``6` `` @ ` L J  @  @HJ   ` ```2@`8`` 8``"`-`N8 "` `9V A  2 `@ 2 2@$%   +@ `2T `  "   "  @2 @D " <  2` `:` 0  ( * " `?" 28@ ( 㿘@` @ d L@ N`@  ` [  ((`@ & ?!@`(8``` ` ("``T @ ` ` (2``T @ *` ` (  $ &`"  (2" "  $ &`"  ("" " "  &㿘R ` R `6 2 T  `T `  T `6  2  ` `  l@ ` `א 㿘  p@> wc< : "   P* " ( 80& P& T& X & \& `> w& d>@b>& H>a& & && \>>@bH& &  㿘`  p  l $㿘> c@ > ( h4! h2( h`1> 3>  hc(`  G3> w  &c< h (`@  hc<> w> w @ c8?) 2)>   ` > > h#h#㿘> d    d$$ $ $  4 ,  `" $ $ &$    >  h@`0㿘@    @:  @0`㿐'> h4" ->  %> w> w8c@` &k8 &f$8J?`" "`" *J" 1> ;> ;@$ > `` #p"8&#,)>  `@`[@ `9`7h  0  /> `h @k08 0&  `)`H`" K (  2   !(`. @86  (8  8`@ > aH@8 !(`86  @   @ 8 > gx` Ւ @! ͅ(㿘c  2 `2   "     "  " `D @"  ``! ``2h  "` $` ` `  `   #           @"   `  , )  > f`  ` `! T P8@4 P@ `  " ``` > fђa ```   "   @d  2 k@ @;" T` `"``@"  @# S `H `"#```2`# @ "3  $@ $` $` $`  $` $`  ` ` O `t  $  @>  fh`0"|@1 $`<W ! ! $ ` >  " @ `  2`" > > `Дf?  # `" `"$` ( ` >  f'`P0> d!  d  ` d"! dʖ㿐`   n`D 0 , 8`@" ``" T ? ?  ? `@T  @…` `` ` &&. @$` ? & 6. `   `6 @& . `A `b-T 8`@]  P@/ O) 8`` `> m =R 29   "4W4 &- `2  "̠  8W `J +`P8`@ $$$2P$"$ ! q 78? j`" ``&&$``nl ``&&$` `d'  `' &p+`8` "  @""  W @4 `Q `U2 `뀠' `  @2 @8`@g "`4w @p v@@  @ 2 " >  dĒaP daW $ >  > d^!0㿘 [ x`   Q 2   2 0 h  2 ` v v ``@  v@ @: 0@v@  @  2 㿘 Ē 2 㿘 > wcD 'ހ`a  @'ކ a @1 @@ !(`! @0  @ 0  )  @0`  0! ! @ @/`    0 @1 '@ @ @@ !(`! @0  @ 0  ) @0`  6 !! @ @( & @0'@'1 '@@ !/`!'@0 '@ 0  ) @0` ! !6  @ @(    & @ 1 '@'0 '@@  /`@ '@0` '@ @0  @ ) @ !7`!'@0@'@ (` @ 0`@`' a6 &@'ނa @ @@& (`! @0  @ 0   ) @ !7`!'@0@ '@(` @ 0`@㿘!> w#D`  $#D "@ `h 㿘"  <`" 4`N  @ f  & 4> =a> D ` > D`6 `âɐ?c @ɐ `?  @`  @ @ `j @`@&`8`$`8㿘 ` @   `  ` @ @V   9 -` @$1`v v ` > `# 0`0 @2@& v`v @؀00Ӕ&@ ʀN`ÀH`0㿘  v`@ `   @` 0 " @2@͒ Ȓ  ꀦ@   㿘 v. v  R  "R  @J`>  @b$`$  @"   2  @   2   v@E@  /`2(``& & $` `2 `C `?@"8``@" 5$ $` 6 & & $` `"``& & $` @"  $ x2 @8`9 `4`2 aa!㿘 " "`  `? @&@&`  `@㿘   7> ;> ;c Q  > $  ` l4 4  l`$ l `! l$ "`#(!!!!"#",""!#<",!#D"4!>  `l 㿘` '    `  -``.`> `!؀`Z` `>( - "߰ 9 } & ``԰ ϰ `ɰ 8$ ` @$ o&у  `" 9bx l B    2   9㿐> `lT'T'X'H'L'P Q' #沀 B  `` 2 @2 " `2  "  @B 2  @8 2  b*  % Ζ H  2    Ѽ 6 > ;c  > `)   > ;c> `x* @  㿘  > `.   -" > ;c  > `x*`` > 0(@㿘   @> ;c* (0`@"2( 㿘> c@)> ;  " ` @ #" ``%#@ 㿘 <"k ``( 4\`  4`" v  ` `"  v& 4 ` ` `& 4 㿘> `x+>  c0)> ; ``%#l "`# "` @ # @ #" `@ * 2  )> ;c%(@ ,(@,` , "! ?  >`p c ` *@ *` ``@  ` @*  #>a\ 㿘. 6       "@Ȑ ".`.@`@7 㿘N`2)> ;# `%  " @ߐ 2 , (`$ ,  (,1  (1 0cP  0    @  ,6 (`  & , &&   @$  (&#`& `  `㿘'> |   *  )> c@ > b0 "   $ *   2 % |`  (` `l |@8 㿘 p 0> > `  S̐ p $ ?  @$ $    ? @ $$ `]ZS p 2    ` 㿘> a0> a4 p& ` #> (` $#>  @2    ? @$ 9$    ? @ $$ `( #> Sk`` T^ 7 p" " " " " "   $p p"" "   & ` > \"#>    㿘``4a" >  ` >@c> ]"@> ]"p㿘  > ` ? ]"㿘 >>  8,& 8 4`(# `2> p$ p( @  `" % t 42 H  1> R!\`߀`  1> \"0]I"> ]F"㿐#> ;c `   $ #\> >  Uc> !> w `t#H>+bcd#H-  $c > ]$"㿘> ;c    # > "" "  " t" tt   t&  㿘  `8` (`      %> x '> ;1> ~* x*x  } % x& $x.``  '> ;@%> ł`> `> `x3㿐 x   > > !\cU#\M> c@> > 0 4 0+`|      ($  `"( 2 +`| > \|#㿘 @ 2 㿘` ``'  ^S ``7 Z 2^ 2^ȓ_) 2 @  8 4" 8 `` @ 2㿘 8` 4 "  8`  $ 8  " 4 `2 4^ " 4 & 8 "% ] $ 4 `"  8`"  Y$ 4 4 2 8 3`` ` 0m$ 4`2 8 `2 8 3 3 0[$ 4h> c<' Ho4`(@a`  / `0` "` h "`4 Hp@@ > &` `` @  N " ``^ ް ``` @ ԰  4at `i>  h "  l 8`" 8$ h l8$ l 8 2]` 4 @ $ 4` @> p` p&  4a@ `"&`4&`4<&`84@v@&`00&`Dt&` t4&`,`4ݰ +>  Qa\ `0$ 4``, v@$ p a\Pb 7 aL `` @ " 4 2 4`4($`4`  `Ӓ 2r`0`, "`0 4 t`0@"2 4`$")`  Ք $ H h " 8 o a\PG 0 8` `($ 80 &`0@@|&`-#`!ؐ  4($ 4 `$ $ @ G$ <` ` v@ qP 2W``@" 4 8&`$ 8 4aA` [`0 $ h` @ Ւ "  h "    a\O 0` 0p@ `ZP8< PX v< X``, v< `"8$ l `4` `` @ " " r`4@%`4 @ K' `$  4@" h l " h hZ#("`@"`@*  4@[$ 4] 4> Y+#@`@ `"  @ `@ `="  `@ < `$    4@)8`/ 86 k``( 4\`  4`$ 4`4('%`4 v$ 4, v @ے` ` v@Ю ӀP> a0Ho4> (@a> `t`9> > `x` ".`@ @$(`   ? @$ -$  ?   @ $`.$  @N``` $```2`Hp@ )Xx` ?$`   @ $`$   D@ `  '  `v] ʒP> > `  "+    ? @$ 1$    ? @$` $  `(  @N `  &  "    ? & & 쒒 X  &  D@ `  '  `v ђP 'D D@D D''0 '4'v< @  D8`` 8D㿘 <@  4 ! #㿘 4@ l@  P'Ho`4 (@a '''''''''''''''''b   @ "  `"1'    >  ` ` `''''''''''''''''' @ Hp@ 4a` 8`$ 8Hp@`2 8  8> ' 8 `$ 8"'4b ''''''''''''''''' ''0'<" 4@'@@'<4 @2 0(>  c<'@' 5>`5 , 0` '''''''''''''''''`L '' Җ̀`@ `   `    7 ` h ,0`  "  8" 8 @@"   2 @`~@?ǦA'j ''  ̦ ̀8@!&8> Vv#@ ` @ @ `" &@ &<  `&   ̒ @ٔ 0&@ `̀   @ɖ 8```{$ 8`n0j> )א 㿘@` ``` ``0`"  @`- :1  @    $ $0w qy h " 4 8`1" 8$h4` ``*   Q$0h} * $hX` \` \@$\$hP> 7cP\>  @E`Yj L`  '@:Xb A "T   `?`;`8'@0> `"'@`$@'''''''''''''''''@  "Ȑ 0 @ 0Ƥ 3 > ` ʀ@   @@ "'' `" 4@` 4` A`` $ 4  >   `  l''''''''''''''''''  8>  w` 4k`?㿘"  <`" 4`  F &㿘"  <`" 4`  2 &[8\0\0\[[g hii4i4g g g i4  ` " `"" `( ` ` ` ` ` ` ` `  `$ (9  ` ` ``  ("`"` "@"`"`"`"`"`"` "`$"`("`, "` "`  "`:@㿘 @ &` =  XA , ` (@&` ``@ Ф   , `! @ ``  @  6.6.Ʀ  ¦ 耦ä †`߀ `'  `ր $   "蛒     ' '  ` ' P  D@> :a2 `f " _ `2X  'Ȓ  f`` ``"'` `$FX'  "8'Ԁ @2 '  '  'ԘC ```" ` `4  X0   $  `` `@&`  ΀ '''2` h4`< 4`T\`$`$` `ʔ `@&`> @c<' "j`| @. D  0  D <'''` '` @''`\`2& t`(  428 H   ͘`` `  ` `$: 4  P' t`" 4  "@ t "&/Ҁ ђ @W' 4Δ H !''''/ /''/ 4 0ʐ P$  v (`m,  8$ < <X4 |4 $ , 7` "`&`@&`> & 㿘 ] K T  X X     Y    ;( `K 0 & & &  @} ,  @`( @@&@```@      ,  ,44, X  Ŧ         S n 㿘 4`   > ;  c4ĺ 2  44> 'b@}A  #) $ 4㿘`  ;      * 4 *! '  " `8    '  " `0   `" @?  &`8հ  `2ΰ  &`0x e `a   '''܂ ''''`w   }Ho`4؂(@a؀`(` Hp@ C U' @@&& >_ 2L7Hp@ >    Hp@> `p  "`  %Z  `@ " 0 i>`0`(( "@|C"&7  㿐 T'T'X'H'L'P'> `l` #@`g `` 2@`@2@``" ``"`@2@` " ` @Β 2@` " `0 @Ē 2@`0e   i`8"`4 2@`4`2@ % b  "`    ! 4!$   9 Q 4` 4e `'    ! 4! 4` 4M !$    " Z  (@@"i@ (`88`8`4?"`4C 2W@`48P`㿘> b,  0 X4  @ 4 5> ;3> ;7> ;cD46`!$P> b,U`  /> ;`?  `? ` D @ D`? 2I@`? ? 5 2) 0'''X " `X04 v `(  a<0`":7  `7 > ;> ;cD4˖$` 2뀥`̀À @`'``@''' `X 0`$ ``?  a<0˒㿘> b,   h X4 !< 4 V \ $  `$ $ 3> ;5> ;cD7> ;6`4x$㿘> b,`ڒ @  0@ X0  3> ; cD0`5> ;7> ;cD4R$cD0`> 'P'L'T'X'Hc<' L''x ' `!    7 `>  `8   N @ ` +`W h (  ? 7  >`0`(` 4& X 61 @&g b - (@a^ `빸 U  2_ `O   "& x` `> ;0cF"````@  > b,.` 24  m  r @ "@̐w   > ;> ;> ;cD4$ l j4 h 7ca 0_ "   > " 8O H`. `"9`?8 t  D@ 'tx'`# |`"``#8  "*  眔  "   @ @ :  q 7`@t&`"ɢ @^ h"¢ 8t@/`  ' / T * >,|`H `x̸ C ̀?P$(̠ 8 8 `Dv`. <`X6`4(&x%` x3 " ` `   / `?̸    8`$ 8 'x 0'| ' D' t`]  4"'' !'''/ / H@'' H`/. '' `0" <"@' @@'\`"' @`'X6  l $   " 7 U \ S  4&(&&, v P(4. t&  "@ "/ t  @'J 2 ` 8`$ 8 "  `?`?2z   vK p|`  0  @@5@  ] X E ɒQ4 ` `À "|L`" @ "   ` @ @ `" $ @` `'` $ <Z`V H "J `"*  4@$ 4>`" $ 4($ 4$(c P <`X6 v`.  4& @`" `` @`2$ D`x t `4 txN X$ v(@$ X0$ @$ X.  Ҕ $ Hʸ 2  H>` H   4"_  4$ H($ 4k E|`"=w 2 8 p`@ v`@" 8 `" 8   |On  |<` 6; @J$ @1` 4  2)` G`2T ǀ `Ā `` 㿘Ho``(@a`> `\`K  G <>& ` i>`0 b  2]  `r$ 8y!> ] > ;c4$ w  `@6 Hp@    E I> !Q  Hp@ 4   ``` #@4@ ? Hp@} Hp@ $ 4` >     >  `  >  ` ||||||||~D|||$~|||$㿘p ":   `7 ' ?  / 7  . (@8  0`(`@ 8 @* (($, /p 4/l `' \'@ @ `' `@V  `2 $  ++$@@(`@pop()   2`G  `* ` B`2` * `` 2  (` @@2`` 2  (` @"`(` 2  (` @" `m  7  /  * $@@(`@olor "` <$@ M@  $@@(`@ot( 0ot#@ A$@@(`@ol0oz 0or? 0?@@0`@8$@@(`@0oz'@ol\ @@(`@ot0ot$@@(`@olor @""(`@ot 0ot* ``  (` @V2 @`2 @" @g" F2`' $?㿈 `@#\ǚ   &  ? $   $@ 㿀> @`c<' ?9 `'5* @ ` ``2/ @`&`  "/`" &`   `  @`(`@`耤 "&#@$# @ >  2 @`(`@`2` @ 1 @ v(`` 2r` 2m@ < @2e Ҁ`r ` g`(`0``(p0`0`/// ` @(`0`" `(-@-`-@0`-```"?c@4+`0``(N-@-@-`3`-```@?c) 0``(;-@-@-`1 -``<->,&&`  0`@(`   p.` f.4 X `*@& 2 ` / `̪`` @ـؒ`  (`0``(3-@-@-`0-`` 2`Ő)%@ $ .$ @.@ @(``  @ & & 4`.`.@`  `& Ԫ`.@@` ? *@ǐ` (`I`  @@2`  @@ 㿘- ( /@@/h @/@`(( ? (@.(  ?.`. . &.`. . @ @6 (``(& (@  ڲ 㿘@  (.z- (@   ?.t. . & . .& (6 ` > bX@>  > b` " 8 > b\) bd*` !<@2 㿘!< ؐ > `, #. k> X`> bd (@  <@` ( #(k㿘Ԑ  `&`%> \@1> ` * # 1> "`` %> \F*"`ܹ $`$\"`.` @ , k ?㿘 @@  @ a@"  \ @@2  \`"`@2 \  " 2 \ 㿘 ʐ㿘!`&! ؀ 2؁ (`@ a" !&!! a" !&!!㿘b Ho&(@> bd(7 Rې> Hp@ gb㿘@] "  ~ U?> , hb> x$!$!$" $, j> a$!` > ֐ 0G`Mɐ`"2`L  7 D (`%> X@1> ` *  H? 1> "d` %> Xk*"dޒ $d$X"d.`  Hs0Rl ΰ?㿘1> ; #B#2`    @) `3` (`@3`?c @@0`8* 2  #%` @? k@>kcH* k#` *#%@㿘#`#%`" #`## &# ((`@.#%&### {"/2### @&#`&# .#%#㿈'D \`耠`2  2D`@8``!<a`( D`([!< 0> F# L DE "  @E   D`a ʐ     - D `|6`DD 8L  $`7'`/D> ;c"D逦!D`/  /D`'  7`  > ;c耠D`` `8`Ӓ  D`` `(` ''' (`7' &耠ޠ `7  ' & ֐7``@ @@:`  ?  ` ,``&`6```(``$` > c$`$```(`` &` ``(` &` \ $@` U  4  `RD $`/`+` $`7!  @+` +` (+` +` @+` +` > =+` #@+`a+`+``(`0`0`+`+`D`@8`D` 8`@C9 H&`(   @c D0Ґ`^ ǐ   2`D 7` ? bݐ $ ` ``(``? cH G D0``@&`&` &`  ͕*t`+``, (`(`(`00+`+`x $  , > > ; bh>da #㿘#(   T `  0> E? , h, j%>!>$c $ l$! /$!?`@,#$4 \"$, i$ $ $ $ $ $ $ $ $ $ $"$",#%>! b(">#cK?Jg D 4 Ho&(@> hh`$"h" h$"Hp@ g> 㿀> #c<' `Z#$/"  \ _> `"耠`"쀠`   H `$$ $`<(@@(@$` , @Bh4 4 4 > =, , "$ " $ @4 4 $`' '''/Ho (@ Hp@0"#$a @>  h㿀> c<' >`0`Ho (@g i@ 20g@"'>~@" lhᢀ@L0aK@ "耠` 1"쀠`2'0 @1I@y2 Hp@ 6@ 5  /``" 0怦@ aJ@0a@2٢ # &# &b@`΢ k  e@ f@2s" o$"쀦@"7 \ a@ Q Ta8 `saq$#$# "$#"䀈` $#"## >"0+ $"$" `6 \ },#$``/`7" \s + p& '''/ /"' a  \ 8X ( "S $#"耠`M"쀠`I" "$" 8`" 8$"$""     \`56 \3 @"Z'j@2,  #$ (6@% b?$! & l @@ J 7 / ,#$ '/'' /"'& ` ` `"&' ` `  ` \@6 \ߏ `2 /`2 /`2 `2ݢ $"$" '''/ /i"# & ,#$$#$# ,#%0>  (6 \ i$"w$"㿘Hof(@gw"u""" "? @$"$"Hp@Mΐ 0 888㿘"   "  `" ,@& , ,  㿘 h` L `$`@ > " *@ 2 ,0$@ " , 2bl "@ 2 ,0@   , 22 㿘Ho&4 \(@g \`@{6 \# `@Hp@㿘Ho&4 \(@g \{6 \#$`@Hp@㿘"̀`2# @  @>   "`"`bk``( ,\`",``"`,2">*"">&ct`"#>&c"#"#"# "#$"#"#"#("#,@>&" ؄"# ""  @ " >&c"#,"#"# "#$"#"#"#"#(>*>)$`"#"#  " >'`T"#,"#"# "#$"#"#"#"#(>)>'`\"#"#  " 㿘@ ?"  㿘" @ , @ =㿘>'>5`&#&#>6>5a($&#&#>)>'bh&#&#>3>3bH&# &#$>3>0`<&#(&#,@ D  " @ , 㿘" @ " >  `  0`@ ` , ` \`",`0A,`  >'a  >'a 㿘`\> >  `Aa 㿘" ؒ??,`؀ `\` ?> `0@ ?2㿘" S  㿘  Ӧ  >'>)c&#&#>'>'`P&#&#>'@b<&#&#&#(&#,&# &#$o& $&" 㿘 h` +t L   `b̀`"``D ` 2t c@ `@<`@<`㿘 @    @H>  c<@'  *      . @ . @ ` 2 &*  2 ak 2 !b݀3@ q> . 7˂@@* (`2      . @  . @0Д (̀   . @  . @   ((`(@?)'. @0 Wƀ . o7 ˄*  (@@i!@㿘`@k``8*\`, " "k``8*\"  k``( ,\`2  , 2  k@B* k`װ @2"`k`"" @""Ѐ` `k㿘"Ԁ@" D@`k   @" D*? D  18 & 㿘 `  #`@㿘> 7cP > @Œa!``/`!!䀠#`<&`(`@a", a (`@ a! &!D  < @Cb>  @> ղ 7!`&! .`<"!@ 2!0`<㿘@  2 㿘" )  %k``( ,\`  `o `@ , 2`   7@? 㿘"A@j"Б*   2h [㿘"֐ 2Y L㿘"`C " ,$b : 㿘!"`"%!B  * D / b̀`bЀ`2cb̀`"" "@`> !` ؀ 2؁@ 2  @> "@ Ġ (`@ a$ !&! a㿘" % >  0` ,  0w  (@ " , \` 0= , 2㾀>  c<@'  0 R` > `Ь0 ``F (@ "a\`2a`2 `@  0=> X!P㾀> #c<' " a2  #2!@2! ?$! # 2  > &#!!h㿘> : Xx(` @ ("(װՕ 㿈`J ," )  %@  2  @  2 #`2@ `" @@2aJB 4  a2 " # \`"#>  0=  #2a@2a ?$aц 0&#㿈Jr 4 ! є  J `I $@` $@@  2  @|  2 `B`$a$ a1 Ӑc㿘   0@``0@  &` #,`@`("̀` (`>%@b&`$ &`$"Ԁ`$`&`$ &`$ k`` \`&`$㿘8~㿐 c`@ a2 \`W83   (, h $ $! ($ L$!4 b2,F ,,@2 , ,?& ,bbԂ$bВ Đп E $`؁b"*'"  $b $bԐ ,  Й  $`؁?x$b7ߦ L @㿘"Ѐ` `\d     `h` + 7   0 λ W> bl `h 2"``($` $" G 0`h`,`a&`L?.`h$`$a>&`P&a$`(>/`&a$@$`b% "`"'&""Ԑ@)b"$`,"&"`&" & ؒa1`(  >)<$` #  ``$`"ԝ㿘#0  S <""Ȥ ""̰ 7bؒ $b>'>&dq⠔  r  r>*>&`ЄT$a$a>-?b̄$a4`\$@Xa$`؂`$a$a > ֐`0;AI~> l$b l϶ > > ; bl>da #㿘Hof4"(@g"`? ""Hp@p"GF"> l2"@2" ?$"v Hp@  lH> c<' Ho(@g @~ H a@>0 0a5@J;0 @ӂ@>H 4  \(`0``D`@> Hp@ @"w"! 1@<2@ג3׀ 4a@:0a@10 a6@ƒ"ؖpĀ 4@@ \/Ð " G  \`6 \2(`@L \X 4N` 0"&#(`@ &"` `G  H H@ ?|@ t H y 4`&`,`2{ `o`,`2g \`0`֕ 2h 8d +"̀`2Z# ] >  a,`@"V \``,`N +`0`t "NE >`0`j = N`9 8g "4 ߐ% 4`- 8[ "( $8: \  "  T 48J " $8: K  "   >  _!@  4 \`> $"̀ ,`> @`0 09!($"̝㿘Ho&4 `h(@g `h ` Hp@(@`L`0a@ N`  Hp@ڰ 7ߐ $8 : ސ@  0ԼԘԄDՔ |`@  <`2 ` 2  <* < <`* <" 㿘  ` ` `x@`8   <`  ?`X(2  `x   " G  @ `X k(`@ +@?((2  \`?(2Ђb@@(&%b@݆ }xa@؆ 沂b@ӆ ˀ `X k (`@њ \@†     @(   <`* < <`2 p *`2 p" p`$ *`@?" p < ** < * *" l d`" d@ *@`" p@㿘>  *a v  <``@. <"`@   `"`@  "    @  㿘 @{Ӱ  `@{͔ `?㿘`<``*`  8` `  * ے`.@ >`Ȕ >`Ȕ 㿘  2& `` *@`2& `> >0b4a㿘N <`f <`. <>0b4`㿘`Ґ . `& <@` T㿘`` * <`2`&` Ք  < *. * ? . <D`` `Ŕ `& <@` `2 * ? . <0` . 「`2 * ? `.02@02```1 `1 62`82` :2` <*`2`2`3 3 $2`&2`(2`**`  0 `X`*@ `Y*` 0*` ( ( ( ( (*` *`*` *`  ?`*`*@Ⰶ*``) ) ) ) ) *` *`  X*` Y*` <*`㿘`n    b `m nư >'>  @z  `2 `0`ߐ n >   Ր  @@z  ΐ d$ d``D2d $`"$`d`"İ  n >    ````` . .@.`.`.`.`.`6``1 1  㿘> a  l`> "``$ l``  @`"`@`> >  a7&T㿘 |<` <> > >  a 7%N㿘```` @ &`> > >  a87$> > >  aP7$㿘  @z0{ `` (`(00. . 㿘 ` *`.`<`. 8㿘 @ /   " " " <""  "  "  & 㿘 |`  t`%> ` 2  " `  & |& `ǒ  > >  ap7($㿘`` `&`>  @!> @ ` `? &@&`r & @> > >  aP6$&> >  a6$+>  a6$,㿘 t `  |`& |> > >  ap6ڔ$㿘!P `?,,@`H  @yo  @ `H ` "@` @@`H2> &!P> > >  a6#㿘"` @yC % , *6@ ,`6`  0 `0 26` 46`  66`  8.` 6` 6` 3` 3` 6` "6` $6` &.`㿘" ` !P. . @@`H !T@ar`H. @@(`@`L`< "> `> >  a6N#)㿘" ߑ ,㿘" `>  `> &"ѐ ϐ , ɜ > >  a(6*">  aP6$"" >9ct ,㿘!X  ڢ $bc" $!T$  $ $ $ D>/a ,>7a|`\`@ ِ㿘     @ > ```` | $ $,<33 3   3 ` 1 `?1 ` 3    n@xu  ,`,  H `& H ,`,` @ b4Ho& (@ fHp@g 㿘 @" D ` & `d`&`d``2`d +㿘  6   &` `"I` `*18.(@2 2 @2 2 `"  ` `> ``>  @& {` ۀ > >  ax5>#>  a58#㿘 < |`   > `& ` &    <` . < @k: > >  aP5"㿘 |&  <` "`+> 3> *>   !  ? @&&    @  <. < /E <> >  a4ʔ" a4Ŕ">  a4"㿘 \@  |`.`> >  4ia( <. <h  t`$& t <`.$ <& t& \>/P]& \O& \ <`?. <& \ & t <`$ <& \> > >  a 4l%%㿘 * \0`0`` ` | > >/ad(> >  4 a8 /`  \ | 뀠> > >  a84;$뀤 !`   `  <$" t   0ـ  0Ԓ ͒ ʒ `ǒ ’ ` > > >  ap3$㿘 > <& `l. < * <. *. <㿘 `k <` 6` < 6 6& ` < 6 6,`* @2& `0p>  ````> <'  "''777''''''//@   4 > 0>  2aH0$   W $$ $ $ `D`$ `D  `D$`D$  . @ , <$ |  >  㿘 &`l&`p"&`t]r`"` ` ` ? &`&` ƻ 㿘  f  I > ```` | $ $,<33 3   3 ` 1 `?1 ` 3  ` n@uΐ  , ,`,  ., `  , , `&    , -, ,, * , +b4Ho& (@ Hp@g 㿘 <`" d`" * d`  P` d`& d P Xp     d& d㿘 <`` . ĒŒӒ <``@?W. <& l㿘`nc  `m n >  @u`  n`>   ? 㿘 ` "` |<`,  @0`@` `2<  㿘 D`2`< ,`" ,`<`"`dِH``2`< ,a @"''''  !'// ` '''''''''''''''ܴ'/   `4  `` 􀠠8 8 􀠠 8`` 8㿐 @"h @k@@"# @N@  \`"b`@ 6 \!<ⴀ`'   В c8# ( '> cp "ⴀ"Ð ⸀`*S  & \` 3 c8 & l 0`  ' 6 \ +Ր> > < cp>da  㿘"   A $"$" 0> 0` %4 \>7cD$ l$!>9>9؂cD!$!$!? , h$> :, j`$!$!6T5| D  Ho&(@> pp`$"p" p$"Hp@ g> 㿘> ?c̀" &  v  @`(`o P @] ",`4` @T4` & a<` & (`D  ! Ho&4(@> Ŷ`@D69H <& (`@"C& (`@ `@&@> pH`` > @`lHp@g> Ŷ`@D& <H`G&HL`2> 3>     <㿐!< `(" &``(!< 0> /a!h&`&`(`  . @> 4 H@'`> ? 3c̀2H`> ?@' Ӕ  A  (      Ho4!(@g!`( !!䀠7 <$ (`@a"2 a (`@ a!&!3Hp@ @' 7, <"!@ !`&!Hp@  7 <㿘> !bpHo&4"(@g"`"#! Hp@`7`@z  1 qHo&ނ(@"`2!` Z"؀``(`@T a$`!&!Hp@`2` @r. ,,` ;  ֻ  D` `` ``$`$` $` D $ `` `$`$` $` !, <@P 8` u$ 8@ z0l a㿘Ho&4"(@g"" "? @$"$"Hp@9,  㿘> ?cЀ" &  `'` (`& a<` & (`D  Ȗ Hof5(@>4`@D6:H <& (`@"E& (`@ `@&@> pH/`@@ > @#`lHp@g>4`@D& <H`{&HL`2> 1ǐ> 6 (  (` <   "`"`㿘 2@1@* `. /@? : 4& 0a5@ 0 a6@ ;\ @@ \`"`@ 6 \ k@0. k  cu \`6 \@逈`@ 8 \ 6 \:Ā 4㿘! Hp@ 7 @> Ho&4"(@g"`!` "؀  (`@ a" !&!Hp@ 2 @ 0 a㿘?b̐"98 j 㿘"   0   0> ,?`:4`\a>;>;`(t$a$@$a> :a` $a$a$`ؠbȒ >;>; bt  c_  cr2: > <>da  > <`< ?  0`@2@ 2   2@1@*  /@"  @@  b" l  `"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿘Ho&4cH(@gcHcL tcL? @c8&cL&cHc< dc< @c\&c< &c8cPcT |cT @&cP&cT> c %Hp@5 `(1> <g @> <  H "> `"`` `?  @&`1&`> ct 10*!㿘!> <V 4"/ 4㿘> <_ @> < `H? 2  05   @  >`Ȕ 㿘    "   㿘  ܐ &  㿘  I&#> <"" `@> < Hː`@ߒ 㿘`@   !h  @@m ` @@m| 㿘`@Ѡ  f>`f >`f( >`f0>` f8 >`(㿘  $ + `" {  `2 &`&` &` &` && &  &`&` &`&`$ 㿀> @c<@'  `a`Ӏ`"z`` +@ >  +'_`D  `a`'> t  " $  4X@` ```````X4\ 4^,} ,m( 4`4b$d$$h$p$,|,l$$X ؂?$p``@ $p h硒``a``" @` 疒a`@`o`Z`"F`T``2 < ؂`0`0tͰ 0` ``a`?@@S 0~ܐ@ O`@-> <$$$ ѐH Ht 0@0fVbvbxVbbbd``H`J`D`L`P`X4@4B$D4N4R4T4L4J4H4P`L`D`H`P`T`X`\$L$P$X$\$`$d$H$@$D$T$@``` 0.@ "@ti 0X > > 'זh``$$>C?(`$4><>B@c|$$  $(,$ Ho4^(@g^> `?`(`$HH t> c !$L$8c 8 d#c @`$<h> ?aL* $PP |"$T8``--l 1 H`@w4 Q> `$ $``''`$    ''//f p> " 0`" 4 0! (`9(`8`(`I `<(`H`(`Y `L(`X` `H `, `\`8 @`X ` ` ` @  "L> !'iHp@0  00( !㿘 (` < 0@祖 (2  @2  ?& @|$ (㿘 (` < @ 2  @2  ?& @`$ 㿘HV` > < `L &`8&`<@j&`&@G > < 0`\ (&`8㿘) `@& `@"60  `@- `@"' `@b@`@ & @@a@`0]ߑj㿐#> < `4  %> < `4R<`1>   l  @ϐ  0@̒  & & <> <&<< ` <& #t`2   O > 7&#tc(> #\b&   Ք @㿘`A  `2 Ho(@`|` Hp@炎`3` g`|` 㿘a  AHo>(@> b  t 2t< $`! Hp@ (`@ `<$ `|$`|Hp@`` " }g> b `@$ `|$`|Hp@ #@8`2  } ``؀ 0E㿘 \`@`  } . @> S  N !` Ho+(@!`0 !!䀠@ `<"`(`@a"; a (`@ a!&!*|Hp@ }Hǐ 2g!`"! *`<"!@ !`&!Hp@  7}& 7 `<㿘 \db`@_b-!* Hp@ Q @{   D  `!H`W2      @@> 8`C> /Hof4"(@g"`ɐ!` %"؀  (`@ a$ !&!Hp@ 2    @  a㿘#> <W`44 ` `   ? @$$ Ho& (@g (@<  `$ <"  |$ ||z (@< 2 (Hp@ > <`< `4  @"  |$ |!> #t #t `4$#t (` <"  Ho(@|`  Hp@"  Hp@0g|` " 㿐`g# (  |y 7 P`aA '`@8 ں$ $@   8{``   `y  ( D{ /|   7`aϒ   |s( `c(`  |i( `2)`{ 7> Ř `Ho&4`@(@g`@`D`H`#`HHp@ 7>4 `( `<(`@ "#@  > < p( `@`#`@H` (@ @!> @ `lHp@ { 7p     > >hcL"X㿘 > #"  > > cȤ#? 1> # #1> #"㿘 > #"> #" > #"  $  1> #"Ё㿐> #" P 4 8 `#\> ##> ##@ > #y#H > #t#P 0 <> #n#X <`"> > `0#f#( @> #b#p @ > #\# D h H> #U# H#O#h @㿘  > #E#   >E a>  #7#㿀> c<'  {&  A $$ $4 4 4 4 4 4 4 4 4 4 4 4 4 4 > :O!?`57 (4 4 ,   , 4 " =9 5   //a4!  > T"(㿘+> c`- > 1> cx>  -> &#ؠ %> 'cА0` :될? #?c&#䀠`  3 > #  㿐ɒ㿀> c<'  z  D $$ !<`$($4` 4 4 4 4 4 4 4 4 4 4 4 4 4 > :ἐ!( 7(4 4`4   , ,  ᭐`ᩔ `ᥔ `ᡔ   //a4!  > "8㿘`<" `>Ja&`&`P > w@ (c`c`  `0`(`M  8 4 $d& 8 0`" H` @  D@e ' 0'  ' v ְ P  )>  8`$  0"`"( @ep D ' ' <` a< v ư &  4$ 4"l#h > ''Ըc<' (5``  yX >  ܲ > ``8  ( <@2 0 h`"\ 2 04`A`A 2 05``@Ԁ †!؀"`<@20 @ 20 `20`2؀`""<@d̔   `@"E' (@`?  D5`A`0`=` `2 `<" ` H"hH" `h`"T h` T@)N'<- 0 0>  !a0I@)>̠- >  !`('܃5``:܀"ǐd (   - `<`h `h" `0    ܒ  (44 Ԁ`2'ؒ ( 7/ /! 0T'> : @da Y@('> c! 0"H` @d  & 4j<@t h`@('<, 0 0>  !b`02T h ``  ,` ߪ ``" 4> > <a4p@%`4/> %4$ ]5` ` $ $|%|! @2 `$$`$|w%| $$  mؒi T@(['̠,( 0>  !``0Y@(M'̠,>  `  0 %` `㿘 `` )``."> c䀠>  cx@%> `1> b`@c]  ` > #c` # $S#wr ` `" >a @(``@  @㿘> %cHo&4 (@g (` 02(`Hp@ 5 `"B>  `/ `   @(`` ' h@w00 `$@" `@$`@Hp@ 2 {  2 0{ 2 0 `!H㿐aQb2A `"`H "P`V```0 `"  \`I9> #| c4P > 'b8086G      @$ $ #|v'#| `"$ ` $ `$ #|`2'#|/ / ^/ `/ / /  > : !9 @'+'> aPڐ v $ #|v~'#| 2 $ $ vv```F> `4&`4 4``@B4&`` > <`x $ `<`@h@H"` > 4(z \t `4```> <&`4t&``  $  $ #|v6'#| 2 $ $  > f!> 4`&`` "Q \   !< C "4 b@&'> aW ~J$ 㿘> `0``H  > !4  2> 1 c!> w>K#pa #p[ `4  "&`<.   ``&`42` `"= 3>  a!4`!!4!> wh`ڂola&`\`>  @` `? @$@$``4&`H{&`4` !>  $` #|u$#|` 2 = `(3> `<`h,`<X4    &`H> > #` !#"" " " " " " `4> d&`4〈 " ` " > `` a`< \ @2 0`  <`2 0&``  ", @> <`|"`@> ``&`<`@= `?"  `$ &`@ `<` X `<` a<> <!`<`0h(`<X> 04`<&`` h``X`&`\a8!&`\ l@8&`\3>  EbY 㿘Ho 4> <(@a> <S`l> c #>  ``a48 4 2 Hp@37d7t7t77t> > w c 㿐 ``"  *#\> <  0 9>  #  $㿈 t  >> `c $` $`$` 1 ) 1 ! 1) ! `` $`$` (,  $ 4 @'4 `` $`$` > = b @ / '/   @9 >  ` !  `8@  ` ``\`  `>Kc` > wcc0  @2  >`p 8㿘!> w#2   @2  8   " " #" $#㿐> 'T'L'P'X'H ` L '  @ - `` @ :  x "    @& @@ۊ&  2M   @& & @``G`"  @? `s' `' \  <`8@@2# )  @F &> `` $` h` 0`%8>Kb+> `` "@Ѻ `s' > ``2  "   @20` < `' \< 8 @2E `2A ` ?``($` ``2 0 @20h |@2  `' p (@`&l j  `' \c< 8@" ` `s' `' 2 ` ?> ``F @(@"(02 @"h02 0.Ӑ  " " `8`2^ > `` ` `h `0 %8'> `# ` ` ` ``@  2I'  ' $ 9` h` 0`!`] `h `0 @`@``8(`` @ I'` '` %c '``r' ```ܲ  0$` `` 2|0h @2  `' `" `   w 0rG`   㿘#> wc ` 2 $ @"$  2  8 0?    ` " "c " $c$ ``  㿘)> #`=Ho:(@> ``%# `E `h `0   `"1   ``$  %# ` `h `0`2`h 2 Hp@a> ``%#`  +  $ ̤ 0 "  $ 㿘Ho`4(@a & 8@" &  ` `"& `\` & Hp@N?   2H&  & >  cHo4> w(@a> wc20 `2 `b    2Hp@< 8   ? @`?`? *   H`" `*     2  *  8@@"* 2 * p> c<' Ho`4 (@a `& Hp@ +>     ? @ & &  ` "   '/! a2@Ԑx 60+ 윐"Xp> c<' Ho`'> ł(@a'> ` 2     @2 0 h    @2  `& Hp@0P 6  D $$ `96 @20$  h` $ h   hh$ a'  /䀠 / a1 (   !  ? @ $ $  `"  6Hp@   > |0"h㿘?+`-> :`@2a< "" a<2``\`"``2`"``2<"L2 aՈ 㿘> ``2  " a<20,(@20 㿘 `H  \`2E L < \ > `` ?  <<@  L 0 5  \`? < \ <@ 2 02 02 0 `2 0  @ ҕ*  & \ @? Ŕ  `$ ?@  *  & >Pbh 㿘`"= < L> `` ", < "& <2 0\`" \ L@2 0 `" 0h`" h  <@2 0"  0 2 u   `&  \Ś `† @  b* $ 㿀> c<' Ho& (@g `8&`8`<&`<`@&`@ `D&`Da'''쀠' a &`D&`8&`<&`@Hp@0:Hp@> 7cP > @ٝb@`,` @e?&`,`,&`\@`X&`(`p&`$`\```,"Q&`L`( 0@&`LFT`\`;  M> 2`8` `I`  0&@`8&@`,`2ł@V{`<`@`D&`H&`L&`P&`T  T`\`ɰ`l`ƀ 8`'&`l 0 @"??&`,`,&`\&`,`,&`\9"x":`0@ 8`  ?+@`@2+@` 0?@c 8@* 㿀> c<@'  @0a@@~ > `` 2      @2 0 @"0#@%!@   "g 1    @20<20 a@e0 @"\ @7@׀ Ho(@aa  0" 4 4 4 4? @ l$ 0 $ 4$ l `$ $ "$Hp@0  `"  @ږ@ > `2^ H @"  | @A@  `>     pHo`4$ 0(@ a$ 0> ł``` 0$ 4` H ` 8$ X$   , 9, 8$  , X\`"$ , H, I$ $ hHp@ Z  `B  a!@" 8(2a#@"\*\a%@. X & \& `& d&a@7 `j  a@2  2 { 1@&  @2!  b͂@`[i -᐀`e@`@V@\`V Ho4 H(@a H' L' P' T'$ H$ L$ P$ T᐀`@ " $ H$ L$ P$ THp@0""9  0   @" < 0蕐"@Ք $ , $ \Ho`(@a z 45Hp@0Ho`4 9(@a 9`"' 0`j \!`"!`m`2  $G Hp@0`2d 8 & <& @& D&  & <& @& D&`"  H & L& P& T&`" k 0 `;Hp@}  0fa F 00 $ X4$ \8$ `<$ ,$ d> `d9 00 $ H$$ L($ P,$ T <u r p  $  $ H$   0m  $ H$$ L($ P,$ Tc\> ֐" cP> c<@' Ӏ @K0a@@"E -@  27` A @F0a@B@ -   @ @W6 2Đ `2o  /&/ :a0` ``"`" `"` 0' G0a@    4  1`2  0 @2 0a@0 @ @WՔ  8 8ђ\`5 Xɐ X ݒa0cb 1Ҿ  T > " 8 8ҫ\`" H Hңא \&&? > " H HҖ X @Vה!0*`2``` > >a+`0@ 0> `( (@ @* > 0`(@ (㿘  :`?>, ` ``  @.6@(`@@1  , la" >@2 <`2 ,@Vh  2 `2 `2 $`2 (`29 `Ă@VK  F> <A6 >> < la" >@2 <`2 ,@V0  2 `2 `2 $`2 (`2+    @?&& @`&@ `$@&  > <`6> ^" >, f`㿘 @ ` / @0.0@@(`@ :@  "3  la" @UΔ  2 <@2 >@2 ,@U  2'    @?$$ `$ `$$ > <`> # .> 2`#@/ > 2`#X㿘  :`y)> Ķ ` `.6( z "  la2 >@2 <`2 8@2 (`2U "4 F ``( <6 8> < la2 >@2 <`2 82 (`2$ 2@1    @?&& `& `$&  > <`2@6> _#h  r)> ā㿘@  ./ 0`0@@@@(`@ 9@  4> < la2 (@2 <@2 >@2 8@2 2@$    @?&& `& `$& > <`./ 23 > #㿘 Hof4 (@g   ? @& &     > @(` &   @(`    @(`    > @@(``&  #`  @ l?& 1&    > < (@ (`&   (`    (`    < (  >@@ @ (`& Hp@   ( < >  , `&   ( < >  ,  `   ( > <  , $   ( < >  , @& Hp@㿐\@  / 7 @(` a .@ `0`@  `'  R @2  >@2 `H la"  ,`2 0`" 4` ,` `   `   , @S 2  `2G@ `2C@ $`2?@ (`;@`2(``2$``2 ` `a2  (`    2  <@  8`+"􀥠" 􀤀6 ?'`  ````",`  @S9  2u  <@2q ۀ"ؤ2j Ԁ`2 8`|` `2 `2  @ `֐ 㿘 H & H㿘 H " & H 4` 8`J" 8& H& H H" " " " " " " "  @` "  H (" H . Q& L & T. P  8 H`2  `2   $`2  (`" H   $ ( & X& \  & `& d& L. Q. P , HI& H` "` (    ( >0 8 㿘 <8@?@  4`" 8` "W 8`[" 8&@2   .` .` &`&`  @&` &` <`"  `\`2  @`  6 E "7`6 `8"@> `` 2  1  1 2 0=<2 0 8> ``` 1' 2 8 <`2`\ &@4ɂP H   D& H@R* 4 P'' 0 '  ' 4 <  4`2  v \ 0㿘> 7cP > @ڒ`X``"``la2(@2@` 怦 @ ` `"` @(@ ` ` `  (` <0` ( `@͞@㿘> 7cP @>  @Ѝ`hr6&` " He H " l3 la}@ @K Ho`4 (@a "   s  ? @& &  Ā"   h  ? @& &  ̀ " @kA Ѐ " @k; Ȁ @t(Hp@ ܀`2 `DHof4 (@ g   ? @& &     @  &&    @" @ `?& & Hp@ 1> ʑ @#} 0    @  @   㿘 @` 2 6 <> 9bb` ``& & & $& (6 <\ @`8& (㿈 @  (`2  b> `` >` 8` b  "\ l `    ` 2```<8@` . 6`" . 0`"7`o ``+>  #\ `  "   @a"  0 #\` "` @P``B$ 8$ 8 l`2b> <` 5 U!#"X!;$4`- ,0`0> Ĭ 8``<`(4`0`=*; . 0`w 뀦` #\ N ߀`4 > '@  |. T` ` ' p.  1`2j"i.  4`> <`,- 0`0@1> Ĩ` 8```(4`0`@* . 0` 뀦` #\  ߀`4 >4`; 4`@> <> <`h- a㿀 @` @e` lae> ` `2 ``. /``<> ``" 8``"7<2  8 `\" 8L`2&` 8`C)   0` 8` >' '耢  0 8`2` >`>`0` 12  1&` & 8`& (`6 < #\#`   @p  @ m# @ P`  H   8 ``  8  1'㿐#> <``!> Đ  Ͱ 7 > => =a> =a> =- - - - % % @>`0`% Hofq(@@`% @u%   > `` @&@ @(`%   `` @(`  > `` @(` (%  <`` , `% ` ( < >` ,  ` ` ( > <` , $ ` ( < >` , @% Hp@ %?% @!% ԰ g@`% @% &`% % l #\     > ` X$`㿘 &&     &     & 6 >   >   0 `   ?( * ? ( *㿘00 8"0 @`"0` ?(0    (     &@㿘&@&`&` `0&` `0` `8"0`*`@``"0`` ?`(20`.`   .@   ~ &`    ?   >]c    >^`Ė 㿘 a &@㿘&`&`&@U &`   ?    >^b,    >^b L||||h`( `| 8|||||㿐 ```` ` *#\> =   0 9> =˧ Ԁ  9> IJ     9> =˗ 㿘Ho (@aHp@㿘a^㿀> > `< '  `f  "Z`- \ ' '''/倦`3/䀦`L> ``@"` `>`@@"`@`@2`>``a$` 7>  { ``a $`0 `2> Ā> `2'j`@ ``$`@˒ > ```$`0ܾ > =`> >]c( 㿐'T'X'H'L'P& & `T'& (` :`@`. :"> = "   ( > Ą``  1 `H"  @&M " A> Ą `  & Ho&4> ł(@g> ź``@`D6-`H <& (`@"0'@ (`@ ``@'`@> pH`` > @`lHp@ ``Z'`H`L`2>  >  <㿘` S  L``.`>  @ >^z `0`+Y  G 0 瀦 ) … -yװ ۀذ -Ho`(@Hp@ɀ`İ  a0`` Ho (@a> `Hp@ > => =`w `l` l   p,㿈  @`(` @ `  @ `` " ``` @``* '0`(''  // /7 c  _s 7 `c   ]  &  @& 4  @& & 4` > H P >  4``  D@K&   0 4 v` '''' f ( @> c<' G>  4 `"  X`"& \ :>   0''''''''''''''''' v'` ' ' '& > b(( @@> <(`@``˒`  @ 0א!ڱ!P㿘> =a> > =!ѣa `?P I 2 4` ` *> =''''''''''''''''' 0 ''  8Ҙ  P8`P X8`X `8``> =aȖ>aua Ő 0ŝ㿘> =!8  A.`0``2 X  \ 2+  > "# <>  av"2 X!' <`l  \*" \`"" \" X`l`(`Ո! X!'0㿘> =a > = aH㿐`- @``" % *#\ > =Ȉ! 9> Ķ! u!l;> =a9> =!H a`ђ '!Ha '!H㿐@|_T@2ϒa(`(`#&@0. 㿘   ,  @& & 4 @v"@4  @& &   @#Y p > c<'  `'VԀ ? @@ ] A > 8 p$<?$ , (`쀥`= `&@0   ` ` I  ` 0"4  (@ % @ @4(@$   `& ` `|6  &@  @&  ӄ``D`2 & @є % &@ @`2`> ``2 '䀦"'  (a<20<? `\"0L`"0@20s? '''''/ / ( 'r  '> ńhT` A\ T0Fع!h]=    % ] @ P @@: P 8`" 8?<_ :9<㿀'X'L'P'T'H L'` ` `$> Ą` \ @@(  ae F>    @& & @M " > Ą`   $@@( 0 @ & & (R> ć(aȤ` `D(`>` ``#(  `(`@& ( <8@@" `)`C`> =a8$  `h. `> Ăb@(( @@> <(`@`` (@`@('> =`` $  > = !L"  `  . \& `2   `\`퀈` L ?'  `h–  ` `$ (  `9 <> =a> =a` c` Ă`$ Āk  `$  `> =a> =a4 `#(i (`@&b (_  > =a\$`> =aL$> =a8$  `h ' (#\   > =a)> =W 0Z8 .>`2  > =a2u. c2 o.    (aH>aO` Ғ0ӄ` `$ `$$ a@쀧`#(  g.&E& a4{> =a0G  @ : !L" ( `0@&  `*`_@ "!   `(`Ң"  L'  @  a ` '  @  Vf'`$ 㿘  @``> ` `?  ` `(c` Z   2``8   8   h8' [  ւ `8  ( & (l&  `(.`> Ą@` ` ` z*` z"`b*Y  `  @쀠@ m>  `& & &  & ?@(@!?*` ` "2" 2 * : :`. :Zh`~  *{ @`"w`s` q` o` m`k`i`g`e`c> Ą`b   @&    2 Z͖( `{Z*H"* >  !0!@㿘  a > 㿐> w`1> w  %@> wc 1* @, 0@4@%> =?c0 l @!@(`@(@4@4@ (0 $lc%> =$T8hh @> <@' `H l`:``@"n' N  p &@  l`@d ':`1В  #p &@@@ V>   o <&@ l  o 4&@ l@w  ?oۖ &@7 "ϐ ''Ԃ '''''''/Ԅ /X7///ِԒ  o &@ l l  /'''''''/ !㿐``L > ł``  #\Z?`( (` $9 - #\> = w!>ft "[ > =b   9> Ű  h U   9> ¼# !> =!> =aȀ D! !> =ߘ!!`-!> =!Ȁ`> =a$!ȁ  9> !P  9> ˆ 耧 > `$9> =   ¶!9> Ų "L  4!> =!Ȁ k $!ȁ㿘  @``(`"!   @&   @& @@(@$@㿘> =a@  + > c?> =0`> | 㠁> ! +㿘!> ="|`?  YL  9"|'> =*` & Ā`3>  c   +> c, ,   `ϔ   @ `> b@$@  Ā`"@O@c$Ā`> E#> @""|> (c  Ā`Ȣ > @/"0‚ 㿘%> Šl? ! @" @ 8`" 8#> $ad  $ l, ,_ $ad   @F#> $ad#> ŝ㿈  / '/7 E Q 4dd" 0 8`A$ 8 `:$ 8 `2 8y> :a` 8`" 8a<2```"` 0 `"`@@2`  @@CW  2` 8` $ 8   㿐%> =Ķ` c>   ' |>  `> Űal?(?  "{ 8`ڂ&8'> $d  . . $ & J dͰ D8 D Z  "   `D8 D[ / <"f4   > =a @?d  !@ ?> ņ`h(` (  "E > (     ז> =ad   4 8`" 8$dh(` (Vׁ   >  "Hp@28'> ņ`h$` $,` ,= 7Ƥ  "> =V> =`02  ` " > =a" `2 ( 2 @" ( ,2 4`" 0`ĸ `v >  "hp> =d \`2L<`lL `  L   T -'> ('> Ų   I $d㿀> c<@' '  '''//>䀢 2  <@  @@? > !㿀> `:c<'  `0"`(D`" @  l> `"`( '  '''//䀢 "` < > =a2  `" `a6` `\ְ` 0Ѐa80@;  E? ?62 > ``?`?c80 0" @20!<`(20< @  @   20 ѐ!DŽ> ŀ  쀠 6 > ŝp ` @`(`쀥 B' ` >`> ='Ԯbܴ`  "  ` ` @  ] > ńhP` P 4 @ D"Z 8 % $Ԣ@ @ ր Ԁ`> =a ՠ @ ``  > =b (1 " <@ߔ  `, ̆> =`"  `Ϭ``% ( o/` '$@ 怢 倠 @90```(``'  ژ > ńhP` P @  = ('܀ 3 <`%`  -`<@8@@ i'Ԑ?n ``L`6`2Bߨ%'@\ `N/怤 J 0  (i  (  5  @  y > ńhP` P `@ > =)b (q `/`@zؐ%7   < `/ (o'܀ # < ߒ %ܒ $ْ 㿘 `> #> =a|` TI@@?` ` @&@&`a $a"    ? && 1> #㿘)> "@ %'> =%> =(80`@8`@> Š 1`h(80`@8`@ ? ``$`"@ ܁㿘#> b@  > Š`h `$ b@ 2 㿘Ho4> ł(@a> b@ > `h !> `* ` `z$` 2 !> !d  8` " 8$!dHp@+$!d㿘   `(` $ `$`  `` @`9` ` ` (1 @ H ``@ 2 `61  @ @`/  @&  > ńh`Sj > !|> =  > Ȁ`"> ŀ`) ` QU @0  @0 7     `@@-"@`@τ+> '> =a| ``@@ @` S$?    @$$ `$ "` `& `& %`    `   @ ``?  `(`@+>  S&ga|'> =`$a|` [@R$`5`% `%@"`` `? &@&`> >#  `(`&    `(`  &    & > Ē # > @"`@@ ` @&` <.`  .` &` 6` &`&`` `&` `&` ` i&  3` 0Pg R > ńhh`  h㿀%> `'D`> `h `h `hD< @0`X`$`XR:V  'D` `$` `< (` 1 `"  `"  $``2 $`t`$`t  #D``$``R $``\2 $`p`$`p`t``$`t$`V 'D  @``$`@ " `D`$`6   @" D `D `h2   `  @  D    D2 D > =  ( b| sD 'p쀢 2SD <8@ID `h"j > =a_> >`x-@ W[ Ho&(@g  ` `$@[ D#\#` @` Hp@`CD@@ ``$`OX"@D ?b `> b@ "   "  @2  @2  @2  @2 1 @6 (`0``"```2``) 6 `%> => =a܆ $``dD`$`d> Œ !|  (D $L 'D`@`$`@  `(`6 D> >`x">`4 ΂``(8`4`l3`1`)/`-`+ V Ho&(@g  ` `$@Z D#\#` @_̘ Hp@`D`4`$`4 > Ăb@ (( @@> <(`@`  ) (y6  "D<D> =a`> =b䀠D `U@ G'D @ T  2U`( `D`$`$`$`D  @20"h@"h02 `|`$`| 8`(`$`(D`$``U  'D  "`| @" 2`|`(`P.$`(`> =  @  D> =`(D`P$`(`dD`$`d㿐    #\> > !|eb    #\> > #[b  K  > <`> Ĉ" 9 ) ) b  ( @(` @@(` @(`!+@ `a2+@ > =```@ '> =#@ @ ! 4`@2`4S`"`4`4; ) )  ( @(` @@(` @(`!* @  4> =bx> => > `> ņ` b@ @`< >  `@;> aԅ0(0 (@@&+` > a0( 0 (@@ +`  > >  @;ݒb > > !P@;גb1> 3>  #@;ѓb> =Ka> = a> f"㿐   > #\# > ]㿘> Š`Ho&4 (@g (` 2(`Hp@  `"> 0 `$"  @$ @Hp@ 2  `"@@@t@> > aH3 3 @ @2`@2` @@@(`@ 2 0  2 @2 L`2㿘> =b䀦  03@ 4@ Ho`,(@Ò , 4& 8&  <&Hp@ > =c@ (`(`> ńcȄ&&& & aӐHp@?&&&  1`> =2 c> = 3  `( *@ `@ (P 0a> `L" p`" p㿘@& `& & D& 4& 8& <& H `` `2 `2   (@@ " H` " L" 8+" <" " @" DЂb? ?/ a@ 8`0> @Ԃc @(`"  " 㿈Ho 4(@a`"     @ Hp@  ' //  @ > =b쀈> łcȂ&8`(`***  > :bȃHp@㿘 `& c(`> c2 ` 2   & $& > "!& $& 㿘 20 ϐ\ 㿘 t L`" @@M`I 8 2@@"`` `? $@$`8 8㿘   g Mw?WG 㿀> > ؤc<' `2 ' 9>  ؂  '''// M  $   $ $ > =P,`  > Pܖ> ŢbL`> =`$`䀢 ѐ > c@`0`$`0>  |c0!㿘@` H L B!3> c؀`9c> &c  (   "`  (:`:`   8 @:`"`,"`(:`0:`8"` `` "` ````"` ````"` ```"`qcТb@㿐  +> =c((`4 2`  *> Ń*Ȃ@@ "I > =b쀈> ŀ   **> ł@Ȃ@` >  cp> ŦL`$<> &<c܀&c4 "(> Ņ(Ȅ `   @ ` @"@ ) 0((@ @  + 0 (`®   `! ! 48`&4`&8> = 97> b- 0``\c Y ``@`&`&` @ & L  D ,`@0$  $ $  "O  $㐂 @@4P (> =b $`$ `$ ` $ `$ 4 4 ` `$ `4` ,`$ `$  `@*`4` $c (0`p`P@`Pv@jqHD! 2  ,   q) )  ( @@(`@ qb@Z `(` N !``")` P &H&D` ( (( > =`$ > =," 2 > c0`$0 7  `"Ns   ``(` @PU "cdct` @jt?b@HL=%@ A @`C`@" " 8 @>H&8&<&@&D&8@@ >8D @>@`` 8`"(@ 8 @ ,@ HL @`ˆ`"@"FG "8`H`8 C`";<58@@ >8D `>@8 7`"(@ * @ 2,@ : @>H&&8&<&@&D }   $Ɛ`@(D,02<$(ŀ`"$@}&Ђb@@Ђb@ۚ@  `! A!  7Jc<(V`@0֝㿘'> =/> Ţ c P @` @6r P P) ) @@`((@@d`2> 4b > `" "H) " L2" @2 22L !2 p> c<' "  @6 P > > ` '/ /! ԟ@a2"㿘%> =`> Ţ c@  P @`Ɛ@ P> ň b> `" "H) " L2" @2 22L !2 㿘Ho#> =(@a#> =c`> Š cȄ (0`, 0`(`(`@@ csc (0`> > = c 04c> €#> }"> Ű "x#> bH@ "   $bH! > @5q"bH3 8> $bH cؒ > @5f#> => = c4 Hp@> =b쀠>  cȁ 㿘> =b䀦 * Jd `k.&`k `m`j"  *Ip`n *   `> = 0 @ # @ "    `#   >  c  "  㿐> =c0> Œ#i"@g> Ѐ@ @$ ЅH`$( b @> c?/b?4 , O$ L H    "# "% `@ @80` L(`$ $ $ Ѡ@  အ ) 8 $" <Y`?25Hp@> Œ#" $ @ ( D ,0Ԁ 2(  am$H`h (0> c<' `d> =b䀦` (` * Hu l>qX#> =b쀠`WV`"  -   `?> =c0 נ -Ho (@a` H``^ te$ tHp@    `?> =c0  -``" ` " ` " ``H`  `2 Ho`(@aג` Ut. P`) P@2`2 `2$`2(` 2,`$2`20-> =c0@? P @ I   PAHo`(@a > =b쀈Hp@"    `  1> =@#((> ł@Ȇ@  1Ho (@a#( ((0` ((`?6#Hp@> =b쀠2@ݠ  ڠ  `ր  @`р ` ̠ 1(`(`> Ū@Ȣ@``  0> = #"  "B``2 U \`>  -3   `8c     `+  ,В @2Ӕ $> =b쀈Ho`(@a͒   t$ t   ? $$ s 8Hp@`  ]  `X> =c > c܀2"> bH "`"@  @> @ 9 cP`2Q - "  `( @ > =& # > ˒`p 䀠`6 0  8 !> > Œ bH!> @2Q">  c!> >{#c#  !> >}"b"#!> Ŕ ">wa"#b쀠`  > `` '/ /! @a1 2Ho4`(@a``8-@`,``$`` $` $`$`$`$`$`Hp@ > =@#(2@ > =1#> =b쀠"`> `0`> `8``  #\2> B`@ VP`>  9cV> " ,В @1ǔ $0@Hp@x 1>  `EHp@g 1] t = ``8 2 `2 `2 $`2 (` 2 ,`$2 `2 " !Hp@ 3& Hp@ > /> aH1 33 @1 @@@ @ -` `T> > b ;> =@`F`@2@` 2@`L (0`` #\ > > ``Lb쀈`qÐ&`L&`@ /@ ` KE ϒ 8 @>  ea002-`> =b쀈UH   x @2 @2 @`"o$ @> ń(h$ @ x 8  %q$ @$ L$ tH> `$H H%HM$ > =c 0"o  `LHp@^ 7>  aH`0`   `> @c#& H& L` `$> (> & & & 8& <& @& D& & t&6$t0Hp@' 1 t㿘Ho`4> ł(@a> > ŢbL>  aP'> )> = `"0 H, `2`@(  "% `@`@`&`@ ,`t "   &`t`t 2 "`$  2`@ !2 Hp@1> Ų w#``  v0㿘#> =b쀈`U ``$`W> =`Q8@"\ Ho (@> LL` L "Hp@a> LL` L  b`$$ ,   8~  -Hp@ 7 >  ax #` @    > a >  aѐ  沖 Fx 2 N 80ʄ ``( @: HV  > ȅ3 a7> H3  @2@2 @@@-@ 2*9> ='9> =2 2L`" `````$  8CWHp@ #> Řc  `) 0(( @@ ` @` x 8~?   8C,0Z E  "Z``` @:`Gޒ M` ( (( > =`$ > =" &4  %` %` %`@%`4%`8%`<> ń#` ( (`(`P`?> 5`%`t%`pH> @`%@H@ H'@H%`L@%`$$}$> !c0`$0{ 8 㿘Ho`(@aJHp@1> Ų#"0,L4l                                   `  D  (                         d    H㿐   `` (`(`2@" 7*   ` `" `" ?7 `` `(0`(  Eʘ `(0` 0 㿘 $``` `؀``H`> $6 $b``؀`2&`H $6 $2   ,  @& & 4`@"@4`   $@ & & 6 $`| $6 $㿘 沖 D;   ` 4 `@}*`4 㿘  `   .`@Щ` @4   5~\ 5~Z㿘 B  &  (   -" ` `*  " `  @`> ``2    @20<"  " ` `* " x> @c<' ` 5?`0 -(`>}` `3`@) `/8 ;-  5|Q G`* 5}4`$` , x$  7` `4`@`"` >   `2@@> $@ `@@` } 5@} 5&@ذ  `"\@ϰ  `2@ ,`ð  `2@@`8@,`   `<8@@2@`> ł '/ /'L   '7 < " 1V \`&m` 1 {  5 { <&@  $` $@4`,`,`H4`<8@@s ` > `` 2 h 1 "e 1 ba<2 0 <2 0 U 1`` `   ` "      2  , ` X@` @ $+`` `@ `   #4`(`3`  ` "`, @ @2 2   0"(`` 2  1 " 1 a<2 0 <2 0  1P\`6@$@ `` 2  1 " 1 a<2 0 <2 0@ Ѱ ;㿘 @$`  `  " `@ @a`@ &` {` (`(@(`5(` 0` $ (@ @$   Ψ `ʆ`Ȑ` ` ?&` (G`?C`؂` `,$ 㿘``(`쀤`  ` `$`>  > {"H> `  $@``造`&@ .@  `.@ `@ 㿘 ` ?c:``2$ ` @  @@:/  ?  '  ,r     & $& 6  $ &  $ > c@$ Ĕ    & @4  @& & &   㿘  `(`&> (֒  > ź`h %94`A  e$$ $ ` 4` `؀`"`H`"R $@4` `H@`'`H@Y  ?(  F> $@ c$ $$`$` $` $`   ($ (4 $ ?%@84`@"4`@6 `4` v 2  7& ł`h6 $x` x 㿐>`0`` `   =!6 "Ր  "А j  *  >@ 0!e `` `4  =s`2@` ""Z 9$r#6 > '  "   $;#`` `"R` =n`` ` ` !@* >}J >ɒ ' " `!((`   @  6z"s`Ӏ` *`0Z> ' P" Ȁ2ߒ >}$ &l0` В`l0` ̒`l0` Ȓ`l0`’`l0``l0``l0``l`xq   @C~ ` l hw&l?`8s .p l di&l l bb&l l `[&l l `T&l?`8P .xM l `@F&l l `?&l l `8&l.q5 h *`` `* `@ %Ā`"Ho 4(@a"n ? @&?&Hp@`Ho 4(@a"R ? @&?&Hp@Ȁ#> =@A* < (@&`! *`h` `Ȱ `@°  `@` x " &> 0`!] = '  "   ِ = ' " 造`\`0 Tð - *W`=g '`"" `  "  ``` `n `@````l `&lAΔ$ =3  '" l` ` @ (  @ u(`>} 7"`V` (倧 ( &`   <(``&` `0V   ? 7Ȁ`ٶ `Ȁ`Ӷ `Ȁ`Ͷ `Ȁ`Ƕ `2   Ȁ`"  nv̔    n' ' ` 7  7`  ;""B Ā`"Ho 4(@a"  ? @&&Hp@`Ho 4(@a" ? @&&Hp@0(`0``:W H` 5 n `"" @A"  ;j 70 Ȁ d `@@[ `Y 7l ` S&ll ߂`M&l nwذ Ā E  A@@< `Ȁ 8  4@@/ `ac (`0``ِ `"W" @@Q" 0;> =a؀5. "0.   @F  &` (`0``W H`  n `"" @@" " > =aԀ.m ".ܰ > =aЀ._ ".ΰ (`0``| `"" @@V"  à.@ 2 .     &l &l {&l w&l }&l &l &l &l> <''H'L'P'T'X'' '\`' la~> -'``j`   '=` `(` `2  3':%̀@Y> c<@ > ''`L 2N "*'  4`" 8` 8`'" 8&  -`-@%`(&<8XW ``\`@`<`l`P@8`P4`20<8  <$ `?'|' '' ;> >''x`x`|`UHo(@g ?r ``(‚``` `$@CĔ` Ƃ?? m?y ! `" `?q ```` ` !$!` @%?  Hp@ `V`<`l&<8@! :~0x@ ` ` `X` 4 `x`  >   P : ` `!!(``   (:Q 2"'  4`" 8`O 8`" 8&  -`-@%`(&C<8@  ``\`@`<`l`P@8`P4`2 0 `p< <$ 8@o"@ 0 ,`t`vT`\`q >  `N>  `> = @C<@"?02 @"A h 0 2 > =`" > =䀠``" `_`\`[(    ! 'Hp@9 <8@ <$  ` "> = @2 0 h > =@2 b _   2> =" `\`2  !@ v0 u,Hp@` "'8`(' `\`ch `l^a0<)@$4< ((@4$> ńh8` 8 `X> = \ <'̀ >  8`" 8' "`> `` `l "  @2 0 (@2 8[`(  `l ,#\#`  @F b " 0n ?(:`x`""> =a2 =@ 2 A7f'B̀:4 ^ (`l'"> 4`" > X`2> `l\@8 \> ńhL` L`(@ `> =a @WY0 Hof$(@`(@AW  A!!   O  c> =a "!" :> a4!8@  ! `  ! @`?Hp@2 3 ( "' 4` ' '/'' / '`(  $ \ ` 8`+" 8`(@ &`" (* ('q `؀``H`@]4 `$`[`> ,` ,a@o'gb "`>  ` `l8 8 @2 08(@2z 8 'Hp@0U'''''cr&`(  `l <,@A- 6H A"'"a>t0` 0|N `2^`\> ł`h`T A' `T|@ `2Z`\> "82!@8* ! |0 @Vw 'Hp@`( 2u > ł`h`T 3' `T ='`2`@> @' 2'` ``"a5 '''''Ӵ>  (Ր"> Ґ"G&CȐ"x>  $h1 $x` x''x `> ńhD` DHp@̐`( 2Q > ł 1x' ( '[ q' 0,/$///// 0/0/.0///0/㿘`   45k d   ` 2*     `  @ l`$ l ԰ 5b6F ' "  l`  ° œ$ l㿐'X`P'P'T''H'L``l`  ?c5 ( ?c8* 5  7ܔ   7 `q`y(( 0 `x0`8   (`& (```H "Ӑ A0?@ @"``˃1 `<` > ńh\ "` \ڻ6㿐`  + $``.`> ݯ#>h ` 9Nr > =b䀧ǰ `4߀` M - `> :a 1 `` /`$ (Nܰ `ͥ ڀ` `> :aа 1`"5 ˀ` P>  `ð > => =cHLLo `> a̰ ` (`yX ` `# 8 (  M `o` $ 8' Ɛ  $ 8" 9`Dz> ""'  2m 1㿐 ' > > =c8̀@%` -`@[`@` 2``la2`|`| (2` `y" : 2` :`x`8"`(2``( 2`) 6  "Ǧlf@ h @ N& W3 "'3'"( lf@ h ٖ@ N  3| 3v=F@ `   M > ł`h`0`4 `0 `4B "g``8@2b``(3O> =@'> Ȓ >]c(!㿘 > "(!"`d(@> Ȃ @(`'U4`$4`!$``td!|` ` )`4Y <4`84`p` O (4`4`p!"`t @!|$` ` `$ ` ` ` ` ` ` ` ` 4`p`4 @ <4`p^^__l_ _^^]P^^^^^^^^^^^܁" "  " " `` h 䀢   耣`쀠" ` Ԃ `$*  И  " l& 䀢$ Ԣ  Ȑ   `@  Ԁ@,    ߒ`Y ?` 쀡 `4`Y `$<   ` ?5M  ` 쀠@ +  @  Ԁ@  &  ȓ, `@   @`& & k Ԁ@ & & & $`*`ؠ k `?& 耡" &  & 䀢b4"> ` !@8 ) 8`1 @8*` 2!@(``8(!B) 88`! @2!B(`(!D"!8`@2 j`8 !@) (`88`@8`*`8 2 l2 l2!N`(`(`2!B2!@` 2!N2 l 2!B!B 2!@8) 8` !@2!B(`ʈ !|` (`  <taatd2  ` ` > =cx 쀢*    l  ("|`@"` l*> =`":݆ ( l׆ (P>  Yc<@' P` /1i@ >   ( ( <  <( @? @  @? @?`( `   1>3> c, 0hא 1  c`c  1Ɩ(`` 1# 70   ˜ (c`$`$` $`$` -$`( @7  Y``"`         ` &`  (<)@&`  .` &`> =`"  D `" D R.`  D 6`* + 0`* +@ `" @A`$  <@0@c$  `` @B` > =$ T@$  P$   ` 2n Y Y``2 %(`0`0`-`-`6`7 "@1 6` Y  |``` @%```(-@00-`-` Y``" /` `<@ڐ -`#\   @M  ` ` ` | -` Z`(6` v`<5`(`=`>`?`@a  7` \$ x $ ,  Z(6` v)4*+,L  X t u'''///'''''''''''Ԁ /ـ C `` '``'x  ؖ@9̘  B  ,,  Y #\@ʚ 00 0`24 `x `q,,z Y%46`@6`\ Y> =a @ *  ` `(`Ē`# 0# , *, /ݰ 0t> =a,K Y㿘 `\` >  b > `ch * @ @~ *> =c@* > * c &Ho4(@a 2 L0& $ L@2  X@t 2@@m t 2xexb 2Hp@Hp@ >  b> `h * @ )㿘@ >  @* &@` >    @> P#H `D@L(M`(L @"  & 㿘 `&V h`"` &@`$ >   @` 4  @`4ͦ  & & @<&  @$$ & 㿐 `` ``   ! `> ca؆@8a &&  p`> b4%> =w s "` "`$` `,!"`4 `"`$2   ! `$ P p@[":$   `9 E  $  $ `$ P p@="*$  @<    p$$ @'"P8 w$ $ $` $ & & a@< $`` &  `ʒ  W    $`$`$`! `N$@$`   $  $ `$ P p@":$ $  ``& `̦& ͘ & $` p" $$ $  &  @& P8 &$ $$  `$X$ U$  $  > #`㿐> =c`>  c((! @@ !   #\> > "cp   $ 㿘 " -  8` " 8> bD y#㿘 `%6   > # ? @ & &&      H& (`(`&  f0>   H (` > (`#  㿐Ho (@a  @` Hp@Hp@> cax@8ax㿘+> b` Y`` X& L)> = L@#> * & Hc*  Ho4`(@a`> =@X> => c@ <hI& 6 > =c(( & 2  `3 > ' bБ0: ad`& ad &ad&ad& `& ` @X`b$`@b> 'bc> cp@` @( " > բ#```> > b vh@* @ P *\& L X> ``h>  vb* @ ?M& L>  ch> > b w& > s#x㿘 `@  G ! $!8 ` ( p p @$!  $!  㿘 `@   ! * &!8` p&  ` @@@p&!  $@`&! & `!  (&! &! !  p @&! 㿐 |+> =cx " !|+ <) (`4422` @`*R ؀8 @* @taL402?쀦H> =c`X`2-, $ 4p  \ հ\`2ql]"|u"Ơ|`"r|lcx @쀦*<a*9, @82$ 4p @?p$l($h  $t@f e*$ 4p, a ,, 8%$ 4p|$ , @($ > =a2l``('` "l @$ , ($ $䀢$ @"``l ` @*cx (cx`` l`" @ @f쀠@: @`㿘 | p `@ .` ȳ0`@  ?@ܐܒ> 8c A@͐͒> 8c A 㿈\Ho 4`(@a`` 4``"oHp@?`!`?`D @ @`4*Hp@ D "`  f  0`(`<($ Ȁ`" $ `  ̀`" $ `  Ѐ`" $ `   lla@a$l w,w"` :``$4> `` `$,` $0`$4`$8 `H`  $$`  +t  " $     *{`D`D<t`&t`@ 0`.S` `0&t.R``ta&t@ &x`> `&`T&X`P&T`&`&&&&&&`` t @&t0`$0``` tb&t`` "td&t܂ 6h&&> =c'> '> =&4cT0: 8`$`````"`p& `&``&Vl&&&Р0`: Ԑ`D `4&&``@<`0׫ "9` 7$Hp@ب laԒ R)ː(  #\@T ) 1{Ր> ca?@8a`C$8 $`$$`` $H`$$L`($P`,$T`0$X`4 $\@o 0;` 7@)k0НP> 7c<'X' `&\ @> a  /> = T $`t` `td2Xa| @ (` @р Xa|ؚ @#\ А@j  > ca  @8a  >   `& `  `" T`h`4 `t a$`t $aT$a\@&$`t@`td a|'''''''''''''Ѐ`'Ԁ``    // /'/ 'q` ؖ@2n  "T`h`td4z`t( L`  `` 2@ ` T`h`4@`tb$`t  `" T`h`4 `t`@$`t``8 ,aS   `" T`h`*` u s > ?`G  @ >?a  /٠ `/ؔ   /`/ 0~  6 H7``t {$`t #(\ `D    `td"V'Р\ @!> =ca|`@?``'`t'؀d'd' d`#\ 7`#` 2,? `0  `" +> c!@  ?!਀ "&(&&Ph  h @`' h' @ `Ԡ ςР>  L" hX@dt `&&&6h`@d `&6଀P Y%%@G6஄?c4&D ag&P ````D<&> =c  ``ং`6`dbdং`6"&ং` 6&ഒ '> c`h`@ `h `@ `> ca@8a +`(` &ఔ  > 8c `+ *&ఀ > =ং`76&T2wd M?'@㿘 |V h `@     @> ax' ő`"7 t` @0&  ` `" $` ? @$ $  | "  la"  H  @0 `  @͒ &  t@@0& t t@(& t㿘%> @x "  > ` @`$  >  @` 2 ") >  `` `! > @ > #  `! @ ;`@ &9 x $ @&`&` > #  Ȃ`! @ ;`@ ?9  ` @@`$7$ x@i@  ? $$ `"$$ `` @@`@O &? &  ? $$ Ŀ`2`$  6`$`?$ `$%` Ԁ ^$ `&$` Ԁ`` Ԁ7@> ` % @ 0# $  6`$& #  Ȃ`!  @ ;`@ 9 Ȉ#  Ȃ`! ;`@  @ c9 %   @?$$` Ԁ"0& &$& 㿘Ho 4 (@a `"  Hp@`  >   > =& cT > cah@8ahÐHp@ca@ 8a > =c6 (0@((! &   `  > 'bБ0: T0& >b  & 㿐Ho (@ag " ঃHp@` 6ঃHp@ऀ`rHp@> ca@G8a㿘Ho4!d(@a!d "&!d   > @`F'`2`&!dHp@> ݐ#㿘Ho (@a> ["Hp@> c|> c<' 'L'P'T'X'H$|'7L'   0```,`'$ N> `  `  *  @g' &  0`(`$ `$ 0Ԑ *   `*>  ׸@`$  @ ``((`@0` /` `2 ``?c`` ``` ?c":` `` $` ߀`@2)(  (@ " `$ <8@|'  ( t  $/`  $`@X(`$(d$`2 ```2 ```Y `w' 'h'l 0 ` D`d'p7~ `"`D Ip`D`'p`h(`@p'd  aP('`@`2'؃8`>  0` `D 0'`ܐ) Ho&(@g  ` `$@-ܔ #\#` @2```@( `Ȁ " `"|a`̀`"oa`Ѐ`"WaHp@p> =Ph 4p `2ܐ h`‚p#\h (l#` p` `p> =!X#  '' ``ppPh`hp`p#@!'t  @ 88`p (*8`` ,` `"i" 2  paT" @ > = " ,d  ' ` 7 ?4p `9 $@ <t 't@'  ' 6 ߂ @7 `XpS`h`Tp`"Q @А 'p`$3pF`'   (p@ #\ @m 0p  `倍! `8d> =c `p`tp`pp  |`@!|``~(` :`>  B 0  w @  'l  'h $~ `2z  @B`  s 0`2p 0h ' ' 'h'e 6 $( `$(,#86 $( `$( 'p7~ }2  0 >`"X%` 0``" `D 0'`2E` :`$0 ` >`"XZ`20``$> =cX> > =#c\ qp<(v   *>  @ &'~p(> :`l  0G@-  W'`ȃHp@Dp''''''''''''Ѐ'Ԁo 'p`$ >'"X'  ( @{ "+ ptd"K;> '>bTp0 8Z: $p]%h`` `? @'`'`'`p Ԃ  @@@ Ђ`$ؙ?`@pC<Ѐ`  Ԁ"gt`p!ep t`@! t0` // //7ڐĒ`  7``ph=7~` (> c>  ޒc` p hd(`/ن / ' /7/' 7`8U (`P23`@"G`> D`Ѐ"  U2U4ephl#\#`#h#dؒ?LpS ؅<  @ <ؐ  '@'`p!T@  !`!` p !`" p Ԁ`&pp h(`0` 8` (@ebp2 6`t> =c = t p =58p3`h p`@$ 'p `Up`Q`t@p t<`=$<   (p#\ @. 02p  t`! t` 9 $@ {<i `F"  p!T p  @ `8p^  *p @@ @G''p'dp`p$[7 > =Yppt`ʀ`p`'`a` >'  ("Xg`"`'`a` `"`" a`  > cl>  c m`#\ؒ '"T `D "!'p h(`oFpPh`"値` ․> =c-@*p`t @"!4p̀,4 p@u 2 rp!!! ! !!$@! tL`$L4`$4 pp@ t(# t8`$8p `!`p`"pPn;> =cPp!p3`n "@`p`$> =c`> > =#Qcd p ``p` pp @ pE  p" 9pS j`p p#! p`t```#a#`Ԁ#`t#`> =c ` Ѐ`P` `"pp @``9$p> ' >0hbTp0 8: p t```` !S !R+!P+!Qppa8`p> = "@p p@  ' p Ѐ@8c @p  p ؀2}  p (`2` "`pPh` 4`> 8@Zp7  ߀`ppP`h  `Ԁ@ 2t@`utɐpp`t`#`tp`^ "%ph) 8`$ 8`8hpp  t h`# # t) 8``"+p` `2p 3`h` pp!|``~ t`@0ۀ d p @     z  u ` p `"`p p !H#  # #!Hp `tX#`t``؂ `$j#`g pT@ p  Ԁ@ "7  `\! `W   1 hy58@pz'p2U2``@   2 U2`k$p`! t`$䀣`" 2 !@2  !`"` `> =#!\#!T`p  ` `4! @*Q n`2`$`e> =pa8  a<"@`> =c 뛒"@ pp"@` < $@ < | "  la"  H  @ 4Jp t p !p @`(# tpah8#ahp ̂ ` {p !_p 4` > 'S lbР 0': c@pa"p@`t'##`tp`t@(p t`p t@{p0F    @```$#!Tp#aT> =pi \`7$p> ' >1 hbT0 8: p t````" !Sp pB#`@g` "   `" >'pp .pp  pt! !! ! tpcPPn6p lp;> =PncP%pc!`' `Ԁ"lpaH gp`?$p!$!#!  pp#a p0`nt  pap0`nF p!$!!!  ڐpp#! p3`np@f:. p3`n* @ ͒ ='p p`Т'@`< $РD<   7~E  ؆ `p!   @@`%H`@5$Ip !L+!L (`2`@a`ta\҂ @@$E#aT p ? `t0 ` $0`$p1 n `@  ;`$@ $<> = n`3 nP(`8`@"T $ p!  p@@L!! p 0  `#@ @ 4 @p `"   䀠`"   p`$ `Ԕ#``$p 9 @ `<`|  p la" t H  @, ptp> =c 2 jp `"g `"c`\`"_p! t` /`pa,(p> 'bЄ  Npp(@ (4p@ t%c! tp@ t( `# t0;p` 2> 'bp0@:`*` P*`n @  0`hp @+2 h> 'bp0@:`*`P*`Z @ 5+@臐 tptp> =c 2 Ep `"B `">`\`":p! tp ` 9 @  <p`$| "  la"  H  @l ` tppt@$! tp@ t (G# t># tb@ p`4?p(` :`>  禘 ap~p(> :`l 皘 Up|`w$  !  1 p(`0`2 @} ( zpa`#a$#``p`t a8p tPp`@$P@<pPn]pp!$!! 3 npw p#a8`t `p#`#a #`t`Pp`@$P@<`pP`n<`pp$$@`  `"@`$@ <`@ `<`> =p!8  p!< `> =c 8"@ p@p 4`p> 'S lbР 0: <pa a$`p@pcPPn@ pP?c(@8p!! p " | "  la"  H  @k @p`  @#`0@papp`t pp !p @`(! tp!h@8#!hp `̂ `#`#`p``@pp pQ h`"3  ``․ "\ ` p3> '>bHp0 P: p 3`hD >` 2À> 'bp0@:`*`P*` @ C`"1 p @ f2 h> 'bp0`P@:`*`*` @ 3f ppt@@#V! tp@ t(# t07p @x ^p  t9! t !R+!P+!Q (@U'pO"@  @2eU2]#B"@ ># tb@S @ p a( a,㿘@! `  > =cP  @&   <  ,    ,  <"  " 㿘 !@`6!B!D((`88`8!V j> =(c@  x x> 'bА0@:` V j`  j6 j> =(c@  ဢ x> Ґ 0 | t> <' @`@ & t'p> p#<@  >   ( & t @"!> =!4cV l * p(`&!  'x t(& t  ' '|''l'h 'd   !  V h> = h|"V nN r`  G@  `@ @` pȕ(`028'| '|@ * ? @"4€ x@  t`|@ N r`2!|!H0; !   !|``` . ( 2  t  ``ဍ d  . ( (` ) )   '  (V h`l b (X> !0 @  ?'|#> chP2N r t` +> c`h`%`h 6  c`8 c$ @$$$ x,% &> ` x`   t` !2  2  4`"! $` " ` <$`` '|@&` aaК`C =aȄ@ =a Ԁ +$` > =#`",`  t@aD @`%aD t2  t   t@@"S?,` 0`  p& !Q! Ժ  ?#+#@@?@4`  ?c ` > 4`` ,`  td!|``w`2N r$` 4$`( ?0`#@@8 @4`N r`"  4`"  ! `4&!@ `2V h> =㌀`"   t " 2   |`$(!|``A`"p`0 |x( |q(`( |> =a@  't* Hx 'pp t!l8&!l`@`%`@ t``` `%`  t !@ `4&! &!` `j& t|`' "!  !< u  > =P@&%N rN " N r`  ` p @  ̘ '! @&! 'p?!Q(! ԇ2 @!@6N!|(`@ 6J!| t2F!| 2C!|  @`4=!| "8!| "4!|! @`  `  4`΀ "'p `2'p 4`"6 j}'p t`& ` `$ "d `ad!X!T> = @Bc &!, ` `    &!, <`" +>  ! N<+> c`H`D `%`D@ =`H a  c` c  (`c$ @z$ G @$ @2$" $ :'x(> =l !2 @!@6!|U(` t& t)'x*N r"!|N rH ?   ..遐d7 }I  À` t `  ``"!R`@`!R@@&x b ( 䀠` ( > #! $@9! @0`  䀢> `  耠쀡 " #@#```  (`@A`@"@ a@    & "  t`& & t "$!`" !` @"! `' !0> 'V lbБ0~: !h 4`" l6 j `& !8` &!> =c&!<&!8``%` " 2  `  @> 'V lbБ0~: h 4`l6 j/٠ / `| //Ē`|  (' |]` ؖ@z  J!| @@#\@x 6!| 'p_ ؐ @p@ (4`؃(`0`0`, ,  ,  |@q `,    ) ((@@0`0`, ,0`, ,  |#\ H't @W 'p'''''''''''''Ѐ`'Ԁ``2 |  // '` /'/`'`|`  0`(`$`   B> = $& t|"4 +> c`x`e%`xc`l`5%`l  Q$K p'pj&! l6 j &  (`Pc p# & taH `%aH @`>+> c`p`/%`pf$`!  N r`"a@" |a@ `%a@2!| h  4& `,6 j֦  pX"r @q t tb>  @A  9&藐0 c`t`%`t@ &\i(`V & +> c`X`P `%`P@ =`X 7p (/p` pA2"V h t`"> >b@ >  H >  x>  h A'pV h`$ tp6!N'p 'p>  +  |@A?'pV l> 'bР 0}/: k'p_'p?*!Rc `(@ *!R   㿘@b3 > c<@' \p@^`.`<`"* '`?P 'X'\7`@bP 0` (` G\@b@b4 @ C>  @'d 7n 'h/l/md@a ̒ '''''''''' z/  z*@p@p  @'/@aŔ (>\? "0 㿘!\ @ !\Oz L&!\ 㿘 ?(`0``O  L*  MÑ2 $!\   zU  4 (> %> 0c<' 2#> aؔ Xy֐ |`>@ay  |`<@at !|`, |`8@al  |`(@ag @a>< p <&!X@&  >  !> d#@^!aؒ#a@aI  $0 |`,@aB  |`@a= ג2 㿘 D*    4`??㿘 D   p 4` X` ? & W? `&  ,` p0`" X? & p '!> #<' '   '/ل >`/#`''''#\> 9>㌐"Xؔ  @V   >  x> `c<@' " `@  ` > =. b ?` >Y+>`bX08 . 1>ڀ+> `(`@@ ''ܐ"Xܖ e> @` D @0>+>Ș``>+>Ęc> =à+> `(`@@`''ؒ`bXQ D   !!l~ߏ!h5 t@/@!p@ o$!p$!t 4!x`f4!z> !b_`A`3`@W '7'  ''//ϐ0E$ t t(@$ t>T`x``"@```"L`  ?>Y`R耦  K> Da@xY>` q ` ؔ ''''';>`"X  T >>  @` DN J> Da@H@` `?`` >c> 9c#`#\>  @Tѐ"Xc > 9cb> Da@`A`3`@ 2 @z@ >φc㿘 DPh` @`$ Pj0NC 66)`$0NPN`"0N6 8`A`3`@20N㿘 ) >ax?   @ $>$ ɐ   ?&   @ $*$  2 㿘Ho (@a> "Hp@> ` 㿘 |@@ t`$ ` > b4`~ 2` x " t t & tܐ!)$D  & t0۝㿘 |V h`@> ` `<"V!N4 8` <4 86 h>  ` 㿘>  "2 O"> =& cx>2!02 p` Ҕ>  a, @, , " Ɛ@  , a>a0> => =c> =c|@?``($`t8( $`$`|4a@4`l4aB4aD$l 4`ll$al$ah$a$ $a   $a|> D`$D,w $a|> =a$D,xx\> '܂c<@'  Τ |@````! 4!|H   3>  `@& `4 44& & &  <((@$ $$ , !Q?=444 |`& (`j`( `> c<@ >  `(v (v  v! v v < -----   |@l% -(`0`0`--4  * @ @jI (4    |`> < W '\ @~  ?`vJ vF    ($ v$ $4 $ , 4@vI44 > =a> =, a @ (`  |> <@ &  @<@ @ ` 8` K v  ( ( (D v < < <= 6!8> 3!> 0!(?c44F& (㿘 x`_ |!| 8 2$>`, ut  up p?(@, 0`0`0`,,   , , , , @kx , ``(4 > 4<<((@$ 4 4 $ $ , 4 `  ( ( 0 8 (0` `?0(`(0`0@`@ @ (`0`0@@   @ 4    !|``` ` > `$` @`(`(!|  f(``2!|  0 $`  ($` 㿐 >#\ b<!   > > " aH !> !x  #\> aP> =c!x   !>  "4  #\> aX> =c  "4> =c>"X> D`;8>  < D> `<`8 > >@!ߓ@s!h㿘>T`2>`@ T>D`2> D>P`!>`@ P"@`> 'b@c $"@㿘 ` > b4`Ԑ & 㿘 , , "   , 㿘Ho 4 t(@a t Hp@I" tHp@㿘Ho`4 t(@a t Hp@V h`  >bH > =!4c  > 'Hp@> '>bD0v:  P͐Hp@㿐Ho`4 t(@a tB> `4`#`4V h B>bL"% | (> '>bH  > =!4c>T :.`<`8`#`8 x  Ԙ?#\ A > '>b D`@ۀ > '>bT0v::  8uHp@`<` <#` Hp@c`,$`,V j!@` !B!D/ i. r. rHp@> =!4c>bP!+ +`8`8*@08`*> =uc䀤 `0` <=$`00h> c<@' Ho4 t(@a t@(@ |  !p   p,!x j`6 j(`8`` >  6 j$` $V!N` <Hp@@ >  (`% (!D!@V!B(88 V j> =(`un6 l* : &6 l > ' 6 l> 'V lbР 0u[: > =a"; j | "7 jV h`3 j(`8`1` @`+8\ " !| 4`"!| X`2 j!|`2 j'/''' / (' ࢒ "  j`X`|`V֐ j(`8`H ! h& & ̂(`0``1&!8 t !  p2 @ ( &! t&!$& 6 n@& t!Td%!T0_V j> =(`t6 l* : | ~6 lM0L> =c t@2 @& t |!@!B(`6!@8`@6!B!{7!t(7΢+@& t)@' (!> =!8$  |z` |`> ("X>˘ 0Ð!x$`X 0Ho(@ a> =c>>"<D`(#c> bH#" = c쀦@ p ?@>t> }> =c쀠 2 p!(1 ( @䀦@> => 8c@8۲ڀ@㿘 | v`@ "`> =c p?@t`Ȁ@` K> =c耡2 p! > 8 @8 pX> c<@'   2 @`   "  @bP @ > "p{ `P`   @gi Ԓ @ga 2ް Ho4(@a`P` >"X˖Զ %" D " @`2  50 2 "p2 0Hp@0Ħ.> @2?''ăHp@"&@p"'@'''>"Xzf!` ӂ?>Ԑ"X  2@Ƃ?'>"X  㿈 `?`( (`  * #\> = s̐#0>>sb"L0jv 0ߐ> r 0א 0ѐ> =sH#0ʐ> =sA#09> =#'s8 #@ >!x% '#ʘ 09> =#'s #@ > "4 '#  > !rW#0㿘 h`8 (`> 6 h V h`4 |"`@V h` > '>bH0ry:  P 6 h6 hް㿘 |V h`@``V``"x b`  㿘 Ȁ`4 !> =`!#> =#c  >(bX " 22 h ?4 4 7 #耢 # c쀢 ސ#!> =#> =`la  "!|"!|㿐` ( - `)7 `.2 la0@L!  `,Hp@ `ӗHo4 (@a  逤` D ` h> !@YM ,`>C Ƥİ -``"> Y$x @> 87 p>  ` 4h> '> =bT0q: 8$$$$$ >`  la@M~    }4h la@Mot q 8  m `"  W `2  x7  _`D la@K W 5 P H`2  `@H  aD  L`@`> #` &` M(@ L `2,L &`HHp@  `,"     ! 4>M: 7 `   R  \ r UQ  $  8  Hp@`܀` ؀`:`  Ӿ 0ݒ Ӏа ˰ =   @,r$,r 2 `2 `2` `Հ2  > `2  >?c  >` @L @M6 0ʔ ~ <8@x' v q  >`  gٰ] 7]㿘Ho`4`(@a``Hp@    6`D` `* /@֘Hp@ 6   J ' \" !"t * `  ۰ٰ J] ΰ *< 0P2ǰ *      `Vh` td @"O&&ܰ   `Vh`Ѱ  @8t&d &t p    ` @p6p t d u s  ` @t `&t &t {&t 4ph,h㿐 ```"  *#\> > o \0 9> "t n 4 ;9> n 㿘Ho (@aHp@㿐```"@ ``` > =b. ?@>Y:`耦 5ꀢ1  `(` > =a"> >a"> >a`"  (`0` >''" `@`@0>aD >ߐ"0@ 0H> c<@' ``" @@ >   ?>Y`o耦 j > Da@>` '/'''''/'''' '@NL' @b > aDs  ''  ' //Ē''''''kŐ@N!'Ԓ @a  U!>#\#`"@H0>aD `@``` ``'''''''ؠ @a k   `@``` ``''''''' @a 0Q!>بaDȨaD#\#`> 9>㌔  @H`"0<"@n@ 㿘 @0`8  @ @ ܁> >`t>>]c(" #>> btc<' 'L'P'T'X'H''L'$bt 0```'  @ >  / `@   @%bt`% bt` / `@   1   *;>  2bt` Q  @@ Bbt (@$' ' ' ' '+`2  `2 ?c` - `-  ?c- `bt $ Hbt``( `v `(`r  `n k "   @btbt6 $(` (> >a> >a`" (`0`"d ـ``#''/''''' /7 @`'/''''''Ԃ /7 @`֒ `ဧ < 8@!>'  (ې !>;!>" 0``bt `D 0'`bt  Ho&(@g  ` `$@  #\#` @ۚ``倥 `@` S@ `Ȁ  `"i!`̀`"\!`Ѐ`"o! 'Hp@'`l0?2`@` @} $`l2`@` ̖`l`@`2  ! $`> ;`lh> ;`@`2  $Ֆ $> ;b`䀠`͐H`@ؐ  bt `I `" '`!` !>""@!/沲 a" `J`J ("`>`@``@` 2``la2`02`"Q`8`,`Ӑ`,`0`В`4``8```2`` `2``$`2``(`2``C   <0?`l@`@` @| `lf`@` `@ؐ 0 T >>t ` '`@``0?`l`@` @| `lf`@`ɖx`@ؐ  2bt =`@0- `5bt $bt``( ` `(T0l}.!? c''/'' /7  '''//''7 ' ` @  2`6` @\6*  > >bt`( @ ڔ  b'`ȃHp@0bt` @۔  2``<2```$ :`%`$0")` ``%` ``%`28 07 @`7Ґ0 @g6*  > >bt` 0 !>' "' (º"`( 2``(ɀ` 2``< t`@0 ``ِY  h5  >Tق` T  2@ 0} 0v 2: 2-0 "' (`(` `? @'`'`'` ,`@'6  @wp 0g`"`'`!` `"`" !` !"`' '  '  '  ' 60A㿘@!㿈`l'T'X'H'L'PT' `?cF!`(`8`  89Ho 4(@ Hp@0怠` 9 , `lh)`"y   &`8Hp@ː° (a ؀0ʤ    7 و`## + 3  + `8# `(# `>3 `<> >3 3 `P!3 `x`q+ + 3 >t, ` ,``H"(`@```0#\+@  A$`2$    (0@@?@@ (`0`0@@8 @3      ~@z u2``2``$눡`> B!㿀`   &``.`> /!> la@Px  ݀`  la" ( ` `  $` (`ް 9Ho` (@a la" $ 8> 9bb` ``$ ,$ 0$ 4$ 8Hp@` 4` -  䀠`" l" l.d`-V  la@ʰ la@B  la" ( ` 8 ` $` (`{Ho`(@a@E Hp@ 2dߐ` \ Ho (@a>bHp@ E> >> >`TXs <` lad> => D`2* wHo`4 l(@a la@DHp@ -  la"@B@  ` 8Ho`4(@a6" ; 퀦a" ( ' ' $' (//'6-'0a* x㿐 ``䀠`` #Ho 4 (@a ` ``8` @.' -Hp@  ``߀``   ` *  > ;>*b(#`      *  > ;>*b(#  > ;>*b(#㿘> bh`! ``b 2bb2b c$@2bF8cF5 (2b`\`"b㿘ՠ "  `   7 $ a< $ (```C <` 8 @ /<`  (`0``2/  !(݄@"0> C"`>T> ; I ?݂c`C> pH`` > `l@f !>(` !(݄@ִ> pH/`@@ > `l@fb >4 `  > Ų ` ° ] c䀠> Ł `D  QHof4 @(@g @ D6 H <$ (`@"& (`@ ` @& @Hp@ `|& H L`Ȑ0 <㿐> ;cL'L'P'T'X'H'> ;b -B 7G  / L /J㿐> ;cL'H'L'P'T'X' 7  `&    @?   @8`C? ````````) (( @0`0`/`/` 0`/` /`@ `(` : `ɐ  `````) (`(@00/`0/` /`/`/``\ڒ*  N@ `"*`*`"* *`* @@c}  & ` @7`  & @7` `@c*`7`  D  Ė Ho&&(@> ź``@`D6+`H <& (`@"4'@ (`@ ``@'`@Hp@g> ź``@`D& <`H`'`H`L`Ґ0B 2K&  <㿘)> >!,`*    %> >@ !!,,` 8"@8@@  @ 㿘> >a$> >.`0`@" ` ` 8@ ` @ > = ` `?(``? (@` à > =a> =a  ` @` @  "``,`-` ` @?"`"`"`"`"`"`" ""`` ` @?"`"`"`"`"`"`" "" ` ` `` ` ` ``?  `?㿘@ V ` @j `?㿘` ! ;  6 a / ے # a| $ В  " aa  Œ  a` a@. 0 \ a@& 0`?㿘 ` `&``6V  > o" 㿐#> >a(  : 0` "$a(   * #\* !> #> a(. . 㿐 ` `> b`@A  '㿘 ``@& <" 2"! ഄ? @ " ""ఀ &"! ༄? @ """฀ &"! ̄? @ ""  $Ȁ &" Ȑ ({]r& $r @r Xr p! "!b&!! "![&!! "!T&!! "!|M&!!| "!F&!|! "!?&!!  " @"  @" 6 K56!6 K㿘 K 4n"0"" """"""> "" """"" 48" " "! (>pbܐ @>p}b X>pxa p>ǰpr`ā㿘 $d   ̀ ${& $@l  ${& $㿘 $`@`  $& $X> >a,`E> >a8''''''''''''''''  (@ `"(@(  ` > R"> > b > b, @ 2?  , > 6"㿘)> >!@`'> > %!@'> >< !@$< !@@bm@ # * >@0` @`2bU @  > >bI @> >a8aȐ8 @     86 @  @ . 6@(@ 6@ @ 㿘#> >a,`e!! !Ho $](@a,* "b"! " !@2 !!&d > >a0* "Q 2 !" !@2`  !! K!$> >a4* "F 2 & " & @2`  & > 0 0Hp@aa,* "!!& > >a0*   "!!!$> >a4*  "㿘 $d   ̀a@ ]㿘 $` `Q@ M㿘!> >!8 K.` `$!82* !8 K  2* !8 K  * 2 /> >;> >9> >,-@`a0a` a@a* $@" 2aa0@`!4a a`a * $`" 2a!4@`"a a`a$ * $`" 2a,,3 Ka0 K3%,!4'a03 K'!4㿘Ho`%> >(@a%> >,`)> >N+> >! !!],* `'> @` > >08(`(`@@,, &"!A!!0*  & "!!7!$a4* & "> 0a49 > >$0 `` `Hp@D! !ϑ* !> >!8 K  1* !8$,` K(`1ޔ !8%!0` K(`1ה %a4㿐!> >!4`1  !4* @ 2!0# !!@2 !@2  $`2 @!$@| 2 d`#\   " 㿐!> >!0`1  !0* @ 2!0# !!@2 !@2  $`2 @!@D 2 hd#\Ԙ " x> #> >a4c<' 8   ~a4* @ 2!2  / !@2 `"! @2 !@2  $`2 ! `" !@ 2 !$@ 2  ?> '/'''''' 9a4* @ 2!0倦 !@2 `"! @2 !@2  $`2 ! `2!%`2 0Ɛ!@᳒ 2 !%q#8㿘!> >!,`% !,* @ 2 0  @2!@2!@2!@ᄒ 2㿘`lh\   \`(!le?@` c$&`C@̞?`(Ho (@aHp@ 2ޢ$]]$$,`,$$> =t` ($$$t$ഃ8`$nt\  =  \ ;c` c@88@@㿘Ho 4 (@a  $@     $(> " $48" " Hp@㿘Ho 4 (@a  $     $@> " $48" " Hp@BPBPBPB$@`BP㿘 0 .`}.`a.@.`0.`.`1HC 6`6`2 ,> 9&` 0|#  4|# 8#  # # $?#  ( #$ >3* <3, @` ++(#8#<#@#D#H#L#P#T+X+4+|3Z3\+` ,#h 0#l 4#p 8#t # # $# (# 6`6`2 8?&` ( &`  >6` <6` @` ?6`B.`.`@+4.`|+&`8&`<6`D.`` 8&`d (&`> >`2"@2㿘 @  @ 2 㿐> >H`)!>      `$ ,   2, , `<> >$ $  $ $ Ђ $ Ԑ>#\ > HcH  ؔ  ^ ϐ  ! p ` `,  %> >L`j7>Ȓ i [  >ΐck ` 0 , , P, !  , Q [W  ` `4`|``````4 R, $, T''''''' 4 " 2 ``8$ ($ X`|``````''''''' "`  ?$ ,$ \ ` `@, 0v, ```B``D4 24 b4 4m4 d#\ > LcXȒ   ј  ` `4`|``````4 R, $, T''''''' 4 " 2[ `` ```8`<`@`D$ ($ ,$ 0$ 4$ X$ \$ `$ d`|``````''''''' "N`    $> 9c|c|` ``$ 8$ <$ @$ D$ h$ l$ p$ t `X `(, x , H`*`Z`,`\4 J4 z4 L4 |> =al> >$ $  `$ $ $  $`@ǯ    > 9c|c|` ``$ ($ ,$ 0$ 4$ X$ \$ `$ d?$ (E$ X`` `$`H`L`P`T$ 8$ <$ @$ D$ h$ l$ p$ t`<$ ,H$ \㾨> \c<' ```   ˰ "6`Ă? & ```(R ``Ȁ```@ހ``Ȑ̖ `a a$a$@n | ݂?   0#\  ς?ꀧ 2 `  (  `'`, ;>`$ $` !Z!)0``8` ```8``Ȁ > > `7`"0`> 4! 8`! `Ȗ i;```````|#d`0#\#`#h 1 "a"]`Ā U @> ``J`?`Ȁ  ˔ $`Ȁ  | ` 6&?3&> mΐ#h`Ȑ ``a "8a$> > ``X> 4$ 8`$ :``Ț````|#``0#\#d ?`Ȑ | `Ŗ? &  $`Ȃ 7 &  &a$@݅ | > >   0#\  ؀`Ȕ Ò:i`H#d#\#`#h 2   \` @>  7&㿘jY  "   ? @ &  &    ? @& & 1>#> > ` !  P  `&  `"G "  ȀR  ̄? @& &   Ѐ"=   Ԅ? @ & Ѐ &  "  "  "  `> >x x>   D@  0''  8>1 > > `  ȝ>  (c<' 9\> >`x"?&@ 3 '  0'''''''''''''''''''''''''''//`#` / &@ e2'2'& '  H   &     7 /    ߖ''܂ ///؀X/"V 77C' "!#\ 0" 8`T 8`" 8 A &7  /  塚   // //@M@M ``" 77      ~t  o`" 8  A `8h (`>˄L`2#\|` |x  ` #\#`&0+ }``'| a``"y h'x  $`  Ȁ  @$ ?$ $ Ȁ ` @| |a$@ۃa$ ` a"d `> > a| ȀK  @$ ?$ $ $ $ > > `#`<|> a4 |8$ $    0#\#`#d  $ $ "  $ " @ `"n *#\`" `Ƃ ? &`2'x l`2'x p`2'x t`?|'x> k#x&#`a: A:7  `  ` > 9 `    `U'| > 9 @c|`?L'|   D'| d`?F'x`2a   " 2  |``ؐ@Ւ | "[& > > `q`  0 Ȁ"   @$ ?$ $ $ $ |`> a4 |8$ $ ` "  #h#\#`#d 3 W$ $ "  $ "    b #\#`&ژ 0ِ " !!` | a$@ua$ "6  Ȁ`=?|` |x  `& * 0 0` @(   ` ` 0` @| `_|*l#\``| |x`  `X ?  &$b  ` @8 |  Ȁ "  a`` "  "  a`"  "  " $  ȀM  @?$ $ $ $ b  $ b  'b #\#`.&<  |x`  ` #\#`&E  | | @¢ 0 2 Ȁ`   0 #\N " #\     "   `     @   *  >!P>)c 0> >>*b(!P㿘> ݐ# 㿐  a 0`/퉰 />&P(` (a%`"ea(>P,` u ,&a`"aa%`"a,>P,` 7b ,&`2a%a`2a%a`>a%`"a0"  ("  2i >P` & 7`a4`ꀠa8`怠>`H`" `:`ې```Ւ (((`>a `P   > @<(@@(@$@ > =4`a4` ,`a($` a $`4`  0d``(( ``2( (  `. .. .  a$؃(`0`0`. . > = .  @J3  a @J. `L`6 ( ! )0`/. / @.   ) (`(@(@ 00. .0. . >P `! &a `"%`` `@",   ؆@C 9  ```2S( O(  ) ז. @ `솃@C >`  솃@C 9 a `؆@C >`  뺖 )0`/,` 4`/ @.,`  륖,`   럖``?@4`㿐'>P` $P 됖0```"  P(` ( ( (0``" `"& >  #   ɐ 20``` `/ `P` `@((0/ `쀦)P ( ( @ ဦ)   `"> >`\`2DP> >aP"?P4 (> :a`7 ``"2Pa<@2`` ` 񀤠 `2   "  `2  @i  2 P$` $P  8 @ <)k> >4 `  D  `m Hof4 @(@g @ D6 H <& (`@"$ (`@ ` @> p$ @H` (@@ > @T`lHp@ S    ((`@0`/@-2 O   ((`(@ )- 0`0`-0`- `- ) (`(@(@ 00- -0- &-   /  @,B?    `(`@$4    P` P ` @Ry 4 > Ŧ `I `$ H `$ d <㿘> >aP l>@ n!P !` 㿐> >aP'H'L'P'T'X l > LH' L P `w `     @   *  >!>)c 0> >>*b(!T㿐a% " a > `E a ``2>2>> (a"`*` 4  >`  7  `N >!  (`!   8 @ 9 (a `#`a  `, ,, , ,  a؃(`0`0`, , > = , Q2  a,Q. a- &  <(@@(@$ > =4 a, , , 4 4 4 a($ a $ H4>   "@& Qm  >4// U &#X > ''''''''''''''Ԩ<' @0R 闐> ` @ V>   ܐ  ////  >,a\ &>؀  >" """ "" \`A"" @: 2" @3 "䀦 2">` J 0 //// 襔   蠖>,e 㿘>```$`  d @ "``k T`  8 @ <`  |4  D  ! $ !<$ (Hof4>(@g>` @ D66 H <$ (`@" p! @H`` > @R``lHp@ဂ` Á`$``! H``$`Hp@ <㿈>```$` ဂ` ခ ` ``$``2` G "V`ɐ dH`[`x ` 8`@ @ <`   Ζ ?`6 耈`:> :D  ]  Y& < & (@ ` !> >aT l >O@!@°! ` 0?@0㿐 L'L'P'T'X'H' `a `> ` > >aT l>㿐 'H'D<> C>0` #> DHD(( @@(`@` !(`Ĕ`@ >0DH 6 >0c`@8` ` b|@ 0@9 0D}  ciD@8ip @@p> c<' !'  [  ''''؂  ''''////ԃHo  (@a ܘ 2 .-> 5+> =&`22$@@2 @@ 2 $@ 2@?$&4a >ᘃHp@0> bא 㿀> c<' `  W > =a<@0a'` '' ''//  * NpHo+(@ 丒  $#> ` 1> =Hp@0`@?&@'!a4! ?! 2 $0偈a> bo 0 ` `  `>فa̘ 2 ` `  `>فa̘ 3㿘Ho&4> ł(@g> ň` @ D> H`! H Hp@O 7 <" (`@"$! (`@ ` @> p! @H`` > @O`lHp@  <㿘Ho&4> ł(@g> ň` @ D> H`! H Hp@ 7 <" (`@"$! (`@ ` @> p! @H`` > @Oi`lHp@  <㿘Ho&4> ł(@g> ň` @ D> H`! H Hp@孰 7 <" (`@"$! (`@ ` @> p! @H`` > @O`lHp@  <㿐 ``"  *#\ > >O! 9> " Nԛ H㿐 ``"  *#\ > >OĐ!x 9> " N X㿐 ``"  *#\ > >O!d 9> ! N `H> c<' > a4 8&`&`aa ```c`z`"y`$a`l  (  &a L a ( `$ a $ 2 3 l" a?`$@"a @6 aDPa `  @:   D@8`C : `''  ' D ~ʘ `` 3䫐 . R `'{   @(`0`0`(( ˀ`" ``)" `$@@2aˀ``2a  k7ȨȐ   `2pa "@? 7Ȓ  aa @:   ς    4  `4 *`@L 4 `4/ˀ`)2`$  @`'0 (㞖aA`" aH`"`$/ `2(>L `} L ( 2  `28> `o @56   @`~  `2> `[ `2>  `Q 3 l 2GҐ0Fy lo 2>~0<``"` d6 ``"a h6   @6 ϐ `2> ` @` $aA``0+ @`' (aA`z`aH`aL` aHaP`aT`"`$ԒaH@q  e `$ aA`L`YE`)`2> 7` 00͐00  ]7ȨȐ  `j` " @>7> _. H`3D>  ` `3K> ` aD `)aD``aL` aHaP`aT`"`$ԒaH@  `$`35> `d >  `] `3,>< `T <> `N  " @I7Ȁ`3> 7`> 耠`3> `6 > `0 >L `) L> 7`# > ` `> 'Ģc<'H@' 2t 3>` Ā [ 2n 3 l> >H  @ `M 2 3 l"`'''''''/ـ؀Z   /@@H Ho`4Ă(@a+P`(Д즖 $`"w2sHp@`>\ ` \W 2> ` @ >,` ,> >aXH86 2> .` >(`u (> >a\耦yHH͐ a`݀ kH>< ` <  /ؔ i0}@YH ` _[Ā` l" Apᤀ  `̀2> 4&̃8`&'̂@'$ [Ԃ@'$" MȠpZƐ`HHp@0mHp@Ā 2Z>4 `] 4 'Ѐ 3,> `N > ]v `Hp@Ā 2Q> `:  3'> .`1 Ƞ@Zu> `# Hp@iĀ 29> ` > .`  3">$ ` $Hp@HĀ 2(>L ` L 3> ` >0 ` 0 3> ` > `  3>< ` <> ` >L ` L㿐@`'"`()  (``(``(@@ ` R 3`(`" >` &!   !> ΐ x㿐@`'"`()  (``(``(@@ `  3`(`" >` &!   Ӱ!>  㿐@`'"`()  (``(``(@@ ` ږ 3`(`" >` e&!   !> V 㿐L'L'P'T'X'H'   l 㿐L'L'P'T'X'H'   2q 㿐L'L'P'T'X'H'   3`  !`2"`3` ? `?`  $(`8`` @ $D ! % (  ? $!`2 `" `   $D2 ! 0`㿘Ho(@a 堔 ")> '> =&@ $a!4ἄ  >``2`$ߑ A> >aX2`߇ A> >a\2`} A " a u a`ސ`````̀> `a4'&`'8 &```̀$@'耦2A`a Wǀ"`   ` 3a `'`$`@@&`$"a `.`"t`a`l2 `` ``  >`` @2a @a "` ` `ҥ(` ( (  ` @ 㭒 V 7a `   `$`@ ``̀``a`2 a`2  a`2 a`" ` a@ʑ  m` (`  +<<<`?`+"  ``(` `ߠf`ꀠ+ _` `A   7`` 4  `4 *`@F)+4 `pWd`@W\`$` }D`@5 D`' (  7`?؂c̐`(00(`(`  "`$` `  " 7``0`C`㿐> a4`$8&`&`"(a > >a;> >  a`  t  Fa 22 a22  >2 2 X` Xa `` `'؄?cӃ( 0`0`((`$  ( `$  0`$  ( `$    ( ` aݹ  (ٔ ` EU a`( `'`ao $``?aDa   #\    @za 0    - a   㿘@@N!``?&`@  # =`[&Yc$! y@78\`)v  (@@=@ ݀$&c<\`9 ` "P`` (@=@  <  ! @6` \ .86(@@`\`造  (@@=@ c `  =@ (@ $\`΀ ` "`` (@` =@@1 (8)0@@ / 87@(@@ (@ =@@1 (8)0@@㿘 4 8S L@PS>P ` PHo(@ 0 澔  "F ,``#+``􀐀 <`Hp@@R1a 0 L@P`$`@2+aFHp@0  L>`  ,Hp@K@O L> ` "@۝axҐ㿀aa``; #  @:   D@8`C : a `''耤'$'쀥`h' D v" `$+a`  @ `8@`@$`  ` ->0`$0a `` @ .`$ظ`?@@@@$`АH (`$H@?@@@@$ `ۿH (`$H  8@C>`@   8@ <@`$27` `` l@ے `$~&`$   `" `( \@% `  25 v 7`%`ʀ  @ d  沖 ˔ `V%x 7`"$@Nϐ``ݒ `B `$"ah ݪ  2`$3U 7`` @'>ah  BȒ`1P  2 ?` (@*n  2/ ޚ @ @ ` @PR  P 7`$P ?ݒ֖" < < $@$` a`4%$``$`@2oa$`a``$``(`d$`  @ @$` 4 LΔ 2 `ڽ@NoP 7`$Pa$a , a BT$ 0  % % 8% 4% 0>c % @`,= %  @%@%a\%`(`%a`$@@ ah' B+  ` % " `"a  @ @%`$ @P+0'%0$`ax aB` a  @ 8( a @` `z$` P>  8 4c<' `(`$`, L@M>P ` P ܰHo`=(@`0@ ` R` " ,`7    L !` $@M $D!`UĠ >>` Hp@ 0a`0`#  􀐀 = Hp@@O L>`  ,Hp@@Ms0`Ā`j@ @ *u 8$Đװ"@  ` @"@$$  @t>` A L> `   $ !@  !h#\!p 1>K  ( ` ( В @ ʖ @ġ`4 "J   L>$ ` $> U- R `"@$ `z " @@  @"@$ $7"@  @ @ {$ a /W 0 $ Ȁ > `" ?"@ʐ ܥ Hp@0˝㿀`$``a`    @  >`  a`"a 2>a`"$` 2!` /`$a#\ah@ apd  ضՐ  `   8@C>>`a 8    8@ =8`$2(``` @̒ `$~&`$@ @  /` @M  vP 7`%P`ـ$ @ d  `4 4 Lf  T@LP 7`n%P LV ``ْ v' ,`<% 4 @%%a\%`(`%a `$@@} " `"sa  @ @% "@| 4  '` '`4'`0>`'`@`'`8?`' (' $` 'aa/ a ?' 0`%a$%`$`@2.a%a``%`(`#%  @%@M0>( ` (ِ> ` ``IA`<%* a`' @` @8(` a`' `% $% ?P  ` % 㿘!\ " !`@ !\M L&!\!` @ !`C L&!`@Kj & & (>  <' ?@   *` (` @ >> ?`  ?``&   $`@6!(0`6! `*` א (`>> >݆c> >چc> >׆c> ?Ԇ`> >цcd> >Άc> >ˆc@> >Ȇc> ?a  &    & &!p&!t a>!h L(`6  #2  &!`> ''''''''' q''(`'') L (`6  2  &!\> '''''''''! ' $@@8  (`''Ԁ ; @Hɔ 0T<$$2 . 6 e& > ?a> ?a> ?`> ?ap> ?aH> ?a > ?}`> ?z` .  ''''''''''ǒ'> Rl! .  㿘 8 4` ( L3@J3>P ` PHo (@ 0   "M ,`"$`#+􀐀 `  ,Hp@*@Iܐ  4ٻ ؐϒ L> ` 8> c<'  8 4`(`$`, L@I>P ` P > Ho`"(@`0@ ` ` " ,``#S􀐀 ` Hp@ Ց0@ L>`  ,Hp@Հ @I/0~"q   @@ *} 8$k"@  `2 $  @$$@Hp@0R  ԰$ @  h#\p C>e  7  7`  ߒ L> ` Q! `4@_ " ʒ L> `  , أ [   `2  @ @$ 7` n "<   $  @ @$ @   @@ @ l$ 2 7+ .X> c<' ``   >   (`y>` (ԫ 0l& > 7`  *`*``82` 2``Р```> b 0  (F>A $8>뀠"" l`( ('> < ߀`@2`*ն̀ "  ?; >` ; 0y'Ă`/Â``/Ԁ``Ր  (׼ (_  @  آ`(> bȀڀ+8<*`@ (`@6 @` @(`@& @ `` *> ;O! >`  0 J@`2G   "p  `` ``20 *'`'';Q'  ( Ԑ&@ؒ &`ܔ (&`&` '''') .`(`vՂ``^[7ł``QN7ƴؒ L  2 7>`l 0``怠`"?7>``倠`"170Ԃ```20  Lp>`I `  L0 (ҡ $€`"v  ( ʐ Lް 0j㿀aa'D2` '>  @: D D`@9 C: a `'' D' D m  '>`,`$`,ahal`$a` +D ``$`  a ` ` D .``$`D  ?c$ `Ұ (`H`$`H  8@C>``@   8@ <`@`$``" ` @RDҩ `  `` "l`@ג `$D~&`$    `" `" \@2`    2! Dp 7`$ 沖 Ԕ  D` 7^$ "'D&VDD ѵ 4 @0`, `$ D > ٖ`$"Bah@G  D3 7`P`$`P` `<$ $D`$ $ a\$ `(`$ a" `$`$@@"iah`$  44 L  D 7@E`P`$`P@>ah$ (% 0 L  `$ N 3D4 Ha `L`c 3,@D/ m a D  JD `%`0%` D>%`4c%`@`%`8=`$($$`$aa, a 9Y$0`$ @Gg' 9K  ` $ / 0 D696  D@@7    31 L@E189  D@@7    3㿀`$!@` 'D` –a`` `$@D (@3>$D`F $  Х`$a#\ah@ apژ쀢 >= ,D 7 D`%  7D` ؐ 7D` >## @b>`8   @C <8`$``"` @=؟D  0` `` >@# `$~&`$@F:  2 <DP 7`$P@$D`$ $ $ a\$ `(`$ a"  `$@@"7  L 4   2 ЮD@D`P 7`d$P``0D   4 D >/a D˜ ' L ;@D;B 8)  ` $ D `$0$ D>$4aX$@`$8<$ ($ $`a$a$ ,, a  8 $ 0@F0㿘!\ @ !\  L&!\@D0 & & H>  c<' c> ?I`> ?Lap @24  & &  &!p>!h&!t  L(`6   52  &!\7 ''''''''' !(`''܀  ' $@@. @B  0  > ?` 0> ?a > ?b8> ?`aH> ?`> ?b ''''''''''> K!8㿘#k##h#i#j@(`#|````` 'ނa(.0  /`.. '+!!  ) @ !0` ! @0  @ (  1 @ !0`! @.  @6 㿘 @ #X`` #``# ``?# @Ò#,@@   !p` 0造` Tb& !p& 㿘#X`# ``?`# i@#,@@    !v` 0!v& 㿘 @ #X`(  c`@#`  @_# (@@`?  `  #` 0@`6@"1bc "-b쀢"# `"# ' `"# ``#" 2 @" 2 ـb쀢`΀@     `  " 4 㾀>  Tc<@' `(`0#?`8 ?  a2  5a@"    ? $$   # 2 @ > J<!@㿘# " &#   2&#&#㿘 #X`  @"`?㿘` 2 \ "  \`A`A2"#X"##`(""@  2"2"쀦""`2p@  2㿈 T6`ה J"   $@Ŕ  2  @  2 #`2` ``@2@ 4 ᐐ @a2 @"`` `? $@$` e U㿈 TT J 4N!   C`p⸀ $`` $`@`  2  @Y  2 `4`㔀$@ `$㔂$` a1 @"`` `? $@$`  㿘> ` @m   a@  20  @X 2 `<&`&`  2 㿘#X`0#&# &# `2 8# (@&# &#> >a > >  `vN 0#> v|"1> vy Ё vBb#㿘 @P `-`#`/ > >a4&  K 0> v)` .`(>  a@@> vP"(> vM &  `)`)`+ , kx#Ր #`> >> >a4&  # 0> u` .`(> a@@> v$"P> v! &  , kw , kw> ub > uےb 㿘#  㿘c`T2cXk  3`2`ᄟ@c㿘#  E4 E2 4E0 L  ! T`"2!t `2X*!p ^ *!r*!t  *!u*!q*!s!~*!w*!| >(`D!p`2*!p *!p2!t"!pX``   `!p>(`D >(`D p X'7> c<' '؂ '/ل  ''''/ئ?/7Ԑ@9 3?'' X''7 7''/@' "&"`$ "  &""$ "耠`" "  &""   > @ G!X㿐#<8@ 'Z 7   " @4"ւ?,"$","԰ 㿘"?c(0`@(`"@Z"܄$(0`@(`"6"ր&"?  @ @ "耠2&"Ё㿈 `T 33 7 " & D  ea @> c,(!\#\`" " ͗ "&D  e5 @>e쀦2\ 㿘Ho`4 (@a  > >aĀ `2  T 0 @| 5#  2Hp@㿐Ho`4 (@a  " `2  < T'P4ِ#  2Hp@㿘!   $" " "  >AՒa``4!>AВ!!`LA̔2 `2$@$`  `$$` `$@ `$$`$ 㿘#  }  "#"#  ?  ," 5 $#d$"$#`$#\b < $"4"$#$`  0> rP?>`@4 \$!>>b$!$!? !, h, i %, j$ l> :a`$!$!xwǐ D  a$" $ >(M $"Ȱ 㿘> sG!0 1> > `" m!`       ?` ** > >!@ >*b(  >"h>)c > c<' Ho4 (@a  >J@a|"#X  w```  D@!<' '   !<  "!<``@    <@" 4@@ 1@  !<`@'  x`<@ `?@s "`t`G`2  m2L`4  a D$ $ @_'!<'  ''   `$ !< !  2Hp@ a> `8y `U@r  "//d`t  @`a2   D@!<' '  [ !< !    "@   ~ D$ $ @!<' '  '8 !< !]2`4`2% w @ DŐ!p㿐  T`; \`. `+#\`"##`"`#@4 \ `8 +`|#d'#dW  U) /B'A `2"4 \   4 \  `R Au #d(`'#d`/ D( a' ``?$#`-` #\`<#``(أAj L) )  @(` (80`@8`'(( @(` (80`@8`'؂AI 4` ( @@(`@(`@(` mA4 4#`㿘#  `I 㿘#` "ڐ@`"#aq@  ap"` "#@  2""?2#ap" /#@Ӕ  "  ``/@ / @"2 _ 㾐> `c<'  #  v> `@ "  @!``Z~   ``~  T   ( T 2̰  4`2 ư `$ .`t`t`#X` .`t4.  @r  @ ` @ @ `"@  4 @ ( 4(8`.`t= ڰ 0 C7!0#> c<@'  `.." . @' @':@ p@' @@& @'-@ > C!㿘`h`l`h  .Ò  P > c<'  T`") Ho`N(@"`S?#d  '`  @ @ /B'  a"`"#d??       8$$!<$ $($ ,<@@@@@  4`l,`4`4`4` ? p,`,` '''' / TmG䀢 "$`  <$` #<$`8@@"4`. $@ 2$# $`@.$* 2 2 ,`,` ܂$  @>`8< C bh< X@ >a$ /> >  `o 0> o"p> o  #@c<  $##(@> $# `"?#`#`$#`27#`(?1$#` @ @ ) )  @(` (80`@8`' >@bh< `h@8`h@ < ?   b4 L$ $ t (,<$$@ t?``,t,` p,`'''' / Tl䀢  0|-[ ? ,`,` T`(X,`Y ,`,`'-K $x 2$# $`(@-P$* 2 2 ,, ܂$  @>`L< C bh< `#\@<`   "@bK "R#`7h> >a$ k> >  `n 0> n"> n  #@c<  $##(@ > |$#@ʒ 2$#@Ē p$#b4#(`&#$##`@$#?> @$#| @ s?#(`&O$##`@J$#?> @C$#@!h@ `0m."`! ڐcX`  `  &c  ` >bh`x@8`x >㿘# 2 0   `2 2 ` \`A`Aߞ@㿘> :a`"`T "` `h`"` 2 \` "` \`A`A2""쀤 2 \``2`T㿘 h`"A `7> > >` > b> >  0`Ѐ`)@@ "` @,$ $ `$  ` `$` m@ mːmɐ``2@ @,  㿘 h`0 T@ +> c0)"쀦 # Tk`"\`  \6 \  &"ْ 2" "쀦 2 Ty &"ƒ ?y"㿘"`T &"&#c  \ 6 \HHof4"Ȃ(@g"Ȁ`" T! $ T "& T"̀`""! ( T"쀠. T" "? @&"&" ` $ & THp@ Tg  T `TV & THp@> 8"$ "㿘 T@ `V`\` 1`h`" `T`s M `T`"c\c\`vc``~ 2&`T$`T`T c`  `&쀠 2쀠 .`c\`"%c``\`4`\Ho&(@`( >!d$bHp@  g`(``\"@$bb쀠C$bb b#b$b `# c\`2`\c`    7  g $ $$ D "c`     J$b b$b  # b# `\4`\ 㿘`` T` `"O`>4`h4    ` 0@@2  `   " h`"P\` 2`"  @  12"   T`" 1#``! \`6 \ `>4``>4 \`#`` \`6 \ / 0W 2Ȳ T`2 \ܐВ #`㿘`  T \`@#\`2/ \  > ``9  0!` "0h`"0P\`60<!<20,( @20`"0`6 \`"` ` @   1 #\`Ð \s  T`" 1#\`  \`6 \ k9 2 T`2 \㿘 T@ "쐔 㿘ߐvun by 5v 㿀>  c<' ^@  "   2  > =|!㿘 h`"\TT< 8"E`"``@2@\@"\@`2`쀤ꀦ>bh`H@8`Hp`A`A>Ր@< @8`C<@`` 0>bh`0@8`0> >`C <a0K@@`?"쀤>`T > j`@ 2`> j#@> j -`h` >bh`@@8`@> >`C <a̔0 > je`> j#`> j  `h@  2"`T`\>bh`@@8`@> >`C <a0 > j>`> jm#p> jj `((` @) (` ) ( 80`@ (8` `d(80`@$8` z"V``k9`Œ ɒ ` `_ > >a ".  `2``d  * @"   `  ϐ&`{sׂ Ղ `0㿘>bh > >a` @ <  `h"  ` @`< M!`"%@ ` @`<  > ib  0 > i#> i 0 > ib > `0i#> i 0א`$  $@@'$*  "@ (` @`!< ( 0 8` @`< 8 > iRb> i#> i} 0 @$ T 0 > i=b> `0ij > ig 0՝㿐!>"h> >a`'X@L  'H'L'P'T' <"h` `h<8@@`?  ".`T"h`` @ J8`"h``"$@"h`` @ 8` > hb`  0> i #> i `Ԃ"h``"h@ `(`$@$"h`8` @ 8`8 > h͒b  0> h > h 0 > hb > `0h#> h 0& '@@'&*  "h`(` @ 8`(M"h` @8`  @&  > hb> `0h 8> h 0ߝ  /]> c<'   /^ p  @/_@#h&  p`6(p@`.`.` @@Ŕ @_@ ^@  ``]@ 'X?X'X &X  `2<@:X:'X   @ X?'X  ''''Ī''''?''''  N   / `2  0' 4' 8 ' <&'Ѐ -Ő@X  @R  6 ''''  ְ  @9 ł``ݐ`" 7Ƃ```Ґ` `p`j,`p@` $> % `@BDDH@%#|LP%# `L!p" @ D@ ?: !㿘#       > c<' >`0` a@:@" a@ܔ.a0@t@A  bc@Д  ː > @"c 1@P2@2 ֐߰@ܰ b`Ӕְ @Ӱ ``߀`̰ /`\`6`\İ` @`T``0d@ c t)) ) @ cd'cX L/Ԁ chc'$ c8 b` # bOd` dd,  `2&c8`&cڐ w`` `@"cx e؀` `4V &cd?c8@  c $ܔ cX@:43 u 0b``2( Ɛ`\ `&bN6`\`\ 6`\&b ذ b` `\` 6`\bאּ b.cXѐܒch$ 4  b`\`6`\>Ja&&$ @8!zՐ0r5`@  ֒ f㿘    #\"%0" #\```#\@'<#&#`8 @+&#\#``" \f\ `"1ښ```2֚` 6 \ I#`@ 8#&#`< @&#\> ``2 "؀"" @20h2 "؀""2#\"&" T&"6"&"Ѐ&"#\#\ 㿈a`  %>  @:   D@8`C : a `''' D V: %>` `$` a ` `" ` .`$` ?c$``8 (`$`8?c`8 (`$`8 8@C>``0   8@ <`0`$``" ` @yѐ `  `` V@ `$~&`$  0 `" ` \@ `@1  2 <`@ 7`$`@ 沖  `$} 7"$0    @   4  L 2`s@/%`@ 7`]$`@`` a$a$(, a$0#   $ $ 4$ 8$ 0>b$ @`@1 < 0=㿘 @0`   4D>@` @ 7 LF 2  <5@.>@` @ 7    @ #`,@a    $ 0$ 4$ >bt$ @`$ 8< #`(#`$` l#@+` a` #`0"@0ā㿘@. & & p> c<' ` `   > ?b& ''& &!p&!t'''''''@ 'В@,Ԕ 0> ?b> 6 h㿐 8 4 ( $ Lv@.v>@` @ Ho^(@ 0   ;>` 8@C<`b`(  8@ =`(`$``" `> L @ː, 0`" ,``8  ,@ `$~$`$ ,``#f``􀐀 <`Hp@@0a 0 L $ ` $  C 7 R@\/ @ *a 8k$-"@  `2 $  @$$@-А   Hp@ L``%` ,Hp@@-``8 ,wb `'b L> ` ޒ  `$" !t  $ $Ȓ"@  ` @ $㿘 8 4 (` d L@-d>@ ` @Ho`(@ 0 ϔ  "c ,``#H􀐀  2 22  ` `= .` ` l` *(` @-:Hp@0 L>`  ,Hp@?@, L> `  7` ` l`*(`㿘`@``(`() &````(((`@@@& ` `` ` (`((& ` ` ``(`((@@@& 5>  > `x x? c??7`c7`(`(`7`c    #@#@#  (#  ````(((`@@@& ````((`(:& >  > `x x? c? ?@##7`c`(`7`(7`c     #@#@#  #  ````(((`@@@& ````(`((@@@&  >  > `x x? c??@ @ @@@@#@###6c6((`6c @   `##@#1 1 # c( 1 `(`` 㿀'* * @ @#@ #`#` # `#` # ` #` # ` ?`> x '  0c 3`c 1 '0(` ((`1  `((`3`3 (c 3 3  #1  #>  x((`03` c * >  x  > -`x> x+>  x `**`@ > * `x> @x , !>  x '` /`,@+ > `x `,`@'> '`x>  x!>  x , `@+`- >  x!>  x ` -`-!>  x@ @ @ ' ''   ' `@c'`'DD' D'   ē*`     (`/ @. @@+`D .-'*`>`+*@ > > ''''P+ *  `xx> >  `xxN' (5`'Ѕ5(`'Ȅ `(45c@''ԃ4 (`(55`c@5 (`(54c@5(` 5`c@ @@ @ Ј    Ը Ȇ@(6'܃(`5`5c'@5((`05`c@ 5`((`60c@ `0((`56c @܈     ؈?'@ @  @ i@ 4(`D9>  ` x(5c5 *`1?#@?? @  P(`P0(P050(`) ) 5 (`5`cP @  00* 5(`* * 0 5`(`* 4c5`(`@ 5c*  1 (4c1 1 * * *    `00* * 0* * 㿘 ?  $ $ 㿘  ? & & `'D`D'` @`DD``'` !!```` `` ` `` (` @Ă@/`@*. @> `x > / +`xD-*>`+ ' '> ''L+`* *` x >  x`N' (5`'ԃ(`45c@'̄ ('55(`5`c'@ 4((`5`5c@ `5((`54c@@  Ժ@   ̆@    @  (6'(`5`0c'@ `5((`06c@5`((` 56c @0(`(5`5c@@ @     ܈?'@  @ iD5(`9>  x(5`c) 5L1?#@?? @  0* *040(`* * 5 (`5`c @  00* 5(`* * 0 `4(`* 5c5`(`@  (4c1 1 * * * 51 c*    `00* * 0* *    > ` H;jc"" &. `v" " " " H 'D```(`((@@@'  @`D``'` 5ک'@x'@@(0:1V@ĉ( 0Ȉ ۄ @(0̂@0os@@@(0 Ђ@=_@(0Ԃ*@@( 0؂*  @(0܂@?Q@@@(0 @`&؂@(0"=@@( 0?ֈ @@(0@"W5@@@(0 @"@(0?f@@( 0)P@(0m! @@(0 @=@b@@@(00,@@@( 0 Q@@(0:m@@(0 @5ĺ@]@@@@(0S@@@( 06(y@@@(09Ȃ@@(0 @xs@@@@@(00ւ@@( 0=5C@@(0V@@(0 *x@@@(0?;@@( 0ق@@(0?B@@#J`@@(`0` (0!}b@@(` 0`@gX@a"@@(`0`@?yN` @@(`0` )/bD@@(`0`c@@(` 0`@=Һ@c`@@(`0`@/`p@@@(`0`  &߈bƄ@@@(`0`:Ic@@(` 0`@5;̺@`@@(`0`@"a@@(`0` 6u4`9@@@(`0`9a@@(` 0`@蟺@`@@@(`0`@1+be@@(`0` = HbD1@ʿc. 6 0@*c+ 30@?$`9*@2@ @7@@@@VւaÉ+`3`  1@#3`+ 3  0@?`}* @2 0@@@!aaѻ*`2`@ @7@@bO* 2 1@?9b, @4 0@@@(Pc,` 4`0@a,@4@@7@@@@=߂bD-`5` 7@,4#@/Nb51@- 5 #`  b0@-5@D#`:ᴂc0@@@.`6` @#`㿘 6 .@ + @ > 3`@  @ `? @@?`ƒ&?   @?`@㿈`> `1 c<' ) /1 1 /2@) ) ///22 @/) /2@ @? @`/`@> >aؐ   ) ) 0`) ( @ X > ,{ Hc;j"&.`" "  0va" " " "  'D```(`((@@@'  @`D`''D''''DD'| D' '@D@|'x` '@ ( 0|( 0'@(  @) 1 0( '@0@@/`7`@@@( 0І) 1 @@@@ @ԉ(/` 07`@( 0.6 @ز@( 0.`6`@@@) . 1 6@@@/` 7`@@.` ) 6`@ 1 @@/ @ 7 @/` 7`.6  @/ .7 6@ @(. 06 @0@ (. ( 6@0) ( 1  0@@/`7`Ժ@غ@5@/) @1 (/` 0@ .@7`(( 0+0@@@( ) 1  .@0@@@/` 7`@@ @+@ Ї( ) 1 /` 0@/7`@( ( 00@@.@) ( 1  +@0@@) @@/`7`@@@.@1 @/` (0 +7`@( ( 00̈@+@) 1  *( @@0@/` @7`@@ @+@ @/ ) 7 1   .@(0 /` 7` @*@@. / 67 8 @( 0. 6 7z㡰 @  ( . 06 0@ ( . 06 @ @0@ ( (  0) 1 10@@) @@/`7`@@ 7@1 @ (00@؉( /` 07`@0@( 0@) 1 1@ ) @@/`7`@@7@1 ( 0Ը@(0 0@ /` 7`(00@л) ( 01 @ @ 1@@/`( 7`0@@@7@@ ) 1 ̸/ 7 7@/` 7`( 0 0@ / ( 7  .660@ @.@.`6`@@ @@5#܆ ( . 06@.@ @  @) 1 .` 6`( @ @@/`( 7`0@) @ @  @/ ) 7 1  /@@ ؅(/` 07`@/ @ @) / 1 7 ( @@@/` ( 7`0@@) @@@ @/ 7 ) 1 /@  @( /` 07`/ @ @) 1 ԗ/ ( 7 ( 0  @@ @/`) 7`@)1 @@@@/ 7 /@   @ ̅./` 7`@/6@@(0а/ 7 .   @.. ( 660(@@6. 6  ̟. !*T6!N@ 6( 0. 6 0(0@) ( ( 01 @00Ժ@@1/` 7`@@@) 1 @7@(0/` 7`0(0( 00) 1 @@/` ( @0@7`1 @@@/ ) 1 7 7@ ( 0 ( '/` 7`7 ؉( / @7 @ 00 @*`( 2`@'@00@@@@0@Ї,` ''2@4`@̢@@* 2 x7(|0 @(0@ ( 1 Ԃ( 0@0 ) ( 01 @00@1/` 7`@@ @) 1 ( 7@0(/` 07`@0( ( 0@) 0 1 0@) @@11 /`7`к@@@7@ (0  (/` ( 7`0@00؆) 01  @ @/` ( 07`@@1 @@/ ) 7 1 7@(0 /` 7`7  0. Е/ @( 7 60 @.`.6`@@ @@5t$ ( . 06@.@ @  @) 1 .` ( 6`( 0 Ԃ@@@/`7`@) @ @  @/ ) 7 1  /@@ ( /` 07`@/ @ @) 1 ̟/ 7 (@ @@/` ( ) 07`@@) 1 @@ @/ 7 /@  @(/` 07`/ @ @) 1 ؗ/ 7 (  @ @@/` ( 7`0@)@@@/ ) 7 1 @/@  @  @./` 67`@/@(/ 07 .  @ . . ( 660(@@. 7\6 @ 6@ ̇( . 06@0@( (000. 6 @@ ( ) 1 10@Ա) @@/` 7`@@ 7@1 @ (00@Љ(( 0@00/` @7`@( ) 1 10@ ) @@/`7`@@7@1 ؄@( /` 0 07`@ ( ( 000@) 1  @ 1@@/`( 07`@@@7@@ / ) 7 1 7@( /` @7` 0 0@ ./ @7 66@ @.`6`@( 0@ 5]@@ +@(0 . 6@+@@(0@.` ( 6`0*@) ( 1  @ /@0@/` 7`@@ @.@@ () 1 0@@.@@/` 7`(( 00@@+( @) 1  0̺+@@@@/`) 7`@@@/1 @/` (0 .7`@@( ( 0.@0@) 1  *@@( @0@/` 7`Ժ@@@@*@/ 7  ) 1 +@(/` 07`@ +@@ ./ ( 7 6 +0@ @. 6  @-. 56@@) . 6 1 @- 5̬- ) 5@1 @@Բ@@-` 5`@@@- 5, 4@@@) 1 @ص-` 5`@) 1 , @4@@) 1 @7`/` @@@@) 1 @6 . @6- . 5 @@0/`( 5  - 7`@@(0@@@ ,44, |* 2 @D 3`@+` @D4`@,`  /` 7`@@) 1 . 6 *` @2` @. 6#@D@ 4@@2 (0@@(0@#D) 1   @㿘 .( @> 0@ @? @@  @ @  @b @ &@ O`@ 㿈`> `1 c<' `) /1 1 /2`@) /) /2`2` @/*//2@  @ ? @`/`@> >b   ) ) 0`) ( @ʒ ` > #a Hc;j"&.`" "  0va" " " " @> c<@'  @ (0غ@@@ (`0`Ȭ(0@@@(`0`''@@((`00`@(0@'@@(`0`'h'H@@(`0`'Ԃ @ '(0@ @ (`0`''X@h(0'x'$ @ @(`0`'HX   (0$@'4@@(`0`'4  @@(`0`x'Xh(0'@ @ @((`00`@'$H@(0'h @@(`0`H'4'l  (0'L lx@ Ԃ@ (`0`'  (0L@X@@ (`0`'ؘ$x@(0'X'| 4@@(`0`$ '\|l (0'( @ @ (`0`'L\4  (0(@@@ (`0`'8@(0'8' |@@(`0`'  \l (0 ' (L@ @ (`0`'  (0@'l@@ (`0`8L@(0'p'P p@@(`0`|'  P\ (0 '(@ |@ (`0`'  (0ܚ@\'@@ (`0`'`8(@(0p', P`@@(`0`8' ,  (0 '<̂@ @ (`0`'  (0<@ '@̂@ (`0`''@@@(`0`'`p ',P@@(`0` ''@ p@(`0` ''<܂@ P@ (`0`'t'@ @ (`0`@'Tt'Ă@܂@ (`0`' 'Ȃ@@@(`0`'`'̆ T` ( 'd@ <@ (`0`','Є Є  ('0 @ @ (`0`@d0t@00'''d'؆ @ @ (`''0'܃0`    'Td'  0  Ђ@  @ '+`'<@'D(`) '@(('' 0@@ @ '3`  ! @@@@ @+(30 @ @,`+4`3 @@  , ,`4 4`@@ @@  ,, 44  @@  ,,44@@@@ @- ,5 4 @@ @-`- 5`5  @@  / -`7 5`@@ @@ 5 -/ 7 @  @@ .6-@5 @@* 2 @.6@ @@ +32 @*   @@ , 4 3+@@ @ @@ * 2 4 , @@@ @@ *22 *  @ @  +32* @@ @@ @-53+@@@7` /`@@.6-5@@ @@ @@h z#H@ /`7`@@ @.`6`.6  @*2@.`6`@  @ , 4 2*Ԓ@ @*`2`4 , @@@@ +32`*`x@ @* 2 X3+@  @*`2`2 * $@@ @ +32`*`@  @,`4`3+@4@@ @* 2 4`,`@ @, 4 2 * @@ @(0@4 , @  @+(30Ƞ@@ @, 4 3+@@ @ @* 2 4 ,   @+3l2 * @  @L*`2`3+@  @ , 4 @2`*`@ + @3 @4 *, 2 @ + @3 ,@#܂ @  @@, 4 2*|@@ @2*\4 , @ @  @@@+*32(@ @ @4 , 3+ @  @ @* 2 4 , @8@ @ @3+2 *  @ @ @*`2`3+@@ @ @ @2 @* @ 2`*` @ @ @+32 * ̒@ @ @2`*`3+@ @ @ @ @ @, 4 2`*`@ @ @2 * p4 , @  @@@P+32 @@*   @ @4 , 3+ @  @ @+`3`4 , @ܔ@@ @ @ @2*3`+` @ @ @4 @, @2* @ @@4`,`@`4 ,  @ @@ @@3+,`4`@  @ @, 4 @3+ 2@!ւ@ @ @<,`4`4 , @  @* 2 @4`,`@  @+32 * @  @*`2`3+@@ @@ * 2 Ѓ2`*`@ @, 4 2 * @  @*`2`@4 , @  @ +3t2`*`@  @, 4 T3+@@ @@* 2  4 , @ @+32 * @  @*`2`@3+@  @ * 2 2`*`@  @, 4 d2 * @@ @@*`2`4 , 0@ @ +32`*`@  @D, 4 3@@+0 @'@3` +`4 , 3  @ Ĉ ('+`03`@3 @ @ @@') 1 @& > @ @( 0#@ @ !'&@''#<@  >  㿘 .( @> 0@?`?    &Г@ @ @@ɐ`? @`@`? @ &@㿈`>  c<' *8`(` 2`80*@ )  8> ` `> `А `    ?@8(0)   ?@  >  㿘   > Pc   ``@`@(`()  ."@*6 @@.6@6..66 .@6. @`@``@    ` `(```(``` .(`.`(0@00@(@@7` /` 7`7`/`@ @ * @+  @ 3 + 3 @3 + +`3`3` +`@&3`+`  @      @  @ <$$$ $$$㾰'D ?  P? ? ( ? 0? 8'?''''x'|'p't'h'l'`'d'X'\'P'T'H'L'@'D'8'<'0'4'(',' '$''''' '????       ă0*>  a07`  +` /`     ((@6./   .@  *`5   @ ĉ-`5` :- 5 -`5`'- - ''5` 5 -`''x'|xD @@**@D  D-5-@55@@-5 'pD 't'h?--'lph55-'`'d` @   @ĸG@`?'?G`S????  ?????  `(` `) (`@@)> +!0@0 +@(0E@(0'X'\(X('P0'TP(/ 0C07`/`@7 7 'H'L/` H/ '@7`'D@/ @7`@C7 @C=@(`02(1 '8'<*) 2'0'480- 2 5 *'(',(@--@ز@ @F @F@ F @ F?Ѓ,4 ,  @44@@,4'$,,' '' 44,''@@G@G耢PȄ3D@GF @F(@C0B8@Bࢄ@DD@=@=`8=`=`=`=` =`(=`0㿘h @ D+`0`!   @@ > @2 H H@> H` @ * P@| @ , @C2> @@&ڐ̀j P @ .@B> @@ H@> H PU@ @ .@B> @@ H@> H@(в@ H@> H@㿘A @ D+`0`?!? @ @ + P# @,`@C > @&?@ @`@@> @?  P @.@C > @ P@ @.@C > @㿘  @> ` P @- & @& D& H& L㿘 @ D+`0`#?(P`p`( P8 @ ~ H @> > . P p@"@  H @> > " P @ p H @?> . P> Q "@ Բ P㿘  0@* 㿘  @@ 㿘  @> c P @ & @& D& H& L㿘 #`@`D+`0`??(P`8`?%Q P @ 8 @> N @ в`P @ 8?. P`P 8@"@  @ @@"@} ٲ P㿘 > `” & P& T P `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4& @& D㿘7@@7`c$7`7`(c(,@``( 1 c1 1 (c@ (@  @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`(  1 c1 1 (c@ (@ $@7`c7`7`(c@`( (1 c1 1 (c@ (@ ,@7`c7`7`(c@`( 01 c1 1 (c@ (@ 4@7`c7`7`(c@`( 81 c1 1 (c@ (@ <@7`c7`7`(c@`(D 1 c@1 1 (c@ (@ &@@&`㿘7@D$@@7`c7`7`(c(,@``( <1 c1 1 (c@ (@ 8@7`c7`7`(c@`( 41 c1 1 (c@ (@ 0@7`c7`7`(c@`( ,1 c1 1 (c@ (@ (@7`c7`7`(c@`( $1 c1 1 (c@ (@  @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`(  1 c1 1 (c@ (@ @7`c7`7`(c@`( 1 c1 1 (c@ (@ &@@&`㿘> a&H*`2`  (* 0`@   @  `2㿈 .&076@$( 07`H''C$`$@`@ ,`  4`&(&0``,` 㿈 / &077 @$( 0.7`H''0 ''$`$@`@ -  j'c'Ր`'(' 0   㿘@.6\㿘.6   `(0`@㿘.6   `(0`@㿐0 ````@```() +`+ (`(@ @  @ ''z00.`.`.@.`1 1 0.`.`.`1 .` ղ`㿐0 ````@```() +`+ (`(@ @  @ ''00.`.`.@.`1 1 0.`.`.`1 .` ղ`㿐;  @(2() +`+ (`(@ @  @ '' 00....1 1 01 ... .ʴ㿐9() +`+ (`(@ @  @ ''00..0..1 1 1 .... @(2˴() +`+  * (` @@ @''ڒ00.0...1 1 .1 ... @(2㿘` @```( (`/ $@0(> 0Xc> X> 00(`X D`@``/`> aX@. ++`  &$@ 0( 0c(0cH@0($@ !1)(`0@0(`L0 @$@@'@@@0((`0@0(`P0$@&0(0c(0cT@0(@$@ @!1)(`0@0(`X0$@'0((`0@0(`\0$@&0(0c(0c`@0( $@ !1)(`0@0(`d0$@$@@'@@@0((`0@0(`h0($@ &0( 0c(0cl@0,(@$@!@ 0((`0@0(`0` !^p0$@0((`0@0(`t04$@'0(0c(0cx@0(8$@ !1)(`0@0(`|0<$@@@'@@@0( (`1 @1 (`1  # 6 6 ++6 6`++6`6`++++㿘```@`````(/`/ (`.. @ @@`|`< '@0@(@> aX0c> aX0(`@> aX0> aX`x(`8'@' 0((`00(``t@0`4'@&0(0c(0c`p0`0(@'@!0(@`(`7`7`(`7`@c `l`, &@0((`00(``h`(@0@&@@'@@ @1)0c(0c`d`$0(@&@ 7/(`00(```` @0&@!&6.(`00(``\`@0&@'7@/@0c(0c`X`0(@&@ 6.(`00(``T`@0@&@'@@@&6.(`00(``P`@0&@'6.0c(0c`L` 0(@@&@ @@1)(`00(``H`@0&@!&6.(`00(``D`@0&@'6.0c(0c`@@0(@&@ 7@/@@`(`6`6`(`6`@c 0,01 , , , 01 , 1 , , , > aX> aX> aX> ԖaXh   &  Ȁ @ȃ(`  @ (`@  @ (`@ $ @ @ ֈ > > aXX> > aXX޶ Ђ `2`(`@2`2`(`@0ȃ(`   3  c(@3 3 (`@0c@ @ @@ @3` `(`(@@3`3`c0c@  ( 1  ((`@1 1 c@̆ '؆' '܆' '''' ꀦ3G1 (`(@ 2(`(@00(`@ 1 (`@3 3 (`0@2@ 1 (` #3 @ #2@  @@@@ @@&& & & Ѐ݀(`(() @@   @    && & &    ` && & & İ #Ԁ`| ؂ `2`(`@2`2`(`@0(`   3  c(@3 3 (`@0c@ @ @@ @3` `(`(@@3`3`c0c@  ( 1  ((`@1 1 c@ 'Ȇ' '̆' '''"'(`3`c2(`1 (3`(`3 3`c@ 3 ((`(@ 3 (c1  ` #+`@ @@@2 + @ @ @@@@ @@&& & *& . ?% ސ@| @| @| 㿘 Âc7`?c(0  ̂c3) 0@@?`@/`1 @ UUaU(7`((0(@0> ax` @1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  c1 7` ` @ $e  7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ % @2*UUaU2`*`7  ?`) 0@@ ̂c3@/`1 @?c/ 7`øc(7 $($@> ax x |@1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  pc1 7` ` @ $e t 7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ %?@l2㿐       () +`+ (`(@  @ @ ''0.`01 .@.`.`01 .`1 .`.`.`㿘 (`(0`0@o > ax` @1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  c1 7` ` @ $e  7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ % @*2@$*`2`@$@> ax x |@1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  pc1 7` ` @ $e t 7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ %?@*2@$*`2`@$@>  a (2㿘> >b`  @{9    㿘> >b\>        (`() +`@ @Âc@+ (  33 0  +`@ @@ 0`?@((0?UU0!U   (3` ) 0 @@ @(`@@ @ `(`< 0 c2  > > xa U'?36 +. @ `??((`@ @d33`<@(`@3a03 `(3833`6 (6 `<6 @(`@6 e06 `(     1  @((`0`&@@ ``@ &``@`36 +.   a  2' "= ??/@㿐       (`(+ ) +`(@  @@ +Ã0c@ )?@#@ (`3`@% ̉0`3(#? `!UU !U) 0(1 @@@(`@''`?ܔ1 (0`(0 ) 0@@@(`1 @0`.`0`(.@.`00.`0`0.`.`.`.`㿐#> >b`@ HofV(@> >bb "*  ? `"` `2``("``'?@ !?(`@`2 `  ?-!Hp@ 퀢`2@? , ,  @ `8` `  ހ? 0߁g> >, ',  @@       >b `! Hp@> >b쀠*> >b䀢&> >> >b  `" "  `"  ` (@@2   "  " >`d`  >;a 㿘 Z d`VHo&-(@> >b䀡 > >> >b ਀`"฀`" ฀`"   (`@`  & Hp@ g> >+ & + ! `@;`  & Hp@  㿘 0``& 0 @@> @` ՛ 㿘>`    >3 ǖ} 㿐  > `">#\ ` H   >> #0. b>#\#>  8bȔ  - 㿘Ho&4> >(@g> >b䀠 > >Hp@ "`. .  .`@`ꀦ`  `"" ` "Hp@ "  @xG `> >`(` 㿘 Hof(@ <` >c`4*& < <`2`4>*#0Hp@g <㿘%> >`1 > >b+ Hof((@+`+` `" `` @  `Hp@g+`+` `"ׂ@w 0㿐 y @`uHo$\(@ <`` > >[> > b䀤@:0`4,`,`  ं `W`" <@:  8`@C9 ` !?"& ,  < `4" `! 04 <`  #& ,Hp@ g <>  & ,Hp@  8  <Ȉ > >b䀠` > >"`Hof(@ * *   ) "@ @@   `@ `Hp@  g* 㿘Ho%> >(@g%> >䀠`P䀠h> >b   ఀ`2 ਀`2 `2   b+(`. B. .  l"  :!> >"** @  (`(`"@v̐.  .  @@(` `"( lDŽ$$"Hp@ #$ lϔ > >  b **@v @ $Hp@?" Hp@?㿘Ho4>(@g> *#0 E $@$`$`$` $`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`@$`D)> c$`<" 4"" " " " " " " " " $" (" , " 0)  2` >b䀠 > >b+`+` ` Hp@ >`     >4 D < 㿘> >b `;> >b`Ho$(@. .  ) b@@@   `"@ `" "@ `" Hp@ gۅ. T8xl`THdddddd<0ddd$ddddH     -> >b耠` ?    @ 20 @  2 ` @ 2@ @"@@`@  ` `? @"@"` " @"@ "`  "`` 㿘?  $ " < L < " L L㿘 (2 ! ?   $ ?  2ڒ L& ( 㿘`  L*   " $\: " <h" l7`" p4`" t" , /  @& @& (㿐0cd@2  L  "&`"  ș , o ,  0` 0 > >b  (& ,! , ` u L㿘  @`˰ @`((` >6X  `  h Lð @" `>8" `a2 ` " d2 "  @  (  ``@ @`'  (`0`@ `() `0` 0 Lx $`$U(`0`@  S >  ذ J`2E@@>,``@ `(`() 00` .`0`"`? # 4 `z h0/ - `s h0( k 0$ }  %`  $ " ` (`@s62` $ĩ L`` Ģ L㿘ɰ 㿘 8 ,x" ,#  & 0㿘`?c  ` " @\ ` 2 ! X l @ ` ` ` ` ` ` ` \ && p t& X &@s&` L `® $@  @  h&@ R `\  <` 4`X` ` < $`$$ $ <$ @(`$"``` & `&& & $& ((`&`>8$ 4$ $ @ $ 8< `   `    ,` " `X  L `  < `ђ  &`& `` D$ D > > $ 0"䀠> >) )  @@`2  ``"  @ $ , $ 0Ho4 0(@g 0` > bؐ %  0`Hp@`x` ,``` X`@ ``  D5` }`U&  ` "` `&  &  && > c<@' 0ce@< (@(cg@'0ch@ @ > ci@  cf@ ܐ ̐ ےذ԰`а (`>6l> ?`<`İ ''''''''''''''''''8'('8 : L  8`2`@@qe:`ؒ L܀ ԓ8`2`@@qY:`̒ L0 ":  8`'2z: > >b`? #\9 #`#h#l#p#d#tə8` "! V&> >c> ?`> ?``> >c> >c> >~cd> >{c@> >xcv " ` @  @ `@ @ *  `"??* `""㿘 `;<``"2>  @: &@`")>  @&@` `>    @8@ & > .b#P.`#0> .\"> .X#㿘 `;<``2>  @: &@`)>  @&@` `2 >    @8@˔& > .#.#> .#h> .#㿘J`E>   8> @6 &@ -,`@&@`    , >  ` @` 8@@  &> -ː > -ǐ @-Đ#> -#ttttPPPttPPPtttt((L(|8((\THL dTTTT d(((((T d((  D d(((TT  ?#> > ,$c  t@pJc '''''''''''''''''''''''''><><>C) > -6 p㿘> >c@q#> >c`m.`@ i@`'>;b  `(`   @oN`  l  "@oE`  l lc ބ    @o2`  l lc ˄0   @o `  l  "ڐ@o   l lc 0 ` @ w lc 0 㿘 5`3#> >c > >c `   ,$ @" (,#cc l*  > >c  '> >22*: l$ c`&,@>;> ?(b> ?> ?b`> ?> ?a > ?> ?`А  lv $ ]@( , > ?b8 l_ & ``D l`8` 2 R: $``"8 `80`@8` `` 8`2ؕ:`` `` 82* 2$`  `@&` ``  l $  հ 7> ?`" @&` ` > ?a` l & ` " `@``` 8`2* 2 `@> ?a> >c``` 8` 2: &h  `@> ?`<> >c> ?ap` l” &  ` l` & `" `80`@8`` ` `6)` 80`@8`@4` `@`` ` 8`2* 2```` 80`@8`> "`ؕ*2`80`@8`` ` `j)` 80`@8`@4` ````` ` 82* 2```` 80`@8`> "aX*2`80`@8``\ ` `\)` 80`@8`@4` N> ?oaHm#> ?Q`" @> ?b` l$ & ` "  `1> >7cLJ#> ?G`> >+c> >(cd> >%c@> >"c  U#c` 0`  7  7㿐  l`  bb@`` `2M  `@ lz L&`` ``2I@` )"M& "@   + @7+`  @* !& ? l: `@ l0 2&` @`ۖ` @ `   l f <> c<@'  4    #> >h c(`"  @2`@`2 > c<@  >  ``2 'L  ` `Ē` 4 2 ۀ "ڰ  0 ` `? @ 詔 `2 ``[``,2@h  ` FX-`0`'P 'T  &'H  ` %@  Ho%@@l ` Ph@T   @4` ҆2l z `L@O "`@` , h2`8@ @$7 "4@`@  `L` , h@2L@ր` @lH倦`@  @   耠`8`$ @l. -`(`'\('d` 2@h`$h@` D` а >  `Ȗ&` `   > W  簔`i ` `> c<' Px 璒 J@` ֘ ` ` 2D ` ".`D w X>  (a4` $@ \  @ $ 2D` = 0Ұ @` ` @ `ʄ 2 $ `"  @ $ @ O P`> c<@'   @T]     (`0` ' w'V< `2    ``@f?K $H к -` :) % ` `"  `@d@7?6*  > @0`,`$ #'`@ > <@ >  'u  '~, 4 ` &` ` `"  `@'< @@@0```@`   @(2 `@@` @   @(2`@_`   @(2 `@F` @   @(2,| "M  $I `  к  \@"N@`"9 `   J`$0   `$ `"i  `@ '` @ 1@$  ` `j @刔` @ $ޮ @(2Ӯ`2'@`2` '  }  `G `".  `@C  { "ư "ð ` `@' 7Y  # R `@  @(2 `@v`   @(2 `@3 Ȁ` @   @(2㿘  `< % `4` > >`c " $`,A `4= $`, $`$ 4 # 2 $`,(  )> >#( >;`0` `? @ @2  `@`  2܂ 8ڂ (`@$`,`4 $`,ɐ`4c $`, "  >Eb  >Eb 㿘.2ߪ 㿘.2 㿘.2 㿘.2Z 㿘.2q 㿘.2} 㿘@g#- l&㿘@g!# l&㿘@g! l&㿘@g  l&㿘@g`H l&㿘@g! l&㿘@g}  l&㿘 @? l <#$.ca6 @:`[@㿘 l '!&.N ?> `h 㿀>  c<@'  cЄ)  .ǣ Ђ@)  2   #Ѐ(@ @)#К` `#Ђ.#@g @  > Ո !>Da >Da > bܔ 㿐 X  () 0`1 @  ?#&#&#ܐ!M 㿘 = &  . 㿘 3 & 㿘? l !.$@W  $!@ ?  㿀> c<'  ``( !  @(2@f  > !㿘 l D &痰 >+` >)a 㿘 l / H&. 2>(bd >(a 㿘 l !$뵐 `믒`  `a먰 ?㿘 l  &듰 ? >1c   >1c >/c  >/c ''''''''''''''''H @` @2 @>>ɂbdP''''' l  W'@> ?b܂  @'H> c'Ȣ'D'#\#`?  @  .` l  :'@> ?b؂ 'Ȣ> ''D'H@o @ HP6 @q   `2̀`9 l  H` &@ l ` !@oԐ L$?  'Ȃ $?$?'̀ΰ @| ̀ `HА@yQ Ԓ l,  &1@oH`(D᳐&@@& l``` @ ថ@ l& `&@yH㿘 (`    ` @@ ` +`@N'( !..  ``* * (( @ ``+   2  ``* * ((@ ``+   2 ` ` `* `* ((`@P> c<@' ݝa''''''''''''''''` `\(@2ݽܶ @ ܲs@dw @@ > #@P> c<' @(<ݙܒ ВR &!!''''''''''''''''୒ `6(@2pi @@d1 @  >  &!#XP> c<@' Ӑ`''''''''''''''''``m `\(@2;| @ xة342c72ee73142f5dec67589a6d50e0b2108013e0ada475fab83578837c67c5d9  ... . .. binmdecPsbinPshareP . .. ftpgzip FgunzipgzcatF sedgrep FegrepFfgrepFless F`more F . ..binstallCbootBbootxxB installboot ... . .. bsd base52.tgz  comp52.tgz  etc52.tgz8  man52.tgz8  game52.tgz1380a1dd6f61aeb0bdc034d4aa516cba6621a589c8dc5ea46f5e4b9988bc5335  PPL < @ PLuSdP  PLP@@<@T UP]PP]A PM0PP U0<APMPMPM#B Ȅ APM#BPMTsPM h 1~rAPM܀P(M3 P(M3 ӇAPPƱPPƱP APMPMPM>P noAPM>PP7P7 AAPUB8P!pP!p KAPW9"P"P" -Wr!AP/ƾPPS <(PS <( P2AP&PS+Ԥ`PS+Ԥ` QwAP%=P[Ψ(P[Ψ( R8ceAP7P]ZBP]ZB S_EP3P8P8 X:!P`P`P`ף?a!P`P`P`$a+!P`P`P-0!P`P`P v{!!P`P`P`.ۓ!P`P`P` g[a!P`P`P`#q!P`P`P`2D߰!P`P`P`*5:!PPP"ܠz:/!PPPC^LJ!PPP%T>p }A!PPP(O>FW!PPPi5!PPP|F!PPP0P'aPPP0PA aPPP0PpaPPP0Pwb7BaPPP0P!PF 0PF 0P0P6r¸!PF 0PF 0P0P6^=!PF 0PF 0P0P6 D!PF 0PF 0P0P6^5aPF 0PF 0P0PQB!PF 0PF 0P0PvaPF 0PF 0P0Pe9!PF 0PF 0P0PaPF 0PF 0P0PU'!PF 0PF 0P0P]LaPF 0PF 0P0P!P޶P޶P0P5QO%aP޶P޶P0P$!P޶P޶P0PcaP޶P޶P0P'>!P޶P޶P0PȵaP޶P޶P0PϢJ!P޶P޶P0P"=aP޶P޶P0P&!P޶P޶P0Pe+;aP޶P޶P0PE(!P޶P޶P0PS#aP޶P޶P0P s!PwQPwQP0P !aPwQPwQP0P X!PwQPwQP0P N4 aPwQPwQP0P !PwQPwQP0P aPwQPwQP0P !PwQPwQP0P aPPP0P !PPP0P m+aPPP0PT] !PPP0P TaPPP0PRD!PPP0PaPPP0P^!PPP0PaaPPP0P!!PPP0PqaPPP0%!PPP0f1oaPPP0]!PPP09aPPP0:O:!PPP0&HyDaPAhPAhP0!PAhPAhP0z{|aPAhPAhP0:oG!PAhPAhP0K}'aPAhPAhP0S!PAhPAhP0$'aPAhPAhP0(!PAhPAhP0aPAhPAhP0Bg!PAhPAhP0]aPٶPٶP0!PٶPٶP0ЏaPٶPٶP0x!PٶPٶP0@yaPٶPٶP0R!PٶPٶP0laPٶPٶP0 \!PٶPٶP0O:aPٶPٶP08w!PٶPٶP0JsaPrMPPrMPP0dNEj!PrMPPrMPP0vrmaPrMPPrMPP0 -!PrMPPrMPP0 |CaPrMPPrMPP0!+[Aw!PrMPPrMPP0!ԜaPrMPPrMPP0"z!PrMPPrMPP0"qtpaPrMPPrMPP0#s1<!P P P0#:aP P P0$L!P P P0$aP P P0%!PԳPԳP1@7 -* aPԳPԳP1@7 .!PmMpPmMpP1@7 .)vaPmMpPmMpP1@7 /*a!PmMpPmMpP1@7 /Lc1aPmMpPmMpP1@7 Ւ!PmMpPmMpP1@7 jhaPPP1@7 . !PPP1@7 jraPPP1@7 q{!PPP1@7 :G|)aPPP1@7 آ!PPP1@7 :}&PPƱPPƱP-mPPPxV h p x cvTm%?PPP f^/PPƱPPƱP O $: A*2W"Y T!Ά~JXng 2Orn6yV[<( ; ųn 8 2>]P>sX}^ȃgXлa ޽ 7]JuI׎kU&$:#LO{SEڭ @x2 /N!p~6TP5)sA"pXy'pOzy~oz5gp{(B "*ݰ1]%9qL%fs"y׍/I2N@&iՐ<ؙi ?Tu]hjE}wDH vΊ6?`mc[$CcJsXXYd:Q!!_1, '9>!m@mW '~7H'ڝyy6.X4 3C Ot[Ou_Vn5l`^7p`yg/Ѿ Ew\=^s$ =<tX 8_,ѐ^mij)M/ZNLEobn aJJ^d7V/2&Θ&6#{J'c3j+rKtv,\OO;aTr$J*xOdy:|gշ"aTO$ lhPiN J;dL9l*&tZrV_ }M+P Acwzg.3Ct[KocLn/.Hi =aj?kQC<DX0Q[Y?zT\߲6:/sk2Sy^L= hw{pئy4~]}01JKA=y~c6\jBL{-2߿{E dee816074461e9041b3799ec7737b7aab2158886a17bc60c216085ef2557e46d 95079a0396a2709ef13ed7ac6fc5a1fd7cd60804ec19687ed7a6f048131ef4c5 ad5a8fffd444992479d96027ec8cd32a2c71032d6f05631fc9e43f3a3526c003 68836f550a090085366a4fb49657150eba813eca30389c2e510e0d97b3e21526 68836f550a090085366a4fb49657150eba813eca30389c2e510e0d97b3e21526  . .. MAKEDEVconsole tty memkmemnullzerostdinstdoutstderrksymsklogeepromopenprombpf0 biodiskmapfd0afd0b fd0c!fd0i"rfd0a#rfd0b$rfd0c%rfd0i&sd0a'rsd0a(sd0b)rsd0b*sd0c+rsd0c,sd0d-rsd0d.sd0e/rsd0e0sd0f1rsd0f2sd0g3rsd0g4sd0h5rsd0h6sd0i7rsd0i8sd0j9rsd0j:sd0k;rsd0k<sd0l=rsd0l>sd0m?rsd0m@sd0nArsd0nBsd0oCrsd0oDsd0pErsd0pFsd1aGrsd1aHsd1bIrsd1bJsd1cKrsd1cLsd1dMrsd1dNsd1eOrsd1ePsd1fQrsd1fRsd1gSrsd1gTsd1hUrsd1hVsd1iWrsd1iXsd1jYrsd1jZsd1k[rsd1k\sd1l]rsd1l^sd1m_rsd1m`sd1narsd1nbsd1ocrsd1odsd1persd1pfsd2agrsd2ahsd2birsd2bjsd2ckrsd2clsd2dmrsd2dnsd2eorsd2epsd2fqrsd2frsd2gsrsd2gtsd2hursd2hvsd2iwrsd2ixsd2jyrsd2jzsd2k{rsd2k|sd2l}rsd2l~sd2mrsd2msd2nrsd2nsd2orsd2osd2prsd2prd0arrd0ard0crrd0ccd0arcd0acd0crcd0c#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 bio diskmap R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; vscsi*) M vscsi$U c 128 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pppx*) M pppx$U c 130 $U 600 ;; pf*) M pf c 59 0 600 ;; openprom) M openprom c 70 0 ;; nnpfs*) M nnpfs$U c 51 $U 600 ;; lkm) M lkm c 112 0 640 _lkm ;; hotplug) M hotplug c 131 $U 400 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 129 0 640 operator ;; bpf*) M bpf$U c 105 $U 600 ;; bio) M bio c 124 0 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 30 0 644 M apmctl c 30 8 644 ;; wsmouse[0-9]*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd[0-9]*) M wskbd$U c 79 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyIcfg ttyI0 ttyI1 ttyI2 ttyI3 ttyI4 ttyI5 R ttyI6 ttyI7 ttyI8 ttyI9 ttyIa ttyIb ttyHcfg ttyH0 ttyH1 R ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 ttyH8 ttyH9 ttyHa ttyHb R ttyGcfg ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 R ttyG8 ttyG9 ttyGa ttyGb ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 R ttyF4 ttyF5 ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg R ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 R ttyEa ttyEb ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 R ttyD6 ttyD7 ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 R ttyC2 ttyC3 ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 78 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; bpp*) M bpp$U c 104 $U 600 ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 36 $o 660 dialer uucp M cua$U c 36 $(($o+128)) 660 dialer uucp ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M ${nam}i b $blk $(($n+8)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator M r${nam}i c $chr $(($n+8)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 cd0 R cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 R bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 fd1 fd1B fd1C fd1D R fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D fd0E fd0F fd0G fd0H R diskmap vscsi0 nnpfs0 ch0 bio cuaa cuab cuac cuad ttya ttyb R ttyc ttyd audio0 audio1 audio2 hotplug ptm local wscons uk0 R random lkm tty00 tty01 tty02 tty03 apm pf systrace xd0 xd1 R xd2 xd3 std st0 st1 fd ;; presto*|xd*|xy*|sd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi base_vapmap_map4sun4_mmu3lrcookiescookiepmap_extract4pmap_extract_srmmupmap_map_srmmuobmemopen_countnetif_prompv_putcharsun4_idprom.2981promdev_inusestringbuf.3093rootnode.3053dtabfilestore.3171promvecstore.3326saveechobootstore.3178getphysmemrelseekLstdLmul_shortwayLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9block_mapbuf_read_fileufs_close_internalread_inoderecvrpcebuf.2161sputcharsbuf_endsbufsbuf_lenrarpsendrarprecvbuf.3292numberetherbuf.3130paniced.2161get_bytecheck_headergetLongsstoppos.2277arpsendarprecvsyncsearchupdatewindowmake_crc_tablefirst.2646crc_table_emptycrc_tablegf2_matrix_timesgf2_matrix_squareputcharprom_getpropdvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopycd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenelf32_execrpc_fromaddrrpc_portstrerrorcompatprom_findrootrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirbstartrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openprom_getidpromerrno.mulocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsprom_makememarrip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660fdloadfilepromvecxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvprom_interpretnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbendbootfilecrc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysprom_nextsiblingstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpprom_findnodecd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.rempmap_extractrpc_pmap_nummmu_initxdr_inaddr_decodeobp_recvprom_getproplendvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumprom0_xmitadler32_combinekdoprntexit_divufs_writestartfile_system_nfsbceaprom_getpropstring__moddi3arpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulprom_firstchild__data_startinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freepmap_mapcloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree5 55l5 55h55&5- 555>5J 5M5d\5`d5n5L{5 5(5555t55555T5 55T505555#5-57 5E5DN5Sbase_vapv_putcharpromdev_inusesaveechopromvecstore.2957bootstore.2848Lgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9toppaniced.2161pos.2277putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevskprintnprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tableprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowkdoprntexitstart__data_startdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfree@H xX9``@!` #``"" $@```d@"b@2`"` H*/+"ä 0 " @@m?`  ?`°`㿘cb@#㿘 @㿘b&c1?@ 㿘@  㿘b`D L?(`İ@ b`@`."?#"İ@`@0@"c@9<6@@@¦2@`  Ȱ`@6@#" Ȩ`@"?#"Ĩ@`ՂD  Ȃ  `L? )("@p`D Ж  @@` (`&@ Pb @#\@( @x`@`? ``a` $ $ a   b b ` [`c` l  a@H@ǰ @ `$  b㿐1@ ?`X'@א@ < X@ b x@ /`` #`%`T@P `T@'P@   `T'P@ b`` `@%@㿘!"` "`$"@X  ` "0b  a   a ` ` ? b㿘 ` ; < @ @㿘 ` @ Ԑ@ @  @"4 ?$?㿘 `` b"` ` "`"`"` "`"``@   b?  㿘#a̔` `"` a`@ '@``",06 @ * '@. @ …`㿘a`@4@㿘a` @?"  8@? 㿐1!`*! @` !`P @` /O`  /. > ?`$(?`$(!`P @`/?!̒``  2!OÞ@㿐a8X/O` (8` (/8`@ ? O㿐a/` @ T@㿘  㿘at㿐1!` @ !`pX!`p㿘@`؁`@ `  ˆ@( 㿘a`㿘a̐@㿘a@㿘#`@`2 `` 4 "$`@ & 4$`@㿘a̐ @  @  @㿘!#ؒޖ ?#؂8` ,㿘'@`$ ?` )!`$ $ $ %!$ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   @ڐ ؁";`D) + X`S c D@ ((c `L< ;@?" (@ Ġ@ @ ``H @$ 0  ` @! ` @!0i$ 4@'$ @V!%`@`$@   @J 㿘1  &  2& @8!P㿘  ah  >@ 㿘m`@2  `2#& a` %"W``@J  : && &   7 8& ?` & ?`@!a )aa@  .`.` @  @" ?` & @@!p@!@"㿘a`@ b@@bP ( @bX ! @b`  `܀`N@H@2 HN`@2  㿘a ` |@@Y |@㿀) @`G' `k @ a b#aH-Ȇ(H`%aԀ((H` ( @H`- @`Z#! #$ L L ($`D `H`-2(a?`,`````\````` ``$`(b `L `p `T `` `X `P `d `l a ` `t$ ` `H  `<, `8 b  H`+@H`)`+@ @ a `ڒbhJ`L# `D@0K`DP !$ L % @ L ($`D `H (8``z`c" ! `d`a!І`!! `s!Ђ`!!!Є `@#a!!Іd!!A@bx "#@b  $`@! #H$ L !$ L@  % @@ܒb  @N"X`@#a`@ @@a|@  .@ .` .` .` .` .`㿘 ,`@㿘  ,`@ @ސ`??@"㿘  $ $ $$ (`@ @`  '@ 㿘  `   ?$ `$<(ݐ  ?$ `$<(㿘  `a``@ `(@ 㿘@g -@`Sa`(_`$`#@aȠ Q bbaT%@%` %`a֐ %`&``"J`Pl`P```` ``l  `` ` ` ` ` ` ` ``  ` ` ` ` ` ` `@``%% g#ffal(%` %` #a@Z##@a`````` ``     D  @a@8#(㿘   * * @ѐ" 7 * a*  @? '`2!?  &? &@8 *?  #@  #@*? @?ݐ?? 㿀m%aa@ `?`@؟ @ ؀ a a0(` aM@9`9`P a p/X`@@ - @;>-g'#a `P8$a f?a `2* 45q0`(`T?h@ #a@ 2 ؂@ ]a'@@ Z@b!Ђ`'!!Ѐ`!!@V X@ !H耠`$!@J h@ "hHh`2h'  @ ?<@z ǐ  @ ?2 ?@  @| b " @ "' `@耠a   b1dǐbb *. a@`"$ `8`>@+p3@2!?: d    ? b? 8@v"妤?? @   ? b?p, (`@@@d?'T@J @b ``@ @v@I,@D `?'N ha'a``   `''''Բ`(0`@6 `2``"``Y؀`h "  쀣@8'@8@(, / @䀠,@ @`(0`@δ @` @``@` [ 4T @T# #  # #  @!(  "@ , ``܀2 `2 a``@Ԑ! @dٔ?  @@`D Ԡ + 024&6*6,& @ 4T2 !@b ``@ @@j  @e?;0(`(`@@&@;@u!Hb ``@y @h@;0   (@ ' <(`  '20@H!0b ``@L @;! '``2@` @5耣` @!@E  7?  ``+`0`@ڠ ( `8`耠"' `"$  a`` @!h  @ e ? @ %@E ?$ 0` ƴ2 !p@b ``@ Ӱ @@!` 4Đ@u?? 4@!1" ``@ @ O&"" @^aȀ 1 O&""`21  41 "? @` @ @w!Ё@r!1" ``@ v@e" `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*J`   J`2 "/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ @ @J(`8`` 2  ` @@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &      ??  8@` ` 8@@@ B 8@  `"``"``"``:`8㿘 ` a``@ `&@@  `&@@  ) `h C@`/?@ ``d0 , , `@ 02, $@ ؐ -  ?@@耠`@&0$ & &.`@`8 &㿐  `P Re8<` %  `(@8`eD`L  Ȁ@ @&@%@& @  c 6  H@  Ȁ@`0a  `=`#  @P$ $  @&@%@& @  c א  ,84(@@ ͐ #@ &@+ `d`  *  Ā $ 8eD @`0$ 㿐`; `@0v !* @(@`" @  @C <@ @ @ @C <@  @C <@" `.@?$@$` `Ȑ.@㿐3 `@,, 􀦀@@@@ <@`@@"`2&@ے"` `8в 㿘 `   @6`0  "  @,`0 @) @%  `" ݞ@ 㿐` @0@]ฐS,Kx``*༠8` @Yd``0 ,  @ 0@"x @% *  @@ ?%% % % % % 0@ϐ0x@ В  @@&`@ % ```    "e\ kFaT `0@g`t% `t% `t% w    8''''N`p`/2   N`/`"f <@@.8``/  .`  8``/  .`8`/`R%%: 4* #(`"  @2   2 / h< (@@!'@@=@" /܀`0@ _@8  d8`` 4' @)e(@3܀6  : 2Ӧ@-` d 0``ܕ*  ܔ@O耠`/  B  'ؔ@O@  0' @((```@ " ! !00! `0!  ! `"@? ` ` ` `(?(@) +`? (?@@@ @ "@㿘`&@@`&@.@& 㿘& @&@   ?`Lh''ߒ`` 2֐ D D6 &"#\#@#`a b@Y   H b? ''h쀢 Œw #' p> ?`X  '؂'''#a'b'̐? D D4 ?$!̒b#@ T#`#\ @   <#!b@˒""V'4b *@2X  ?@ِ"\`L'  `L3`` "xx*cȀ  a` ?@!؁    ??  8@` ` 8@@@ B 8@  "`"`a$"`  :`8 㷐O @L`@_ G`D@   `,4  @(* :  /􀢨H `g"''`@ d (􀠀 # "'@ @<@  `@4@ @" ` &@@ $ '@1逦`@8〦㿘  & @  㿐@ (# b( h1h@Ĕ  2" ``"- @ ```<` 2(:  (@ ( @ ( @  (`@h (`(@@ )  @h```!(@ `, ``  (` ( * :    @ d(gx@ 0ڢ `, :`/ ` `  , :`/( ` `(` (@   U :TK (`@K    "@   + ?` `:K@`` `a՗, + :`/` ```  ) (+`@    -8`@@" ` a  Ն?  x:/ 2 "? `2%  w ! (< @  ,nK@ @(1 ```?8I  ̤ @  ``` - (:  h2  (`((@@@  I`.`?`;92 @   @ Ő'  , $''$L#\@#`̐1"a@ "X &@ "01 H&""1&""㿘  "& @ O x&  0Ȁ` @ l"x ,9aN`ۀ`/2 `0 N`/" `"&``0`ר @ x@" " "N``/   `/ @ L`   ,@ X``?`?`?`? *    @ +'(@ h#\#`"  @'? l  h, 0`"" @@Ԓ x80`@զ`$b @   0@  D, 0`䀥@  ?`"?` ?`$? #`#\@ ?A , ? M@ ѐ (@d& # @ @@ O`/'@ x@{BN, @ @q x .@l x@  b 0S&` ې x@Uאܰ ڰ ?@ꔐ CD  D 4` $@@ : 1  80`@`'@ eԄ $#\#`a b @_??$ Ԁ!ؠ"ؔ @ K $?!?$ 8$ 0$ 4  נ   b? b? H b?"@?2cą(c@2  @ 2  @ 2  ?Ā`  Ć` ă(`@ @@ ` ` `㾐ab@p\'Ĕ?< 6   '?'?@ ? '? '?`` '?Ă?#\    " {xa$ d@?  H `  `& @@ " H b?'x 'p't'|#\#`  p  !"@?@ " H$"'?ؐ6  o㿘7@& ?@c2?``2?``` &@ W"?999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999(949@9L9⼝㿘 ` ! @ H H@;0. xcpccbc`ccccc0cHc``@*(@` 㿐'X'P'T#!$`P `'$ x@Ր#X ``.&&(謐 [ʒ  .@ (7ʂ 7/΄  /7 ``///y/bL/ ./ `y/!//// 4/@D#\  0XX0X? aX$` 0 @? aX$` ? a?@3 `?@, H㿐@ b ? `5@``h`f`` `@ɔ   H|`И 5`l +` TЂ``  9  89   9 + + Ђ@@+` Ђ" 8````)` # .1@  ?#8?" ͖?cd`((` ?c`(`ݐ d`h(`((@@А Ę 2Ӑ?" 㿘` (``   0 ,? 4  0 ,2  0, ..??yc"@ Ђ``  (8) )  @@"@ Ђ`` (㿐 J`2 ޒJ``. ՒJ``. ̒J``. ÒJ`?, ,` `,? c 㿘\蘦   )?+"`("$@`@ ,@Đ `4 ?" <? b㿀@Q hh" ?`@?<@ `0`<@Ւ 6(`0``Հ &@& `6`  @ `% `%4 &&. '''''6 @ &&&&&  4 (`0``?&&&&& ??@I x&$`$` $`$`$`$`<(@@(@& ,` 4` ,`  $` @U$`4`  6 4 4 ``` `&$`,` '''''4` @;4 &$`$`$` $` `'@{ܖ(@? aЀ`"`@ @@a`'@_@ ?`)c      @ " `@ `` (`ꀠ ?88@( (` @@< 愊`;` ?# @8@)`   0` (  :`( (@ + 㿘弒 ? @2  ` 7? @'aH "` 0㿘  61 1 .((?((0 w( 4?  @ @`2  ?  㿐'H'L'P'T` 'XH@'@ { @ H㿘!㿘 a, @  , @, 㿘 D`?   !?& @`&$" H@ &  L& & D"??& @㿘 a֐, @>   ːȐ ?& @ ?   `A```21  D@?`& @ ?`0 ꀢ?`0 ? & & & T`?& @& &|   Dtq* ??`i?2?`㿘a^[X?, ?& @, ,`* 㿘. `@ @li`e % % 1@ /% @ @`2P P D`2L P  "H P T`P ` D`&" L@ %  % D"2t P L%@ % @  P@k" % P Pd? @`2 P  @%  = =   @M % P @F" % P&?@-` @Ԕ   " @@% % % % @f   "%   & @ C = @ =  % D" Ӡ% D`"  P?% @ق% @㾘 . U. `TC\O `  @ ?@%`L? @$@$`$`$` $`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`@$`D$`H$`L$`P$`T@Ô$@$`Lt$`H`2@,@ @I?$` @> ?? b "$` b?? b א@e !”: 2 b2 bdꀤ `F@um ? b?l㿘 . . `@  @} L@@ X@  b? a 㿘@?`@D X. ` @ """ " " " " " " " " $" (" ," 0" 4" 8" <" @" D" H" L" P" T? @@  @M X@P?@&`L &@&`H@$㿘쀒@a؀a؆ ?@* @ @:`? ``   a   #a!ؐ?"  ؝㿘 . a```` `@` $@    b? ``" ` @뀤 b? b?㿘  . a  ?? b   b?? b 8 ` @B 8㿐`  ` @@`  ``  b?` `$ $$ '͔ 2/$ `"'$ (J`$'ऀ`  ` त@ `@@ ``  @$ b?$,, @@$ 㿐 . a ? b " @^  `  +`0`    b @C >  '`  b& ? ::|::::::::::::::::D::l:::㿈a  @,즠  ?L ?㿘a  a8H@ *! (xb @(`8` % ` N@ %`  @N@`` ` % @(` 0  x @  ` + ,3`3  ?L*? @y @Lq`   (`8`G (@@ @?  ,   (`8  8 (`8` 4 †`H@ w`L  o@ i@ , _@p # V@"S@ >O@ l0j  - bc#㿐bH'H'L'P'T'X',#@   ( 2 @ "@   @@* (@`@ 2(@㿘@`"`h`f`` `  ``.` 6` `(` `(` (`  (`  .(``.` , , , .` `)  `)  `)  `)  `)  .` +  +  + ,((|`ЖH%Daa@J @D @ ʒ  .``@````@77'777& (77ʄ 7/΂  4/#\ .`,*!܀?D`. $D . . . . .  $D$!@@t't!h㿐 b ?h@``h`f```D`(`(`  a ?::H:H:H:H:H:H:H:H: :x:::8:::\:d::`::8:P::T:H:L: : 2 $?  " " " " " " 8 0  ( , 0 8 < L l P  2 $? ` <@`  8" < (@ @ (@" 8 㿘?N`125?@22? /? ($  ,` ~ 0  ?0 `$ $>``"``8 ,"`$"`4$ 0`$ ("` c|$ , 0@?$ $  `  㿘 2 $?` ,``4 0@ $ ,@ 0& $ 2 $?  `" "`0  ! @ `"    `! @ `  @@ 㿐 2$??2<`?`h<8 `$<)$$8  * 8<1 $8$<`$hh @$@<$h`ð?ߐ  << $ 2 $??`  <`?㿘 `W?`$`2`(?N?`,`J `0 ?0 B`4`@ `$`(`0 *@ "1`0 @f3 aa0`Le0*`la,@8 `l`P0  @$P$L`l @e0$l`$`4 ?*$4$ $ `,@?˰ 㿘 $ 4T ("! $&@@ :( 0"@ +"@@26 0 (@@)$ 0 ,@ @$ , (@$ 0$ ,$ (&@@ * 0"@  ($ 0$ , "@ 0 (@@$ 0 ,$ 0@ ڰ  4"@ ($ 0$ ,  $ ( 0  (@ $ 4  㿘 2 $?``` @`     & `( `4@"@`($`, $`  @"$`,` ؒ  @S @P`ڰ?$@?㿀 2 $?`? ``" @   `lbbĂe0`8`<'''`p`T`X ''' 8٦?) "&  @(@`  ?5 5 - ? (`$`& 8   $@` `p  @ $`& 8 $@`"& ``   5 ?$@Ĉ"&  @(@`   a5 `$```5 $`d``$`\5 ?򀠠 $`h$@`h`\(  @"]&  @(@`   ($`h0p5 ?@ ( !@(`$`h@0`p $`l$`L $`T@  ` $`h$@```d`h   `T`L( (`@` `+((@ (  `2 @& & && `($`8` $`<@`  @"  ] ҂     ' &@@> C > ``@ $` " ` `"@@($`& 8`@`<` @ (`?(`& 4`"Ѧ?0"&  @(@`   $`5 `@ "` $@@0?ۈ`@ $(@ 5$`@ $@`X`P (@ (@` @ `q(@ ( `  `c`2 @t& `, @ $@"i& `D':@`@`0 @`4`(  @@`@8 % $`@ ( `@`@@|$5 5 @$(0`$`D$`H $@`H"`D `D(@` 2 @& $@/??5  @| $`@   $@`@`<  `@@ @$$`@@%@,   $@ ``  "&  @(@`   ' @> ``@ $`` @!'@ $`& 8?`5 5 ? - (`ʸ "(&  $@  ?  5?(@`  2 @& ``  $@҈"&  @(@`  5   * 3   `"`$b(&  $@u?$0`5$`@`  `@  ` $`H$@`HЄ  `@(@` 2 @S& "P& `@/@` $@$@`T`L (@ (`  `u`(@ ( ` ` g`2 @&& '@Ά $@ C `"=@-?٘( (0` @0@@ (`@ @    $( 0@@ (`@  @ ` @2 @& (0``(U+ `` $(@` z2 @& $@(&  $@`R(``L  0`( 0@@ (`   у(`( 0@@ (`@  @  `2 @&  "(&  $@͈$ @50`p$`hj !.@(`2@(&  $@`D $(@ 5$`D 0`$5$`@$@a $`P"& $`X$`L $`T$@ $@$50` ``   /`h ($`h@0`p "  k$(@` c2 @0& & & & &$`<$`8= @ $`l$`L $`T@u즒 M`l``$`P`d $`X*` `p@d@  (&  $@:5  `;(& ? $@- '$(@` 2 @& (`0`$`@$5 `g0@  i$@$ ̩5+ `n@? 5 u`$50` `m` (@ $` @ $` "& 8 @? `` $@㿘?6 c`V U a?GbP![          @@@@ @ @ @ @ @@@@@@@@Ϯ ##a@aN-@@`@?c?`c* ````````` ` ` ` ` ``@`@@@ @ @ @ @ @@@@@@@@8@ @`@!?⡒##❐-@@c@?`(?`(@㿘 ?@!? # {u##6`6 @#@&$8$c…8&?c8&. @ 0@`` 20@"@ (@ ( `0@ / @ ?/  0`(` @`(`(@(0`$ %@ " .@ڶ.ڂ (`@ І`ƀ 7@0   +@ ( ?`1?(7@+     (@'''  '?  '"    `(@ (@. (@ 2@ @" @(`@`0((` (@ 0 20T * (` g` (` @>0 @8"'@@(`@  (  @ . @.  @ `` (@ ( +(* (`'@$@80 }@ @ ";7?Hbn.''? `? (@U'"&   @@   @2@(`(@@(`0` (@ 0 20 -@$%@ @ @րb}''!L`) L c0  8(@@ `  @ 200)  ! @  bHH`㿘bH1 㿘`X bHU8?`@``(`@6 `(@0``(`@0`(@0``(`@0`(@0``(`@0(@0Ʋ`"8`@6 `(`@`8g8` `2``2 㿘 $  2㾘;;n c  'x @`@(6>@ `, 4`< @"ɒ..6>@㿐/l  &%Q   @`   ` < ` <@? "`??cV? c   `1@2P) IG`ܦ<@2     ƀ @` ƀ  ` >   @`   ` < `u`?n`    f . @ * 2 6 @4 ,    !A`  !!`!8: @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @  `G a0@ ( 0 @><@` `㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ݾݹdvma_mapoutdvma_mapin%lx pgmap@ %lx L!%lx %x %lx %lx map-pagesobmem %lx L!boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s node %x property %s length %d > %d Invalid controller number prom_mapin: length=%dprom_mapin: invalid maptype %dprom_iopen: "%s" error=%d no PROM root devicenamemakememarrmakememarr: hope version %d PROM is like version 2 memorymakememarr: cannot find "memory" nodeavailableregmakememarr: cannot get propertymakememarr: no memory founddevice_typeblocknetworkbytecompatiblesun4cpagesize %x l!sun4msun4dUnknown CPU type (compatible=`%s')%x mac-address drop swap 6 cmovexmit: not a network device Can't open device `%s' Can't open network device `%s' prom0promsdstxdxyfdie   2.6>> OpenBSD BOOT %s can't figure out where we have been loadedbsddevice[%s]: boot: Booting %s Loading at physical address %lx Cannot load %s: error=%d lseek phdr: %s read program headers+%s%lulseek textread text+%lulseek section headersread section headers [%s%ldlseek symbolsread symbols]read header failedread header shortELF=0x%lx bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_read: hit EOF unexpectantlynfs_open: must mount first. getport: %scallrpc: error = %d recvrpc: reject, astat=%d, errno=%d Input/output errorInvalid argumentbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorUnknown error: code %drarp: bad socket. %d No response for RARP request sendrecv: short write! (%d < %d)readudp: huge packet, udp len %ld sendudp: bad write (%d != %d)0123456789abcdefexit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O error@@ !1Aa  0@` #+3;CScs 9l9 99D9L99999x9ˀ99h9@9ָ999X:;H99@9P9H:;P9P9@99H:;X:;`:;h:;p:;x::p:;:<@` /:Z9@:L@:N:N 9:N!:N):N19$?9lR9a:Ng:Nr:N}9P:P:P@:O:P:L:N:N:P<:N9h 9p99p9l(949D9Q9`9t99999|9X9L9p999909 99$9`9T9x(949xD9Q9,`9t9h9H99T9999909$9H9999999(949D9Q9`9t999 99x9T9H9l9999,999 9\9P9t(9049D9,Q9@`9t9|9\99h99999D989\9999999 99!9494?9dG:PHQ9XZ:Pc:Ph:Pq9Lz9:P9:P:P9`99:P:M:P:,: : ::/:NL:NH.:P8:1I:1[9c9p9{9,99H :W:09x9H99:8 :XH :U :XL99ݴ:MD9p#:M *98 :W@F9O9a:Ld9j9x9ְ :U9:L :U999p :V9999:8 :V:M9#9$)9ɸ39@=9D:LLL :XPS:pZ:LD_90g9ˀs9$y :XT99 :W:99P:L9$9 :XX9l:\ :X` :U :M$9$':MP09P= :UC9pQ:W9 ]9b:NDj9p9 z:LH::L@ :V: :Ll9T :U9: 9h99( 9/9ָ89B9Q9ތZ:%Lb:Mj9|q9h{:99:M999\99p :U :X:09X: 998 :Y` 99:LP/:L59F9N9@X9b :U j9Ls:M| :Y9 :V9$: 89T99 : :T9:9: 9l 9 9 9 & :Yh -9 59 C9 P9 W9 ^9 f9 q9( 9 :1 :Yx 9@ 9 9 :U :W 9 9T 9T 9 9 9P $9X . :U 3 :U @9| L9 T9 ]9l h:( x: 9 9 9D 9 :L :MH 9 :3 :D 9 :7 9 :D 9 9 9P 9 $9 4:L@ A: 4 L:L R94 ^9 h: v9` :U 9 :U :/ :Vh :)d :M 9@ 9X|5 ``@! ` # `` g!" $@` ``d@ g P ga@2`"` H*/+ e g"a 0 "#@h㿐' f@ X- f`B f`E` ?c/?+*`@..`@0  `   @@"`@@ ׀?@`@ e f"p@` e f"X@` e f"@` e f"@@`㿐@ g  @q  f e"@`  @ e` ga@@ g? `  P?`°` g`P"? g`P㿘 @E㿘@    㿘# ga` `"` a`@ '@``",06 @ * '@. @ …`㿘 ga `ట@ (@ 㿐 ga/` @ T@㿘  㿘 gat㿘# gat`2 `` 4 "$atp & 4$at㿘   ?$  g`$p(㿘' gt`$ ?` ) g!`$ $ $ %!$ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   e @""; ec) + X`S e c\ D e@ ( e(cP  f`< ;@?" (@ Ġ@ @ ` f` @$ 0  ` @! `  e@c#$ 4@$ @+"%`t`$t   e @"㿘@ % e` ga`!# g`@a  $ $  g`, g`$$ J# g  a e@#(`$@a• 㿘 ec ' g`1 g g@ ?``````` ``(`$`,``\` g`h `p `P `d `l a ` `t$ `H ` `L `T `` `X  g apI,`8 g g`X H`)H`) )㿘  8$ $ $$ (`@ @`/  '@ ` (@`@ 2(@@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  g`D`D ?@* @ @:`? ``  g  `H   #`H! gD?"  D㿐 gx'H'L'P'T` 'XH@' e@# { xH㿘 e#55555555555555555555555$㿈 ecؠS @,  ?L ?㿘 g`L g!| ecH@ !!|x d eaDت@(`8` % ` N@ %`  @N@`` ` % @(` 0  x @  ` + ,3`3  ?L*? @y @Lq`   (`8`G (@@ @?  ,   (`8  8 (`8` 4 †`H@ w`L  o@ i@ , _@p # V@"S@ >O@ l0j  -  a dbT!<㿐 aH'H'L'P'T'X',!<@   ( 2 @ "@   @@* (@`@ 2(@%s: alloc failed%s: block table corrupt%s: read failure%s: short read%s: can't open deviceInvalid controller number prom_mapin: length=%dprom_mapin: invalid maptype %dprom_iopen: "%s" error=%d Can't open device `%s' prom0prom   exit0123456789abcdef|/-\bootxx5@5d5555H5555555P5P5P 55t%5p.5h@5XO5t[5k5px55`55555X545(5L55|55 5555<#50*5TO5[5Hk5x555855d5$555555555`5T5x5#5*505H45xA5|J5<R5Y5d5q5|555| 5 55|5555\5|55@@c @@ > #pd@P> c<' @(<T `؄ &  '''''''''''''''' `6(@2+ @@c @  >  `& 1#P> c<@' b`''''''''''''''''`Xܒ `\(@2  @ 8@cY @@ > #@P> c<' @(<û X &  ''''''''''''''''ߋ `6(@2Òƺ @@c @  >  Xn& #㿘` @``      ./`0. @ @ >`@86`7 8.7`@``/ $` $@$`$`㿀> a0c<@'  .a/`0a J @ `)  @@b @ > J#!$* >(`D2㿘6       @@&`%`@$ ` `$`@ 㿈.6  ''''  $̒  $$㿘. 06.$!0! ެ !0Ǘ" " " ""   ` ` `"  ` ` `"! ! " " " *` `@ ` > `# @ *`2`@  ` ` @  `  *  㿘  @&M&  & M > 4bX& ,㿘 c;9>  ` @& 0`@, 2,`2 *  4 ,  @* 2 !4 ,@  " 㿘&& & & & & & & & & $& (Mp& , & > ?b> 㿘> ?cА  `' ( (` {? 2 H   @ t=$a ``"  `z  2  0``" v `zڒ   ` (` `  'p ' !''// z "Ӑ @`" P 8`F! 8 8@`B9 P! 8(  @<(@$@ 4`4` @݁4`    & & 4 `@u4   & & x   yD  > ?!㿘> ?c̀  "  `(`@@> , 4 @7 4 z= ? u?z2  ? 㿈 ``5 c1 ` ``('-> ? ! '''/造`/ ;p`'0`@`` ``I`u-  Ů "PH@`M ł(@g> Ţ `@`D6`H <& (`@")$@ (`@ ``@$`@> pH`` 0D@`"} 0```v `I Ho&>4(@g>4 `@`D6`H <& (`@"$@ (`@ ``@$`@> pH/`@@ > @`lHp@`h `y  2 @ H< h`" 0```ۀ`et?8`$8     40````ƒ ` 28Ho&>4(@g>4 `@`D6`H <& (`@"$@ (`@ ``@$`@> pH/`@@ > @v`lHp@8 ` 28 ``2y!sӐ8sϐ8 `$ ``"8!@8`s$`H`L`2>  > `s$`H`L`21> ->  < < ` 2]8Ho&> ł(@g> Ţ `@`D6?`H <& (`@"D$@ (`@ ``@$`@> pH`` 0ђ ` 2)8 `륖 `"80@8`sS$`H`L`2Y> U> `sG$`H`L`2> > ? < <㿘>`Ho&4 (@g (` 2(`Hp@  `"> 0 `$"  @$ @Hp@ 2  `  `> ?`!c 0```> ? cЀ `'80 `> ?c̀ `80㿘 0 $`2  `@ڀ*`4  $6 $㿈"  ````! ``" !!@@̐' ! /'''/)> ?#`vH`p4@?  ``A`;`  `rv@Ԑ`P1` <`3'  " A P 8@< P$ 8#$ H`"`` 4@2 ````2a̰ 3@yҲ@β`!$ @$``" 3`|6`'a@ 7Ӣ -㿐` -`` >` `O#\#\> ? r#0㿘`  `>  (cހ - Ȁ`> ? `  > ?> ?cԐ ؁㿘 ` o @ `(` n@ vz  2 0㿘 t    (`(@(`(`ؑ 㿘 o `vY 㿘 ` `"&@o .@.` .`.`v=  2 㿘 rw   "  !! ! ! ! 㿘 ` @4 @p ` oK`.@&qA v  2 㿘``(  r5     qÖ( `  & "@`”q7 㿘> ?`1>   4 W 4X ` /'  ~|   쀢 pq '  " `  @%?{ 쀧` qߐ '  " {  qϐ   "  @ {  2 q '  " (@0`(` `> ~p  > ݐ q  "  @ {_  2 q   /%  p  " <"   <@\hf> ? c$$ $ $ $ $ 8$ $ 4 $ '   ' $$\ m < ȴ#@> ap s% '    2|> `'H쀢 I؂$@`   ``"#@ 2\쀢 "p' "p''''#\  #Ѱ? > ?#݀ ``2*` ``8> 2!Xр \'\ <oo쀢 0` {'`> !>  !@ t '  ڰ 7 ր  ` `m `'''@㿈ab@+ p '  "     o?6 #\    `8  tN   ' o6 o6  7h  0 ''''@@'  H  < 0( ''( ''ԇ0 @'>b`X'@'8`XȔ@i ` 0& 4d& 0& @Ho$(@e֐Hp@ 0 > < H''''4`s`> !b`P> `` `0`    H C :`PB8` @8`0 0"4 ;,` , @'C'''` @`?Ђ ' 0Ȕ& 0@h!0``~ 0& 0@FP^ 0(& 0``y 0d& 0% & 4 `5 & & ~& @@EEP0z>b`@'@8`@@_c >" 8> ``(  `8@*` B`8`(C 8`8* 2 @9 8''Ԑ@_Ȣ `؀ w&  <   @(  v  H @Ze& `*`8`&`  LY> !xɗ `s' 0`& 0@F" 0(& 0 0`"& Ho$(@eːHp@ 0`؀` 0b& 0>b`h >   ('' 8>`0`@:`hB`9 (C 9 8 `@_̢ <&  P @"ŀ`> & 㿘> Abt #>>bbH@8bH %>a `> aaȐ ' a  0 2&  0@& 0& > & $ a ` $a$ 㿘 P b $`@ > 'bЪ!(>  a`4  "  `"   @5 - ``4  " `  @5ΐ  v `  `4   U4  `4  4 I 㿘 Pb$`@ !͚ 7> ' ś+`  @5    'D'H P`'P`' H` ` $bHg```'%`DPѸ %`%`a PuP%a`8'| |08 8'xD8`"D4`"OH``{> ">b`0|@8`0H@<5 @<і> Axt?`Ǩ   @DX "K `0aHH``< @c 4v p $t` "q```@j`0`h$`0v`0`> Ҙ D DP&  `cDP  eā`4>b``D@ 8`` $  `0aL H`@`$ @8 H`HD4`` Ϡ  H`ˀ GD   ` @&ڠـ `0 @$`0  g WD`Ȁ" aD`0 @$`0 HȀ`8E@; @;  `@ D@"`@D( Dq d  0a  0 @ $ 0 ȴF`E@4`DP@St=  0h$ 03!> !P@]~ `P` ` `>`4`  ඀`" $4ඁb 2` ` R ! "$ $ @ 'h`%@ 'p=0@?x8`8` 0''t'l@r>b`H@8`H %@8x@:=`@ @;2 < @3 'p `H4$ , @6C H$ ,' "( "`4@ F ؄ @    2 (  't ń  $@Rp `0`"X`4> ݐ"8 Hɍ  $x $ @$  `:  @0 4-$ 8$ $ `Pb$E 0$ 0h6M``pt(@? `=@ $ $ > "( $ $ ;`0耈`23$ " $ /<$ ,z {l 0` @Aؒlh@$ $  0$ ,`$ 0@U  } ʀ  0$ 0@B4ܐ 0d$ 0Ex> ` > <@' >  8'쀢 J@  Y'䀢 8'q耢 3'#' )' && ..&i& " 8  > "0 > "p@  > > "Hiǰ H> 堐 @; '?#\%a   В  @  #i’  i H8 `nZ $ ' `j4 iڔ  > "0@;O :.i  (*`J@*`  @*8`*@>a> <' > :  ">  Đ 0> "  vĖ 0aH `% 7Ԕ= Ò '> [#'Ԕ'''   //Հ }?!' //3> '&` ''j '  "  %a$`$`$@$@  o$` 7#\'  ۤ` > `8 m ' 7@fҒ `7' > &` e`8 #'> > "@c \@ '$ ' "h `h`>  0>  HՐ a  >  \`A   2 \> "ؐ$'> 8>  X#   > q#0> n#> j#p> f#P> c#> < 㿈  $ ( 0 8> ƀ `2 4  ,    #\#`#d> >  ؟ƀa㿈 V   > ƀ! `2!! !!(  ;`#\> ƀ!H!8> ƀ!J>`f>h>X! `?L>[`J>`f>h>X"`?L>[`8`"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@M` 2V``2   "`""@@") "` @"(@@9`9 `""@" @` ` ` ``2`@"@@9`9 `ݒ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2㿘> 9aX<`*`8"``%#> ?Pb\c,5c "  I>'! $ > !> !㿘> 9aX`<`,> `8%``'> `4`"`` $`>`0` @T3  ` `4`   S!T!㿘 V`   V  $   2V  @P` 㿘 ,  V`1 `" V $  `2 &`&`&@ &` &&&   @P`怢 &`&`&@&` $@ H> c<@' >"`0`'LL> A`Ī> ?c9'@7d _   &> <@ \> K e 8@` 8 " 30> ?&.c>  >#! `8$`($`8" > !0FbpL@L /$ 4 S > ?c?e$ &0@PR L`4`2`8 $`4`8`$`8F"P> > >  b0  㿘  V`  "V  $   2V  @P `  <`@ ` 4`$ " @  ?`2   ,@`@ @ " "  @ ?@2  0 >T `0`L > b$ 8$ <''''''''''''''''''''''''''`ȍ)> @ '>䀠`6 #> @`2 $ $@2` ӫ $ &  P> b$ 8 ɔ  " " " " " " " " `"$`>]  > -` 2ܐ #> @㿘 <`26 @2  ?& 1> @'> @8  2 0"   @2 >  bp$   ԫ  `$  $`2@2 ?$  ؁> @ `0> />5> @b;> @` 9> 't Z` @=` 2 `$  ``ǖ F`k S  `$ $  ̀@"O  ` $ $    `"$  $  $ $  2 ``"c"(@ 0` :y` 2 P%8 (  $` `f 0Ѐ@2  Ā@"  ` 0Ȁ@2  0`"0 P 4  8`@  ! ` (@`&   @`  `$" 8 4x     ''''' L "`ؚ@. ܀ bG& ؚ@. ܝx   `'''''& `ؚ@.v ܀ b"& ؚ@.h ܝ㾨   '|> 'x'''c<' $  @ @ '` H &  Hx@.; | xa x'|L&` ` K ' | ` ` `  ' $#\ @;1 a `2& x@- | 2xax'|& `"  H+ @:֠   @" a`>" adN" x@-, |> ܶ"㾸   '> ''''c<' $  @ @ '` H |&   H@, |` 'K&` ` J ' < ` ` `  ' $#\ @9 [ `1& @,  1`i'& `"  `H @9   ~ @; n @, & H@,   & @: Hi Ò1&   @,^ 4` '&@9>@8k 0`  P@" $@` @@" " " " ""?" " " "   " (" ,@5/  Y_ۢ 0&> ۲"   '> ''''c<' $  @ @ '` H |&   H@+ |_ 'K&` ` J ' 8 ` ` ` ӂ 'Đ#\ $ @8 [ `1& @+  1_e'& `"  H @80  Ű @:   @+ & H@+}   & @9 ui`P `0÷&&  `r@? ? @+H ^'& `H`J@? @7H`4`1̠ @.Ԑ $`$@̒@.̐ $` $`@.Đ $`$` $`$`$`0$`,$`$$`(`$` @3  ,^ 0T "̠ " " " I" @7Ֆ@*ݐ > g"㾸   '> '''c<' +  @ @ '` H &  H@*  ^Z '&  ` `  '  `L @ @= ' @ @D ' $#\ @7 "I `& @*^  ^ '& `" `H @78  @3D   @ @‚  @8  $#\ @7L 2 q 4``  r 4``    @ 2, WŤ&  \ @) =]'&@6Ґ@5 <" @8P =E  H@)Κ " $& @88 %@) X&! 2   ,]K 0C&> ""P   '> ''''c<' $  @ @ '` H &  H@)g  ] 'W&` ` q ' Ĩ `T @ @E ' @ @ L '#\ $ @6S x `N& @)  N\'& `"  H   @6   @1   @ @   @7b \ 0ސ @7V  @(Ӛ &  H@(ƚ a & @70 B  gj&  `5 @( \<'& `{Hy@5|0q@5t@4 > ``"` `" @(^ > "x   'x''t'''> 'c<@' %  @ @[ '` H B&  Ht@(+ x Bt[ת t'x ` `  ' k ` @ @ '`" @ @! '    @  $#\ @5  2 5 a @ W @`   @? ?@ @ ''  o ?X'P' ''`'h'l''d 'T '> P`X " ` ؖ` ܔ```@@@` ` ``'@0K  x`F @ @o ' $#\ @4Q J `& t@' x tZt'x  `"  `H} @3 > c<@ >  @5m gߨ  Ht@&x t #@ @5T N @5J D  @5@ :% ?   "&  &  `!t@? ? X@&x tZRt'x#@ `" `H@3 xZ> > t @&x gtj#@C `& t@? ? X@&ix tZt'x  `W> HT@3BN> #@& @?t ? ` @&<x tYt'x#@`2 9>@ @8Q``V@2; "`3'.@`"` `` 䀥 @2 !d"`Ά "  @2Ȇt@% xs#'a@1 >`""Q`>ad" 5 2 > @1 "+ Bt& @? ? h @%x @tYat'x#@`"&@2@1 @"D " >a`> ad t@% x" S @1 @2i@1 @"DG"  㾸   '> ''''c<' $  @ @ '` H o&  H@%E  oX '?&` ` > '  ` ` `  '#\ $ @2; N `%& @%  %X'&  } @3g ` @$ &  H@$ؚ  & @3B ;v `2&  `4 T@$ X\'`& `@? @0`T@.  @-  sX? 0 `Ӑ Dѐ T@$ >  #x   't''p'''> c<@' $  @ @c '` H K&  Hp@$M t KpW p'tY&` `  '  `Y @ @J ' @ @Q '  $#\ @16 V `& p@$ t pWp't& `"  `H @0ܔ'> c<@ > @,ݔ   @ @  @2C ׂ  $#\ @0 2  ' @ '  ' '耈`   @?'  @ @@  C ?X'P' ''`'h'l''d 'TՒ '> TPX `?`````@\@@@`  @`@' @1 -p @#t p& ``H!   Hp@#t p & @1n tV' `!& p@" t VpVp't& `> `H@/'p@" Xt`24  H`?7 "  &  `qp@" t pVNp't& `"2@/{Ҥ &\@''& p @"st pVp't& @/S@. ؄d"܄"  h h '@N'I`" `P ` ɐ# p@"3 Xt'd'h'l'p't'x'| P'd'h P`$ fo _ܬ  ?$`@@Y'@. >`">`>ad" W T U&ip&  h @!t -pUp't&@. @- >"ܒ " `>" d" &# "   & ^I&&@&' @-ǐ>d" "" @3̐@+">ad'''\ '`'@3є 7`H`?Ϥ   '> '''''c<' +  @ @< '` H $&  H@!Z  $U '& j` `  '  ` @ @ ' @ @ '  ? &"H`? ` & @!   T'& `"    'l'p#d $#\'x#`D@.r   `ؔ2GX `& @? ? x@ ǘ Ts'& `"k Hؖ @-p ^ +0Z@)   @ @x  @/  q`4`h\ l\XMK   ђp &  `@? ? x@ d T' & ` H`> @. = h'  H@ 8  & @. ! `8`; ͦ @  Oؘp@- S  @ & H 6&p0m@ ld> o#8㽘   '> '''''c<' $  @ @W '` H ?&  H@  ?S_ '&` `  '  ` @ @ ' @ @ '  ? J! H`? `4& @k  4S'&2U  `"Q   'l#d $'p'x#`#\D@,Ԛ   ``p _ `& @? ? x@( R'& `" Hp @,    @(   @ @r  @-f k @-\ E_  '`` ` т 'o'X `'\l\7    ,`}& @? ?4 @ RH'`& ``H``hp@+0r  H@v  e& @, @] 6O R  "\\l\X>X 804 @9 & H & `@! @*; $>ad"   l  @*X@,֒ ;X @,o 6,@0C @*  D@'p0> t#H\XlҖ )X  @@=wP''P`$ "D Qqj   '> ''''c<' $  @ @ '` H &  H@  Q8 '&` `  ' ͒ ` @ @ ' @ @ '  ? &"H`? `& @A  P'& `I F`'p'l#d $#\'x#`D@*  `np  `k& @? ? X@ P'& `"  HYp@)ۨ  Ѱ@%  G @ @z  @+G 7s @+= -M  H@ 1 & @+% @  PH  @ MP&P|> #X  @@<`P''`P`$ /0 (& @? ? @X P' $& `^ H\p@)0 U&  `@2  H 4&@.z Dؖ@)  p@)0,> ˤ#X@(1ؔ@%0!h   '> ''''''@c<@' $  @ @{ '` H T$  H@ߐ  TO 'Q&` ` ɂ '   ` @ @ ' @ @ '  ? j) H`? `T$ @  TOC'&2  `   @ ~> '@#d $'D'L#`#\@(   `hH g    $ @? ?4 @? N'  & `" H" ` H@(" 0@$   @ @`  @) Y @)v 3y  'ϐ`` ` ۂ 'd`   ''''p'h'l'x'|'t'd` '``@-4 `` ` ۂ ''(@,`"0-$P> #0ܒ@0,i, ܀@ =  H@  & `9@y ; @( N'@`. "00@0,@", ܀`ʐ 0Ɛ @E & H $P> v#@&P $>ad"     @''Mа H@,@( '! @( "ɑ#hM@ܒ,@ *`#?Dc'@'H'L'D  P> "#Gܐ @(Q "T6,P$PL$1ܔ @@9f,P ' 'P`$ ",,PP   'H> 'd'D'T'\'`c<' ,  @ @ '\` T  H&  HDX@ H DM- D'H& ΰT\` ` ς '\   T\ @ @ `'\  \@ @T '\`2 T \@ @ '\t  ` T\ @ @ '\ \@ @ '\` ? `XD"XH`? `.& DX@ H ?DLD'H& ` ~p $#\ h@& h `.& `@? ?0 @ؘH  DLD'H& `"U `HN @%  (@% D  HD@XH 4D 6&\ @ @\ T\ @'l ,lUT\ @' l "l-T\ @'l lT\ @&l lEt T\ @&l UlHL! T\@!i  T> T\@!`  T `4  '$'(\d'0#d#\#`@%ӚTd   ``y `` f$ ```c d   o(dh ;& `@? ?0 @H DK'HD & ` H}``"y@$ؐ(@$ jDX@ؐ H ``@ː H&E 'd& H h@ H  2`Q > 2#xh P`P@k ql$r㼨   'L> 'l'h'H'X'`'d'('c<@' +  @ @& '`` H &  HH\@d L HK H'L&@ zX`` ` ߂ '`  `X` @ @ '` `@ @X '`  ? C! H`? `-& H\@ L -HJH'L& `" 2  #d $'4 ('(l',X`#`#\@$|l   d`P< N `& dH@? ? @њ\L HJ}H'L& `"k HP @#  @#l W .0SX`@  X` @ @q X` @%p ypj`LX`` `  '``= H a&  HH\@w L HJ#H'L&X` @$ޘp Hp ~'l  HH@X\L H &X` @$˜p ,pX`` ` ? '`t  ``X` @ @ V'`Р H\@! QLL I͸ l "hh `,(` "5( l v q0 H@\L H& HĤ _> #(& `@ @ڂ '`$& (LIx Hl ',h#\'#d'#`@#@h   d`̒ ̀ 4`4`d P`P䀧d``? 0`@O"J(2#> 簐cl   lh   h 8畐c &  `HdH@? ? @B\L HH'LH & `ڀ Hd`ԖP@"*@"#0Œ HH\@ L@  :XLHl>(#> l @#rp 2Lp @#hp p# @#^p p`&_ 8'h> i# 4`2@ P |`Ad: P`.d``? ;`\@ ~L``? +`40' `2 (-|`2 d |@`@逤`<@4 〤`?d@?,ע`   '> ''''c<' $  @ @ '` H $  H@Y  H '&` ` ؂ '  ` @ @ ' @ @ '  ? "H`? `$ @  G'& `" 2   'l'p#d $#\'x#`D@!x   `ؔ8 X`4``8`2 ` \\l\ `s  $  `s@? ? x@ GT' #& ` H! @  X @ @_  @! HX" `U j>  @! 0$ '  H@[  & @!Ř p @< F 0 @. "%& H  ؘp@ ! 0 N\B`80PXڔlN@= —#㽘   '''''''l> c<@' .  @ @I '`! H 1&  H@ڐ  1F '&> c<@ > ` `  '  ` @ @ ' @ @ '  ? `! H`? `+& @  +F4'& `" 2  'l #d $'p'xD#`#\@  p E `& @J  E'& `"n Hp @7 a ^> @(   @ @}  @  v` `  '> @a(@`؀xP|> 4#\'l\ c?d&  ` @֚ E'`& `> `H@p>  @ - 2  H@  & @  @ xI  @ s~E3  ll`B\l\Xw7X "> 1>  @_ &3@ % 2Р`>X`P |> ぐ#\tl\P H P|> q#\&'؀\ P\lX@ "EP+DĠ` ` d '(?c('$xX@ $>ad"   B  @Җ @ڐ e#p'l't?c'p 'x|> #`2p@H\X  @@0WP''P`$  r @ P\Xl 2|> ΐ#XOג`&   =X\㽈   '> ''''''`c<@' $  @ @ '` H &  H@A  C '&` `  '  ` @ @ ' @ @ '  ? <! H`? `&& @  &C'& `"V `2S  '` #d $'d'l8#`#\@`   ``h _ `& @? ? x@ C`'& `" Hh @  @@ ۰@   @ @p  @ i @ wC 'A`` ` V '`〠``L '  'В  H@A  & @ :@( u?c'`'h'l'd p> W# `Z& @   XB'& `i `H d  B` `p``$PPLL H0D @՚ & Hˢ !&HDp> #P` `  '> 90` `<'Ђ ' Ђo'Ԁ: " L  'Dp> Ր#PLcXP`d  ߓ *U?ؖ ''''''''''''''''P`?P`$ Q`  ` @-ϔ  2 `&  `@? ?| @$ A'`& ``H}`L`h@ 0n @v  @l ;oLǀł`?`=:D\ p> #P `PL``'2+L L )'@  @ܒ D@A0"> E#/d․`L8''   'Ҁ?P DP'`L odDp> ͐# `& @   A.'& `߀ H0L'# @:` 2pL'@} $>ad"     @>D` ` w ' L ' 'Ԡ@ 1 P@٦`2DPL`5 KLp> W#`CLf Lm'4Y> <#d@"'LuPLP&  l&  @   @'& A 1 5'А @A 2@  >D&@  &.`p> #PݒoP `& @    @F'& ``H0@   @ z &P   '> ''''c<' +  @ @ '` H &  H@ K  ? '& ɰ` ` ͂ '  ` ` ` & ' `)` ` J '?c'$ >b耠2', b耠2'0 b耠 ?@ b耠" 'L'Pb   'T (( @@(`'X $#\ @ & `&  @ ƚ ?r'& `"y H @ n `v @D  4`   ܯ  _&  `@? ?̒ x@  ?/'& `4H2`@j0% @ט k/  H@ U   & @ S@ < w'XZ  | H@@  c `& @? ? x@  >'& `ŀÐ@ 0@  ٪ > 0`'@ ` ` ] '` ` i ' @9 &@ؒ D@<0s`? j&  `  P`$  @   @  > #i&@ h W @ט k~@24 @0   `> '''''c<@' 4 `, @ @- '` H &  H@ (  $=Ԥ '&@ )` `  ' b ` @ @ '`2 @ @ '        @@ 2  @ 6 #@  ` `@8 @&  $#\ @֘ 2 `  4` j&  ` @  ==' & `"e H"b  @{Y @r  =`w @ @  '      s@ @ʘ E H@ H ! @    @ I< Q  @  `QO  & ` @  &  @ B  &` YLJ> ~#   F | ,`w 'l'h `"! !  2  ?p` '|'h'x '=>bbh@8bhy u`2&  &  `D@? ?Ȓ @  ``!`(!   " 㾐   '> '''''`'d'h'l'p't'x'|c<' +  @ @Ȃ '` H &  H@  ; '& ` `  ' H ` ` `  '#\ $ @ $ `&  @ɚ ;u'& `" H @   4``x m   [& @? ? \@ ;='`& `H}`Jp`2^%@ "n @ @ Hw  H@` T V& @ʘ 05@G  `@8  @`)p`@&  D:Ҡ 0_&$  "@ @N" ;ː ( ;[ $$ ' ' 't'd'p'``'h'l'x!'|I@ `J$H:C$> n#㾈   '''''> c<@' .   @ @ق'`! H c&  H@  c:_ '&> c<@ > ` `  '  `L  @ @;'`B  @ @'    @ @ @> @ؘ 7  H &   H@R  &@G  x`  @ @W'  @ @Ǩ '    @? H $#\ @4 2D&  4p`cW  6& 1  @h "[ @^ $ @T  @J [9~ #>   ` @ 9j'  & ` H " @ > `  !֧   @֞ ܖ   @& ''@? ?  d@g 9'&`@v d>ad X'" '􀠠`  $$` %7` $  9 !  9y($@" e#, sؔ 'h  > 7O@`  $$ $@@$ `'x h '|'l?p]' uK  8 +80ܔ-T(\& =@ 8#@  '& `N'('#@'@ג H D'f''x|@5x @ 4 ` @@ Ԓ#@` @>>ad#``' +&> 7 a` ``'    s1 {'h㿘> '>b@ -& * & & & & & & &  0 ) > @`,@ 4( ࠃ9  ; 8#@  ࠝ㿘> @.``,@ (`@``88> '>b@ Ա: @* * @@8 (`@``8` `$` $`@$a*a  㿘 (!>b@2`"   8`! 8 ۓ >! (<` <> } 㿐 (``@& (c $ 42 0 0`$ (  `h   `")  $  `$  "n     @ 6 0 @@ 8%"";@  0&  @& 4& 0 $`@`2  (` " 4 R $  $& $&  9 <$  4  @ $  4 @ $  4   $ 4    `$ $  0@& 4`& 0 (& ( 4   & (& & & 4& 0 ( #& ( (` & (& $& _&  ( & (> Ð 0``(>V`<'沦bȢ '#\' E􀠠`"` @` `"&` `&`  M ` H #F``(`&`(``"@`(ݐ``沀"=b #\''Ȗ Eq쀢 * #"`(``"( @`0؂ @@&`0`2&`ْ ɀ `(`&`(`2 ` 0`(`&`(&`$&`0㿘 8  ٖ `(> `@ٝp  '''쀦  @ @')('>$  ؀@ 6ؐ H  @ @ '$ $ >b $> I $ $   (@  @ >$ $ b  I> b  J $ $ ې 5א ` K $ $ ͐ +   $ `Ĉ `8 L  `8 L(`> @$  a >b `$ $   $ $  $ 2 (` |  @ @ m@ '  @ @ Z ' $ @!U P $ $$ ($ ,Y  .@  @ /@'쀦 ``! 4   4 04!  @ @ @ ' $ =$ @ ]π@ i찒 U @՘ K $@ W찒 C 㿘@@`2 "`   @83> ``  @ ` @2&` @&` 2֐ X㿐> @'`  2  0H`   A `"  5’  `a.`)$` > @ ` @'    87 `" @' 4&  5!(р`㿐& (`7 3'`,&  T``"#@  %>l ($ $$ `$ 8  &&`4Olڒ'$@&  7㿘 (&(&> 1 㿘@ (&(&>  㿘 > $` @-@ $(` +;> ' 8 E `8$$ `a b$2 8$$ $ (`  %㿘 `  ``8`$@@ (`>  `'@)/> '``  `&aТ (`&  㿐 4 > b(' E > b, $` " ` >!bI! E  >>b>! ah! .! ` $` `''@ >ba@8a b  J= J#HK.L2! @    3(` $` ` >!bI!  >b>! b ! ! ! "  @@  "  @   ""    @ t$㿘 $`"/3   P` `2  `2 R ` `?Eo+` 쀦 $`"`@ &$ ?ހ #܂ @?ؐ t "`@&$2&$ː 㿘 t  `t?2 Gǁ㿘 & t` x |  t@Q Nt P` $ ` $`"F`> 9> 'Ѕ(`4$`Ai4x   >   ` P`’ ༃(`(c00J `@@44p$$$ഁ484 Hp@G Hou(@8(`6> +> '``q bА* `8(` ```8 瀌` 4(@48ܡ(`3M   "  @ =   3?   " (@(`0` `> ?2'  3*  "  @ <  R$Ā a(qc(ă(`c((fc(a82r48Hp@6> '2    " ?c< > 2    "  < 6Ր 㿘 > > bP    ? Ho(@    $" (`@" $ 2 $Hp@ a  2 $0X>`0`&&@  x`4 t .  ` '܂b@'''#\ @z # $`"'  Ђ @' 1`& q $ >> b`}x> @ aX `2 $2`t #沔b @$ 4 a8@=a8$$4$$ "$  ?"M "  $ $`e'''ܢ'#\ @   #0 #`? 2D$2'쀦  ``2'쀈` "  @ Ђ @'q n ?m0  &`( א $ Z "n  $0P`0A '''Ă''''''' @#\'   ? #`? 3 YЀ\@@ab''Ђ @#\'  ?} # ? @ : Ѐ `("! >  ٲ`02$  @ʀ `(` b  @=br  `j  g   $sW   @ \ `("! >  x`  N  `(> !a>  j80Kp >bԪ$9> " %l " ? #`t`0`8ѐ  % /'`'` ` \ '" b Ԇ@/?b 0Ho`4(@a 2 0- + `2 @2$ $ $ 4 $@<@$$ $$ $$ $`&$Hp@ u `> y! @ 7 /n0cbԆ@/g?b0\U$ 㿘Ho4 (@a `G>>b0> > @a +@`:` `2@`$ 2@`8v 25 `4``&`4 $h".`0  `,`@6@` `& `$ '`( @4 x"@="`$`&`$Hp@>b &`$ ``d&`( d&`($ `(`$ &`$ t`?&`4````! ` &@ $h    6@ b1  "~@ $`` `   "`$ k?i #"h@ `"c4`8b@ `  逢 "`(`&`$`d&`( d&`( 8``& !& !8@=!8>&`4&`$ a& 8&`4`> b Pb" " " 8" 0     .Ȑ $"/>  > '@  `x`@a>` `$''ܬ0$((`> @,$4 $$b$ @?bHo 4`(@a``"Z$`$` `t`3&``x`"'`$Hp@``' 沀 Ho 4(@a?  @$$``Hp@$ $$`&`2 $` ؐ ''' @ @  >'   @ @ z@ '  @ @'`2 +  @ @' `$b6F&&-&>b`t`b  0TO`` k $`@`a&`$$$Q_*$$ cʀF-Z,> 4'=' > > '@Y* *  @40@ r  @ @ @ `` + @ R>Q  >b` &- > -b˔> ͒a( @ .Zh``Hp@?$4ܰ&` @$$``0] $,Ȱ6''',&>Hb /    @[ cVܝ㿘> a#>%> a1 ( 2 0) '  @2   @2   `  @ @*  "  ` `.    `. 㿘> @` 4 >>> a a `㿘 ` @,q  . ,J  `㿘>a "2>a ?   @$$ h 4`!> ?  @$ $  ?$  @$$ hǒ 4`2 > a㿘 `a  `.  `. . Ӂ > @(``"  `> @b0@> @(`@    & `.  沖 . & `. 㿐 `"   >""@!>> @!`@@ 9"@!>!> aȂ.  !.  @??& &>! ? @?&&.&`. &   $ . & `] `@. 沖 .C& >6> !a0@@(` & !a0@@(`  !a0@@(`! a!0@ @.(`@*& .   4f> !`$!& !>* ! &   $ . & `` .& "    ? $ $>a`$ ` ` `G`.> `1`>bb0 @8b0,   `, , !$ Obb8 @8b8 沖 - &bb( @8b(>bb8@8b8    > Ӷ! @`"  H` "` &@"` @ "@ H㿘 >  Pa4  @  4``````چ  @ @   @ @ (@ `  @  @:  ` ` @` ` @`2 ` 0ބ    @ (@  ``2 ` 0˝㿘`&` & `& `"0@@> @(ap@&`o&` &`$&`P&`T& `N?&$`L&,0`@&(`&4&0`&8`,&<`0&@`4&D`8&H`<&L`@&P> @(`L&@ 8) `> 9a0@&`$&`(&@`8?`L&`P(0 @& `&$`&(`,&,`0?"8&0@ے#&0`4&4`8?"6&8@Ғ#&8`<&<`@?"&@@ɒ#&@`> 9a@&`$&`(&@`2`L?&`P(0 @& `&$`&(`,&,`0?&0`4&4`8?&8`<&<`@?&@ " `@@`?Ho$4 (@e P@l \P@2 l\0```2PHp@0 0` !8! !(9!9!!!8 !!(!!8!!,!! !!$!@9!!(!@& @ !@ 9!!!8!!(!!,!! !!$2!(!@(!(9! !8` `!`0(` ` ( "!! :@ @   ``@ (! `!@* ` !8` `! `0(` ` ( "!$!( :@ @   ``@ (!( `!,@* `㿘 ``!8`/` @7`8`) @2!>!>!&!8@ >!!@4>!@" !2!!@:!>!@8>!㿘 !8`>`!`0(` ` ( /@ !> @*" @9!(9!f ` 49!@9!"@9!ဧ(!(9!9!׀9!㿘 ``!8`/` @7`8`) @2! >! >!(&!8@ >! !(@&>!(@" !,2!(!$@(!(>! @*>!(㿘 !8`>`!(`0(` ` ( /@ ! > @*" @9!((9!(f ` 49!(@9! "@9! ဧ(! (9! 9!(׀9!  `  `F> b@ ?(> b`@P`@Pc @㿘 &@*  @$ $( `8 > " $  @$ $u!㿐`' Ր>ad"`" ` HȒ >ad"` " `F >ad"`" ` "E`$ >ad"` " `$" `,E> a4l  "`," `0" `4<> a4S  "`4" `8" & #>a`"`y #>a`"` `$#>j a`"`,> a "`4> Y "& P#>a`" H#>a` "Ba`"=  "&5  "㿘` + >a`"# X>ad" 㿘` ` >a`"`  >ad" " $" 4" 8" <" @" ̕㿐>`0`&kf F   `0 " ` ` #` ``"``2\\  `  c(& sj`   S && +`@ `S ! `   6 `+`  @P@2`20՝㿈`$'> \ Ť$`8@ @ @  '@"9 H "J`5 `/2, '@, @`&@ $@ &`8`4$`<$$`#\ W 2 `8 4`t `8`8c㘁  2`8`8n$$` `,c$`,dd$`0 2`8`,@``tw``r $``,a$`,"`8$`,r``㿘 ` > >b`@8` a4$>b@8b8  ` < hdab&`,&`0b&`4&`8  2`" <8<8 @< @bO Ґ(<<8㿘   &@ & H$A@`A &*  " $ @$ '@&`" 0ߒ  @ ' $@`'   @ 4 `$ & &@ '@@&@ > !p''  @ @'!>!d  @ @'!d  @ @'!d  @ @0'!d7  @ @H'`L`  @ @N'`R`&$@  7 S!d  @ @'   @>`   @ @  -``5`,  @ @  ``4`4&$@   H$؁ ژ !>!dC  @ @0'o5&`  !dF  @ @+'9&`  @ @'&`     &`    &```&``  @ @ '&`,&`0``&``  @ @!'&`4&`8&$@  K g A ] 7 S㿐@`P b$b@?" T `@> @a(@ ``8``4 (( @@(` ?`4@ ` $`4`4`(`P&&&d&P&L&`P`&, `  `(@ņ?& & j`"``P`8&@`g`& ` &$`&(` >8` 8`(` 0&l( &h`(&0`,&D`0(( @@(`&H&``<&X&T`@&\8&p b&t e> `2`>`" >8 >82>@8>8> @_Ҕ > a4L&@`(> @(a`'@``D`H?c(r@&@`` & ` &$`&(``  @>8` `   >h`8&0`<&D`@&H`L&T`P8&`&X&p &t`">> a4& hda2b&4&8(&@&,&0M&@$@ <?8?9 > Aa$`0" `4[&H5 > 9<`@> AaT$`0q  `%> 9b$`p$`0p&'@㿐> aa#\ `!@   >> ! bw 㿐> 'b>(  b >>  b>>  b>> ah>ab > >> a`?>! b d@#>  b b@  > 7c( <#\>> "b  ; 㿘 "    "o($ 㿘 &`&` @ T`` o@` @$` & " $@$   "=($@ - ``  @@ ` @$` &" $@" ` ''Ԅ '' ''''''p '''''''Ё>c >c `P``>c ` >c 㿘  @c @``V@R ` 2 ! H  "````<` @@ &`>`$&```@@8`&@&`%$'@``@2 @ @ @ '@% @ϰ 4@@'@㿘> @`1>   dO  d㿐\>   'V` `,4,  ` @   ` ڴ& &>b>&b >&b&  $b/ & 0> @(b0@! ` " " " "` " `"   "  ` `! !`( `  & 0! > >  b @ɡ"0㿘 > #>c%>0!> Ab< 02(* ?' ?(`28` ( 8&   `&  \!$ \c  \ $ \ b< $b<㿐> bL @P2 +> A`8-  @  >> bPO?  . @   {  . `6  @  0㿘> bL (`27> AO: > t` ; %8&t0 3>  @ 0(8a @  !a +>@a&a />?ަ`  e  ^ $ $ $? @$ $ $a%a 0 L Hod4 l(@e l 0  0@`2  0`& 0GQ 0@& 0G p` pHp@  2 > ! 2  ta @%&a &tNǒ >& t! >  k(!&a   8`" 8 (` "  ! ?  >`p 2> b4㿘 (  & (  `$  & +O" 3g        㿐'>H`q`$H)> 2"0"0 20*   ? $$ [| 2` (` $ ? $$ [b 2`2fH%"0$$H*!>><> b@b@ < ` < 2Y "0> 8`""08 8 %"0 `> 7c(>#\!l>  tc(  ٘ >U bH>8$> o#㿐'Ho`4$(@a$>b@5> A$ >`&@&al>b`Q (``iHp@    `,   `"" ] d π  @`  'Ho`(@a釔 $ $`2  2 (```h `$(```"d'$ $  (`@a@@8a@ @` ?@-`$`8``$` Ē (`r` v  `?8`? `"   r  T '`>!lPHo`w(@{ ? @$$Hp@ 4Z`[&> > A(``7 z"@ 3?" `$ 84   &F,$( B e 9    i   ` `  @ > #0 a&㿘 ( P`C T@`4 2AT`S  @";P  4 4 4 Q4 ! !  `& ! Ho`(@>b$ $  ! (Hp@a>>b8("T 0`2       "  'V      " ?c'H   < 2W >"b0`" `  ` @a 2k!>"H>> b0$"H  "H"   N"`l x B 4 WF " "  `?8`?` ,`7m &耢`쀢'& ` 0؂ 7f   ` / -    - -㿘`    -Ȑ > A   "pbo "p & &3>"p2b ـ@ `Հbp`Ѡ ϲb"p㿘`+   ' P@ 0@2  2 \ l` j  2h \ 2 P㿐"`p`0 `&@㿘 6`"a  }a`@` X 㿘Ho 4 $(@a $`?@`?@ (& $Hp@````,#>!> '"@Ab @< & b@7"Ѐ&& * *  4& ``"  $`0``d4 d&  $`2` e& `" `  `` @ " ` ` ~ `& @@  @@&  4& ``" `$` ~ `& @@  @@&  4& ``(`}|c&  Ā@&& `  `4``$& , `8``$& `H ?c$u6 Ԃ?6 `"V `LQ?c$M6 ւ?6 ``P ?c$N6 ؂?6 `"? `T`:?c@$66 ڂ?6  t`"  "  ~ x`=>  &  &$ &( &, &0 ,&4 &8 &H &L &P &T"  &   ր86 `  ڀ86  t``$o& {```& > cPP>  `X R  <  "& "1& 㿘`$@   U ܢ&b^> '$`(>b@at $`$`$` $`$`$`, $`  $`p4`4`Ԃ <4`4`  `0`  `@p`ax Z`t Zp Xl$``$@$`$`` >`0 $`x `$`| &`8 Ւ  ÐVX 0> c<'   `s`  K a X (' 5@@> A`N  $@"" D $}' !t0Ҁ@Π Œ ȐP Yi   Z%@4@Ԗ Y[  %@'4  '$>      $ H? ('8> #pj * X$@ $@ ' '' j ' ''   $  > #x> ސ#> c<@' >`0`!(̒ @kܐ> 8a? x > `1> <#\> # > !$$$ !$"!!$ @ iw`#\``}E V> @3> ca> ia` N1> l"?"> Ő @@ 8 > h`XK  2#>  > _``i>Ȇ  `4Ȃ? 8&"% ``} 2 > > x 0 &"%  h> > ( > I#G#> D p>ba D@^8a''Вݔ ''ؐ鰒 Ԁ`'` ` R '`2Y D` ` /Z 0' : ~& :`R&  :~& : >`F&  Ā|& Ā: $ <`5&  $@& $հа  ` Q   0t & & & h"`$b'`p`0 ]`2 耡 `$">bă@8a@? ? D''̒$''ؐ 耠`Ѐ`'` `  '` ܔ 쀦 e` `䀠@? `4@ ` ܔ4 j``@8 e&`"&``@  3 + &` @3` @&`` `  3 + &` @3` @&```   : 8 0 @ 0 (8 @ >` ``   >`(`$`    @ >`8>`0&`h]e\V `4@ 'Qܒ  tϰ0`&``&`8`&`` &`8&``&`(8&`,&` &`$&`0&`4㿘 ` @   P `82 @欐 <    E㿘Zց0`  7*d4 `<"`PT`$[ ab ' ' b"  ' '  {5')  d4 `<`P'  Ȃd0㿘`ඐ਄'0㿘`ඐࠄ'0ҁ0` cd4 `<"`Pz`$[S ab ' ' b"  ' '  zǐ[㿘`ඐ਄&0H㿘`ඐࠄ&0b0 `  P`$"  4   z "   4`[(@`&   zw  㿘>  !`,`0 4`>   Ё_>   Ё㿐 `    #\S 㿘 0`>  0` >`0` 0`  !8x  ''ؔw܁p Pb`$ >ba( D@8a( ''РВ Ð" " " 'a 'ܐВ Ԁ`.` ` f '>d@hԀ`'` ` 0 '`  ?Ԁ` ` ! '`̒@   Ԑ| a1 ﻘ  ﱘ  ܤ`̐ 律 "ݴ  ` `  '㿘 0 0>`0` 0 ?b& 0Ho$$(@= `@ ( p` pHp@` @`"9 `z` e< `@ ܺ`"  `%  0@& 00 0@& 0<}`` `% =  0T  0`S 0I 1o 2G,5- '< @-  @  0 > @ & 0  0@`C < < 0> `0` 0(& 0 ) #S 0& & & 0Ho$ (@>Hp@z`e0  – @L0 @S< a12^` ~`PY`> !P>b 0 P  'b`$'P @@ `?@ ('> ??` ?''"Hod4 l(@e l A   =9  0`` ;[ 0@' 0E,@    1 (` ) : @ @ @   8B ˀ ǀ ?Hp@Z 0@`C = =0P a1  @= < 8, ? 0@' 0 뀤  @= Hod(@e; p`& p 0' ' 0 0?ބ@' ' 0=Hp@ ̓, Ho$4 l(@e l  0Q-L 0`  0`W`: 0@' 0EHp@x0 0`2޸: 0`' 002ָ 0@@' 0>  pHp@ P F> 'Ю (`Hp@ P `$ ( ?> !4Ho$(@e> [dHp@ PÒ > 'Ю ܷ(`  P(  l` `0඀N ``>b p P >b"`$ b'@@? `9 ` ?h ''В6 ?   `ං`0`0 ` `Ē`А`'\'㎒ 쀠`ZԺ Q ` ` R '3>adbԺ ; '` ` f ' WԺ & ` ` \ 'adtԀ '` ` ] 'LԺ} Ժ  w  g   ] Ԡ ^ ` `  '  <  2 + !  ` `  '   Ԡ>  㿐>` `0```#\#`֘ p P >b" `$@b9 @?܄H' ?=''В0   ? `0 `{''ܐ~ 쀠`4Ԁ & ` ` 1 '>d@3Ԁ '` ` = ' * `0  `00 y 2` `  '5 "  X 2Ԑ L 0  4` @`>a`  h P>b$`bC @?܄H' ?8''̒U  ?`@`6 Ð''ؐƒ   `耠`0ж 8倧`耠`) ` ` \ '   @ ? ʸ H ɐ^'@  ` # ` `  [ ?'@F' `w0`耠`NЀ -'` ` [ ' @`и ^0ܒ ꌘ >ܔR /쀤 "@b`T`@"8` P ;`ܒe 'ܔ* =`;@и 5@ܒ B @P 2 PX0'l0㿐F` ' Jn $T $`$@X`4`C> `  a`@ؚ SQ F $`@d@$``  " `]T@KԒ `@ `>  M!`p P`b`$@ b' P<`@ b  ` > bд`@?` @@? ?  P''В튐H 쀠`"`` `"` " " >0'  L'쀠`Ԁ`'` ` z '`22쀠`< @ @[ ' @ @$; ' @Ԁ  A d쀡  1 " "" $@`4`0' E @ @  5 ƀ O H٢$@    `–  }&!0p P >b" `$b@9 @?' ?4 D''Р쳐>`0`''ܔ߃ `Ԁ`'` ` @ '`2. ` `  ' ԰ H셖肒  ԁ 脘  K Ѐ   n h P`b'`$ 'L''Pb'`c2> `    >ba솀@>b@?8a ?렐 X''В 쀠`ے ""   ࠆ !! ȐĒ  `L?쀠`Ԁ`'` ` v '` і S쀠`` ` c '  ` ` 8 ' A ` ` N '`? Ԁ  y>`"` 7`@@ @  @! ` &``"9`̘   8`P  > ܐ!E "u  쀠`` `   ' ?` " `(`` 7`@@ @ @ ` @&`8n "l@*@0$,4 ,`@&`@`!@b `  @< @$@@(@@ @ @ ` &`쀠"D` ` `@ @ m '耥 C"$$$ ?쀠`` ` G '?`  ; H``  @ @  '` `@ @6 '耥 „@ _ & ˘ ?   淘    椘 2q" " s  擘  托    0y`w> !0sp  P b$b 'ZnZl`>  '#>b`І@8``   ?@? ?ܐ H鬐''В,`\``'` ' 쀠`dԀ & ` ` Z '>d@\Ԁ '` ` 8 '_ D`> ΐ# `0 ` "( (ے AؐYY  ! ?`> # `0  ՘ 2#Ŧ  Ș 2` `  ' 崘  `x h>Pbb` $ @ 8`  b@'耤 7 ``L@ <@''̪̒e -耠`bd$!   ?> 3#`0 `(G Yf ``(@̄ 耠`C' ' 耤 Y  ` `  '`s Y ` `  '   @I ? P Hٔ d$ ⯒  > 9D>@"" " "  ,"  0?"$ @?#$  4$  8?"$ @6#$ Ш   "X> # `s0p # ` `  ?@'P ` ` `  '䀤`|` 'ܔq 4Ѐ  ` ` + '>d@-Ѐ '` ` 4 ' 80ܒ T а   ܒ b ` ` 5 'ܒ N ܒ D ܔ  R n`` ` S T'ܒ  ܒ  d`ܒ  Bܒ  p P >b" `$ "@9 @?' ?K ''ДВɐ쀠`T ᤐ~ >a`"''ܐڍ 쀠`.Ԁ &` `  '>d@Ԁ '` `  '`  'd ʰ2 `?*`4`\> 9(`0$` "%>$ `"'>$ `$$ `,$ `0?")$ @۶#$ `4$ `8?"$ @ۭ#$ >b"` 2$ >b$ `2$ >b$ `$$ `,$ `0?$ `4$ `8?k$  7 z` `  u'> 9a@  w  `0㿐    d `d2P> =" P  GUJ UEVV`` @"  P2  <`(  `"+ 4 ``#\#` " %  "4% 4`ƀ  4`>V `֐| 2 "% V  >0p  P $b'`P P" > Q#ITְ   lÐ>b`І@8`  ?@? ? ̐''ВLH$& ?>  #` `0 `  ` `"`%/ `%* TVE ' ' 쀠`WԨ : '` ` > 'FԀ & ` ` B '>d@DԀ '` ` T ' X(> #``0  ۘ %Ԩ  㞖  Ę ` `   'Y ᫘ "԰  ᝘ c 0  `dP  <O>  4` 0ఀ`$` `kT !ఀ`" `> 0#Um$Uk "$E $@ %`(=3` ` ۰``` `O Ұа > r" p"8㿘  4`  ` Pb$    $ (0`` 4   a  4 p P`b$'Lb'PZ'P `` <@ `   > bЪ`@?``@? ?ܐ X2''В䲐쀠`m `"` " " L" " '>0'   m'쀠`*Ԁ`& ` `  '>d Ԁ`'` `  '`2 쀠`f` ` k '" @@$@ @ @9 @"``@@c&`>`+&`$@)m, $@$$  `L`P ` `x$4Y`L ے ` " " "s" 2$$@ې@8  "ݠ P  l Ԡ ' g    [@=   M>d[ ` ` + '  1 F@  Ә *`N ᗖ  FL @&` ߶      @ L> ݐ"X4`"    >S`Đ4`"    >S`Đ㿘  H`3 - " `P`$, ?R`4 `P`$ W ђ  | <8<@A (@`2  4`  "V ,?? <   A "   ", $<<8@At 7 `C" 2`4 4"L ,`4` ֪  쐄` | 2< @8ݒ ے  k    ̀̒ ? 2?2?  2h`P ,2d`P 42``P 2\`P_ 2`4  p`P`$b' 1 ` ) >" @9 @? ?  D''ԠԒ≐ ''Z   'b삒 ؁Ű0 4`D  ``a " I! $a`  `"`a " I $a ` ``*  h< !`"8` 4`";$`    @AĐ $`$`$``> "x    @A$` 4`" $`  h 0$`Ȁ2 4$` $`p P`$$`" 48 (@`& > a4ؘ$  ``"n "f>b` H@B8`''В `40`j2 @2 "` `''ܐԂ Ԁ`'` ` U '`2Y @` ` 0 'Ԃ,@?֠󀥠  > M > a4$``$`$$Ɛ "4``  p ԁ2 @2 " \  #  Ѭ \"2``@$ "$`" `T :@`L :@ P`'L'P`'p 't`c2> `''| 'l 'x ܪ >"! \@a9!''̔ ̐ڟ "|"  `""" t  t pĒ !༔! `L'Ӛ'Ѐ`'` `   '`2쀧 H` `   't t!  I` ` ! '`?Ѐ  "x >> ѐ"`` @ @z'` `@ @  '䀧`P ` ` 2 ' ܀܀ 0` `    ' ?`  x"` (`l'x0@@ @ @ ` @&`8ʬ @ @-5 -%`@&`*`!@x0 @"''Ă`   'x @$@(@@'l@ @ @ `܂ @&`` `@ @  '䀥%'|%@`O`` @ @S T'` `@ @'N`` ` т '`xЀ`@u `@ @ t@ 'P@͠  P $````'''ܐ\  > 9''`(!0l<@8` (Ā4`7]'>```  @ @ 1 '` `@ @ n  V [g L Q ?` } HK` : ?ռ 78` ճ T .` `@ @R  K  ` `@ @  Շ `3`N  , tP@7@ 21 PHΐt4'"   Ƙ  t ڼ ` ܀ 耧 x l" 0@@ @  @! ` &``"`|t   8`P   ڂ ``"`> "}` `P`b  '`4 `  2  a'\ `Ӹ  ` \@E   :*   @  $b˖$  :  'X 'Ȃ$'''?'''>0'$@rȔ c@" `" ;   `2u  @ = `u> \p> @`\쀥) ?5  (`0 8X) 0`(]ӓ2` e     `  ' `  `2@  4  ((0`У0'Ȕ )$@@" c@` ";   @    @b`( @8`(  ! $?@&$g"s=  { @l4$@2  @2   `cD 2  2  2 >b`  @8`   !h'P  >`$" Ț b'@ 9 Ȁ`` <`Hܑ@''ȨȒ`$H_  ?  `0 ``#   Ԛ  ` 4  "M> Đ#M "ؒ 2 @> #Lܔܓ䀠`C֠ ' 'Ԓ ό a 䀣` ` ` % '` `Q` ` 6 '   @{ ?ۨ  H} ` g`$= `> 98>@"" " " `," `0?"$ @͒#$ `4$ `8?"$ @Ē#$ ' 'Ԓ -  䀠`ò & ` ` s '>d@ù '` `  ' y ` 0`?`?`?  # ` `  ?@'P`삒 Q```` ` K '`"w`2'耠`?䀠`3  `0€ @ؒ  ` `  ؒ Ҙ `?̰  p'ؒ ׻ `ؒ ױ lؔw eؒמ ~Pؒ ה 䀠`` ` S T'ؔL yؒ r ؒ T i̠  #9 h' Pb$b` '`PbI -L>b`䆀@ /8` ``0ښ@''ȤȒ$0g  ? "K.> # `0 `K <``Tm@''ȤȒڴ䀠`" Ԟ> @(ap@" Է`Z>`0`r ''Ԕ ͙ E䀡 آ   # ` `  ?@' P삒 ` ` ` - '"2'耤J  ` `䀠`̀ ' ` `  '>d@̀ '` `  '`̶ =2V:&@  I) > 9a0@$>$ $ $ ,$ 0?"$ @Ύ#$ 4$ 8?"U$ @΅#Q$ ` ` u` 'p ` `  '```@H ?M  H> 9a@Ԕ&@ >b̠8 Ӷ ؒ   qؒ  o! ` `  _'ؒ Ԙ eؔך ^ؒ  Pؒ ն 䀠` ` ` S. T'ؔn ؒ Ք w5 N"L?0`@" ؒ ~ Ѐؒ T Ѐ> > >  bЖ$  # `'D'P b $b'`> `` @ 'ĥ(` Ȭܴز@ =` <``L؝@''Ȓ`$&`k ?䀡  "`I.`> #`0D` IÐ䀠`Ү ""  "ҦCA$$ `>0 '` 'ˬ `䀡 ؠ   # ` ` / ?@'P삒 ` ,`` ` A '`2`` ` SH T'` `j`(|Y `2 '耦H ``` `X `䀠`.̀ +` `  '>d<ؠ ̀ '` `  ' Ā2'' +䀠`"`2 ` ` D> # @``&0` `  ' `ӂ@ ʒ `[> 90(` $>$ $ $  ,$  0?"$ @V#$  4$  8?" $ @M#$ Ŕ `` ` P` '`! ` ` W '  @  ? H ͘ g> 9a0`  Ӻ =Հ BLӧ P ӝ ~ ``  ӆ  | ` r ?İ < T ǀ1 ߠ@ > > >  bЖΔ%_`L 2!`` D  #X 㿐  Ӓ  ` G. `P b $ b' ($ $֨`4`! ` '/D )   "W ^h` "K $" $ \Ȓ` ``-.Đ `>b```C @8`8` @?܂`H  ?'@''̤֦̒ $9  ?"$"$ h$ ($   \v @ Q   \x` `>.twDې$9 ' ':  e耠`Ѐ '` `  '`  "= "Fa]? 2 $D$ܔ `P`$"*`4`$ | y`P`$@?p Ā` ` ` ` V '@ ?8 HD # ` ` Ԃ ? @'`ڀ P@"D"`P \ɐ $ `P q耠`Ѐ`$'` `  '`Ѐ`'` `  '`쀧`"  ($ " $2$T$Ё\   )$ b`@8` `` h$ À \L  耠 `Ѐ`$'` `  '`4Ѐ`'` ` L '`=쀧`2 \  $ ܒ l+E8$)"'PP@"`PG z耠`Ѐ`$'` `  '` Ѐ`'` `  '` $  `h$ [  $ ܒ н UDp$ܒ Я Jа G  @ᴔ >耠`Ѐ`'` `  '`ޤЀ`'` ` ǂ '`" ܔ;   [Β`  ($ @g J 'ܔ 'ܔ  ܒ / ܒ % gܔ a'ܔ :ܔؖ ܔϖ Wܒ  JܔѼ ܒ  |ܔѩ tܒ Ϙ iܔі aܒ ϼ VBܒ Ϭ F6ܔr 2=ܒ Ϙ  'ܔZ  а" 㿘 \@ɩ " t.@ 2U8t` 8`4H B@Q.<@  @O,@ɇ@< ,`L` 0`(``@' 2`L@  `@$ * @  @^8^$8@ @X 㿘 \@4 " t.@ 2T8t` 8`4V P@^.<@  @,@@u<  L,`@` %`(`@`2` L@  `$4(  8@8`88`@B @Ǔ8`@ԑ: 88`@B@ "`B @ 8` 8@ü8`8㿘 @ 7  ,` .@   & @ " , `@ȁ   ,@` @   @  㿘%$``l`h@ @.6@ @ (@@+@%$`p @{;0`8@ @   @(@w   @  `(  @  ,?> @0`8@ V@   @(N   8@ &@&@@ 4 (` @ ( @ + @ %$(@ @  ` `2` #P(` .6@ @ (@/@v+@  4 ( @ 㿘 @a>: 80 0` @(@ @ U9 0`c؂@8` @ 8> A(`8`?0@` @@ *@] `@bUc 8 (`8`0@` @* @D  @(`$`,8``8`L@(J 8`/ > > aX|@  @ @"@8Ucث:`A>  >0@(0 @  >@  `8@@(` @B ( @" $(@ FՀ2π > V#H> #`9 @F``@`, `80`@8`@9 U0`@c؃8`[ @``X@``q@   >  *#> #(㿐 ,<@B @=  `8 @3? @ʼn? 0`@8`@=`0`@8`%@ >`>`0`@8`&@$  4| [i&   0[`@IJ `@Ī8" . L@@$ 4  4 H E  L @$ 4  4 H + . L`@ (``@ 4  L`@0 @ 2ZZ0Z@=$Z |=`0`@8`%@ _>`0`@8`&@_ ] ~| n , @\* L* @ 6 @4 @4  L 6  @4  @4  Z Z0㿐'H`H'D @bUD#` '" (`8`@ 8`Ѐ@ (8``8   ' (``= =@"v? ' ccL@?c )   ! e\UaX `d t-`8`@˔ @bUeP*`'`Ԁ`/ @`8` @`@O8` @`@D8`@ @D>` @9`@8`*` 6  @bUj T(`  /`` 8@8`D `EP`$ H-85(@=r@@:850@-@`-8`@S @bUeP X `-' X 'Y* 23 (`8 8@x`` = =@!x 2)```8 T-82@(@=@㿐` ` >@8`  @ 8`BYc. d@ : *D  28*0@*@    ̘ @ HbUԀ@   㿘  0 %@>  $8`4 `"$<> `# > #> X#@>  8`@  < 8`@ 0@9H T>P@ bU ؃* 2`@  ``8@B ``@ `2`* @  ``8@B ``@   `?> #@bU `:  :* 82@(@:@@ `?`ܰ 㿘 ``,Xk@—" =>  H4$ $ 8`$ @$` @bUC"Գ4@ 8@`(@bU"3@ +@(@( 0*$ 0 -``$ dcL@  @̖`L`Ҁ` @ bU"ц@ \͆@ \$ ccL@ `p > m `㿘  P`${@FȰ 㿘  0 %@>  2  8 T>  8@@; C8`4o i@$8`p 9 @  x > H4&&8`& @ĕ8 0@   8@ bU ؅<08`` @ 8 @ 4:@ @v? T > K @bU؃*2@  8@`t@3  (@@B -)@ `($8  >  > ʐ "$< >   `  ` 3> 9> `! `͈;$-@&$$#L @?$ @! @bU@ 88  @ :@ @  `<@bU8lؐ@3 2$ /  8 @&$ 8$#L@ :`c?$  @ !  `&##L@?# `! %\Uaق  d ,@_@bU%P* `Ԁ @5 @1V @EV @&V@; * `5@bUІT-`` ``|Z`p@ܕ9 J  `<  <, 82@(@<@@bUؐ@- @bUؐ@v -`&##L@?# `! %\UaX  d ,@4`8,0@,@@ 8`@!@bUZ*`%P `Ԁ/ @V 8` @M @8` @ @8`@ @9D> @ @8`*`@ `6@ @bUT. ` `i  > !> n!X`o`xT%PX  V* %PXV* T1  > !> F!8x .`L@`'T  } "  H` `> a48%`%`J%```0@bU$8bԃ0`@88`08 @ 2``@ bUbԐ @ߠ "`0`@bU |b@ (  8`@Cj`C ) `@> !X> ܐ!@{< `@bU łbԵ. 6`@`8@`2`0\Ua"Ix `P$2`@bUbԇ6`@ +@@(` ?%` L@= T! < -`"0UH: @ F  %`0. ``\k@`\@'`x8`@F< 4 `t @(`t  `U''@j 8`@T: @8`B?U,8B@6?@N`d* : B +@3`8+0@+@@0  0 H@  x`H c! 2  $ Px!`x@O%`x`\<@T@CL``\6`@N@``%`L@=`Z%`\@>  !x> !㿘 .`P@   " H$h/   `"ༀ`$? ?@@ P$9  `?2P༐8`@>`?@   lp@@߂@ `  `Q*  Ԑ "  > a4 8$$B$@$bU  ؔ@ @: i`&2@`Ą 8 :  @`:  H:= 8 3`@@  C   + (@3` `S $,@6+/  @8`N > "0> 8@@< * 82@(@:@> !> "㿘 .`L@`0@" / " H "z0> a4' ' 8' 0@"T8<@r,`@`4l,``8`h 2ɐ8 @ 38`@Q@@ bU#؅;`0@(@  (@@)8`   @톃@  `;`0@(@  (@@)8`   $"@ ' $L:@ C< *@ !  ,4`p 4@>   @_ `+@bU #؇3` ` `(@(C ) @ +  `+ 3`@ ` `(@(C ) $<` @' $L@c<   @! ,Ї, 4@ 4$(4` 4>`@8`  PF`$ }  " @3c0㿘 .`cL`T@` '@8@ Z`8?@ F8?`B > J  E  @> H4$ $ 8`$ `@P8`T?@2@  bU#؆ 9 @(0@  `8@` `  ` 9 @(0@  `8@`      `8 @@v@ @ bU#؆@ ;`@(0@  8@`" #@`@T   `(4@ 4#@(4` 4`T?@/@ bU#؅? 0@(@ ` (@() $ ?$ $dcL@ >  cHZ    > > `-"> b"@   ,Q @~@{#H `*>``Ŧ P ` 2l`  @@ ``v`   ``  Ԕ > Ð" ` r ` ` `V `X ` L`P@ ` O`P `P 8`P`?` Eg *$ P P`" x v"P   ``*Vpє0cl`" ] ["l`l˂`?`l@  `d`h@ `l `l  $ *$ l  `h  `h~8@ > ?"P> "p㾠'`'d` %$'(',' '$'`s'    ``?@+`` 08@8`f > "   d, `` 00(8(@8@L 2> "` @ `C @" > #`  8  d( ; @ @" Ò  8`::@-`@ !`8@8`@&@  *8(@:2@@Җ-`@ ``0(8(@8@@ހ@ @D@S쀢 @@@=`C  h@S耢 쀡 #@`('8@D8耠`b(`X``@ $['T쀠 ("}@ 0%@ 'TS nT@8`(@ @T> @ `C N*@ @@ C>  @ ?@ + `@I*`@ `9 @ @ > ې#@`@2> `'T'< @< >b,?HHL T`8/`@ TT 'X8`''\' @|  \ d+ @ "'4`8@8`','( 0(,% "8>   d` @ 8@ 8`'d'``8`@"> #``0',8((@,8@'(',  8 ) (@0 9 @'`'d`8`@d@> `P`$"XT   8`(@%`#h;`4#\@PXF`C ?X$0 8T@8`D< 0`#hd#d#\#`@HuX)  0@@Q   `H'88`(@ j!> A"x` T@ `"x``H>  ` /";> A,@! !   d 1`8@8`'' 0d }b`Xe 88`@D`P`$;  d ,4`80@!  d,@!   d ``0'(88(@'@ '`H'<`2@> #p`%"x2T`   T d `8@8`'$'  0 $' ``0'$8((@$8@' '$  YeTb#i`> [#㾠'`'d` %$'(',' '$'`s'    ``?@+`` 08@8` > "   d, `` 00(8(@8@ 2>  ` @ `C @" >   8`  8  d( ; @ @"   8`::@J-`@ !`8@8`@;&@  *8(@:2@@+-`@ ``0(8(@8@@ހ@ @D@QI쀢 @@@=`C  h@Q;耢 쀡 @`p'8耠`^(`X `@$X'T (`@ "z 0%@ 'T  lT@8`p@  @^> @ `C X*@ @@ M>  @ I@ + `@S*`@ `9 @ @ > > ``@2> `'T'<8D@ 8`@ >lb,?HHLT`8T/`T @ ';`'X'\' @{  \ d(@ !'4`8@8`','( 0(, "&>   d` @ 8@ 8`'d'``@"">  ``0',,(88(@'(@ ',  0 8 ) 9 (@'`@`'d@> d> `P`$"XT  8`p@%#h`#\;`4@@MߔXF@?X<. 88`@DT< 0#h#d#\#`@EӘX)  0@@  `H'88`p@b!> A"x` iT `"x` _`zH  /,@! !   d -`8@8`'' 0Ő q] 88`@D`P`$8  d ,4`80@!  d,@!   d ``0'(88(@'@ '`H'<@ 2 0>  `%"x2T  @M T d `8@8`'$'  0 $ ``0'$$(88(@' @ '$  cc tTϐ x`> Ȑ!> Ab| ` `@ [@xd'`\ @ 0@_?`@@  2Z *W ?   2Q ```"  `` " (@ <@@B@}8` @ז d@ d4  2 (  ` -` @`pd )       '`@e  > w!(> :!h `<`'8` 8`'ܐ' @g 2Ԩ ༐8`@ '=?쀐"I8 `  `@C8` d` & d  (@ @"> !1 ( 8 ) 0@m@ > >  cHS  "`` > > `,"> a" -`(j8@4@"b<  @<0?@:  @ d@&䀠@P $>aܬ @  `P$4T `  `8@C8` d`& d v-! ! 84>  <0 a 0H@\@d h 2$90"@8  @  @c> 84~>  <0 a 0H@7@d hh9 > u"8> 8"`08 0@) @2(@ <`|@@'8` @ @q@" $k@ ($f h@ h-580@! d-! > `> 0\a> ! h@f h$?8EP  >  ! > ڐ!ؐ"֐"㿘`%% 0@ C\@?`@  2= @ "`??` `` "o (@ <@@B@8` @ d@ d(?` "> >  cHR   > > `"> " > "> #> ?`  @eh 8@/"1 @Õ8` >륚a܀ . ` $> `@C8` `& =1 ( 8 ) 0@@"!<   @ג> w h@ h2`8 @cs > @ߨ > #('D %< 0@'T'X@>`0`'h'd'l'P'T'H'L '`@\h P`2&@; ;   D P   2 耤 `p@Ly 􀠠D`x'(`@`Ѐg?  'X'\X ` 0`   H*@@D 0TD#\#`Ҙ `? 0   ' d b ." "  `<@x`H `@``P$@D@I \`&'\,@`(G=@ D   T 0D#\ #` + 83@(@;X@*82(@2]@ X  R @O L  D ` `w  F -58-0@-@ `0 - `PD%<%D L 0 @@ D p鹒 0#\TD#` #d#h? `P`$" PD``.@`p  0@D #` #d#h#\@A" PD -`-! ! D``@˔D`.@8`pD`  X`6 @Ȁ  찒 0\2@'Dd`d` B\`@-`p`I`  d` x8` 8@8`'L'HH@ܖ @y  @8` 8  ; B @ @k8` DN8+@ 'h'l D h`l  ˚ ' 0`M \@l`j 0`   ' 0` 0h" 0\.680@"  d." 0a] ؘ k 3`0@++@@'l'h  8) 0(@9@'H'L 0h" 0\D` `D,`@ `p P`D  * ƀ`#` 0  f@`D a8 *'T'P P@*e%D@",  0D p|TD#\ #` `` 0`   ' 0&" < d ! (@! X&@`P`$D` @D#`#h#d#\ @?ҔD`,`@8`pD   20@*@*'P'TP @%D L@@28*0@@u*%D L%<@@ @@`` 0  l@ `<\ 0(`@?x q ?H(`  d\`@,p 0`   ' 0h" 0 @6D$ 0 D 0 dTD<  < @`FD `9 D` d`d` @``P\$`?)` X @ `D` ``P$"\D  @  \0(@80@!  d(@! ``m\D ` @  ΀  rDT@: 02%D `<@`H `@? 0`  ' d  ,," "  `<@g`H `@``P$x 0D 8#`#h#d#\ @>iDx(8D` 'X'\D pTD#` #\#d#h `P`$D` @D#`#d#h#\@>vD@ 8%D9`^DҒT 0D#\ #`8 b`? 0` s ' d ,," " X*&@`P`$`(`@ @D#h#`#d#\@FX`(`@(r=@  `<@Ʋ`H `@ ` H`gX% 0`삒 h&@Xd\`-580@!  P-! > #P`  ' d 9.." "  `<@l`H `@@ 480@"  d,"   Ddd`` ?l 0 Ve480@"  d,]" 680@"  d." Ұ> A#p> >#'D <0@'T'X@>`0`'t 'pP\2 ; ;   DP   2  p@G찒 쀠D (`'@`Xi  'xX?'|  @0p% %` H*8``XZD0TD#\#`  p'@`0 8 'd` +." "  `<@š`H  `@pP$@`D@D,@ x(`#% Φ`D ՘ 0T: D#\#` + 83@(@;V@*82(@2[@ V  P @M J  D ` ` ` D `F?h.@   l86`0@h.@(@ `( @ % `D``<DL0 @@ D (f0: T\D#\#` #d#h^ pP`$"PD.ഀ`@ `(0@D;`#\#`#d#h@<@PD l l! +@! Dp`@D .@ `( \ ! X`"p\  $,OЀ9xtp` ` = :x0 D8`P0 @@ x`|&@`Ttp  ` =.680@" d." `` Ę : | &'|܀ D` apD-``@ `( P`E  * (\`p0 \` E *28*0@*@ @*D@"{ 0D (y: TD#\#` R \`p0  \&06d" <d W" (@" X`.\p P`$D\  D#`#h#d#\ @;?D`-`@ `(`#` 28*0@@*DL<@ @@h\p0 \ `<@:0DL@0(@80@" d(@"  SD'0p  'd A-" "  `<@`H `@p`P$:0D 8#`#h#d#\ @:̔D( XDX `# s'xD (⪖: T\D#`#d #\#h p`P`$`D\` \D< #`#d#h#\@:KD 8[D\`Dp: 0TD #\#`I V\'@`0p  'd ܇,,@" " X\ p, P`$\  \@D#h#`#d#\@B X(``% `<@`H\ `@D<`<` @[ D h @ h $!  \G`(`0@p?   ?H(` Xi`(\`X(0pʘ q\  t|?phl.6`80@! Pl(! > o#p ޚ 'd /.." " K -580@" d-"  Dtp` ` ;N?'|'xFB`680@" d." 4`80@" d,@""  `<@ `H `@Z> #>   Ue\\#\̞@@@'XX`?'D''''''  'ܨ` t ?``@'Ȁ"@<: D0Ԗ8` ' E  0a">`0`> ం` `(`8`C @8`(8`8 0 < 8 " 048> ;:  D ` `"`H`H''Ȁ0  '0`H=<t) @) t `@D ` 2 #@#`t `@ P`$@D' ` `'tܢ?@?@ : >d 耠J H / ܤ@`/ <`@ '` `"8`"(@`d P8/@ ''D#d?#`#\?  2'0D溰@E>#0`Ȁ`D ` v.8 2Qd؀B d @D` ` `27`0@//@@''`D '؀6'm'-'mD' ` `_]' Hd @``0h&`09d @ "8+@ ''@B:`D#`#\#d 2'.3`0@++@@''}{ P'T''''''`9 `4?`<  ` `р 4``P`(8`   Y`&`h!%G``p@+  ` ; ` ``&   "  @U @*&0&4&8&<&H&@&D`P`$" $>T`0`9  I `  `?4ye0r@e<@' ` 8``0`P=@@ O8;; ''= @?`t誣@: c=?: @ e ?` 'Ȅ@? `M) @``:??  H` *@`p*8@瀢`B2 "l ` `5 2  3`e0@ "Le4T#\@?D   5 ` 68`@g@ h`&   `P`$>>a >`0` `8?@:08``&     *@`pЮ=8`p w ` 2* (Ђ `8%! ( ` ` ` `(`?@ 8`>@ > ` ?`?  @W*@:ٔT>`0`   `&   ("`) @ `p `t*( 8y` w>n`0) @ `(`h‘80  ` *@`:@8`Ж` `  8` T>`0` g ???`t @: c@<'? : @ e@? '̀`D, @`Ѐ2`d`&D? `)) @`Ѐ  > {F , ' @-@   #`#d#\/ 2 ' `  ` ``0㾐 Ȭ' ???```-@`p" X`0`8`"`0`"=> " ϐ`T8@8@㇖ ` < 'Z 8W VT2  8`0 ` ``PE "ք8+@ '' 2`0 (`0 `e<eD`L @@` 8`0```PE 8+@ ''  ` 2`0@ (`0``e<eD`L @@*X"`8`"@ X) X8#>    ) `Ь `p  > zU ) (8>   ) `8` ` ` 8@C8``&̰8?@U| ) Xؙ8> z p ` , X8`) @ ` ` ??:T` `P'#\T@?D ?  <  <,84(@<@`P`$"  ` 8` `0@`4``H$ @R `<`02 ` 8`0 ` ``P` E +@3`8+0@+@@   2`0 (`0 `e<eD`L @ @+ 3@(@;@''5`8-0@-@K@h @I h:8`8`, @W `X`0) (e8    U`    E `"H-`@`p ")`D-`@ `p `t` 4`0 ` =``P`(@8`   @ `0  і ̃=  '̮E " (`0 `e<eD`L @ި@-`(8-`@ `(`` 8`) @ `X 8`3`0@++@@']'3`0@++@@'*'8``-`B`2e@` 8 e@e8`L`0 @ 8`C9    @>T`0`4͔  " 2 @ ( >` x 0` ` 㿈 `P`$  & `` `` ` ۀ` @8 $  ` ʀ` ` `D `` ` ̀ 8 , ( `   `@ ` @> ``"  `  8 4 0 `  H  & \FaT"m, @ 8`@? @8`B8,@D @x@ `d*D 5+@0Z ;`P`$B  `  P`> =x@b  `H*  6>`P`$@7W 03`80@++@@! "`Pn0=`4  p0 t0@1w ` @'  `H* !6ƀ' ` `9 + @* # F ` 8  $V  J  `D '0  `  % ` w 㿘 8> A/`b@.``-(`> > aX| ?`0@` @@>`" / @ @ @& () @2@&8(@) ܴ 8 "  * @ ``?2@ @  * `?*2@ @  +` (@ `?*2@ @  +` (@ `? 8   **@ 2@ @ *)*@*2@ @  ((@)*@ *2@ @  ((@)*@  8   ?*@ *2@ @ *@*@*2@ @  ((@@*@ *2@ @  ((@@*@  8```* @ `?2@ @ 8@``*2@ @  +`(@ `?*2@ @  +`(@ `?㿀 < > 8c9 D@9 C "  0h2     3C 2  ` `@" <  怤 "  4 &9 @ 9 @ > _   <@9 9 @D#\> ;`u!> vO!@2 ( > @8 ك9 㿐  P  < "< 0' 0i HQ `<%<H@&',86(@< @ 5`  ` 6 `` D +@3`8+0@+@@  2 0 ( 0 `%<%D L' 0@@# p8 0 ` `'$<Tl҄ҜҴ,D\tӌӤӼ%\UaFaT" 0  0@g h 8`(`> A@ 㿘  @* &  %L& %,`$ 0$`>$` @&$  &%P%,`4$ 0 t*8 *$:?< @n>%0@ D@h>%0@  D @`>%0 H L88&%8$@8B9 >%0&%@&%<`&%D&$㿘%\Ua*N   $`0 (   #e#c\9 ?` ` #d0#d8? >#d@#dH>>`#c#c> ;;c#d#d+`#d4#d<#dD#dL#c#c#d#d %\FaT"$4##$$ " " " " ā"   2@"` ` ഐ `P"` `l"``   `(` ->\  > B>*b( p  > B>*b( t  > A>*b("|  > A>*b("x  >>*b(   > B>*b( >bܐ >!b >b  >!b >` >!b >a >!b >a >!b >b̐ >!b >bА >!b >` >!b >bȐ >!b >` >!b   >>*b( x  >>*b(!\>aX >!b 㿐> `      !> 7>#( $#\> lc    #\>> #`lc!   >> "cl#\@@Q㿘  `4`@J? PcL`8 +@    H2̔`.`8@1@`0`44А%dH`d@ =`@  83`0@++@@ t  H2`- `8@Զ"`T`T`d ` * c8@ 8``h O > ,`4`h$d48`$d0 H2ueL He,`$%H!`9%0`^cc) 0 8 9 (@Ժ@!%P 2¶0%8%H 2 㿘"` ``,4S`  F@P㿐'D"> A>b$> > A'L`@B~L D `0T  %i   i l%`   `%`%`%` %`@B&%` " ВaL @ @༤8`@; @8`B3,@D @x@`d* D +@3`8+0@+@@0O c` ` j >i#`%`x@]* `H @19`P$N`P`%`D> A> AcP@Rఒ ` ` 0``P`?`" \]` *$ P` ` I`P`"C @ `P$2\``%`\FaT"',L `lӂ`?9L @!D>i&"%`x@* `H!@0ѐ0`` p` t Pl`"   l` *$ l㿀" MЀ`MҀ`L''''쀦`# `䀠/>`?a@` /` .W 2 . @JMЀ` $@" @#ʔ 2`" '''' > q[!X> r 㿘 4` ``2` l` `  "`  ``.  2&@` .ư 㿘"`F\aT Ua"4> q 4 &`0&`@>`8@ۑ8`@B>`<@@ґ8` @, d@ d>` ,2? >`(>`8>`0㿘 $" V`   ` @K``2 B ".ʒ`` -.9 㿘" $6``J @#N AN`Ҁ`2 e`` ).`Ѱ "cH "cH.`с  | ` .`    ?>N` @?? `,Ғ`[ cL   `$$b($`$w㿀 |` '?'`'  t > c\ .C`    - `$`'@?? `,r` > 'cئF%@aT 7' 2U@N`<0@$0d'5 @8` 8` H\@ܐ @@@ | ` >-`쀠@? `,/`-Q ` `K H &b ٰ Lт,Ѐ$耠``$> o 0L耠  !hh | %`\FaT %` ``H/ hhc0h 0'`Lр``$4,Ғ@S?$`,(` C $L C8  .`H'8@$6$@040ې%Hd@ <`+@@  3`8+0@+@@C ԦL F| >   o/ O<|$$,$P`  ( @,4$&b&``"`` `"\` &``$ &`o(&`(&`$%`%@%`t%`$d%`(8%`%`,%`| `耠"Q,$HԔ!Ӓ- `!Ԓ "@0> =a`a0@40(8`0`(@@8<0"!4- ,,`$#$@  İ `&` %` @ဥ<0>   Xn | r $H$@ ڔ 2L  H |㿀 $'`7 `,z`   + + `< 8 0@(0 8 @\ f H[  LP h$cL$cP,`Ґ-hc0h 0(%(X04@? 5L8   `H-l8@@&@@04/'@Hd@ <`+@@  3`8+0@+@@ E`"$$',P`  '$ , @''''> c> n @ $㿐 <`2``0   ``  c 2X> @ @%8`@e @8`B/,@D @x@` `d* D !+@0 @`x@* `H @,qP`%E03`80@++@@Z "@0n!( l+ ) $`@@a " L`Ҁ  e`: $ L`Ҁ` & $e"+ $ "4 $ & $  `  $`& $e@@?k`@ $ (& $ր L`Ҁ`Ҁ (& $2G4 $P`"r   Z Y* Z I @ &,?&(&&0&&| "  44`"| F񀦠> ]`H[    ae  sL`р`2 e $`> l 0e`" `, `@  2X`,  E $cH D 2K`H@ $D HҀ@(( $` ؒ 00Œ " $ $*C` `   ?!( ) 2 $@* @M`|| @Fn *` !`(u ) "L`>   Xl0  Y) Z  @$@ ! Y@ $@'@ 7!t+T l ` 0w`q 2(! Y@' Z"@ xpH`` 9(mi 㿐> ca>`0!> $  D`  > > lb#> <c\ 1> k!  834 3> a$ @  `a$&  ! " ` Y ) P 0@Y$4> > ̐!H` c\ c\#a$`  Ւ  c\㿘  @;M  `"  ` " >>a#`>a $& a">a $& 㿘3ف`'D ' `'䀠`` % `4`` `2> kې!䀈> ` 0@@ " 4* "  @܁ `` n'`?'@ +(`(''`<0@ P6`D#\`  G< `` @ `    < < , 84@(@<@@܀ W0@"@4H! 쀠0@> Bt` ``̀ % `耡 D `"S``"Os0`耠F܀ "`䀈2`'`"``$` 2v`2 ` 80 ` _`P` E +@3`8+0@+@@   20 (0 p`<DL @@`@? ߒ` g< 28` ` *`ܒ@ޔ` Q' `   H'x t  `H@X1```8`䀈`  ` b`?` ` `SX`@ ```M` M  +@ ` 8`'`耠@V쀠2;P`$"J`>>a$C``>ܖ &m 9`D@ ``#@`?`''`jM!`d`?``0l`   > j5!P㿐 ` ` 4``> ` e0r"l ` '"PJ: `0e<@ %* <  p k "m``` D+@3`8+0@+@@8G`(A ]<`( @% T  H LZ'"J ` ` 4`` ` 5`P 2:* 82@(@:@e4( `(D@`,@ ``` ` 4`P ` "P P `$"```$`8`P ``P`( `2D` ``2=` > i[!`$`` `h> .` > iL!iJ!㿘 4`" | Ho4(@e l?/c> > `?a  ;W0@ 0 l 0J`( @  " 0@$ 0`< 0@  0`g"  `&` `  ` 0@"硐 0@$ 0Hp@$9 聐Ho4 l(@e l`Ȁ21 l `G  Hp@@b Ho4 l(@e l*! `ސ w > h!``"X `$"S  @ N  4`>  !Hp@   ` `?  0` Dt /.D-.x.x..x----.x555P55655P5P5P5P5\<[Y[lZZP\YYYY\jjhjjjjjjtjdjTjDj8iii|fihiTiDi4i$iihhhfP4pP`@4tX@@@@DXD?" " " "" 㿘>` (("@ ">2 @8`@>>`쀢 >̰ ` ́P> c<' `4 .`(Є Є@ς (2( > Ѐ cX(> B`x@ #\> "> ƀb( `  (`> > ƀ  > #   > ƀ"0 0 ,   ;`#\> ƀ"0 $   > ƀ#0 > ƀ#H0 ( H   0 4 @ D#t#\ #`#d#h#l#p> ƀ#P0  > ƀ#0 8 ( ,   #\#`#d#h> ƀ#0  $   #\> ƀ 0  , (   #\#`#d#h#l> ƀ @0    > ƀ 0   > ƀ 0  > ƀ 0{   > ƀ 0t9#`㿘> ƀ!  0  > >hb!㿘 0d2 > g!H 4`P > f!x㿘 b>b 6  `,`2`H! ` ` `3` ` `" `H``` `2` ` `3` ` `2`H  ڂ > B`Hp@`> > !fb1> e!㿘V `) >?6 Ԁ>@&@  @& > ` & & >>` > f"㿘> 7cP > $@(>`  (`6 0 ?6 `8&`8 `&`8`8&  2       @?& &  D`&  D ! D  D& `㿘` > 7Ho-(@%> B$> 7cP > #@'cp p`> %> Bb@ p D`& D ._ $ p`2 D` > B`Hp@e%> B㿘&`  @ .: &@Hp@ >`0``4  " @Hp@  . 㿘 +> 7cP > #@'c 0``> 3> BbP#@ 0@& 0` - &` 0` 0` jΰ  㿐Ho$4>(@e>b> B`= >> Bb ( ` * "' (`" "Hp@ `  `!~  '   ΃("Hp@> L"X> G"p   h㿘>`!>"` + "`> B``1>56" 51"㿐 b/b  6 @x`H*  ` D > 0?? `"#   4? 9 > B`Hp@> e " ` O  !& #9!!@ # (`@`Ѐ"7@ > B`Hp@ #\#`> > B#`dݒc@> B* ݂* @`p"4@ > B`Hp@ #\#`> > #dc@> B ``1    (@ @ D   4 0(`@ ` ` 2 2> B {`  (+`@8`p 4 02<    -ဦ 0`D @u>`@ր @Z`* `p h @`?$@ ? %: &`&`2 (` Ӏ (@J8`< @B>`  ( `p@  <@ `6> B!!   `   ``Ԁ""`Ѓ)@0> B"`"`Ԇ`}  (`@ 8w `> B`Hp@ > d#> d"`Hp@> c#> c"`Hp@> c#㿘 b3b  6 @6x`H*  ` D f> 0   `"7   4a [ > B`Hp@> c" `!> B Hp@ O  & Ho4$ (@e$  !ؔ  @ 1 $(`@`X > B `"> B`1    (@ @ D   4 0,(`@ `X 2 > BԖ* ς* $@`( " > B`Hp@ > >  xcMc@w`  ,+`@ `( 4 02<    -Ā 0`D @.>`@ @V`* `($ @`$@? #̒: &` &`2 ,` Ӏ ,@8`< @B>`  ( `(@` <@`I> B ` `  `X`""`X(@M> B"`X`d  ,` @ 8^ ``Hp@ > b#`Hp@ > > B bc@> B`Hp@> b `Hp@> b > B`Hp@> b H`Hp@> b#P`o ,'''''''''''''''耠`^'  /`HL$ @9 C?@8`C? @8`C?8`@C?"   $ ,``E .@88` @8`B"-@d@ : +@D  3`8+0@+@@T-`  @  㿘 @. `8`T?>  8@@; C9 4&>  @> Xq!Ђ 2   `? `(2  " $ P"  : " "  `p((>> aΐ!㿘 >XL"  " : : 2  2 0& (㿘> 7cP > $@#oa 2  !> B !> B `2 Hp@ >X  2 " " " " " 2 Ho(@$  ?@2  `" `&  " e$  ?@2  `"& p?\   `t"?Ho!> B(@e!> B$  ` '  ` "{  H> a-! H `0`Y @ ` =  H'`0`t'촄? +8` !ǐ, , @ ''ܢ8`"2$`d`0ə@' 耠2 0@" 0k  H ' ,@4`8,0@,@@ܚ#\<C] 2'`0a?)0   @?  Ho$#(@>`  `  Hp@> ` Hp@o e> H> `x!8X 'x'l  ' $' | `  ?+'В '̔ '>U!Ё㿐> ` d82 : * * @[>> `> `> > > c  > > ` >>#> 'b cP @ , 8>  `@5 N >p>  bؖ >> ѐ" bb O >a >  b >> " lbp P  @>R> a >> ѐ c >>".'`x H   !> 7>#("#\> XBaX X#\   >>  $X8ah (#\   >> "X.ax #\   >>  X$a P#\   >> ! Xa #\   >>  Xa @#\   >> "Xa (#\   >> !WaȒ #\   >> !HWaؒ #\   >> "Wa #\   >> !Wޚa #\   >> #TWԚb #\   >> #Wʚb>#\#>  b   W 㿘  >`0` 4?> _T"0`&&&,?& 㿘>>c> %>@@(`@2@2@2@2'  "> U"" : " `" `&& '' 㿘> 7cP> $ @ a8 >Pb >؃> +>@ %> B@@b(`@@N I@2 @2 $@2 @2 '  8(`0`` >UB" " " : 2 " (" D" ," 0" 4" 8" <" @Ho4$(@e$@`& @ &@&b8 ' φHo4 ం(@e ' 㿐 1 *> Ho(@7> B&$ $ 􀠠 ` `  "  ఃHp@e^L"H㿘``@> Ho$5(@> B"  ` ! ? @ ` @` @ ` #@ 2ఃHp@`  ` `&` e> B^"p㿘2  Ho?(@> B ` - >` (`0` (`Z> B0> Ѐ cX(> B`x@> ]ߐ"@ `2 D`   D``  2  > B`Hp@e> B `耦` 逦` `2  2 ߀ `,` ` Հ` `2 2`Hp@ (`㿘  "k> Ho$K(@)> B%  l :> #%> 7c6`P`  @- 0`2` 0`C  `"```2頔` o Hp@Ho4% (@e%  l`P` Hp@e)> B  Hp@H> ]#]"㿐Ho'> B(@e'> B$  `Pe8>8  =&  @@>`* @`, :D "7D @2 & < @Ԓ @"     *  @?& & `,&  ,  `,,& `ఃHp@2@2  㿘> 7cP > $@\`X ` ` " 8`X>  ,      @??& &  &   !  & 23    H (`;@    ? @ (& & Ho>(@e>`& ` & Hp@ H (`!\8#(㿘 0 > Hon(@%> B$ ,>`H'>FaT/-> ` H > Ѐ UcX> \ #(` e\̒`2 Hp@`2  a>  `FHp@ < S $ Ho"(@$  `4  Hp <  H`Hk <`2 e%> B(> B`x@> [#e$  `4  HL <  H`HG <ݠ`  0@" 0 4    ? @$ ?$Ho4(@`$ `$$ Hp@%Hp@Ho(@$`2K j{`2D ce$e[N#X[L#8  b '| ` X'''T' Ho>(@e>`& ` & Hp@>  #0㿘> 7cP > $@В` @Z>   (0 `0/(0`` 3`    ? @& & Ho(@>`& ` & Hp@e>`0 (0`` 2 `2   @?  D`  D ! D D `Z#㽰 '' `'0'8 '$|` ', ` 8`$`  , `'   ? t` 8`B ?@@B? 0'8`   شࠀ2a d  " ` 4 0$` i` P`(@8` =  7@  0  < @'ݤ (􀠀> !Y{ ^Ho>(@e>`& ` & Hp@( 0 ;`%<%D L @@4`,@  -`@#\`¤ 0@'`80,@-`@,@#\`` > !А H0 ,K `p A8` (``0`` ` " 8 ` <` @` D` L` ` `    ? @" " Ho>(@e>`" ` " Hp@>  㿘> 7cP > $@A` ` 8`" < `2  @`2  D`2  L`2  `  $6  ( ( (? @V & (& $& ,  " O& q  > B`Hp@> !Y: h?(6     @&& 㿐   >`0` `HoJ(@#> B$`   @K ` `@A 0  `$  P`@ P` @ `Hp@ > Ho>(@e>`& ` & Hp@e#> B0  `$  P`@ P` @ `Hp@ `   g `HoL(@$` 6  &   @#> B 3`  .` ?@6 @&@ ` @`@& `Hp@  `$  ` @ > !T Hp@p,e$` 6  &   @#> B `0> !1!( H> !X5 `H> !X+ > !X(!㿘Ho%>(@e%>#> B Y$``2   @&` " T "   E` ` "  ?(4    ? @$$ >R>` Hp@ (`0`"2  %  0` @`?(0`> Ѐ cX> !> !!PWax`Hp@ (> B`x@ @b`?@`? @'`?2 `2 㿘>`0>`J ,F>`@ >b@ ,H`@$`  > B`Hp@ 9  6 H`($>܀``+ ܃Ho(@> B `    T `" > !> B`Hp@> !W&!e> B `  > > "` !">>a `#> BHo#> B(@e#> B$`1>"> `$&"`" (> ! *"$``&"Hp@ > >!Ă` !!>>a > B``&`&ƒ `㿘> 7cP > $@a(>>` > 9>@'> B@ (`@)>+> l@2 @2 @2 & %` 쀠@` ~ Ho4 ం(@e   ɺ &   `>$ L $ ?2  ? D: 0 L" " " " " ," 8" @" <" D" L2 " H" PHo(@$@`$ @ $@$  l &e$ఝ㿐'Ho4>(@ e>` +> B`%`>> Bb   ""('􀠀 ` "> a$a$@  `$@"@b`"@@ 2`$x 􀤀  & "?A> !> !aȨ9`  "`Hp@`` A' ` Ȗ *q Ho4(@e%``Hp@ `  0Hp@ > !t!l> 0㿈> 7cP'D'H'L>`0`> # @/cLHbo  `/> B` vఃHp@H` Z  `R / ` I & Ho(@e%ఒ s ' 2ఀ"` 2: ఃHp@ $HoL(@eL%@" 2 /> BHo$Ԃ(@%ఁ` `   `2!, 'ఃHp@ Ho4%ం(@e%L@2ǬఃHp@`` @n`8`@{ ``@`8`Ba,@D @`x@W````d*D +@3`8+0@+@@`0Ø찒 vڼ찒 HoL(@eL%@wHp@> !Th"`ఃHp@D   `  bHoL(@eL> B `@2K ` ` Hp@> !T8!Hp@0#> Bd찒 Z03^: 0*e%ఁ- /> B0Ԝ0అH> !T"@Hp@> !S" 㿐> 7cP> # @c '> BఃHp@Ho4$ం(@e$ఐ  b`D 2 `L  `2  @ ( 2 `L 2   `2  @ʐ   2 " ఃHp@ !Ho4$ం(@e$0   Ho4$ం(@e$ఁ㿘 ~ 2 | P`$ Ho(@+> B%` `M` $>`Hp@`` `$e+> B%` `,` `> `xԒ  l 8 `"Q` (``H> Ѐ cX(> B`x@> !R"  "`Hp@ Ho4%`(@e%` 2  "  `2  8 `"7@2 ߐ`Hp@VHo (@e %``2wHp@Ho4%`(@e%`v  쯐 "`Hp@`L JHo4%`(@e%`t "`Hp@ ``  ,`,` Ԕ, "``Hp@ `2v8֐0Ӱ  l`ఃHp@ E  |` c  | ` ` 㿈 >` `0`Ho%> B(@e%> B$` *  Hp@ @`<`" DH> !QӐ"`L`8"`  "` $````  ` 0` `8aHp@ U ``Δ t`  `    e` h2X 0ָ찒 k! 0"`<׭ ]Ho4$(@e$`  =82 8 0 ` : ` P F +@3`8+0@+@@   2 0@ ( 0 " `%<%D L @@`  2 :Hp@ `` ќ0H> Ѐ cX(> B`x@> !P"H> !P"㿐 P`& Ho!> B(@e!> B$        @&  Hp@㿐@?Ho3> B(@e3> B&`    P`@ P` @ `Hp@`H> !P#㿐  >G" " 2 " 2  "  P" Ho5> B(@e5> B&      ?@6 @&@ ` @`@& Hp@Hp@㿐Ho!> B(@e!> B$ `  r   `, {0   `$ `$ ( "  ( Hp@ H> !P#8㿈>'D`0`Ho> 7(@e> 7P!> B`$ > $ @aH%> A>>`>>cT>>aȨ>>aH>>b   ? @!!  Hp@ ` *`> !OĐ#`@EKHo(@e $  Hp@> bD>`- +>aĀ`)>"`f7>⬀` D>`?>>c9>D^ #``2?aĀ`#>"`#>B  @0``2?Ho> 7(@e> 7P`$ > $ @aH`"a@` `? @"@"` Hp@` (8(sD0wD0sD0oD0kD0gD0cD0_D0[>D! 0V>D 0Q>D $0L>D"0GDHo(@e`$  H⬀`4bDD`]>Dj0>Df#T0>Db!0>D^"0>DZ!H0>DV!0>DR"0>DN 0>DJ! 0>DF 0>DB $0>D>"0b>"$b 03la>"$a &"">"%" 0Wa>"%aܒ )>c>㰄 c 㰀W>`?` 㿘'>#>`c> !cc` $c c㬂$c?$&@b `)C @@ z&@ ` G   c`$ 㿐 k   ` ?  " 0㿐> 7cP > $@ƒ` ?(6    ? @ & &    @ & z&    b  k `0J>cPn>c ;0 @ (6   0 ! ? @    @  Ho4(@e`  `" Hp@  0`,> BHo(@>`& ` & Hp@e>  `  ` > B`Hp@> !M_#㿘> 7cP > #@c b} (6 ! ? @    (2  h"M D   D `,`"3` ` ` => !*   `5 `H``!` `3` ` `  ` ` ` @?#` #` D`#`  D` & D #` ʂ " `0`?>w > !L#؀   D   h     ? @& & Ho>(@e>`& ` & Hp@ ` > !L#㿐>!>`"0@8`@ " `>$"C#@ (`2  2  P" " 'Hog(@!> B$ ` ``Pe<;@8 @ w ? @0 `􀠠 @` `$` `>& @xU *  , 2 !`D "`D @2  D  3"   ' 2 "  `/6   @"    @"  2 e!> B {"> "L  H > "L  0H> "L 㿐` `e< >B{!Ȅ  4 $ $ 4 = h  `2 `X$ `   ")  ` ` "<`@wŒ * ,`$ ,  , `,?$ 4  <`$ < `! <`<$  `4  D$  D ' D  D?$ 4  8`$ 8 `! 8`8$ > B`Hp@`"  $   `  $ 4 㿐Ƙ ` (`" (  ( > B`(" Hp@ (` (`  ( ( `> B" Hp@㿘> 7cP > $@ `  w4 (``6 D D  ,`E2,T >`!    ? @$ $ Ho3(@>`$ ` $ Hp@Ho4(@e>`& ` & Hp@>T e>`$ 㿘> 7cP > $@ `` `2 ` `8`< <`<? @&`8&`<` ~` `? @` &`&` @?(6` ` ` @&@&``H [? @2 `D`H<` `D`H`< `H`D <`D`H`< `L &? (2    ? @" ?"`L`;3? @2 `D<`"`D`< `D <`D`<" Ho(@>`&@ ` &`Hp@e>`L0& ` > "J* P㿘> 7cP > $@ `x ` ` " @`,> " D  D `00"`"  24  ` D` `  . 2 I x㿈> 7cP > $@ `8 bA} 6 %\FaT$ x @u( `H * `$ `X! q O& `0`>= `  x @u `H *  ` D6 v  ` > ".@*@`Ѐ  8` ``U1 `  `` `2  .(@ XB`2> " $# X  ( Җ( (@`p @ ;`#\> " !> "> "a IT@2;` 8`p* ҆* (@(8` " @ #\#` > "  2#\ $#(`0` >Ȃ`  0j`"l  @"7 < ?? > 0Ƞ D >c  < \` @2    ? @ "" (0` > Ѐ cX(> B`x@> "H" @2< ??> 00ȃ(`@ `2 ` ` 2 <$ < <  <H <`= <> "H `> "H!Ѐ@" : @"̈́?: ؐ %> " 0> "#\ !> "> "a Hp> "H !P 2ۤ  D`դ > "H!H"P㿐 0d 0h>%>'c4)?;> `` @@4` ` `? @`$@(0  $`0> Ѐ`  X> "HU"ȃ) ` $   ! ? @  `2`"+` 8` @ 0 "`  H. <` 6 S` `$` `4` ې`2 ` 4` 􀠠$@ `'$` 0`bЂ`'b ` `44`  eb$@c$) > B`x@> "GH"> "GE"GC"㿐> 7cP > $@``( "`,> B`Hp@ `(` > "#\#`G"$> B`40> B``4> B`"2`(4H>`( 0&`4`H&`H&HL"" ?( 0 ! ? @ ? L`? @0 `L `L `&`L`L  ` ((> B(,2L`H> "Fϐ#8㿘> 7cP > #@c L D D"& "#  4 "N  P    @?$ $ $   /" L 2` 0$` ` @?"` "` H"` H @ L`& H` `` & P`` @?"` "` H"` H @ L`& H 2 L+ L(  & P 㿐Ho!> B(@e!> B$     2  Hp@  P`y> "P`  q  0 R ` ?2 `􀠠 @` `&` `M D`" @ @' ?c @ 0   @ ? 0 ? `< `<  <`<  @2  `   , Hp@ ` > "Eΐ#Hp@EĐ#`H> "E# "> "ޣ#㿈>'XdX! h<* `" 0  : : : (" 4" L2 2 Ͷ㇔&H  A쀢 > #Ho{(@;> B'`   &D "  $` &@ "    ?  `  ``&8`8 <#``&<"   ? > `" @:쀦? &@6 & p&`P` "&  @6LLP`@&H @"A& & @."@2+`ʒ'`e;> B'`   6&D 2 $ &@`6 "n & P &P @"P @"[ `Hp@@: 2`H> #Dʐ @58" H'`  <@@`? 屘 ? @0  @ &p `( jP &P "P`Hp@@2`E`@8^L& H> #Du h> #Dr 8Dp 㿈'H` >P'T >.86(@>@<>@!:ޒ \" T " 2  2 @ '쀠 : ` !> `0#T4 :Ò   4` #T$`  :4` 2 " $`2 Ho‚(@!>#P> B `$`#P` $#P`` ?$`$@4` '``$`> B`Hp@Ho(@> B `H 4  4 Ho>(@e>`$ `$ Hp@H ՘ ? @0  􀠠 @   & `? $@o * ,`$ ,  `,T`,$ ` ` `  ?@4 `<$`< `"`<`<$쀠`a> B `Hp@8n e> B `H 쩖 "x e=!>` ` ` j#P$  > cP?$4 `<`$`< `"`<`<m$@> B h0  % ?5  L`% L `! L L%> B`Hp@  `4 Ho(@> BA `e> B9 ` 2@` Ʈ @2 > 9# 2 2 xi2@` j> B@> B` 'HHo(@>`% ` %Hp@> B`Hp@ e> `P > B @"m H> #B > #B 㿘> 7cP > $@]` ( 0 4 4 4? @ & 0& 4(`&:    ? @ (& & `7? @2 `<"`< `&`<`<" Ho>(@e>`& ` & Hp@?( 6  !  ? @&& ێ0՝㿘>)>ad+?`<" ) `(`> B`Hp@ > Ѐ RcX> #B!w  a a  4 k   `& > B`Hp@> #A!@> B`Hp@ > Ѐ cX(> B`x@> #A!  `, " ``, `` ,`(> B`x@> #Aː! D "  ( D  ( "%     ? @" "  `e" ` ` ` ` @2 `<"`< `&`<"  ( 2  h#`<2}> Bz> B` 2 @2 @ 0 ! ?  ?  4    ? @ $ $    @$ $ HoB(@"`$" `%"$ Hp@ ڗ ( A> B <> BH H < @4     @  ??$$ @4  $ ` !  `$ e"`Hp@> #A !h> B`Hp@> #@!㿐@ > 7x!H   2 2  ` ` &`,&`  &`P&` `m `>` >` `m `&`( ) @`p:0 ` ) @ `p `t    `2  ) (8:0 ` ) @ `(     `)  @`:` `)  @ ` `Ԉ  ` ` * ` ` ` ) ` ` @k: 8`@gx @8`B+,@D @kx@k! `d*D +@0œ  ` x@k  `H!* Ho(@%> B$  t bߨ`?` @6`  <&@ < `" < <&`X D`  DW D` DHp@ Ho(@$ٽ  l +'$+ 30@ 0Hp@wHo4$(@e$ l '  2    [  ` `6` ` ` jHp@ C ) @ `X ) X803`80@++@@ۘ "K > #؋"  ` Fx@j  `H * ǐHo4G%> B(@e@%> Beuː `>` >` ` `h `p `h `  ` ` بH> #?O"@> #?L!㿈 `> #?D"h>+>b   )> B  0'>'Ho4% (@e%  2 `2 Hp@`} ` Ę "> #Ho(@e%  `"  $` &8 "    ?  `  ``&0` `4#``&4   ? @ ` @4X &,` "&  @ @" 2&  ` `$``&` `"y`` H (`;@ Hp@ "&```Ho4b(@eb`$b `%b>b$Hp@$`w> 4  `$`  2 2  `B  $ @.$   < ƚ $  H < H0 @ G  ( (&(> " ( ``& $``&` `2``H$(`! @2   ߚ `  2 ? 4  $ `& $ &8`+6  @  H> #="F ="㿘  Ho> B(@e> B  ?@2  " `&  " ఃHp@~㿐'X`XhHo5> B(@e5> B& <@@`? 5?` @7`  '@ `'  '`Hp@A ނ ߀ ? @0  􀠠 @   '  `> #=k" -@㿘j ``@  0@!taD t t| "@ $"  "`L Ҁ@? x` 2 L Ҁ`A $2, ҁ > BĴ  !>  `4  `??c @ *`ㄒ E  .` $  $ `" " " 4" "  " "?$ 0Ŵ` Ԑ! !Ԕ"@Ȑ ~ Z|! Y  Z"@!tn t0> $<Đ!h㿘" `+> B > $a/Ho4`(@e`?(W XHp@?[F`o  "  `,1-   "?`,?뵐 ?(@8H`$ 렐 ҒҐ $`Hp@@@'0  㿘> $<@!㿘`4 > $<4!㿘> $`  ;c!㿘 . Ұ $ 㿘 `(> $  ð <"㿘` `<+` #  &`< `0 " `H`Hd&`4`4`"&`@`0d&`0Ho$(@eHp@M&`4㿐> D`0 `؄ &> $ <`"!> $   4 @Ho4 (@e & X" Hp@ ;"H0㿘$`Hp@rHo4`(@e` 2 XHp@    g ``> $:"`?J$`㿐 P b'` F 8 >  > $;S"> $> @b v`$ B?yt@@b;@eQ     ~??@c@>& C @ @C&> ]'􀥀e '`$ @al @ae@a >E&& 8@a@ `'d22`$@2`$ ' @@ e @aߒ @ `  `$ (窥@    ր " > $:" 'F?> $Ā @`?'D PD'P'' \`"`> $:"耠`? `` &@ 8@eC@? 2`2D '@ ' ` " (`@`И? `'>  `L @  '  8D ƚ  0a%"m> $( ć--@" " 0 @&0`(`8@`C ?`(?`86>0`7 I ` WH )  8?` ' DY "(( 8-@ ''???P8@c> $9" ` ,ം@`p( +@3`8+0@+@@P8P??8@u0H ( ?` 8$2?@?@,,@@@2?`@?( &@D $2?@}?z?H,@ @@ o``@ l?⦄5`80@" (-@:" ^?`[  8$2R?@O?@ J,@,C?(>?;?H,@@ 1`&@D $2'?瀠@`ID 32@` .@ : D2`` 3`E @- ` "!അ,`*pp,@@`` &@5`0@--@@'',`@*`((9 ߅8`അ,(8 (Xz8m'8ݐ#㿐  " ` !     #\  㿘'D a * @DH* @D@d`a ~ @ `  ? @&? ?㿘 >`(``?(! `@` @>`(``(" ` >`(``(2 ?  `&   >`(``(? `> > $> $ c@h8# 㿘 >`0`@8` - $*>   `C C80`@8`@(  `C C *@`(" $*@`(& `(" `(> > $> $ c@8F#z  @ `C C@ 2@ `(?@ `(㿘>aP1>.& |> > $> $ c@8$5㿐> 7c( #\  !>$ |> 0#a |(̒" >@3!@> '> aPaP `> a\*> `x㿘7>@?@->9>X!\@T/>P H>P`|@@. `"P> !@`D$!@!H;!L L!L @? $!H$!L  $!D$ $ @ @`  , @- ,   @X!\,` ,`@@ %X P @@Ͱ?&!H @Đ@@?> $> $ c@7#㿘 `E1>@̐!@@ʐaD`21aH@@!@` !P`` > `|, ,` @` ʒ `ǒ `` (` P(`@ʽ !@@$>X @ X@z!@" aLaL LaL? @$aH$aL> aTaH㿘 @ ` $(` 8     $ $?(!4" $!4@K@I@C> > $> % c@7 "㿘 >@P `4 $(` @D>   (80`@8`$``  ` : (` (``6  `? @ P@@D `$   `? @ ;@> $> % c@06"b㿘  !?@ `!  $`2  `0`?<@ (` @?@㿘   n    ` : (` (@> %6 x> > $> % c@X6T#㿘 $@ `  $(` @@4 `> > $> % c@69"` : (` *  @[@W㿘 @j ` $(` @``B` @3@/x> > $> % c@05"㿘>aLV R@5 `Y >$ 0`@8` @ > %5 !@ A?> %@`" F   ! @"/> %(`+<0`@8` C8 C D (@2> %5S!) @`("> %@> %5F!@5@!8> %5=!`5;!㿘 C@ǐ `9 $+ @@a 8`0880`@8` &% !4 ?$!4  @"> %` `@ 2  `( ! 2$ $@r`$!4@m> %4"0> %4"> > $> % c@5,"㿐 `4@p` `h`80`@8`C(@`(?(`,@? ``C(@5?` @> `@ > $> % c@X4!?@ , `<`  K`"``!'"8>`! @0``8> %$@@&@/?` ``!'  ! `"҄`ְ?2"4B"㿐 'XH`!>@ɐ!@@ǐ `H @!@D` ?L!!LL $H!H$L$HH L!H!!H$L@!@ `@`?Â` ?`P@8'8:8`; < " ` 9 (`@ (? ?<`$8(`@ `(?Q?"@@H &> % ` N `< 8  @> %3" <`(`@ `(> % @W  Hn !" @i @'@2 `g8`p`@` @<`(`@ `(??@   `@vQ X` .X @8`2 <@F  ``@$<'& "  =``  ??$@m?Xǰ?@ː' @ "?)$8H> aT$8@ݰ?> > $> % c@3Y!W㿐 ' { `   `>`x8   >>aX\  `  >?` ` `   ` `a8 f 6  ` @[*`@ `0`8a8D 4` , 0`@,`8`0-`@-` P8`5>@9@3>!>aX!\@"-`aX@@&aX!P Ğ O Ę  $`  ē` 9$` "`U> `|,(  $ ` ?! $2` @` ` "``> `|, `" '`  ,  ` "  % @Ր@aX@ @@&aX? `  `g ac` @ $`$` $` $`$ `?(2` @?  ($a4$a8$a< $a@% Pb 8 ` l `< @ @@>$aHPaH$aL  @$aD@[ ꀢ 2 H " d `  j H`b !" @\`2 `  ` : (` (`2```$`@?!  c @ ` `͖  ` % `>`x8 K  `P(4 0A@@!\0@8`9Đ aX021 `> > $> % c@ 1 >>ad`@@(` 2  "   @ 2 @2   `" `  " "㿘    l >>ad`@@(`@@"@2@2   `& ` &  㿘>`0`)>%>!d` @(` 2    @2 @2   !d㿘> 'b  >#d> a`㿘> 9aX"  <`> % k ` " ֆ `u@ Ӧ# 㿘> 9aX ``<`=> %  `2  A   ` "`" @(`0`` `P`$ `"ߐ `   ֐`Z# @Ð & @   ? `  `p `t @0@ `$ `P$  `  ?@ Q    `(`  ` ` M `N>ܬ`0    #l #d#h#\#`   0`- (` (1   M `." M `.1 @D 4 802M 1  `>>ܝ`` `'= : >ܦ`0%?# `4   `5   #\#`#l#d #h `&@@" $ӭ`P @ ' > % ә > %.# 㿘``" @ > % .# ` > %  @`  N``> &H`` @H`@ > & .x 㿐  `9  @ # @ P(`(``&` P$`0``&` P$`@ `& >    㿐    ` 8@ > `  `;  `1 `0` `   "  a  @ `P`$ ` ` &`>ư $ `$  @ǒ@ @``&`0``&``P$ @ ` 㿘  `P> & -  0`> &.y @㿘`h &`.`` `P($. @0 .> &.\ H㿈 'H``& Ђ P$##\ :`   `" " P`$`4 ` 8`@ฆ9 ` P`$ـ`(฀8`ฆ9 ` 2P@` ` @14`@`J @$@ @`Ȃ@[> &64`@ऀ` @`"@"aऀ`~a"@P`$@ #\" 3: `$`2   ``$ @"@ z P`$ c` qംb8`   `$ `@c"6P`H8@ ऀ`"PS~`H P`$" <@6  H"@ 0`b <@ 4 H #\8讒 gฐ`   `> &=6 ```8`ംb8`  ` V$"%(` j`:`H@ =` 達ऀ`"ฆ @:` H`` H`)Y `` 論Hђ`P`$2  )```臔 > &,x h`,t ,r X  ( $''''@< @@@   @   ' P`$`( > `?'`?/ǂ@'2D ' Pb '?'8   ` 6`?'Ԑ( ' &'    Q H@@ '$ ؀$ `  ``@ @ ^@ :7~$ǀ` 2~@  P `耢 v܀` S @$'@C@Ԕ0>2#$"$ ` G`8   2$($$> c `8@8`8 '؆  '' ``@0 ('І@ ( @\؀ "9 `      !2`H?''`H@ `b> BT`2X ` ` ` ԀY'' `" "a' $ `@؀ G @'  ` '{`` ` !`_ > &B !" @j$`І̀'Ѐ@` ̂ @'@m  2$' ` ^a~$  ''ǀ ̀`" 3$@  P `趒 ! ` 0` ``"'@`  ` `@ "'@k 0u`> c `0@f8`0$  '` a~ @$ P `袒 i܀耤 "'@Y  ($ؐ}'@C> & ` ? ` 9 `.$唒 @   P `趒 ܀'@h$撒 @$`  [> ` 9 ` i(e$` 4$'@܀[̐"`"9 J- ` &`$@0 (@( $a8`0$܂h$,?;&'@͏0"`p`p` $$@&ܲۂàa$$̂ $ `" p>`0`^``'(``Yw``(> &`0`6` l `( ٰ  `( 6`?؂  ` '''''`$'''ؔ ` " `` 6`媒 Ӑ`> &( > &( 㿘``(`&```&`&`>l`&`  @ x`㿘   X` א& X   p.`>``0`' `@2'>>ahx<`@@(`@ @"> > @2 @2 ` "   ? @$ $ & 'l >`m> B!taX %>l ol> & D( ' D m t`$t@`協$ `&$ 4 $ $  4  .`@`#@  $  '?'Ԅ ''''' $'  ` f@Ӓ  `X (4  $  @?$$$ '> 'b!t(!taX`#aX `> & `"B > &'! 4`2  (`2   0`2   $`2  4  `"d' <`2  @> a40@$ < @`2V'> `84$ @' @$ $$$$$ $$$  ? @$ $  $  @ ?$ $E$ > ap   㿘 X `  \`"  ` ! ` \ʖ   "  ` `  X " \  \`t`p㿘> 'b  >ܮh>> al xal `㿘"``   >B ̒`㿘 4>`0` E    , @`X` ``  2 : ː 㿘 4`2@ !   `(`@`X `X 㿘 4` @`   Y p "R S% L`> &a 6  `( ,(4܀ 8 4> .4@`0&<4 8(&8耣 8 &8.@> `84&@&8@&, ?68@   ?6 6 p " nǘ g`> &a 6  `,8''`<@''؀`",@(`H> .4@`0'䀠`8@$4`1.@> `84'$q ,(@ 48@6  260`"$66. 6ْЃ.> `6㿐" C   f $ 㿐bĐ ..@`'  @`, @''>B^a@ ` 䇐`:$` @?, @ $```$(&`$> &%!0Hb m @?'''''' ܔ  N4`  ` I .@ @ @ N`,@`$&`$8"`&8&   @ `  @& 8& & 0 2`<`$`@& 0`@`& 8k>Bגa @ ,@Z> &%A!P㿘>`#&"` ``  `` `  퀤#&!%+&%$ ِ"2 n?ްذ㿘+  )> & a (@@2` X 2  `4    ` 8` ߂`4 ``  $ 8> &$!p㿘  4@%> & a (@@2 X 2  4  ̖  `  ,$ ,`4    @$ ,8$ , @$ ,> &$u!p㿘 ߼ "#> & `"  @`"  X ` A`" \`2  > &O!> &$Q!耠`" $J!㿘.`X 8 0@@*  4`" 4 ` W ` P `M> & Pc$@`> &#! ` 4  E@ 9`7*% >  @a4/ ` / ` ; `%> & Pc$@`> &> &"X#x ` 4  E> 48@$ @ ` `"  `p E> &Pc$@`> &> &"(@#` `p`p㿘[> &``'> & a (@@2  X`2 ` 6`  ```8`6`&`8      (@@2` X `J ``Ǡ  㿘.`X , $@@*  (`" ( `W ` P `M> & Pc$@`> &"" `4  E@ 9`7*% >  <a4/ `/ ` ; `%> & Pc$@`> &> &"X"Ŗ `4  E> 40@$ < ` `"  `p E> &Pc$@`> &> &"(" `p`p㿘@('> & a (@@2  X2  6 ) `,@6&,    > &`> &  (@@2 X`D    㿐 `  &@㿐 `` & ` ` P`&Ʃ F&`l㿘> `   㿘"`Dl  4 0&& \ HHp8\8` ` X`@ `  $  `!  ` 0d   E `(` >G  `P 8    @     $    @   >   @ `P 4      ?    c      "   P > Ba| 8 <  " > Ba\ 8> Bal 8 <2  @2  ?"   <`@` ` ` 4`$ " @  ,`"  `"  ?`2  ` `@" "  ?`2   ,@`@ @ " "  @ ?@2  㾈> c<' `<&  `谒 2`` ` `` ` ` `  ``  2 i 2`4 `$``<0@> 9`@  `4`$`0``P$` `` 0` `` 耠`` ``P$2   2 "a> w#`$`0```$` P`$2W! 406   `谒 x> T#ܐ0# `(` ` t` ` w `` p "x > 9#``` ĻĹ (> & `t t L`tǒ u` "Ġ&Ϻ > u`{o0h`tP#0> #0> & m#p㿐` @> 90 `(@ $`43$`0 ` 1 `tɐ  `&> 9b$`$`0ř$  ``8`$`8  `< `+`+` @ (`@@ (`@@ < `& "$`0 `(㿐` `  `   #\ h `   #\ h㿐 h ` # `|` $` $` @$` $` ` `$`  `  `$` `  `t$`L `  `<`  `  `$$`, `  `D$`0 `  `,$`4 `  `@$`8 `  `4$`< `  `H$`@ `  `X$`H `  `P$`D4`"(`@P`8$`( `  ``1 ( )  <`P4$@ `<`X ` $  `  8 $  `` `  8 , ( ` @< `` ` >  4 48` 0 $  $` $` @$` $` `Z `p$`  ` Z `t$` ` Z `($`L ` Z `<`  ` Z `$`, ` Z `$`0 ` Z `$`4 ` Z `$`8 ` Z ` $`< ` Z `$$`@ ` Z `d$`H ` Z `l$`D4`[`($`( ` ^ `h1 9 ) ( @ <`P4$@ `<`X `" ``$    ` ` !  ` @< ``r>  a4  k$ )$`(>  a4  a$  H  7 㿐`<:` ` 5 `0`` &  ` V 8 $  `` ` E 8 , ( ` @> `` ` ,>  4 48` 0 &  ```&    ` ` !  ` @> ``>  a4  & >  a4  &     㿐`<:` ` 7 `0`` $  ` X 8 $  `` ` G 8 , ( ` @< `` ` .>  4 48` 0 $ 忐```$    ` ` !  ` @< ``>  a4  $ >  a4  $     `>1c8 `>1c 㿐`<:` ` 7 `0`` $  ` X 8 $  `` ` G 8 , ( ` @< `` ` .>  4 48` 0 $ ໐```$    ` ` !  ` @< ``>  a4  $ >  a4  $     `>.b `>-cD 㿘? > &   @ `2#]  P` > &V#  @ ` ` ` ` ` > &`A# 4`m l > 7 Ё`p ` `t ` > &`'# 4`䍐Q l >  Ё`>c4 l `` l>`  ` >` l ` %` P`(@`  2``>` p` h`" ```>%` ` `>` (㿘  @a $   ? 2 `" `> '`"o @$ `  `  ""_  "`@"   (`` 0`@C 2  -  -  < @ 7   @   2 @( @" D  2 @8 ֦ 0` (``Ƈ0`ͦ @ : "㿘  > 9(a0@   `"@ @`  L?  ` 9  t p@@ `4 @$@ `(㿘 > 9a0(@  L `\ 㿀  ` (7 (`" G  @D P`(  ` * `p. ` * <`   `$   >`0`#\ #` #l#d#h  ޚ  `( `  <`  㿘 `4` `` ` ``X"  -VT``d2  ` !`X2  `, `" ʒ  ڀŒ )`d2Ȱ  㿘 `  ː `|`"   ` `"  B`  겐  B ` : `X  ` 7`X۰  +$ $`P$@] 붖  % `$ $`P`$"`Ӓ В ` `d"  `d"  0 -`P`$  0  `$ 0`$`P$ `@`?* `"y`u`Ɍ ɉ  ` > c<' dU ``cP@@  > Ð#K => &` `  2` ` `  ` ` ``` n 2 1 2 `$0@ `4$0``P$```$``0``$``P$Ӑ`$`2  2``P> B`(ۈ'  '  ' "' ' ''`' #\  2i` `  "8` `$ `@`H5  P`$" #` .,0 ``` t``t= -`P9 `5 / ``t t͐#@> ' (> B&a"H8`O`㾈 > c<' `d `4`PPO  > &B 0또#P  d Pc@@ S` ^X`@ `P`%`0`%P$G$`2  >%0`%P$2=`>  #"     0> 'W @ְ 󀤀Ґ0ΰ 뀤d{ Pɔ "`h `x   > ''c<'   d``d2 P> ' XP!  Ԓ耤 耢 ԃː@  Pޠ  ` `XҠ  ` `XƠ    `` P` c@@  ``X2 `  `X2`<@@ `? H ` ````'``0``'` P`$2 P``$2  "  $  7`'`Ԗ  ``'`0``'` P`$2`0M>`d"_, p O0< 4`# ӳEC`` @$` $@  +> &#```d"T  Ӷ  Ӱ `d$  `d2C`ҁ ӕ  {@ /߂@ # f   ˒S U耢  " > '`"N`> '  =  N ϒ b0 " ` % ``"``@@``2  ` '`H@.뀤  X/߶  > '` p @ p> ' ` 0` ``"  `" c`@"   ` X `@Р  <@@`?x `$( B`> '`>Pc@@  ം`%`0`%P$"ฐ@ P$`2  "ം%0`%P$  0|n 煘 "琄`lം%0`%P$"ฐ ฐ`   0PL ``@0 w @߂`E'؀2 %P$" Ғ  !' P`$ؐŒ ؀&`P$ 2  0`%   0  `' ` @  x萁  o`` @$`ޔ 䀢   ߀2> '  ID 0/`> '$ ؀`"`> BPa  '`ސ` `'`W   B D`> ' Đ0 ` `p`p㿘~ ` ` uo``X ` ` n````@`?" * > ֐` ` n` `` ` f` ` Jِ` ` _` `` ` W` ` !|:``@B``@  2` 0``p/``` ` *```h`t`p8I  0`p `p `t `p `t^`tY`p`t읐 &@ @ `` $`` `w0  ``{0> '  㿘  ` C `  2"  4`b( O ` - `} 2 d  p0 o@0@ `$  8   0` ```@  `p`t㿘  `     ( L  T D" H "_` P`$-` ` `` @ ` `  `X@@ ߀ > `$ڀ  P`$"`` ``X  H?c  ?``X `X` ` ?` H Xc! X``$` H` ` ` `X`@ `2  " P`$ 6 z ?` ` ``4`l ``"P` @   \ @* @"i $  ," 4P`$` `}``" 4 " 4 ``8 k 1 4" ,``$` ,  P`$:``8``` , 4    P`$IM``d"C H `d@"@ ` HO X@:  `$```pQd H? d` H dc7! d``d& `da`2Z` y ``p2BPL 2sP 㿘   ` `  4` `@`ȁ 4 ` ` &`X`@ `   4` `t@`p(@`&"`  P$` ꉐ "` 0d㿘  4`^   @" -`  `|` $ D0`@񀠿  γ "+  0$ 4d$ 0Hod0(@Hp@2` Ho$ (@vHp@ e02`  2`  H <@T  $ @e0> '!㿘   `@/.`@3``< `(@ '$1!(` (  (@; &,* &@`&( U 8 (@ ''!XL&` > ' @0l ܐ!x $  > >ib`㿐   @  $ > '! > @;w&@ &,* `&&(     $@<&@: `H H8@ ` ) +( &,@$  `0 ,& $> '!> '!㿘&    > $>  "<@@":&` (@;? ( >Z" " P ` >``"  28 @S) >| > !4`@ |!4 || d?@:ɐ?&,  4   @6 Ҕ$> '@!> '"(㿘'?   > $>  y"`"   : "`  $@:&&>Y^"Ȁ $`&8`  ``$`' ` (@:{?&> '"H㿐 .`f,` 2  f`(f ߘ Zf,` T``$`H&@:O@l   0`%@ N`B(``< 2  N`V  `P*2J_   %@ @S@ "Z @N(`   @`(`d> !X> 'J"԰ * < N8@`P )@ .` f,$`  0 ,f8`$`2  < ކ @:u: H 8@`Ԡ " "@:g2 ~@:b&2  @R d>  2#> '"p < 0?d> '$"> '"㿐 .`f,p  f`(f   _(`H`(@:: H 8@` )@+@`f,$`0<@G,f`(c `(> 0`@ 8`$ 4 @Rw " @L(`   @ (`d>  !X> '#H @R[ d> ' #> 'p# >   f,`0 'X '@'T` ` 谒 x耠ഄ(`'@`X?0(c!?(`0@@@ ?''\ `@f_ ` H*0> 'c(#?(`@0@'@ < ޲`؀@   `&"`U @/`f  `' 0`h" 0o 耠@6` 4`  @  `  T ǘ찒  '@`%f .'f ," 8`" `<@PH `@ &'-@ ) ( 4 0,  &Ǭc`^`2ഀ 3ഡ, `(?0(c#?(`0@@@(f |X T X찒 %%छ0(0(`@@@ ! (%f  \'`f(@8`" "  `<@P`H `@  vT 찒 J%'f  'f (@" 8`" <@OH `@: ?''ؠ  %f @@x Z4T ݘ찒 %'@(`?%ਂ ? , (`0@4 @@) &\`of , \'f,8`" a" X f(@?ؘ Y?H(` \`\`*f Ӱ  x0`X) 0(`(@@@ #@@'%3' К 'f ,8`" " Zf `<@O6`H `@> ' D#p>  @ P  " ` ! k  P  b %`8@6@?<`е R`2Q  ,`@`((?(0c?  0(`@@ @(@ `> 5`` 2 .    ` ` %%"`  (@`(((,(`0`@@0`1 ()   (` @1 @@ @ ۔(`@`X?'+`c3` @ (? @0`^>   HP / % `8<    0a`"> '( 0 -@@8" 0Ȋ: >0 `! `(@>`( eH+ @ `(0(`@?0@"@`'`<  "((?-@`?8`>` ހ`$ @؂ Ӄ,`,@@̂ H,@ @ ` %$`@??>0M #> ' I#> ' #㿘6B?c !?@``` ``(0(`0@@@ 1 " ) ( 1  7` "@/`.`. +(`@@7`@? @ "2 >>22`` @ǔ `` ``p` `*```` `d`h@``x`z`''6 3 ''22''2 4`''ؓ45`''Г5'`l0`'ȳ.`?@8`@3Ġ  , 89 33` @,- -?`? @3x>3z35?. (`6 @ @@# + ( 3  # *(` @2@ @ # * ( 2 #*  (`@ܐ 2 @@#؄ @,`( @4`#Ԃ ,(` @4@@ # -` @(Ъ @5`#d- (`@`l 5@@#h) Ȅ ( 0` #l@@(60`) (`(#p8 <0$2    3`     $ ( , 0 4 6 8 :'23 '2 ''24 ''؅34''Ѕ4`5 ''ȅ4 (`''5``(`?1 '') ?  (`1 @@@&@+` @( @ 3` &`+  (`@ 3 @ @&`* ( 2 &` * (`@ 2@ @&`*  ( 2 &`+ (`@ܞ 3@@ &`,  4 (؂ @&`,`(`@Т @ 4`@@ &` (, 4 &`$, 4(`@@̄ @&`(- (Ȩ 5 &`,-` @(`@Ī @ 5`@@&`0 (`?  ' < @ L . @6`:==6`46`6`?`, @6`8 D T \ ` d H > P R X Z'1 '2'5'4 '- 8@6`>8`) @6`< (`@3`' 1 @@ @&`@(+` @ 3` &`D+ 3  '(`@ 3 @ @ &`H(* 2 &`L,`4` @'(`@5`' @ 4`@@-`&`T @ @ (`5`@@@&`\- ( 55'&``    /`/ ..:: 6`P6`R;<6`X6`Z-  (5&`d 6 ,, &`ȁ <    l @ <  @  ` "!  ! l L`d`2 `  d(  ! 2 `&   ! ! 㿀'D'P'X   4  P`@26D>``   0< '耈a#>`0`> ం` `(`8`C @8`(8`8 0 < 8 " 0>" "  tP H'䀠`'  '" 2,"@*@Jɔ'0`?ȏ` @- , ?@/???0((`@0@@" D. ?u 2'Dؤ@ݠ? P`,` ?0(?c(`0@@@ 2䀠`#9 X @ X @P(@@3oD?5 2'䀠` 0h% 0X @0 > (X 㿈 `P$` o  ````& `o @  ` `j   ` @> ``2Q> & `ۤ   &  (`@2u@1$@1ѐ,* @`, B . & LH $ X  ?0  0  0x  @2D0z Ǥ# a4  c00@ 'P'T` T 4`QQ7 rq l@P@? `<T=#\; '!@@$`H @Is@`v `<s   z @  \`&  P`(8`  `` `e  @I@ ( ݔ  ` &   (P@?D  !;T<`#\ ͖ @,@J  S + 83@(@ޢ@<`@@ ;+ 83@(@@4`'$Ƶ' $<` ''X`( <* `& ?` 4   (@@ `(  ` &  |  < (`q `(l <O T>`0`  ?'\' 2 $?h' $ ? '9? (`@ (?0((`@0@@2[@@`6*`X??` "? c)?@ , @ `(0((`@0@@"?#`(?8`  @ `X@l`\@h``@d @`([  0@Ӓh`> (l`̔F  ` &   0- ,  2'\5 @T `( X ( (?4!,84(@r@ L 8I HT@ 8` > ( > ( h > ( 8㿐> 9aX ``<`.> (  `2   " `X` `"`P  `"  f   `$ * lk    ` $ d    ̘?ppppppH<0H$HH HHH`` `'I F >?`0+?% '?`4`B #l #d#h#\#`   ̚ %`/@@+ 0((`@0@@@ $`P`P @ '  > % <> %X#> (  `>?`0ܠ  -?8 `@ `  #l #d#h#\#`  l /`,(` '`3  L`.3 L `.3` @+`( @0` 3 `@) 8`@@D  㿐 8`@p ?`0(c ?0(`@@@ ` L`2 `(` `& ``0` `  ) (`>d` )  )  )  )  )  )  ) 㿐  `2  8`@ ) 8@  `?`(@8`@@(`0`@`8(`3`M `&  @8 `  @' ` 'f'`'@'`'' ` '؂` '  ' P`$@` ܐ '؁`?`/`?@' ' P`@8' $  'X'?`8@'B@+@)Ζ? ?''''̀  Ā`E $ 'Ѐ ; 9;   @\   ` ?''`H`(`4m> BT`"& ` (  `8`@ ] S` 9 O> (,  (? 4 0`B> (`4`@8`( @ ``  ` >` '' "` `"F`4'Ȅ`@(8`@@$`@`(@8`@om'"; ` ` 6'$'> &ӕ  S$ɀ '@   @'@Dƒ` 2? 0`4 , ? ( $`@`8(`$r `` 8`Z6> (M ` 8Y `$@ `߀` @$ 䀈``2`6@ , P ` Ԁ` B `@%` `"ܐ@؁o' U`  ` ܐ a'_'ؐ< 8w$6 $Ш o'ą;   @ C c'> (a@?0(? 0*> (!xh> (+!> (aa@a`> (`(<$`"``"` P`$ `  '؀`$$̀6@+ @$`$`Ԅ%`?`' `@%`?'؀`)`'`m '$@  P ` '@଀ ` ' 4 ' @ ' P ` ' @`h%`/ `@z%`6  "`@%` P `  Ԁ`2 ` S'`(N%`  `(%`'؁@@)B@'4$$4 D'؁ @Ԁ2&ߐ @ @P$X> c<@'  4` `  `f  > c<@ > (@"?` ?`?`'?''''В  `4  /` ' @' 2]Ђ$S? @`8(`@(``v0`5?j > D"@`5%@(1=``(`0(`T0` !@B?0((`@0@@'  // @C``7`(`0`@( =`"  ``@  @" `  $`  [ @ : $ '}  @ @I  =`Ӱ"X>  c<' )& 0(? ?c0/(`@@@ ' L@`/Y` K?8'  '''?c'ą- 0(܅8'7''''ԐÔ `Pb4 ` > ( ``" @0 ` g(` /` 8`@}谒 ` ` ) ?c8  A@  8(`4`@` `` (@8`@@ @Ԕ@&@`@  <@= B@'g@%   `$>d@`/@@ l(`?0``@(8`@7g` i$ eʐ< 6 8` wU9. ?0``@(8`@7  8(`4`Ϣ@ S/ P/ M/ J/ G/ D/ A/")@'> ( !> ( "> (" > (<"`> ("> ("@p'D `` '``` `4` ` `> (> ("b䀋`> (` `) @9 1 (@@ @ w`8'?`'@ O(``@ 6 ;+ 83@(@@D=` #\4 2-``= D8R`L @@ H@)쀠`N@Mr  `耠 D` ` ``  s0"I`䀈`UD`%`"` `' ` 2`w `@D 2` ` @/0Z | 䀈3 ` "9``,@  耠@쀠   ` *``#@`=`%`> ("ba=``> (> ("ڒb㿀 `4`> ( f(8`0`(@@o"j ` '`"P9 f +@3`8+0@+@@8T(N@Θ a=( @$@ X  H7 P} '`"N @ b =f;  ;+ 83@(@;@D?ff $@*<  @( (D@,@f #`'#\K` "P|P `$ `%8f 8m lfP`(@  `2E `2@ > (> (#c> (> ("c> (#0c㿐 `@> 90 `(@` $$ 4`;`$ 0`?(?0`(`c@ @0`*`@@N@   &> 9b$ $ 0$``` 8`$ 8c``<``+`+` @ (`@@ (`@@ <``& "$ 0`㿀 < > 8c9 D@9 C "  0h2     K 2  ` `@" <  怤 "  4 &9 @ 9 @ > g   <@9 9 @D#\> (;`#@> W!@2 ( > @8 ك9 㿐   '>@;` v H@&'8'6.`(@@ ;` ] 逦{'  2@ "``d"` -㿘    $ y  H`z /㿘  `8   z @*    d  (8F,`H ?p` @۪ `2㿐"` ` "`( F`(bf F ` & `2 F&`d`&㿐"> B a>> `s& `~J  t   _ l `% %  % % % % % " `( Ғ@%f$@$ @$f,* f@`f, c [`L`H `Xf$@%u֐ >"DN% z % x(`@% z(% `29 > B> BbLܰ "  & ` d`2) >!|> a4`@!!|a4!!|!| dP`$2& `% &zU& 0@ M Đ&㿘 8?c( p8cS  L?0 ((` @0@@`> (֐#x 0 ((` @0@@`> ( Ð#`$ T0 ((` @0@@` > ( #` d  0(`0(@@@Ȱ   `0 ((` @0@@> )  㿈" Lf`/''''>pƒal` m` < 2 ܒ Lf`2,f> a4$`0+ d> P!X>  㿘 4` ``" l```   ` `` 2&@  ```2`0㿘"`;8cSh> )L(`,d`) &  (      ) + @ +` @  @  〠  i`&`&``_$$$ >`  0 >``>`   >`(  >`0 `- Z!`) Z `` @< y 8㿘 " "```` l` 㿘6`ޒ ` -b`L&`)` 4` | ``v`L&`@?? `’`K`&, ߒ ܒ `$$b($`$.  2` :`2` 4 :  `㿀 $`v b `  w  $}6 _`$`H `; Wb` @?@""$ $(?$?8$8`4 $$ $@"$ L$ ` X@"(@"$$ `-$( `Hx, ? 쭐x? @$'  (8|٘ x&''''>rc> ) H㿐 |` ?`N ѐ > c\   V `$`?@? `ڒ` '  $| &  wy`@? `ƒ` `` ߒ &bo`H ٺ   ,!h  '&0'``Hw'` , '` :` 4: , @?@!"$ $(?$?8$8`4 $$ $@!$ L$ ` X@!(@!$$ $(   `2$, `H, ? 뿐wQ' @$` d  (8{`ڐ,X Z` &b&``$` <&`&`(&`$'`'@'`0`'`$ '`('`,| `4:㿐 <`2``-   ``  ` 2;> )@ (@!$@!` @!,* @`, { @L`H$ X@!?{vO4 `( l P@ $N "Lf`#!@? ` 7    `:`  4`:  ,f $2V4Lf` $ 2V`:`g,f 4`: ,f`  DU   Z Y  ` x Z F @ &,?&(&&0&& 逤`4`"| x߀` "Lf0> ]`H ˒` !`& :"`:0 4`:,f. " $ $` `   ?!  $@@; Β!" $c" "@80 L`%  Z! Y@8 Z'" @8O&`c` :`/&> a4' 0/ W`̀  ?n @ @ @7 Ґ> )E x㿐> ca>0> ˒`  > lb!> Ē#\ "> )> ) > ̐ В` :#\a +> a$ @  `a$:  ! b `"d@7 !! `L``ڒ 0@f`0`  d ~#\  @@7 ?  #a$㿐    !> 7>#(!#\> )`ؒ > "D  > )`#\`   ` ``?㿘> 9aX <`> ) , ` " / `">"D>!&  L!( 㿘ԁ㿘 `M`? ` `? 㿐dz`%<?& 㬖 2B `$    $ `$ 3@1 > 9`@  4 1  d2@   첖  "'> 鍐# 0 `$  4   m > q# 2"&b   {0> I#0> )!H  @`(> 9a0 @>u`Ԑ㿐`      #\ h㿘 P`(@ `2   `"    ?    (0 㿀  ` (9 " @@P`( `(<` " i  >`0`#\ #` #l#d#h   Q0`L$ 0㿘  4` ` 0" ` @97` 2  縷 @`0`$֐㿘    Ȑ ``"  B  ͐  B`  `` 0d 値 0t$ސ` 0   e`0ϝ` d   `c  a@"  > &# `` `$`$``$`1  `4` 0  +  `0   $  2{`''''''`?0(c ?0(`@@,@ 7'܂ /` L` .``h  ./ ?(0 ?#(`0@ @@ '   /(`0`@`9 (`7` L`" .``2/ .>//`0 `#\ #`  #l#d#hܖ   2  P b &`419 鐐 "` `0` $ `0``$` > {#/`$` 2 `@ > )ؐ!h> )Ր!㿘   d 4` H ڐ`PP @= ΐ> )!  7 c* `0  @ԐE 00 ` %  5  " `0` %  >  #〤@ ހ@0/ "  `   ''  d``d2 P> )V! P  ѐ_ Y  P  ` 0ަ  ` ؀_ Y Ғ cx `0o` k <@ @ ѐ ` `` 0`  % "V  ``%  `0`%0 4`u D֐`` @=$` $@=m T S N M/  Ct@ @  `"   4    `"`> '"G`> 'Z      0 " ` ڒ ``"``@@` ` #%H@.뀤 Ϧ Β  > )@"` `" `଀"`` `<@` 4  `  `0`%``0`0(``i    ``'``` @N$`P I` d `_> )` Ɛ u 0mH> 'c 0` % :  H H`` 0`  #%0> )t!> ) < 04> )k"( P  B``zx }dW"U"H2`ސ 2   0 `$ $ > )?!Tt`>`00` `%` #`#\ #l#d#h    Вꀠ` > )? @@7 h / ??0`( '#\#`    #d#l#hk |㿘  ``      ( L  T D" H "+`P`$  "v    H` `@ (@ `$ H`Ր  `0А  " `P`$̀ ` "  @" =   @@ % % @ ``"  ` %  ` w0"   `"  {0 ?`4` ``"`P   v w ," 4`P`$2u  " 4 " 4 ```  Y 4" ,`$ ,  `P`$R`P` , 4泖  > : `P`$2< `    * " `4`  O z 2   p1 0 `$ `8  @0`P`$  `$@  .2g`4w ,@" % B 20 0(T% 2`PP 2g`P 㿐 U``"```$`` `` ``! ```@<```2X> $``$ `$ `o$ `$ `$ `$ `?(c0?(`(0@@@$ L< ``$ 0$ ,``$ 8$ 4`` $ @$ <` ` @ ($ H` `@ ($ H``d$ D4``$@P`8$ (``( 0$ T$ P4$``< X `a4 `($ (``( 0$ T$ P4$``< X $ (``( 0$ T$ P4$``< X   ` ` `4 > cଁ `4 > c㿘   ( > 9a0@ @`  L?3 ?+ ?  (0`#`(@@ `4@$@ N    "  ,@ :  2 ,㿘   @ @@ 8@  @@ * @ 㿘  ` > )" ``@> )"㿘  6 > )> )bȪ> ) c @:  (`"  $ƀ ( $   ,`@   $ (ƀ ( $ ,@ƀ@   ( ƀ > )ƀ#0`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`M` 2 V` `2   "`""`@") "` @"(``9 `9 `""@"  `` ` ` ``2`@"``9 `9 `ݒ"```"`""`@""`"``㿘 3`, ,@?@8   `"  ,@? ` @ ?@ 4  `2 "`"`"` "`&& &   &`&`&`&`"   `, ,@"  8  2 , ` @*@ `4   2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿘> )cX    ƀ`` `< `:> ) Ւ? 2> )> )c`(`$`,@@ " ƀ ` ``" `$``(0`"* `,: ƀ  `a 2`(ƀ#ǐ 㿘 >߼"$> +"a8" " 㿘 >߰ > +"a" " " 㿘 >ߣ#> +"` " " " " 㿘 >ߔ"$> +"`" " 㿘$ ! > b?< @$ ,㿘 >w#> +a "" " "  ! @+Ӱ㿘<` a`2 0   2 "  2 > )> +#ŒaP㿘` > )> +#跒a㿘` n > +> )#覒a㿘` ] )a($,@`@"  0` @8  :  `2 > "  2> *> * `返%@> +> * @oah㿘>`> > *> * `觔#z㿘>a` $2 > ْ > +"`" " " > *> * `莔"㿘\`:d& @ 4@ 4@@J> `@M@ 1 @ && @ @ @ & @'> @@ @ @ &&@  ς> > *> * `0B ڈ @ ւ&ц> *> * `02 > > *> * ``* > > *> * `" 㿀@`'L'T'P\`dh> aa(@ $@0`*ۑ6*6֦*$@` `l  8`6 ```(`$`,#\#`#dK ဎ ``2`(`@>  > ?/> *> * `绔$`˱6 T P Lr ` LL  `TL@ L#  ? T@L @L#  i&T  @ > > *> * `焔$7> *$@8!㿀d` L %# -`@ ., @  (@ `%\ `$/ ( ( $ ,\ #\#`#d  \&& &@% \#\#`#d#h-`@  $ ,@8\#`#\#d \&& &@% 㿀 \`  > a`   `(`$`,#\#` #dn   2`( &`,`(`$ #@@ @ @8 & & >>^c#>>^c >>^c!`>>^c#>>^c"$㿀? @$I\ &1>) , ( $# #\#`#d  @# &  㿈`0> h" `@ &`"``#\d#d#`\@ `&@$ "` `@`> *"h> > *> * `PR!㿀dhl8@ @ d> bX> V> *@T> *p@2Q t@2M x U @G? P ( $ J ,@  @#~ = ( $ 7 ,@ 2*8`p#\#`t\#dc  @#ڰ> *> * `ޔ!q> > > *> * `Ԕ!n&  &8& 2& > > *> * `峔!m> * `孔!r۸`e!> !   _*   *m? , (" , @ 0*` 4@#@#` #` # #  ?#  !@ ! 2  ך  #l\#h#d#\#`#p#t    xd'P ?\` 8 $`@83@ 3% @ @ -!> !!,`!*,@*@P @?#\`#`#h#d#l#p#tĚ  P @ф% ժ#t#p#\#`#h#l #d P#d#\#`#h#l#p#t P#\#`#d#h#l#p#t 0˝x `  > a`@ #@  \#\#`# #l #h#t#p#dg 㿐    !> 7>#("$#\> *ܺc    #\>> *!`ܰcȒ    #\>> * ܦcؒ!   #\>> *#ܜc>#\#̒    > *ܒc> a>> + `    `, ,@"  8   2 ,` @* @ `4 㿀 \`@d` W `@!@ N {@O@> a`! \ @Ra@ E @@@,@* @ 2 d   d8  ( $ ,@@@ J "4 d80 `2 2 ( > a> > *> * `0 ڄ @€@@a@a @ (`@$s`@@π@2  ( $@ ,`8#\#`#d 2 @ !&@8&& > > *> + `㒔"B> > *> * `㊔ > > *> * ``ゔ & 㿘 >  !  D@;!  @0@ @` )>>,`&`6 `(@ "$@`@4 @, #>>@ "   b$@  > > +> + a3!㿘>  @& 6@@@&(` `$> +!  @ ( @ . #@  (`  # > > +> + a$> +Ⳑ"0ⱐ"P㿘>  @4 6@@4 .  "2> + "  `" >>b$   . `> +     (`   `$  > > +> + aⶔ$> +k"pi"g"㿘>  @ 6@@@(` > > +> + a⒔$Q> +G"㿘>  @` 6@@@(`.j@> > +> + ao$g> +$"㿘 @E @' 0B,  `!  @  ( @ + #@  (`  &  `" 2  , @&  $  ԉ(`@k瀤@ 㿘  b* sڔ &  8" "`"?& 㿘> (6+> +  @ @`$%> + ` &``"&@ &``"&@> > +> + aΔ#1ᄐ#႐#@㿘`D> +`> +c @ /`-``(@ U> +``$` 4`2` (`5 (H`` " ` @ &`@?ǒ` (&``$H`!@Ed``@"     @Fk ې@@MO` #h㿘> =@B'>@ `׆ -6@4* * u @@   * $` $`$`$` $`* $@ r b$` &`*$`$`@#ʒ >㬀$`$`$ ( 㬂$`(> > +> + a > > +> + a  K 㿘`>  `> + `> , t] b ?tV b1>."> +> , a! a0ݔ!㿘`C>  `F $ ( ( (? @ & $,& (  @( "(> , ` "> ,  @$& ,  (` "> , `"> ,`" @  @4 && N p> +> , aX!@>c''''''''''''''''''''''Ȁ ] ̨ ('' ( @ $$ (' $ `(  $$ $ ''  ` `@i$  $ :     +` (` @〦@` 4 "$@  (? @'' (Ƞ @'Ā 'Ȁ" (8> > +> , a$=㿐1> ,"   > ,> 7ac(#\ 3е㿘 ` < .``@@  + @ @ `  @&@ `8"#@ 8"#@ @ , @ @ ` @ 8 " "  @ `$]    ?Z2.`@(`@@, @@`7 @6&58#@!&@,8%% 2@`8#@!ډ, `@8'@'#@ʄ8%#@'@8 > ,!8> , !㿘`+&`"      I? @ ` & ꀦH-?㿘`& `&  `     @ 㿘 >  ! $  D@ @!@  06@@ @$  @`   ް .`.`s:"@ ;   * .  b"p  `ݰ r b bpr  .  r b?$ @$>  * $*  &* ,`@!0 $*y  * @!$$`  *j *  @! ;$ &@>?(`%@@ `$$ qɒ b? bq°  8$ &( &@+(? @ @ `$  > > +> , ah<!,> > +> , a4!- @<  (` %@2   ( "> +> , a!}㿘`D`|@` > ` ! @Ѥ!@ 1>`9"貒 d7..re"@f  * &`&`&` &` &`* &@ o b &` D@&`&` #    @ @(`!`"`` ``!``(` ``&``  `@" @ U*`b' (S H$ @$ D>$ H㬈㬀&`$`$ (&`( 㬁P> `$` '0@ `(+' (@ @ ,T:@( @@7(H>  $'@( $ '$ @ $ D H$ H $  @"2[? H `" ' `$`  H@$ H&@8 ${"> > +> , ah."_> > +> , a&">> +> , a"A " 4` `" ( (H`@! 4" 4㿘  @`d & 㿘  @ $ " " @`Q  (& H` >Bc\>>b$ @A > ,u"8㿘 "#  4` `"% ( 4`I$ $ 4`3>  `61>#~ 2  `> ap`4 p` (H`` >>b$ @;10> ,> , b`k > ,> , b`d > > ,> , b`\ |> > ,> , b`T 㿘> Ҋ#  "" " 㿐> 7c(1>#\#    > ,Lb> b 86`@>`# `" @㿘  >`(`@>` @   @2 @2 >  @ t@`"@ `&@" : 㿐> `  X   !> 7> #( t#\> ,b> #\!8> , (b   㿘> a```.,0 > B#`Z>  `  ` `!#?` `%   @$5, : !8! c  @& ` & `)> B`4 ? > ٰ> B@5ݒcl!> B@ߐ#> B㜈㜀&  $ & $@#mE c & > ,4#>  !8ѳ " " > ,(#> ,%#h> ,"#0㿘 `<  `@.` @ @/@ 0`(`@` `  `"   `"    ? "" > q t" > ,#> ,ِ#؀Ȱ > > -> - `8!S㿘  @^~ 㿘`X 3> a` (@ 8`` .q> -` />>`@9a@8`D  (``"  .` (  4> -ڐ `$b 4 4`"B 0T  (H`` " a8`@d" 4> -e 3> a` `8(@F 88`8 @   > -ى H `(@8``2$@ @>` > -` ` > - ` 0`$@ ` ;+ 83@(@@K@9㿘 `& !> B@# " $ $ $ $? & & $@o#> > -#>>a    ( (`=b$H`` "     ( @44 c >  a, @  @]y `p$`p   cmb1> ;!8@  ;+ 83@(@@Ԑ@8 ` * > > `t .`@`"` "@, @`  @]= p $p@  `@2.` cm1> !8T@㿐d'X @ y>     aH`` &`>  8`@D@7 " (`܆ (X ">  %   `` 5<`@;,@`X @>I  ֆ (H` H` @  (' , 8(@4@@`@$ ɂ (`@`  '> -> - > `  !` > @!8`D2`X@􀠠"` <,84(@@@7  ( (`2) (H`` &Ð@6  (  @= @DH`` "  (H` @ 2`` `@A/`@`@; (H` >BD@f&@dg   ( (`"?@ZŒ  (H` @7 `(`@`㿀> b .@' 8'#`#d#\|   @[ (H` >Bc\@<` 㿘'> B@L> Bc`a Ȑ@# "``@4;` `, 4  @ ;` 4`@` `+֢  2 @`"?  @$ ` *` ` ݃+ `@@` ?0@Ґ#` F@Ȱ  `"  㿘  H\`  0 D @ٰ  > ](`L(`    83 &@@` 0-> ``8`@@D,`2@"@?`L>>@   D@  `D@  > -@C 㿘 `A `6>  `2%> B> -a & "  `) `>  `> -@Q ``    ? @ & & @  jX> -> - `Ж!& y㿘 > ](`L(`   >ua>ua< 1> F?!8`5> B> -9> Ba0@# 2 0  @2  `;`& "t 0@Ő  hU @ې#2> B > B@2@i 0ːc@0 & & #> B& `#㤂   & @`@&  `@&  ` > B& @# 㿘  > `1> -`$` !@@E'   !@'@ `ܰ `$`܁㿘 `@>`0``> ` @" @> -> - a@`"!> `4`)@8#`㿘 ې` 3> -'@a@3> -'@“a@㿘 & &  `  @  $<> - %a@@'Y  @i (   $  *&  H`"$  0 &     $`ܐ@Ŕ'[  @C ܐ   & >b 㿐 `W @8>  $@ > > -> - a@Ւ&@ Q#>>@<%> a@ 0 @89>  $@ X $@8 X@  $@('> > -> - a@8`&`@@3s @:,@a> > -> - a@E&> -> - a@ >&> -!㿘&Ƣ3> -@7a@a@@&㿘> a$`>`0`ऄ > -> -bxh> -->B7b`! (H`` Ђ`$ fO "  U  "     @9 @ g`$    4`" ( 2 (   @9̘ @  `$@`n`(`*`(H` `(` J4D@@8     " 0#׆`( ܖȐ`@@l$0 ϔ ބ `0`਄W ਀( @V&?@3%& ˄  Ą >>b$  2Ԅ `$Ԓ  > > -> - a@@!㾰> aa`.@! '''Є'H'L`?'(','0'4'@+ ``rH L 'L X (@ `?'<'L H`"  0L2X 0`S Dz'H@  \(( @ > . t> .t@>   "@0@8  $. @ "@0@@  @ '@    @% : \`ˀY 'D  P'$5>>@ ?$ > =Ѐ"$`P?O$ "  4`2  (`!2 @7r>  >>`  8@!$`X @? ? 0> D`"%'쀧`""'@` LL @#\#`ПP 뀢 $L$ 'D   r _,`@  耢 2> -`4`L`>  `>  `     @8 2pVa> ph#`FD> > -`#@> L8 ` #>> " " (`2  4`2 0`Wb$`@  8 > ! %`@.C 8@DĀ > . $.     `H` Ԑ > L`s ܔ   `H` > -@>u"ސ>#h @ @6ِ> `' @H`8  ?\L% #`@ @C #d#\P`'쀤< @? 1>> `0> ?8 (` "'@6#> ` H@ 8!@? @ (H` ɶL 2 > `  >><@L`8)   'C> ph45> > -@=͐#L`7쀠L` H0`` >>0` ` > !!`!!H`24`ئ(>><@L8(  *,(`H`$H > a`p`h> > .@=r h_Lu  `Z   @6y @/>>b$ "4 4 `(H/`( @5?$$``(H`@!`(H`    В   &> .֢   8 `? + @6 > 쀢? (`@4(H` O > ph`43 > 2> > .` X@< LL`̐ &?> `@/ `>> (` (H` @4'H  @"@ (> -c"?0? '@.ܒ`(H`  "@ @햖  $ > > -> - a@8Ѐ# S@4g(JH`$HВ  > > -> - a@["J > !! `!!  0 `  > `  '@H8  `\ @?@LC `  @#`#\#d  倢 >  "P> . L   @5 b@.C(H`$>>b$  (` ( (H`    @6 @6' b$ , J@3В  > ! ̂`! ́ K> -> - a@Ϭ$ (` (H` @3В > > .` @;v cLې> -@;m#ZL@2`(H` xР * &  @쳒"@ Д   (`"@3=(H` L v`> > -> - a@3%:Ð0@2H(H`$> a`  ;; '4'04H(_λ (8+ ;(@'03@@'4> -> - a@&n> > -> - a@&> > -> - a@%> > -> - a@۔$㿘@ #>   a  `9 0  `9 8  `9   `9 ( > a```( ; P> b܀```2`㿐>>a>B#  > @,  > .> . `y!> > .>  `q!㿘@ > B& !Lc@6&!L㿘\@ &` @+@&` @%> b8 @ @ >a 㿘> a`8@@@" Y `$.@3@@L> Bc@> b8 @ @   1@㿀> a`'T8@@@/ `  (%`7%-> c +>>Ā@  RT`` a@,@  `  ;)> B#ؒ@ "` > a'',> ccĂc` #\#` @.R 5쀠 '>B! ? @ 8ㄐ >   'T @T&@@ @ @@#ؒ@B` > > .> . `i!㿘%> B ش> b@ '> . h@ _ؔ@`8@ ؒ@  j㿐> a1(>*@/ b<@@G@i^ƺ@6,@ T> Bc $  H@> 6c $  H@z> .ː 㿈`i` @a =c^( @7> (` P8@@@@@> . `-> B=:> a`4 (@80 @h ꀦ $81@ؒ@ ͔ ؔ   '@'ؒ@  @̒  $Ԣ  㿈N`5N `@> N`R'쀦$'>Bc'>>#> @ a@* F""  a'@@- @@ N`2@#@ &$$@|>)ސ#0>B@Ȑ#@@N`> .!> b@8@ @>aX @㿀-> `(@'??c'N` N@?c> N` `> .N  @ (,` @> . `N ` ݖ @`@ '#\#`@  2N`쀤 &>B)>>c'>B 8@' N`! 8@' t> N` `"N @)> @## `N `5> . a`/ h  `"N (` '@$ >`0 `    #>)#@#@,  @#@, N N`?   2@`@ #\#`@+ , 0> > .> . a0P:#b> .> . a03#> .> . a0h,#> . a0x&#> .> . a0#㿘#> a@?!> @^##   $ (@@5 `@)@.> Bacؒ@ @)㿐>B%>>c!> @@ !@( " > .@)!@ʇ!P>) > ܤc#/> B-> ;@ p$$@ߐ @ $$@ϐ''''''''''''''''  $#\#` ??@  8,```@Ő ,`@`(@ ``$@0$@`,`` ``@@ `@   > . $$@h@Հ'>>)> .#ܖ>cȒ 㿈>  #@N >>a> 80`@8`@% 8@  @4h% _((% %  9> c# -> B!c % ,`@ @` b"% > O" @4` , '#\#` ?@? 4!,`@ @ `@$@-?' @8` @% % 㿈>Bc􀠀#>  $b @ (@@ > cP'> .b8h'#\#`@ 2 > > .> . a0v"q c  ?>`<?㿈>Bc􀠀 > > bc'@'#\*#`??@~ "> > .> . a0E"R >a( >a( 㿈>Bc􀠀g)> !>  cP@h(@c''#\#`?@L? E > Bc؀` ;"> > .0bH'>>H`  8  !@8`&@D`h @- ݆ (`D@4̐`2h&@ z @s&  > > .> . a0Ɣ!㿐#> .a0@͔!> b  @ 8 ' '@@ Da0@!ߐ@Ē 㿘> Bcl` 3 -> > .bx@&” ";`(`"&`(H`` "h 8`@d @ D ېג <, 84@(@@H@'8` <, 84@(@@7 p%pЙ8> > .> . a0X8!㿐E`c'\c'> b#`(@#\ ?@M? %> .@&@@ @@@&@@4 > .@@@֖ 2@> .dz"DZ"ǯ"㿈>' > !>  c @e >Bc$ 䀠 Ec'&#\#` ?@? > .> B c؁DŽ#㿀>Bc􀠀h ` +>  a'*(@c##\#`?@՚?  ~`   > Bc  @'쀏 ' 2  ץ6ph6    2`\`d#\#`@( RH%>>0'>B `? @'@'`@%֘ `(H` ``8 @ a@@9 D@`'@`8@ a@2쀠` >  @Ű > .> . a0!> > .> . a0H!k> > .> . a0 !h   @ 8 ( $ ,@@@   2  ,d@*   d@*㿘 0    d2& d`HH"`$  @ `X`X``LL`PP`TT`\\݀"`D`00`8` 8#@@<@`D`"D@` D` @``?㿘 s & H`  @  $@@   "`  P` P> a 4 `@C>) 8 "  (@* ( @ 5 (@:" , 0@   4@* L `<  ` @  @  @: 0 L  @*  @: c@* 8 `$`(@@> a ( :  `@2  8>)c@ q 8`" L@@ _`@:( L` @@ G`@:( `<`@@:(`@" 0@:( 4@:( (@ ,@ @ Ј 0@(`@ (`@ (`,`(`$ (  ,  `0  `4 ?  `" 㿘``":` `26`8 "@ `"-$ @"Z`$`  $$ i`i$ @" $[$  "`U``2`  ` $` $ `" ` "G `  "I@   $ $ $ 2`8$`@" $$$`` "```$@ ```<&``@" $ $`  &$ $ n&`$  ` `&` " $$` "&&㿘"  `2`  "` `g` $ " `2& @@% `2$  &` &@$ ``&`@" &&` "@@` `x  `"` `"`` $ &` `&` `i``$ `@" &`A$" `2#` &  $ $ L `& @" $ >& "@8@` $ &`  `&@ `)``;$ `@" &`$   "2& $ &` &`$ ``&`@" &&` "q`m`Z&&&" `2p`   $$  ؐ `& @" $ & "``M &&&`$&`$&㿘@"G`` 2R``2   $`" &@@"$@$` @"@<`< ` " &@""" @` ` ` x  `` $`"&@@"$@$`]ꀤ` 㿘 ) ` `"  @?@@  `2 &`&`&@ &` &"" 3 &`&`&@&` &   ` `  "  @ (@  2   2`2 @2 0  @ ` 㿘 @ $@@ @"&  2  `$ (,@L@   8H  2  `2  @20 @ `   `" `6 `2㿘> a  $& <ɐ& L 瀈" >0a$  `>` 㿘 ` X}X ` >a 㿘 `  `   Wْ @`?  `$  `>aH  `>` 㿘 > 3 a  W "  &  ʖ   `& 㿘 `@2 >)c@B 8 L>  6?@I>  $ @ !`@   8 L@? & @ ( $ ,@@@ *&r &0> /> / `l#.> /> / `e#8㿐'> /@`>>> ah@_`` @@Q  B'' l ]`5  "s $ ( $@d  ,! $ (@@( 0 ,@  0(2' 4@-  @8@@* (! ' ” @8@` @ @@ '  ֤ &@?{>>> a@ @' 2   N?'㿘 `@6>  x | -@ ) @ @@`@@ ` &@ > b6@> @  Ոن> /> / ` z!㿈 `  @   @  $> /`h/ \   H`ڀ`"  $> /`Ӏ`> / $  ( ,@> /\ 8 H q  m ?  ''HD` 0`d`"c$> B䀠`"^$@ $@@'e$@ c>  _ "J@k (j 4> /! #쀠` P`H`@8% @`C @C @ "  > / > /0]$ʨȨ`4% 4 0`>  ܅$@ `$> @"$ ` c > / 4`>  0` (@2  `> > /> > /` L> / =>>$@ @#Ȑ> > > /> / `@d/j > /> > / QY㿘 t> b1<*.㿘 > /ƀ! ";> /> /ƀ"`3> /ƀ"  @? (` > /"8ƀ> / bH@F `ƀ` @˒  ƀ@5 `@꼒  > ƀ Ёƀ"ɀ`㿐> /ƀ"P 8 ( , 0#\ > /> 3"`ƀ    4> /ƀ"> /ƀ"Ȓ @> /ƀ"`@ (@7 ":> /> /ƀ#> 0ƀ @"1  ` @@"P> /> /ƀ# (@8 > =X> 0ƀ @`> 0`ր2@> 0ƀ ƀ#؁`> /ƀ#P`@?  > /@ > /ƀ#h (> ̲cP> /ƀ# (> IJc`ƀ#0 (x>  $ c<@' > 0ƀ p ( ,> 0ƀ  0 4> 0ƀ     > 0ƀ > 0`4ƀ! `@+`2C  8> 0bs> 0b   <d``  L> 0Zb@ > 3 X \ P T> 0ƀ! ` d> 0ƀ!P p t> 0ƀ!p x |> 0ƀ!`" 8 ? > 0> 0a> 0> 0b(`> 0> 0bx D 8  0#` @#d#\ƀ T H L P#\ X#` \@?@?#d@? TT ƀ`T H $` ( ,@? @?  `TTƀ dƀ H`@? ƀ`T````@ƀ 2 DZ 80 㿐> > lcP8> ! \a8 \! \ h2 \    !> 7>*#( #\> 0b#>) hc   #\> 0bؒ h   #\>*> 0!lbc(ص㿘@ H`   X2` `"s L$ Xf'> /'`'  H`   $@  LZH >'ݔ'`@> 0Ր"` ` `$`X`M&`X'@2`H` H`   $ X$ X2 H`42 H`'' ` 0`   X''`@   $0'ށ'> /'K '`ޒŔ'㿘@2 `X0`X``H`` `$&`X㿘 `u9> /( `D`` H`` `+ ? G>  X`  H` $ @@r 2 X> a7@H @/ (B  (<  ϒ?  $  H` (   φa?  $  > > /> 0 `(㿘 ```Ho&,(@> P\> &P \ PHp@ > 7cP> 3 @}ba1>*)!lcP> 3 @}Wa1>)#䁈g> 㿘`X`" H: `>Bc􀠀22>   &@@" 0` " $ @4` `$&`X H>Bc2>  @% $> Bc  $ 0""@ H$ 0$ H> /> . `&> /> . `&㿘> a* @@ܐ">{ڒ㿘 @ F`> 'bȀ> Bc؀i> 7cP> 3 @|Œa>)#䀢 $* `Ho&(@> cP\ #> aP$\` PHp@ * ` 7t`"" " g> a> .> .c> /x 6> 0a@~ h  h &a@u h ?`h. .  @@(`$> l> B!8c耢 > 0ߐ#hcP> 3 @|^a>*!l * `#8㿈 ( $'H\`ds ,3> a @ @>$ @ 8?@0{0  @[$@ @u  a$@ `r > 0$ #`G`2n @2d  2 ,&H @ ʒ`z  @&* @& @8^ @* @8 q@ 3> a܂À  > 1  H< @> 1 3  C?ߐ#@@䪐zդa> 1  > 0#@> 0# ( $ ,@ @j @ @  @0$@ @$@$@ @J@ ( $@@@?> 1 #\#d#`T 㿈\`d `<#\#`#d#h;    L#\#`#d#h*  㿘 ` !@ 7t`&@&`&`O-  > 1X!X㿀@7t`Ѐ> 1`"`> 1I!p@> 1 `  U 2`,O  #`#\ ` #d $`$#h (`(#l ,> 1#p$!㿘H@ ` > Q2!>  `  ```@H&HN͐  > /> 1 `0<!> /> 1 `p5!㿘? 9D ,7 `"  $"  , `, (@@I$`,$ ` $ ` @&`㿘H`>  `` ```@H`&HNa `> /> 1 `Д!㿘`  `H`3`)> +>) @ 9``2/`$QH$@" ," " $" (" 0" 8" <" H" P" L" T" X" \" @" D2 ``(`,@"&` ̔`,` !`(@`$&`(j "  n!&("&`(&`(`@2`,c逤 `,@ @&`,> > /> 1 `>㿘?ː  ( $ " ,`D 2 (㿘\& (& ,& 0& 4߁㿐 `@8 x t | @*> b22@2  (@ " ,#\> 1#@@  0@  4@ > > /> / `WԖ 㿘 `@: ` .> a7>) *  2  ," $ " $ , $ (@*.,`* $ @8&`aԴ&Z> > /> 1 `P $  >c 㿘> `@A"  @D   & $& & & 8& <& @& D& H& L& & ,& (& 4& 0& & &  > 1Lǒc@>`& H ` Ȑ ` M @ > 1#L > > /> 1 `x6(> > /> 1 `.(㿘  H P"㿘`@& AB `& P@@@㿘 >*<  ۰㿘;   ( $ ,` @@@"`$T 1` `$`(`,ΐn&``&` & Y &&% ` `$@ђ "`(&㿘\$(,> C$`8$`<$`H$`X$`@$`D$` $`$$`($`,#&`(&`,uŐ&&@ @$` @`(`$@ ƒ&``&` $㿈 ''u C\#\ 7 @ H H \ 0 8 L P T> @ D& 0> 8& L& P& T& \`& H @ $ > `b" 2 6 @& @ H 0`  8@> 8`> 2 (㿐 $#\#`"   HD` " H`2X`"%H   Ț DX`  H`2  H $` @ @&` H`" h"PH2 HP`&H $ & h`" H>B Lcl@  $  H>BLcl $ H&H㿐H`% $ #\#`" 9  H` ` $` @ @&` H`" $ h & h   T  㿘> bw> 2`  > `(`$`,@@* > /> 2 `M)j>ݒ ` ` s4 @`$:*`,D&`$& &`,&`(`&`@@0`H`2` `& 8@>8`,`)z#&$&(`$`(&H&8@&< @&X&,& &D&@&@ @&`(&`,"`,0`" 8``"8@8@>8 `㿘֐u%` @ `(`$`,@@*  > > /> 2 `Ŗa @ r ĴP㿘` @ `,`(`$ > > /> 2 `8 4㿘@ @* `$  @   `$ @ /1> / ` k "*  $@ ,@:'>  @w $ \k      $ $ \/ ; > 2  9/㿘@ @* `$  @   `$ @ .1> /" `   $@ ,@:*>  @! "    $ $ T 2  . 6$ T߀ > 2  ڔ.㿐 $@ @  @ .T #> /Ӓ`G "#'`,`$@@:F> ` @` D> `$ `" ` @"`$ `.h `.hߔ@ `0``D`2``H` 2``"`H `0 8 < `$ > 2` m.W> 2` @g.X㿘> b8@mt   p  $8l  ``h> / @ $V H`2S  "   > X H`C  $  , (@@@8 9 2   $;`@`X`"  X`,`$@:}> ` a X`  (>  $ IG `  `> /(^ߒ``(  ">> G`2  X`,`$@8> ` 8( X`  (:>  $*ӐS00> > /> 0 `( X X> /> 2 `X(@> /> 2 `h(f> /> 2 `h(M> /> 2 `(m> /> 2 `z(T㿘 @  @* $ @  @   $ +s'> /d N $@| }  (  $  H` `j  P@e K 2  c G)>B@"r P ,@q@Y d "R$ L L$ P$ L"  H`@? #l X`2$ X#l  $@ ` X@    $   2    $ H`  L@2 ,0+ư ݔ >  $:  @2 ,0> > 2 +> 2 +㿐 @ $ @` `^> 7cP> 3 @sa ꁒ $`V`,@:i> ` @``?'` :`?5'` 1`$@ 7s`H` ꀦ` `@"`H`0`"'`H`H``$`   @ & E`2` cP> 3 @ra Bs0Ȁ` h` `$c$& h0`> /> 2 ` '㿐 `&   $  '['@ ` D\ @  > > /> 2 `.㿘 @> a"   0``" @ #   ? $ $  $ D   $ ` @"g2 H`ـ` 0  &   ? $ $  2 D㿐`*@  P@* > > /> 2 `!> /% 'Q'Ù@&@B  s > > /> 2 `kp+> a`@@@:  '䀦@ ' $@8 /V-> /Y C & $@+(,@H`0@( H ( ,@   H` > 2 $ /͐7  H`  @  H% /> B @ H`   H` ג/> Bؒ/>>aha` @@&#\#`#d 29& @(2 7> B @+  H`!@ &@ $@؂ ""@#\@#`e ؀`@  P" L쿐 2  ؒ혔/~ؖ    ؝㿐'> /횔- $     (`Xms X-& h''` ? 2  .!셐 '  $ H`0` `0> 2 T`뀠` T`Oa 2 .;7.W `T`> 2"`"㿐 `2  8 D @ G> 2 86 & 8 <1`$ <`  L* & L' $'$  $  '1  ! !  '   ! !  '   `2D  @&"㿘 P`& P T`Ȑ1>* 㿐> a@Q @T> @'' P`   & @ϐ  T`ז,V1> /줒    $$    X @, ( 2$ > a $ $ $ p,{@{ > > /> 2 `g,9> /> 2 `0`,;㿐> b@ > > /> 2 `O&j#> /`''V&l  `7&nW 㿘`D`2%$#Ðk($>`(&`$'&& @&  @ "ْ 㿘s 3  `D`" D`  20 2߲0ݝp 'P`\8`> 7cP > 3@oAaЀ?9>>> ah@`'䀤 z@> ''쀎(?s' `@ ,4 ` @" > 7cPϐ > 3@o aЀ?>>>>>  '8` @4 ` @ _> /$V  '@E'@> m> / `@ >)c<" 냚 x   `@  @>)@U Pg '@ ''䀠`w?"u@@ >  `@    >  "<  8`7#\#`#d#hf  `@> / 8#\#`#h#dO  > / &' > /ϔ$  `@#`#\#d q `@> /#d#\#`˘ > /Y ?_@#\  0<`8$`L$`PP$`0$`X0`4 $`T$`\Pu`H`$`H26`H$`@ >  (@ $`D`  @@ & P @ h@뢐& h}> / `@zIt> /$`H $`H2@P U> Bc@  "P`@ @" > > /> 2 `$$ WK@> /#$'``H`$`H> > /> 2 `#> > /> * ``#@ [ > > 3 X$> /> > 3` x$i> /> > 3` $v  ` `    @ (@  2 hhH$h8"" " " " " " " " " $" (" ,> b܀$ > B," `85| `2 "> ,b21 (@`逈``22,> " , l " l@"  " " (" " " " $#: `2 X=c'`7  ( - >c=> Bcc5> a `'l  \ X@@`_؀ ֒ d$ `@* $ T> a \'k  X `@`_  d$ \@֑* $ P> a X'kؘ  \ `@`_  d$ X@Ժ* $ L> 6c > !Tb-b% >* b0b 0\ #\@8㿐> a4@f  > > Bb |0@8`q=> b' 0 (*` H1` ``g`2`X"``` @) ` 2H1*` j #>*b0jܐ'\> 3b04 a$b0 (jА"j̐@4` $ 2>`0 (`@  `) @+`+`)  )  @(@ (` (@0` # `  2u> `8|`80h4P㿐`` > a 9  @ @` "@@@h]'@@H\4`~\`j\@9? "\`Z ( /  @@ @@#\#` 8!> 3$Vג!``K H  6(n@!糔$a@@W  lc`??  A@ S@??  / ( @ @9  @>`\ !s$t``|`? ҍ  \? |? | o4``    @  @@ (@F&@㿘   쮰 㿘@` D   `d   #㿘> @b`8@@$`@@8 Dk  @    㿘> @a `8@&@$`  @@8  6@ H @@ #D6  @ c 2 0 > @b``8! @8 * >X >`  >`   >`x`@?&` # ` `" > b8"@@8 @   @? >`  > @b``8!@ 8  >a `@`` > b8"@@8 @  >` 㿐> @b`8$" @ 8  >@c8  "#> 3a6 a"   'I'aߔ"  @`' `@ `` f`c` ` ? Z (hW`U> aM8@@L  @G8@D@>@c@<'9A5     ``    h (@@c =@ #\;` `d#h#ln `&`&` &`  @ `d@ @  ` V` ` &` ߰ װ #\`('`4`=`1`ϰ $`"$  `` `2`   "`2`2` 2` ```  2` "` ?۠`|@aw` 2(` 4D   Ā ``bY 2` `"Ĭ`"` u &`       㿐-> @@ ``(@@?20@x   8 pؤ  g> 3 ܒa䶐4 P > 3 @( H`@ ; $@ `"9> 3`  4@8 H`= 0 > 3` 4 @ ,@  @ R' @O> 3 H`^@> 3> > 3a  ] > 3a!+` 9  D0@Ҡ  ,  @Ñ$@ ` ,L`` `8$@@C @U ق ,> 3aޔ!+`ǔc<9x  > 3> > 3a  > > 3a 8 㿐@`' `@`* ` `@ `%( P `"` w &􀠠  ` u'?`? g'" "" " 㿘 9> @Ҕ "> `(` 2> @ p!@8`D䀤@ 2`(> > 3>  bh > 3> 3 bhx @> a`f; ; + 83@(@;@ #y '  @@ `#\  #`#d w`J "a> (` d @%/ @S> (` X> 3@" (H`  /   @'`  @` `` '`@ @> 8`d&(@@8E2'(' > 3> 3 bhՔ ]> > 3> 3 bh͔ ^`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2 ` ?   @8 00㿘    "ڐ   㿘  Ȑ &  㿘  $ + `"   `2 &`&` &` &` && & Z &`&` &`&`$O > Bc >* b@1 @8` * *  @@ @  ?  1 @8`?`# "@㿐> b6հ ? * * >* b@) ) H ?u㿘`(H` >>c>  b> Bc10 >* bH@` ` @  2@㿘> &  & ' (`AH`@!` A ( (``(  (H``!  A` > > 3> 3 bM > > 3> 3 b E 㿘 ( 4  (H`  (   (H`@#@    ,& & , (> "a"    ? @& ?&H`@(#@> a $  ("" 0 }"    ? @&& H`@(#@ $  0`" & 0 $  ` @& H`@(#@H`@(#@ (H`?b! @   $@> Bc> xq ( `=> H`@(#@  @& "    ? @& ?&> cTU> cdx> c\> > 3> 3 b0D$> > 3> 3 bP< > 3> 3 bp5$3㿘> Bc m> ctk>*,`,`@#@ ` @@ ? E:> + )+ &   `! @ F" :㘃?> + (@&+  @@ ?  A@ "c  (`(` ?]Д  @ 0ׂ#@ @` `,** @@ !蘃?< > 3v#@ "c  (`(` ?]  @ 0> 3_#> + (+ & `"@ 퀤@ "c  (`(` ?]|  @  㿘> /#` #`  (@#`@#`#`> 3#@ U@㿘@\<`?@@4@`D 09> ! > 45  !*@  .@ɦ_'`67'\266@`2@ ` > > 3> 4 b#> > 3> 4 b8 #> > 3> 4 b`#㿈'> B> 4  `>*> 4b@       #\   ;` Ӑ@ > 4ː!81> 4ȑ!H@"@㿘!> !`Ӧ> 4+> Bc  8>*b@  (` 2`.2  `?c`b@  w.` o 2, ,  @@$@$`$` U$` $`c`%c `? w> Bcؤ$, , D@ d! .  " 8" @" D" H" L 1@*`@8` m (H`b  " 0` P@!>* b@&* &* @>*b@,,@@$`$`c`%c, ,  @@.`.` @@ \ @? \ @?$@> 4"81> 4"x>*  _b@> 4!  > 4 !1> 4"!> 4!X > 4"㿐'> B)> `!1> l%> l)`!@D!@ (@> 4`> l@( @#>B c !> 4w"А!@@f֒D`!@D@8@@$D&!@ $> 4e#㿘>  cP cP```'` '`'`'`@d'`@/> B`> 4 >* bD   @  +> aa`P@(@* * @ `U>*b@b@``  I $,`,`$ `?((@  @ `8 @@ `D H@ `L?1 `? `$ P@a??? * "@* @@ %   @ > 4$@ِ#X> l@> l(@&D> (#&@@d< > Bc '`( $($T $L  $,$\  $`$X$P'`$#(㿘 (H` >>b 0`2` (> #a"V    ? @" ? ("H`(!> a`#` (  ` `#`  0`" 0",    ? @""  (H`(!`#`"    ? @" ?"> cT> cd> c\㿘`5>  a'>>-D$  (@2,`@  ?8` (`` 2  (H` `@ bѐ ( ;0σ+ 8(@3@@0Ɔ (H` ^ ` ("$ 0 W`    ( @?" "H`(!>   0` ( (5 > P  @?"" ""  H`@!> > ` "P"    > d> P > \㿘 (#"i     ( @?& &H`(!>   (? 0`I :&> cP`& ` ` (H`@$> >B\`  (`>Bc H`$> cP` & `  ` > cT> > 3> 4 b+% 0`#" 0"> P> " ! ` ( H`@!>   㿈   > > 3> 4 b#> a 88  > > 3> 4 b#> > `> a4  8b k9  <b8` 4`> k@  @8` 4J D@ 2 (`" ,` " ( ,4  ( >`0> `%>  @?`'#\#`'     @    > `5> 3> 4 b#b۰   D `8` 8`B > `#    @ > 8>  @  Đ (b! (H``I! H`!> > 3> 3 b0%#㿈''[> a`@(@ 0#\#`  `>  `? '@'`7i `',@E  '`0`(H``H `(b > @`'@> 3> 3 b0Ô#> 5x 㿈> c> cĂcĤ`.0@''#\  #`N  B" 0 (H``H  (b( 0>  ? @"" .  @ D    (" 0H``H  (b  '> > 3> 3 b0Z#a㿘  ` (`N   (H`    ,& & ,`! , (`> & ,& `  (H``  ` > > 3> 3 b  > > 3> 3 b  > > 3> 3 bP 㿘> 7cP> 5 @Zka>Ԃa1> $ @`7#> $ cP`d`H$ $`d `d_u#@` 㿘.!+>  a`  />B->B  "P ( (`2@@7 (H`   \ ޴@D@(H`` _' (@@͆ (H` `@ " (  `" (`  ; + 83@(@@㿈'X X`` `#\;`@& `?@ L``? J`" r`pJ d@`68! ` 9 `(@( ` `ဥ`?@o'@ &  @$`? ` 2'@0'`0> a``  `` 8@ nҀ ɔ` `$) 0 8 (@@'@  & } @2`0㿘3>+aL 8  2> > 5> 5 `8 ձ0` #!>+@^!@8`$ (@(aL^"&`"@^!@!@@^&`> Bc5F> > 5> 5 `Xo > > 5> 5 `xg 㿘> b.@>B@c#㿘` >  `> Bc &> 5> 5 `D > 5> 5 `= 㿘)>+@^!@>+?aL>`0> > 5 !@P`@ `"`@`@# 8`)   8`@2` '  _߀@@` `@  D@@ 8`2ݠ  (@@!@@^$`@, @!@@^ 㿘+> a`@?.@@@D  /`-2> (`'->B  0'>>@!> (` 8@ a@c, > 5> 5 `! > 5> 5 `! > > 5> 5 `!㿘>+.!L >+@]!@> > CcP `` `` `d@` @ 2㿀 'X`X` @?耠@4?耠@> `` ;; :`4&  ` ;-`  &'  + `/>>>  8`@D`@```'>  @@e䀠`X2 `(@` 쀈`` ` `N`(H``!`(` Ո`(H``! $@ `2 ?&@`D&(` @H`` !$@@>B@ `(H`!0(S & &+ 83@(@;?@ + 83@(@F@%@!?@#> !?㿐>  8a> c<@' 8@8@(``#Ƣ`> 7cP > 5@V̒a 0d  00```  H,ư,   @ HԒ@ (2$l   / 9>B97>B@@ " `B (`@} %#\@D@(H`` (H`  . " ( ̀` @"Ȁ`> > 5> 5 `(ߔ#@ ( (`@" #\H``  ֤O`"  0`  "> 5(> !@@ > 5 4"Y 0W@@`> > 5> 5 `H#Qg*!x> > 5> 5 `##㿘> a`` 8@@K *`,`$`<$`<`< @>, $`@ $`@@6 $`H㿘>`0`> > ΦPa> $L`@ PH+@[` 2 $` ]( ` $`$d@[tP  0@"   8  8@ %  Hod4 (@e @Hp@@[m ,@Z@[G0㿘>`0> ` 3> @[Wch> #Z1> ch" \ݕ"> 5!> 'b3> 8@[Ech> #Z1> ch" \˕"P> a@8'> c<@' '(> `'#'Јp'Ԝ#'''''ĸp'   7> `2X > < 4@ 8``  @ (`8`4>> `$ @  `(@2````20(`$(`(   2&p>>$ @>``$``"> %@5  ' `M耥 &'쀥 J'4 `$4#\#`#d    =`Z '> 5`(`W`(H`$`(` 3 `/%@x$`>>$@ @   (@2[X'쀥 '"@@48@$8$`(@"@?@  >B >B#\@Ӏ H  -Y`(````4`%`($`4H` @ `(`2P0$`$$`( C @(`4ph "ll@ @W `( H``$>>b$ ଀ `]$଀`"` 2h-`'%``$0k,`$,>B\@>BDH``$< `$p@Ӓ %` ``  @ǒ ` ``( ` `` 8@ 8`''-`(z'4''`$4#`#d#\ И ֠ߐ"P@8'@   2 H`$F `@> > 5> 5 aȖ#K` "'` ` 8@ 8`''f> > 5> 5 aȖ!` "` ` 8@ 8`''Ĕvp`> 5dl"`$8 ) 0 (@9 @''`$8 ) 0 (@9 @''> > 5> 5 aȖ!` `$) 0 8 9 (@'І@q'> 5> 5 aȖ"> > 5> - aȖ"1> > 5> 5 aȖ("D㿘> > ` > a4 9 ` ߂`@ @ @6`%`d`2> > #` 2 `2d`> @@Dlh"p > cP 7#<`< @ 00`+7>>/ (2'  `"#   ` e2=0$  < @0`<` @ۉ0` 2 (`݀  4` ($ 4H`@  (2׀ Ā  @V<`%<`   8@  @_  (H`   $) 0 8 (@@@E   ( `H`  ( o+ɐ#X 2N> Ð#` 2H># M I! I> #X8> > 5> 5 aȖ#> > 5> 5 aȖ#㿐>`0`> P%`DHo@> a > 5> Bch> 5> ܸ`;> +@W,` V ` $ `$ `0 x$    ? @$$ V@Wv@W`8 V`@  `$ ' '@Wg " @@$D`$D "    0a4@@8`b 9 68` `4?1@D ` -8`8`BՒ?@  ̒?` XØ `8` $'' %`< ˒ (? Ԗ  (2  `"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2`<"1@`2-< 4-"4@`"" @4 "D`8 8 @4 ! 8! @ < <`K < <4@"J 4 8! < 4`<2@ `@ @! @ɒ 8`"8`@"7 `@8 ";`48# @ ! 4! @ < <`*#`< <4@"? 4 8! <#`8` 4 `<<`1"`<<`4@"#`4#`8 < 8 "! < 4! < 4 @! @"! <#`8` 8 `<<`"`<<`4"#`4#`8 < 4  4"! <k#`8"4"8@`2`@8 "`< @`w`<  @"@`2R"@@ L`4 @`24 @8"`@"`4 <`<`R <`<4@ " 4 8`4"`< 8`8@`.4 8 @`y"`<@`"`<`@ @"`@ @4`"`8 `<`<` <`<4@ " 4 8"`< 42"@ @4"`@"`8 <`<`F <`<4@ " 4 8`8"`< 4"" 4@`2`@ 4! @  8 @ <<`K! <<4@" 4 8! 4 <`44`@ @"`@ @8`"`4 `<`<` <`<4@ " 4 8"`< 82"@0""" 8@`2`@ 8! @  4 @ <<`#`<<4@" 4 8#`8 <`8s8"""㿘`4U`824^`<4`28<@"<`""`4@"-<"`8<@",`4`4 4`8 8`< <`@ @`<""4@" 4 8`4`8 `< <`  `<`2`< @"`4`4 4`8 8`< <`@ @`<ْ"`8`<`@"<`""`4@""`4"`8`@ 8 2 4< 4`2  4@2 80  8@ <`  4 2 8< 8`2  8@2 40  4@ <`   `" `6 8 4`2@   *`   (@ ` ?@@ 㿘    8 "  4 㿘  א & 4 8 㿘  $ + 8`"   4`2 &`<&`8&`4 &`@ && 4& 8T &`<&`8&`4&`@$I  $`$? @ 8`8 ?@@ 㿘    "   㿘  א &  㿘  $ + `"   `2 &`&` &` &` && & e &`&` &`&`$Z ? <`< ?@@ @㿘    "   㿘  А &  㿘  $ + `"   `2 &`&` &` &` && & . &`&` &`&`$# 㿘c (& (㿘֐`<`* `P @" `` `? @&@&` (`@ `@㿘ߒԁ㿘`<`* `P &@ (`@`&`` `㿘  > `8 0@@`*>  b0@ 80@`   xu P@  P` `80@8 8㿘  &`," 0 ,   ?&`, `,&`0  $  &`,&`0 0`, & 0 > c| @( 42 8㿘>  8a`0 h "  ` 8 < 800@@@  /  㿘 > `<a`8 0@@  ,> a 8 0@%? "  m  8 <0@@  80@ 2  뀦Đ $ &  8 <0@@ 80@(2 Ӑ `  8 <0@@ꀦ 80@z2 㿘> cP`8 @ @( ` `  $ ?  L  2$`<㿀>`0> `PD4> 5> bȪ> 5bТ 'bВ; >  " > 5 Nȁ㿐> 5#> c`A > 5> 5c H> 5c``  , @M  1?   <&? "  < 2 <`` `$`( . @  . |`,`2˲`1> 5u#p 㿘OM C&&  >  <b`8 800@@@#) &  > `<b 8`800@@@) &) @@2&|2&0) @@@2&pm2& &> > 5> 5 c(!%㿐&`"sg`<<@&`< <`c <<@ <& <(`&(㿘> `8b0`<H& 6&@(`(`@, @,  ( @@2 <+> @(> <     ' P2( 2&`<@@   &<8˂&/@> 5> 5 c"㿘y㿘> cȨ > a "(  :R, "((K,(`"G,, @``,` `80@`: @ ``80@`@`,@``]`T  `<`8`0@@*V @@ 72, `8`0@"$`<(`(`@$@  @ `<(`(`@@&`<((@@@  `ـ Ȑ~@& @  ,9`<"@$`<*` *`@@:"`< `8``<0@@: >  `< > 5> 5 c”&㿘`y> `8a 2K-*@") 88 0@ */8 8 8`8  @:@28 8`8  @@0@` ?!  @  ?%` @ $`<  8 800 <*&> > 5> 6 c0="0㿘 `> `<`" @`P  ? .?  > > 5> 6 cH! 㿘``.@`  ?<@8   (`@`.> > 5> 6 ch 㿘> ct D D  @ń D  $$ $ $ $ $ $   > > 5> 6 cpȔ%㿘+> @Jch } y :> @Ich@Ich "k> 6(g> 6 $($ $$n$? > `8a 00U 0@Q 2`8  4>  8a 0Q>  <)`  80@R <@@F$ < - - @ @"`<`pΐ `$ > z#|> #@Ipch1 @Ilchv> 5> 6 c2%<> > 5> 6 c*%X> 5> 6 c#%b> > 5> 6 c%s> > 5> 6 c%r㿘> a``8`@66@?='> @IKh?>  Ր#| .> c 0 0? @ $   @$ ,@$ $$ 0y  ` `" , @  , 0% 4 ,@Hh&@@> > 5> 6 c(%㿘!> #P 8 0$ <$ 0$ ,$ 8$ 4> " b?0@` ,$` ؒu> cc̀  c̠`   P @ @ `@ > > 5> 6 c@{"耦> @'̀`  `?@> 5Aܒ> ``> ` \`  ''\ 0`'> @Hch@ '`?`?''Є ''''Ѐ > ` > 2cP\܂cP`0{آ ( '(`"n,` @:g,(`,''@' +> 'Ȫa> 860*32> a`<``80@@`8  @8 [&& @8 `$@ @Ж@{' J`Ȣ$@2(``\` '\`   ``2`  '\'  Ӗ ```\`> `..k.@ DЀ > @Gch  v'`'Ԁ`a'܄` @2U2,,`$$@`2`> a`> @h@Gq%`` @ U'\ 6"02`%`\ ''\|'V > 6' '\'``?'؀؂ ''؃(耠`\ \'' '''> F7#'> > > 5> 6 c#㿘`N> 6> a > 5> 6 cN$d> > 5> 6 cF$\)> @F#h> a> EԐ"  8.@ #h@Ff)> #h@F~`8`80 @$`< $, , @@`80@ 2` > > 5> 6 c@ $m㿘 7 6b %@H`@ H`~  "%>  (@ (}ϐ (@چ (> > 5> 6 cP~є$%> @Fh> a8   ``* $`|28> " EJh@E㿐> 6#!> !!   > 6#     > 6# P \ T X L `#\> 7  0 4 8> 7 ` < @ D H> 7     !L> 7 !P    > 7!> 7!H    > 7!`     > 7!    > 7! !!!! > 7"> 7"X!$!!! !(> 7"x!<!0!!,> 7"!4!8 t> 7" d x | > 7# h  l p> 7#H> 7#> c> 7#㿘  $(&@  $ (@'`>`(``$ (@('   $$( "@8(`@(@ >+b)2$@ " $@@2$D`$D$H!$H$H@"  dD?> "$D"$Hd d2  $H@$D ?> "$D"$Hd d>+b```"` $(4$D$, $D2$(` `2` 㿘 $$@"$$㿘 \ `: E* `&$>` \.` .`<@&$㿘>+b > a  "  $`"  $D2$ 2 `8` 0`( ( @ 3Ȓ$D+ 83@(@@㿘>+b20  "$ ?   \ 2㿘 >+"C 0.@+ 2 "" 2"  `"   " &  &$D &$H @>   dD$ d` d݂ R \& $ $ d` d`&@&`&`">+" `"│  " Р㿘>+b`5> a``@",` d`"$dD`d8` 0`( ?@ !( 3 0`(`(`@"dD? `@ Yd2?dD@2d` `2`+ 8 3@ (@ަ@㿘?F֐> adR "_> $ @S$($0$ dn  25> 8$ @&$ l> C`( %&l @b "`$($&8`(`(`@@ " `2 (`` `@@" @`@{- $ @&$ l> C`( &l0> > 7> 7 c|(&O> > 7> 7 c| &Q> 7> 7 c|&P㿀> a d5+>+b+2 ! "  `"$D$ $@4$D$0    #\#d#`f "$D$D 2`%  /$H H$H@"$ dD$$D?$$H$$H@"$ dD$$ @$$  l% l$(&$$ @$$  l% l$($$H@$D$> ̒`\ >;a 㿘 `#`$T$P& $X# `&$T0p` p8:$T$P6 C 2$T & 㿀>+b   #\#`#d f &$,&$(> 8{ P㿈Ho$4>+(@e>+ qaЬH`<" " " "&`@ " `H>6( . 0$X`&&&&&&@Ho$4(@e` `% LtHp@|<`@E$L$@8`'@ 7e 耠\$L< @@  ;R"@4Ho$ (@e >+q">+Hp@`0`,`@&0>`@`&!Pc!&,&<< &@ &<@ &8&4&H&p&}>`<`  @&"@`t&`<`  @& @j&2$L> 8zA `Ho$*(@ %>+`0&`4d&`0>+oaȐHp@Ho$(@%"oee%㿘`d(d, &`E "d( ``&`d,  d d$ d@ 4`*d@> c\ ` 5dd> h  @ h*d@ "> 8ΰ >+d(d,bb cd0 q \*d|d@y (`> \((aT  >d@`@! -;> c\ ` 5 4`]`"  c\`5   > &`a< 4 ( @ c, 34`b ٰ > Cd4` > 8xb #\ ? \ cz `x&d0c\G>  > C`w`&d`&`h&h `4ז c\P  0` c\P`8> A&dL0`Ā"W  &dP, 4` @dX  > + 83@(@@? `\P`4`@2 @ < *` :`82`( < @@ $3(d0b!  $> 8x! '> 8x!@0 b  c\> 8xѐ + 83@(@ۮ@&dP> 8x > 8x 㿐> lb?U> 8  2K> 8 \  $ \    $@$` [$d@$d [ \  ?@$d4 S ? dd?> 8 3`@3` `w`a@d $d >`0 ƒ " ϒ vd@d  \  \w!xw!`5 d> w]`0dd> 8wV0ɝ@> c<@' 9> C` @`r`, ` > c\ ? 2 @`> 8`ڒ Z``"r` 6 @ > 8>+b`< >  a0`-(@ ,4 @$ 5k$ $$5d` Ҫ`$Dd" $  8`0`8+0@+@ۤ@ 2& > b` & `2 `4`"`|  \ ` ɐ   ٔ0   \   $ \    $@$`4v?$`4`"l  \  $$ 4ݐ f> 8˒ ^ Ր|`4`T # \  \0N$4쀢 G$ R D 'Ђ?'''''D 25'@  *``"& ="!$4쀢 "@> 8w6!J"> l`   \ ݰ 0 `$|`|` |w!㿘`  , @ , 㿈%> @>h'> ``,@>|h$ ''7> ccĂc` #\#` ܘ 퀦`5 ? ``@@  ` % &(H``  ?'``@@  `   㿐> >+> b ` &#\> 8 "( \ `ǚ >+ ! b    #\>+> 8!nbX >+ "  > 8b`n#\ˁ> cOa "#\> 8v~!> 8v{"0㿘  Ho4 @(@e @ <`@ @ $`@ $  4`2$  `>+k" `"`@`0d$`0 $`4 `2T `T$THp@`2T `>  `2T>+k!ƐT> 7> 8 chve%h> a`6``> <'܂`?' (`'@68@(`'H`'#`'Ԕa '耠`/> C(H z;`+@ ܃, '̧4` @4  > c`8Ā@}   w`8@ r@p 2  Ho$(@e  >`0> `v -> l)@Hp@ ‌`\\Y THd(d 8`(`(`@ 1 d(d 8((@ ` @s〤3`8+0@+@@> C`> C(@ '耑t/HH ;`p+@Ԃ C @ . > < > 8 Ԓ >  Ԕޕ '̢j Z @'d(d @8`(`(`@ >` > 4 !  , @,> ,< < @Eԃ-@(H` @ > a` (@@Ѐ`2H> 3ɒ > C `  ݬ'  /  G"܀ '`@> % 0!P% ,c!`W% % H% p= % Ho$#> (@e#> `m% Hp@> ̅.% <% 8 > C (% `0% Ho`(@e`p` pHp@`> >`0 0``@ @@% 0>Ђb% 1U  > % HHq01IP 0܂d@ J( 0d|䀦i " `>  *2c` > @!W  (@8` 8`@@D > C (`倥H@Z ݀d(d$8`(`(`@ 5>  +@@ZѺ`גHo$4 (@e `k̀` @ "@@icHp@>  אܫܨ0ΐܡ0㿘>  t'D`$ t  pD $ p   p`$ p> > 7> 8 cs۔&   `?>aD*㿘>  a 0(`    ( 3  $$( &58`$@ 44` (@`, @9`9> 8s]"+ 83@(@@   2`0 d&`4&`0Ho$(@eHp@80`0@$@+@44` +`@, @ˢHo$(@<`&`&`Hp@0e$@㿘!> C `@>+!@@#`$ 㿘@7 > C$` $㿘!> C @` >+#`" $ #`  $ >+#``#`㿈> C(`  (ؒ 8'8'''!>+ p#`7`耧`#`@&`&`&` `@X&  㿈> C`(9 8'8'''!>+ <#`7`耧`##`@&`&`&` `&  @&&&& > 8r`"㿐` @    -;> C`3h' `'`> C*u`$> C*o` 㿘 x@> l>(@ @  `0  >` 0 0@@#l 4 00(80(@@(#l㿀 ?ِ` "V ' L'' H`P=> c> B%>c!@" 0G "= ' L'' H`8> 8 L`"  0`" @@ ' $' $'쀠@8'`x `l``(@$(@*'쀠̂ 'ƀ > 8q#p  (?r d H`y,0,`0`@=@> B>  a ->a@" 0ܐ G H`]> 8 L`"  0`" @@  $ x  l  (@%(@*@c(`aH@#@' ''#d#h#l#\  #`/ " "#`D#\#d#h#l / `&D> 8q#㿈 @ t> a`8 @8(  ` `$&@  d`(@@@@ @ @'&@c#\#` ?`? &@ > 8 pm#0 $@: d  @@` d @0@ $ d ` d&@0@$ d 㿘 > b8> 8p#X `" p @` `?`s> 8 cx& "8͖   @d`?(``?`S `& #> a` .D L' G  ''?''''>0  @['쀧 8 ` ,@ `@829&a0 "M`  & `-@ (` "    #@` +@ `@̤>`0`,’ ŀ aϤ @~06 Ԁ -3`   [|.  @ٔ">c  㿘> @  @> 8 @8@> 8oՐ#@> @C?b 8 8C 8  ?@8?0(  > 8c & "7     4`   `[``&  b>,XX`& X $ X & $b& `C& >`0``+! 2' > C`,  > &  & `>,XX`& X $ X $ $b$  " 64` &  6(&   |> `0((`  > \aT  `h  2  `(    @@$B   |`> \((aT Ǡ m >,>,> 8 aX!H>`tc㿐d`@K D `   %> H`` &`8`@DR'  ( (` '   ר '  > 8> 8 `cتȤ />B )> !8`@D2`"  ' / ( (`H`` &H`` "6   ӥ' ډږ    (H` D& (`5  (H`  `> a > <' @8'܃('؂`#p` '  8 8; @ @   `(` 쀥@ ''  ; B 8 F  ;   @ s `2s' ''; 2`b(c`(`2>>>B@( 8H``$(`C`0`f>>> 8`@DÐS䀠`>  `> 9 ` `"& 5  `2  a\~& > <@ e܁ǀ```À` '䀏`"> "/>>(H`` "> 9 5r(> 8`@d@l($ @ǐ> 8`$ @ > 8`H``$>>b$ ` `ކ'';`#\ߘ` ```"ԆH` Ԁ 쀠F `.` 5(`V(H` (H`` 2>B`0`#>>. @2`20"쀧 쀧 2`>>$ @ˉ$ @D@΀`3P(H`$0m`@j`M 'm Ɣ  (H` > @8`D4@g'c' > 9kb x> 9k_ 'H`<` $@ g(`> <2  @A'> 9l 8> > 8> 9 clD"> 9>Ր!@㿘 `   Қ > 2> (> 㿘 `*`2;`H&       `> 9 a `"& 3  `2  `  &  2"&   $! $ $? @& & $& & > 9k!㿘 `F&  8 B& 8&     l   & `-> 9 a'$ "3  `2  "    $ $ $? @$ $ $ `>  ` $     . 20> 8> - ck!㿘)>,ސ!H>,aX#>,aP$aP K$ @"   "aP 2 P `2  `=`$ aP3$ ($P 퀦 aP  0&o ( !     1 ` b?  $ $ $ @ & & $P&  ( i!H ($P$  㿘 ` ` $`  ` !>` 0$`   'q(  '`㿘 @'Dǂ D{ " @ @{   @ > 9jaP 3 @ ǵ    D)+ K 㿘Ho&4"(@g"䀠" "? @$"$"Hp@t" ""  " $" $"  >,> C a\>da  P㿘" L  ? `  0> i:%?`$ l4 \>>܂bt!$!$!>?H, h$!> :`$!$!o$n D X̖ Ho&(@>,\\`$"\" \$"Hp@ g>,㿘 aF@@ 0H@"^00H aJ@G@b aF@,2@1@}@tI@"b" @:2@@ @ aG@"9(aH@#0aK@" ("`$ J(B" C(; 0b`ـ`װ /  0aH@В0HaH@[  1 0aG@0HaG@  @ (  " &"   $  ;c& l aF@n aJ@  aF@ 䀦  " /@g"&  @ 0  ` aF@ aF@ >,a\ d `"""`"""`"" `2" @2"`2"@2"@Ĕ  | 2"`2" `2"`2"`2"``2"` `2"``2"``2"0C i$ H   ] `Y aF  V    'A $F   '2$Ho&4\(@g\`@j4\Hp@ a>, /]>, /`2]"``2Y"0@8 w 0ܝ㿘 \'H`" H"``" `HD 2 @> |6`"``HH3 / `@H2 Hs 2 Ho&4!(@g!`.H!!䀠5H `H`<(`@a" a H`<(`@ a!&! `@8`Cl> Hp@0 `@rH (<"H! 2!HH 7!`&!Hp@㿈?!Ho&4"(@g"`*ϒ 'Hp@  \d`"  "`` @" H0р`" D `" D|2 "`` 0@  ͐ " D`"6 `t`   (```)r`)``a`y     @"  @  @  DXX @  @ @ " @> `.` #\   @[  0j!`" !o&!k؀ ' `  ܐ@ ['     0@`2  ! ` ``)   @q    㿘`#! " @  $ @ ``@ ```` `?. > 9fĐ!㿘`  .@  $.@``.@> 9f!㿐L ''L'P'T'X'H@  (6 >,a\` b`2 bb䀧`b`"bb"b``2b`2bFbC (2b`\`"bb `2bb `2b䀧`Ő& a<& (``@?` @8`C?` @> "c<@' `"  ``" - /@ P> 9 !<( (!< 0> eM# @"0'''''''` '//'Ԅ?//'̂`7 ( @``&`! L   "g"(08! ~ x a㿐' lC>,a\ ? `` :" """`"" `2" ``2" \`"" @{  2"`@t  2"䀤 &   @< `@9 C< @R!ѐ!@> "c<' "   `"  f / K> 9 @C"0'''''''  ' /' /' /' /' ' ' ''܂?7`̐ ( @`ŀ`&`! Ή   " f07!Ѿ Ѹ a㿘` &` @(@ ` ` ` ` ` ` (` <0`   `  `  $ ``( @ `㿘` &` @(@ ` ` ` ` ` ` (` >0` , , ` 0 `  4 ``8 @ `x> c<@' ````" ` @ `"` > 9 '''''''``@ `?@> DaЅ.@/ 00``(`0` la, ,`0`"I4 @`p@@"t,@>  2۶@` >@϶`䀠`,耠`쀠``<@2` @,@  쀥`8`H``4`X@  "ۀ``f`"5`?c]> 9 cB!0K> 9bb` ``''''쀧` c >Y``@̔  `cc```` ``''''''?'`, > 96"0㿐`@M` ` F`l`H `  o 8!#"X!$4`, ,0`0>,`,a` && 1`?4`(0`@b@*` .`0O 뀤 #\ R  6`>Qϰ "`l`l` > <> <`,, 0`0A4>,a``,  1`?4`(0`@: 4` .`0Om 逤 #\ RE  6` 14`[4`> <> <`, y㿐 @>4 `h y >`c  ,`_ 0`[ 4`W 8`S"S  `"J` `H```E /`@h 2< `&` `` `?`cA 1``626`` `"Y`6`&`  -  d̐ "* 1 `& 1- 0` ##`& ,` & 0`& 4`& 8 , `  2   `2"-  1)#\>, Qa` "` @Pڐ 0`& ,` & 0`& 4`6 >P& 8͐ `26```- 6`2 "#\0h> ` c<''' 3``0 /`", 1`2  , `?c" 1 ,` ,''' '''@' "    > 9  '#\ H@ "t H 4`<'@u, w@ ` 0`2  > 4`2 > 8`" >*#\2 P 0 @` 0` 4` 8` >`;>@$ ,`$ 0`$ 4` $ 8 p$ ?$ $ $$ (4 <$ p> D`̀P 0 0`r? 4c2n @1?*@$ p4"@ x 1u'Ђ`0` @`"@ `   @ `@`+`   8@@     8@@ ?2  +` `"?`8+`> lbȀ 2 0  @ 2    `"   `" `2 !   0"`2`2 ``2ऀ@ > Ch `` h(`(`> l H> 9c  .?`2 ?2 0`. 0`0 : : ) `` )? ?0` ) ?` )  ?0` )  ? :`)  )  `2 `2` :)݈  :)) ؈ )ш  @@ `  @   ` (`( ` \  h`A`A`? > :a. |"#\`2@)l``"@:@ ("` ``" 2| > C `И  ߂`㿘`@]     㿘!> l"Ȁ @20@2  6F " " "> l"`" ` " 㿘  1   ,  $ '!$ @d$ $ $ 㿐 @*  ' `2  `" @k  2㿈> 9c> ?c<@' `( &@ % 3> 9`/c& & & >`0`@8  ?) 2).@ > 9> 92"P2"h㿘  > :`` >0`>@~  @ @ @ @ 8@`?㿘` ` ```  > 9# @W   ``  ```耠` 㿘Ӑ?  `X㿘Ȑ > :a`~  ?;> D`Ta<@2`ސڐ2`` 2 `  "` `2  2 2 2 \ X, "Z`Ѐ`" `" Y" Gh<"`\ &< 0iĨ$>0 @'>0- c jh@8jh kh@8kh` k膀@8kj膀@8j>0ci@8i- c i膀@8i î`2> : ] @0ـ   4y 2u p2o  ` "h  4Ԑ_ 2А㿘  20 `"  ``2 `@S  2 x@`` `!<'> c<@' '؂ ' /''''/ِ    4@a2 < 8`>" 8 @ 9" 8H"  h H`" 8 h " Th"T 2 82 8T T 8`" 8ӂ 2h 8@逡  8ł > 90" p> c<@' Ho 4 (@a `& Hp@@ 6> 9@WȐ   ? @ & &  `"      '' '''''/ /! @a2i 60 0"㿘 " 6V 㿘> lbȀ`2`0``@2@` ` @"`` `? &@&`0 6p> c<' Ho4&(@a&` " ,`" ``"<   2 , 6b  @$`$ ` $` $ $$` `" ``"2$  2 6Hp@ 1 & b> 9 2 Ȑ , Đ @  2 `& Hp@0  `$ $ `$  $@` ``a''' /'''' 7/ a1  &" ? $$ 6 ` $ Hp@ 20@W0/"Hp@ 7 & &㿘 6    1 & 7&  6P 㿘  > l`" ``"3   2> lbȀ 2 G> : D> : 2   " &  `& `$ & `   `&    "  `$ &  `& `$ & `  ` \= x㿘Ho&(@gX>4h2? `22  `"  @"  +& \` \&  ` & Hp@cHp@> :[+  @rX &  h> : `\5 > 9c c > 9` ``||'''Ȃ  //>  c<' ''//''''''''''Ԡt @ D@$'x ''|` '<   > :a> :a`0> :a [   H  8 8 (> 9@ `" ` `&`  @8`` 80`   .3"㿘>4`h   0@#  2 ``   0`   4` <`\ 8" 8F 㿘 @c ` ``Ð Ā?  @ Y  Ā2ǁ 5   & ڐ 0> : aX[?`00՝㿘 a<n  4`2  <  8$ 8`\ 8$ 8 㿘Ho&4`(@g`, ````2$a `h`"a Hp@`p`&`$ "*`a>jT`\`a` @a Hp@`p&`T`\``؀   ``&`> 7cP> 'c<' > 9 @cȀ``" `\`2`-```2 /`H`造`" `H`P@ $ `0`,`4`8`<`@`D`\''''''']`\`-``p`t@h> Dc_  `H`|`^`H&|`L&`P&`T&`X&`\&``&ـ`Ӑ`h&`l&`p&`t&> 4@&> 4@& B'`d&`d"&> a4& |&ـ`2`-`2`-``2`-† `X"`-  > 9 > Dc  0> :bxY  ' "]  Ȓ 뚔   (* )"" Ă > * (4" " `\`k `" |& &>4`h2w `h`2 `&(`&,` &0`&4` &8`$&<`(Vm&@K`H2`H  "T`\ &T`\`&T`$ `d` @e; X&O&`뀠`"``| /`> :bHY{ h@  ",`h`&&`&d&h&l&p&t&x A  "> Dc"0> :bYL +Ӑ"`X''?'77 ?'''  //'/) > DĀ`"Ă &> 9> 9,cL,cL` ``"`Xa<''''/'/''''/''7'/''Ԧ 4  `@l   8`҂$ 8<  D@a<('T'D!'@'H'l  Ŗ ' Đ͔ m> DĀ`" Ă  &" > ` > @`8 > 9cc``Xa<` `''Ȃ  ''7'//ߒ   `@  S 8`$ 8<  D@1a<('T'D!'@'H'l  q .'z > DĀ`" Ă  &" `H> Dcf > : Xia0a" c > :`0cXY O`8z$ 8``9$ 8cא`0> : X<c01 '> DĀ`" Ă  &o"  c > : X!b0D0<@C<|<8c"Q> 9> : cX`0F> 970> c<@' 0 ak@ 0aj@ƒ00`l@" 0H0 aL@"(F0aN@W@   @]@ > 9P@!0JO@뀤 M@瀤  i@<0g@:   d@f@4  > : -WcX0ւaJ@1aK@ ɐU@V@ @@E0H  1?@@ / 80H ae@ @K0a@J@D0H"@qI!@Q H @"M` @EF@C` 0H"@eI!@ l H | 10H%@" |R Ha@! a@"$d᐀`@`^ - "[ @U@  ʐ b@`0H`" ``2 ``2` ` ``"w` `#0H)"ؐ@4-@ׂMG@ߒ%@2 ڀ`@" Q%@0H @ M a@Q @0H @R@20H M  1?> a4a4  ?> a4a4  " " " " > 4@"  > 4 @" @"6SI@}Q@2] & & & &   c @:&&   c @:& &@V@S@2 O@łT@2*ᐠ !@|`!: 0@("@2\`"z  ` & d& h& l& p&  t&$ xj&( & & & & &  &$ [&( ( & ,& 0& 4& 8&  <&$ @K&(  G&`lD Ho (@aMHp@ , '  `@P' / ">$ $(PTX\'''''''''''ȈP@!  tpd'' 0((@@hi' 9' `/@js$ 6 0" ذ " + $ + 0Ϡ  @1|@ z 0À$X `"`X }"`$ \` \ @k G` > : Ukc02` p> c<' :8 @h0a@@"b -  2T`^ @c0a@_@ - L "ې 1`@D `?  `ΐ L x @i  e\` `'l`'p `2 / (' a0` ``"`" `"` 0'''' m0a@    Ĕ   QĀ n 1 `2 `  ؚ @܈ 'Ԅ'''@&  2 0a@]Ԕ x @-  ( (ߒ\`"E' ` `֒ |Ґ | '8 Hwa0#" 1Ēx k  ' e'" Đ Ț @̈ І''''А @Ӣ  " > 9&ΐ"''' ''' ( (\`" ` ` 1 &  &> :SӐ#Ȓ @!  x @ k \f   ] ]L ^ ] ] ] ] ] ] ] ]D ]$ ] ] ] ] ] ] ] ] ] ]㿐 ```` ` *#\> C   t0 9> C p  9>, !   9> C l㿘Ho (@aDHp@㿘\ x>,> `< '  `'ጐ ( "``X+ ^ '؄ ''''''/ـ`0/>,apap@"` `>`@@"`@`@2`>``$` 9> :ؐ Đ ``$`0 `2>,>,`2' '''`@ ``$```$`0%#> C`>,>]c(!p㿈'T'X'H'L'P& & `T'& ( :`@`. :> C `"> C` `  `  ` `T ( >,`  1`2`2 #\`H"  @Fa <>, & Ho&;(@>4``@`D6@`H <& (`@"C'@ (`@ ``@'`@> pH/`@@ > @`lHp@ >, ` g>4``@`D& <`H`;'`H`L`2> U>  <㿘` S  L``.`> ;R! >    ,  瀦 * … -¸ ۀذ -Ho`(@Hp@ɀ`İ ) a0`` Ho (@a>,ElapHp@ > C> C`lpȐ `l` l0> c<@' @0Ȑ@U  20, "  ` j 2 `> ;->4`/> D 0@`` ``2 ` ``"<`Ģ2@ɐ@Ud> 9c,c,`` ` X!<'''  '''7'//ِؒ `<Y@ x> ; "! ?   `Ā2``2"!<M` `$` h@2R``D@2` ` `8$` wh`(  ے  D@ 4`|' v''r'!<  / Ȑ  D@ې`4'`  '`0 '`'< `vV0C]`"`  Q#` %h#"> c<@' `?"$?`2!?J@`% `." !    `q`.p @2H `? ?@ Z> ; `/G@)G(H``8 (H'H'L'P'T'X'\'`'d'h'l'p't'x'|'''''''' AGG=m && &.&& &&.?6 X 6 .  0#"І (%> <' ''''''''''''''''''''''> ` > `8( `` ``.` > ;"ِ"> c<' |  x@ݐ  0@> 9c|c|` ``> 9` '   / //?''''''''''''///'' ^  > D > ;c? > ;O`80""㿘 2? `2"" h G   % %   ? 8  %  G  `'> C@ฐ@? > C@8` ހ  2` @.` ?.`  .` .` ?.`  .`  .` .```Ƃ`` .` `  `` @   2 0㿀  `!> D#`2= 0 x (!> D> :a` @ k 2``@!> D``@ ˒ B!> D#`> ; 0 aOH##`ϖ`0 0> ; `O<#> ; `O5#`      #l#\#`#d#h> ; Oax#``0 0> ; `O# 0> ;?M!P㾸> c<'   x@ 0 @C X \76  /-'8>/,74 '<'@> 9c\c\  't 'p` ?'''  'l'x/d/eHo`j(@@ Hp@ u // > ;   \`  ` h` `߂`&`  `@?l'쥒 lp't''x,''04''8<''@D/'' @! ?'' @@@a*' ! /a4 v> 9> Dc? > ;NSa0 @dٔ ޤ> Dڤ?c֤? > ;N?a0> ; Ɛ#M" 㿀>  hc<'   ld> Dc> ; 0bHN   2> ;` ld> Do h` \(`` 0`> Dc 0> ; Mb0݀`> 9> C`c 0 s#(c c ` ``''''䀢 > C > C0㿘 {v````.`㿐 @ ¸ '' /' ``" ````` ` `` @ @@@ @ @ @ " ```````@ @@@ @ @ @ @ @@  *   &2     & 5-?0@4#@ (`+`? ? &`  @ @@@ @ @ @ @ @@@@@@@߬` `@@@`"%-50?4%` ??5-?0@4 @?(`? @ `0???5-?0@4 @((k  rq& ``>`2;`;``` `2``c "w ? `& 5-0`@4 @ (`(`? ? &``@```` ` `````````@` @@@ @ @ @ @ @@@@@@@߬` ``@``@`@@`"!-50`@4%` @?`0?5-0`@@4 @?-(`? @  `2 ?T5?(`0`N``H?> ;K#h @?`(0`q2@ (`ٸ@?  (0`Ϭ ``2`` ``2c`c`2 (` ?  (0`> ;K#8 ` `> Db|```"` " `" `" `" &"  ```'``` > :a|) 2 " ``䀢 `2` > :at@> :a|+` 2 `X2  @" `" `" ` " "  @`"`" ` ``` > :at> :a|) `"" X@" "   ```"  2  ``" ``` 2  ``㿘`"( `"$ "  > :a|( \`2  `"  `2`   A A>0c`@8`` ` `   /`i 瀦 A>0 2'`2'@"  Ұ "ϰ  "& 4`" 8 ` 8`$ 8&& ` ` ` ` ` `&  &  & & & `&&& `"``   A <l ``   \`X2 A` 8`4``4 8`_&8&`  &` &` &` &`  &`$ &`(` &`&`,#<@I] 2 ` `  8` " 8&`  Ah  e <&`  @  〦28>` `  AP 4`"<8`&8 8`! 8&  Aib& @Ɣ  w`U 8]&` Y&` U &㿐\#\#`ߚ㿈 #`'#\њ 4` @`` `2'@? Ap> c<@' '@`` $ `\ `" \'Ԑ'@ D @  > ;`\ `2'Ԁ  ` ` ` `   > : " `Z` U  @Gה /\ < `00'؂ ''''''/ل /' ' ' '``#\K؀  1 ` 1 '@'' ' ' ``\X7 ```\X7… 1 " & 4` 8`' 8&& ` ` ` ` ` `  & & & &  & .  e.   A @\` k " ?0 @`" 19`0`@250 A 1'@a|(\R ( 0 1 ``P`  .> :at> :a|)  2\  '@``뀠`" "  \ ,`> :a|(0 2\"`O#"ꀢ`@A  2w 8 <`2 @w&Ԑr&㿐@   B `N` `(` H A`   `>0 `@  $ @v?' $@`&@ >0c`@!8`    *>  `2`!m  @ *>  @G >, aa `㿘> lb̀Q  ` /      @ }  `"@`` `? @`$@$`f  `2@"    ? @&&  0>, @ O >, >, a> ;> ;#cFȔ"[> ;G#㿘 `  7 }      `& &  㿘Ho`(@aHo-> l(@g-> l̀`j %̃Hp@/>,>0 c)> D`)> D 9`* 9(@K<(`2 9)> D'>, ᬀᤀ`>,>0c` 0`@< 0 .@ ᬀ Ho(@%̃Hp@!>4 l  8`" 8$ lHp@g%`$ lHp@> ;> ;#cF"> <Fؐ P> @c<'   @ E@ ":!'؂   //''''''''`Ц`Ѐ    @`2`  8``" 8' ` `(`, @  !|!@ @9  L> < ̀   *x>   2'! `. >0c@>|@ x@9 x  (`?#!h@>h|@ @9 &@'Ѐ`Ӑ  @Z 2|!Ho> l(@g> l̀`< > l ̃Hp@> D`>,a>,a> D    ((`(@> D4@2 @Ӕ  2@̔  2'2 `?%,-8 ` `,(` ( ?c? @ Ho> l(@g> l ̃Hp@5!9 5 ''@?@@" `' '#`? @ K  ϐ  ː  @ `2,  ׎ * @ ` ` `((`@(#` #`#`#` `#`3`2 ` 0``0`2`"  "  |@ @9  @I> Ho4> l(@g> lw b `>,ᬀ݀ᬐ <`  7 >,$`7 >, a$ $     ((`@( x, 9$ 4 G  C ?$ 0$ , 'E ?c<? @ Ho(@> l( b Hp@> ;> ;#cD > <Dݐ #@ `%#`+>,a `%a0%0` ` 0{x`"|@Ho> l(@`T` ! ˈ `  M`@  2 >  @ @ `7 :    ? @ ${$ *  2 0@ 8`@ >  "+! ? @%%0>, @   >,  `@ @`Ő q`#@ `#`o#>, `` `? @$@$` `   ? @$$ `" $ ʒ  2` ’ Ђ@(`0`0`, ,   @  <  8t  "Z! ? @%0?%a @%a@t* "J! ? @%0?%a @ ׂ%a>,ᬂ " h  $h@>h|@ @9 '@&@Ho4> l(@g> l b̃Hp@0>, `>, `㿘Ho%> l(@g%> l̀` $̃Hp@#>,a  >0c @< a 2 Ho (@$̃Hp@g$ p D  h <  ` 4 P \ D ՜ Ր`"0 ```" X `@: ``2 ` (@: (@: X@92 ` @@: @8 `*>&P 0@: 02 ` 8@: 8 @:  @:  @:  @: @: P@: P H@: H㿐 ` "?퀠`   *#\> D Đ!0@?^ 97>,  ̗P > < 4``  D@ 4  0  v` '''' Z B P !> < 4`` X`"& \ @ D 4  0  v` '''' 4 A P v = 4`)> D'''''''''''''''' ' 0' v   P8`P X8`X `:8``> Dap>' 㫒aH - ( 㿘> Da> m> D" ~at`?㿘:`      "`؁ *  *`   '  " `ؔ  ڰ ( `   `؀`  0ܝ㿘( ``(  X @  2   & & (@ ` Ӗ( `퀦  + &  `  H`.` 2H  p m K@``.  ` `@˂`>ɀ. `  ``Ђ`` `` ````Ђ`` `J `` Ђ``  (8``- )? @  )?   J`. @ @n(@`@2(@ && | ߴp> c<@' >0 " > D`  ` `4`2`< n@  > <   'ؔ //ؠ'ܒ''''''@?~؀ ـ `Ԑ  π    Ȓ  Ӗ(% % %% i` `0@ ͐  `0   `4`"  `"    `0- :?- ---- ?-((-`-`-`-`-``4`0 @  @>u`( $ i`  @ $ 4dd" 0$% @ ~%  '@ 80`@g , , , , , , < , ,  @%  % @%  `"~ `"s ``"h ` ``"] `  :؃(`0`0`---`-`   (*@ * 2 2 -`-`#\    @3W |` @9 |>,` @9 |` @9 ``C :```P P d 9 0Z耦 " S 0 @ [``2 -`-```2 `-` -` ``2 `((``2( ( $*a,  `J$ "H% `"C$ 8-`(,   i `*6$㿘@e``^HZ@HV ]O*  J @*``E   : ?<8` ?9 = 8- +) & # @ @&$      @*   *``ŧ:  @{ `   @`?x > c<'    ((`(@ @d  > <> Dzap`?> D> Dah`&'؀'؂ ''''''/ل /' ' ' ' `"K  ([؀  > D 4`2 X 8`I" 8> Da``@@`2`0al`ǀ'؀`2 8 \@(` <|``l@ @`"@:@( 8 >,!`@9" \``2 ( `X72 8 <q> DҐ H㿘אԐѐ> l"И$> <<(㾠 > c<@'   (`   > D`> Da@ *Ɛ @`ϒ` Ē` Ԁ`Ā䀠`> Dc >,!`@90f   @@``2I'8!> D!xݍ'4> D`耠`O  ''p'T//U/q//T/px 't'''''''x'|''''X'\'`'d'h'l \ #\pT  Ú44 !x>' 6`߻4'8  @'<'@'D'H'L'P/9/8۔ 8S /@ F> <``> D `>> Dc" >, > < =eau >,``hXd7Ƃ``]XY7> <a@=N ^ >,i4  4 @ *H>  2@>,ah @8h  `2'> Dc"? >,> <a=$ 4 >,   //'''''i' (F > D0 c `'> Dc8`; %8< c" >,> <b<  >,> <b< 8  @c "8> Dc"8e> < <ƒbX8 >,` %8Ԁ`J @; `?> Dc" >,b> <b<  >,ÐԒؐ`( @8@:M *(` i` > Dc" >, i5> < ,Ղ```?> Dc> <c(<\ 0ق@7b@> '\c<' `'`(> Dc > <  `/(  : `(.` `` `(/W `'Ȓ   ''''''//ȴ  " '''''//'' i   >4`h  0@~s  2  `"X 䀠`''''''''' (#\   ԚX   8`9" 8 2> DcrJX> = ;`0h (`Y `/8   0 Y  (b > <> <c#  (;'0Gt  `.`.`.`.@ :.` `"M> Db|`.`ؒ : (-`-`* 2 2 -`-` |<6 #\    @.\  \`b|` @9 \` b|` @`9 +`>&d 0 2  0``2a' `@['`.`\`b|` @9 \`b|` 膀@9 \`b|` @9 \`b|` ؆@9 \`b|` І@9 \`b|`!@9!\`b|`!@9!\`b|` @9 \`b|` Ȇ@9 \`b|` @9 \`{b|` @t9 \`pb|` @i9 \`eb|` @^9 \`" Wb|` @9 W`P\`Mb|` @F9 ܮɀ   x0> c<@' /z>, `0@  @`@`? c 3"  .<+b,2*  ` Ȑ @ 3  `(`@ `@  @ w>,  (`2 Т"  _ @`a ' ''''''//``@'`'`'` ' ]'Ԕ $  > Dc> =?0; ` ] @,>,`(`@`2 @ ْ @>,`2 0``"(`m 0 M>,ah ?@8h @ > < 0ۖ  0*>  ? ̖  *>  ^   *>     *>  / `0*>  M@ `(`@ 'ؠ //ْ'''''Q' ٭ ' t S> D   ((`@(?)`:'''''/?: ""`>0b@(( @@> C(`@``l @0f 9)`@%Ē`     ```((`@(''Ȫ- >  * >  @ah @8h   8 p> c<@' ` '   @  ''/''''' / ت`D><cc`9沢 70?Ԁ^` la"  v`:2  ,` , 0`"o 4 ,@{9  2  `  `" $ @{*  2  ؀ ` 1 (` (" `" "  "`l@3`@Ԓ  p$Ԁ "''Ԣ 2 l`V0?`l)`@Ԓ  Ԁ @ K!` , 8`" `@0Ԑ@ `@Ԓ ^ 0Ԓ GЀ  *#>  7`v  (`"y q>0c`P@8`P`@'Ԓ@ > <  7 㿐`  (``   `@`` `J ` 2 B  >`2  `= 2  0 C < 2  "  `" (R` 3> ?'   0`"9 1 쀤 ǰ  =; Ȫ 0" ``"  "  4$'4 'є ̔  0`2  1``"4 `(`(00.`.`  > :(@`iခ 㿘  (`"V  > :aU @  E  "``2 " 0N * + 2 `"  `    `2'&Ө@y  ې'  ܀ "  "   `> : p>   c<'@' ` eY '؄  //'''''' &`(8m   `(` , `-` -` -6 ``[``` <  T`  b   ($HE 08ݲ ` -`R> 8 @ > < Ѐ  *>  6 `  {`À` @x 6 0> Da ԃ* *  8( (```u ` >   8 ` ``  ``@`   Ʊ-b6  > Da  f <0 < ` ^ 8  N( `e` & & N ( ( H-0``"&, `, , , ?,0\ β t h `? 8, & & ԖՐ 8& & , ,  8'А ڂ?,  , , (`8> `8(`(`(` >  8 &`  @& Q0``?``;``8`X57```.`57 І   *> U$ݐ㿐@'   @|`@9  >,ah @8h  ` b|` @9 ! @ ]l>,  :w > Dc2 >,ah(@8h( `b|` @9  `hq >,`(`@h@@8h@  "= "j̀ "  ?> D   "|` @9  `8_h(`>&   *'>  >,ah @8h !B  $*` 怤 "`> Dc(`  6 h@!`>,  ;  " T`` b|` 8@9 8mh@?h8h 8@h0@?h0C > D   "|` (@9 ( `H  `2h   ` b|` @9    > = 4K`p>,o'& > D?8`~> D@! `` b|` @9 (h0z@`` b|` @@9 @2hk@  (h0  `  b|` x@9 x沖  "@-M@` b|` h@9 h2`h '(hh0 沖 m "1@`` b|` `@9 `2Ch (Kh0 沖 P @A@` b|` P@9 P2'h (/h0 沖 4 n@N?@`` b|` X@9 X2 h (h0 沖  E@?Ԕ@a `"@ π (h0 沖  "@ "@h8dx`C @?h8?dx (@`` b|` H@9 H2h 沖 ٔ @OД@ ` b|` 0@9 0   "|` @9 `y 2ht r  沖   `22V  @8.V  ?*  *h8d `C @?h8?d  2R@0є ё `` `X > =2`1   {? 5 c5 ǔ , & 6 2@%# ( (  0 @`(%% r%?,`, ( (2g `"@2 h P` "@$ $ > ` ?̀4  ( `(`0,`0(`(`(``4>  8I  R4$ $ ,?,`( `v b|` p@9 pn@,% "'' @R  ' `*>  C@@NՔ '! '@> '@@d '@LҔ '?( 2*@㿐'>,>0@"<Ḓ `'x c  ` `}ǐ```"V `?'  )@- `:"e    Q dk$А 0v  o> D `/e  ̐`` Ȕ  `h`" `j`" ,`(6`(6((((6(& ḃ.`@`@ (h8``2`2` ( 2 `@O8`0b  6  RJ`T `@p8`8"@ 0 2 > Dcc> = `1v!x ``2 , , ``2,`(, ,    `*">  @``쀠`2,`(, ``܀`2r , n, h @8h  2> 0 㿘!> D! @20@2  ٔ  > D" !"`! ` " > =0 㿘@+> DӒ`> D> D apӍ> D ax㿘`+       @W@Yz ` , @W@Ym , 4`4 @㿘 ^?^}& 4 !$4@ ^v& 8 $4@ ^o& < $4@  ^g& D $4@  @ D& @ @[ 2    @[ " & D ^_ ,`@``  > & H& , a4 0& L`  (& 0@[z " ߢ` @[r ڠ㿘 , >  La4^  , @ D  4 @  @[Q& 4 <  H  8E& , 0o ,㿘> D1?ɐ!|* l T < $ 8  `(`  (`3 `(`  ``,   `(`㿐 `?`+( (` 1 -#\> D !0>9D>,a b> ;c \7> = m> Db P "   9>0 # ~,x9>; !@ x h`> c<' n> = `2  ? a> =&?<8?.>9`*? ;ʀ& ˂`(`@װ?`*Ӱ? $?cǀ&ð`(*? (̀Ұ&`*? ʀ& ˂`(`@?h!.!㿐 ? x ?'㿐   ((`(   3` <   + `   3`(`@  &@`  `` (`@(``@ @`&@ 㿐3 32<"> =-F!0 l3*`(`      ( ` & } K& ؐ+2> =Ԓ`ٵ(` p @> <@' `` l@ `'ܔ@?ܔ  7 ) & l2 ```5 (``+-/ 3 33 < = +u  30` `(``  3"  < 2* + uހ 3p>0c`@8`@@ > =Ғ" lZ0 `ӥ(`Œ l@" @@?  @" @@?  ) & 1 3`Ҕ `f`\ဦ` ``2`X l@'@?   ) W& lK@  ? :&8 @(`(@0``'ܒ  =v ) 5& lD (Ҕ y>0  `(`@n l@@? ) Y &ϐ. l l````7``"7` l l!㿘``@!`@ ``` >0? c`@8`` ``c ?>0c` @ 8`? ?㿐*?c  = H *"?I &  6>0 `& *>0 `0 + ``(1  `9; 'ӂ >0 ` Δ  &Ă >0c`@8`? +"  2?>0c` *@8`"  #?>0c` ,>0c` ,@8`㿐 `) `(`">0` `(``(  `(`)>0c`@8`? ( @  *">  ڂ (1  @ *>  ؂@`6? && + h> c<' '̂?'  `>0cȆ@=Ȁ`Ӏ@" > ``>0Xc(`@h@8h ` cb|@@9c@;c `'!  ```"/ @= ` b|@ @9 R > =   ('̀ ܰ@ ="|@ @9 `h `(`@`@8`  " 2  `"   w `s `o `k `\"~ `"   `"   `  ?c"f @= `b|@ 8@9 8 ` b|@ @9   0{`X`>0(`Ecc@D=c@>=>0c@7=`:    Vv 2  `2  `2  $`2  `2w  $`2s @= `5b|@ @9 -?c~``q  `@"k ``:> D L` > D̒  蘐̺`  b ̀   `@m#``` `2 ```2```"# ``2 ``2  ` `2 `$`"  `\` `W" ` ` `~`" `"A ` `뀠`"3 ` \`" : `"Z ` : `F `l'>4l (`l`4`Ȑpl@=p 8` " 8$l>4 " t  t" " " " " " ,  ,  $ `l4``"< `hV> D`"@   ` `(` ('' `" ؀@ *v`( ( ` @2& ̂`(  ``Q `2  `2 ?c"`2 P`2 P ?c"P@=P|@ @@9 @!> C>0` '> D(( @@(`@` !Ā`̢`@&v  "  2  `'  \ 0! `@= `b|@ 0@9 0 ```2  `X,``Y,` ` `` `X,` `Y,` ̒ؔ   ` `(`2 ܀`2 @= `b|@ 8@9 8 `" b|@ @9 ̐   0```2  ```2  `X ` ``2 ` ` ` (`" `@j=̆@=@ `bb|@ 8@9 8Ẑ``2 : ̮ ` ``` ` `(`~"  |@ @9   > D`" ``"y   2> D`"> Db @= ``" `@@=@`)l`(z؀> D`2 ̂```2. ` ` > D`> Db  @ ۔ 2|@̀2 0``` ` @k  27p @23ph@M=h}"@̮ \ `hL@ `2?> D `O @@ 0 2 > D > D @jҔ  29  ( `Ԁ   *0>  '@=S$l@=؂``2o@ c"yƯ`Ƭ> = (aPl̆@~=@0g' ̒  Җ 0_㿘>4`Ho&4 (@g (` 2(`Hp@ 0 `$"  @$ @Hp@  `㿘><>oc`P  c& & & & &  ځ㿘  zR  O> C`>0" 9 ) ) b  ( @(` @@(` @(`!+@ `a2+@ > D`h``@ &#@ `@ ! 4`@2`4S`"`4`4; ) )  ( @(` @@(` @(`!* @  4!>4 @ `\@$(> ='!`> '̴c<'  ' c `> D`" `,->4'Ȫl  7> >`x`ŨHof̂(@g̒  " `(  ` `$ ?͒ =̠ !  "    ``    !$! @iz  ̃Hp@   ($В c `l`"%``4`"`8`@"`8`n$`8%l%`Æl`>0̒``<``4`0`<`c` \`" ` ``" ``" `<  ^v ̀ :!`!+ +*:B `24 `20 `2, > D>0c`@`> > D4@  ;`@} > =4" ``0> = &Ia02 \> D` \0 `'Ȓ@% ؂ `<' \l` `4```8`‚$`8%l>4  t  -`-` % % % % % % >4 |%`͒?`J>0c`@8`  ʖ 0K ! Hp@ ``2S`<,O, ``2E , A, Hp@Ԁ` "'|{> D`h!>4 l d 4` 8`N" 8Y$ l``Ѐ`2`<,,``π`2 ,  , @h,  2|`8`@2x`8ܰ~'#\#`  (Ԙ T w@$ '`<`" >0b|@ X@9 X>0c`@@8`@Ԁ`74`"Ȁ`(  5 > DLj@%lDŽ%l*:`<"|`0 l  "(  @`@8``<"|`@ l`" (  {Z> D l>0c`@``C 8`@@8``<`" > Db|@ 8@9 8> D> `a4 > D cے  ̖ 0ՃHo4̂(@gt`(ʔؠ 6!! 0  \˜ (̀s|0̔ ޖ 'ԃHp@{u> D{qL`> D    0SHp@̂ A{X'3*|s`a43! 0`< `0#\`0> = $b(> = ($8!>0c`8@;`8`<` b|@ H@9 HȀ `H@;`HƔ $ l"h> D`Hp@逥5  & 0/!6!7|!7!7!7,!7!6!7T!6> Db ((!>4c@)   :  (:  0:  8:  > m  @  > m b `   @` *   >; !>)c 8㿐>;a'@@8a a!l / 0  @@ K "[<@ @!z<@@  g K@@@h #> D> Dbb@@d< ?c@_ 2V/$i ```X (@ ;z\<(Ȗ   @*[>   2@<!!@z=<@!z4<  0}  x- b(( @@>4(`@@`> D V '@Cn!z! `(@!z<((`C @<<(y!" 㿘Ho4 (@a     $ ( , 0)>;!@>;a   (@`C =!@  $ !@ @e  2  $@e  2  `2 !@` @8`Hp@    ` > 8 h> @ p> H0 ak0aj >EaĐ >Fa 㿀`Ho(@a 沖 |L G``K` `'8 ~- ( 9`6` "|`" ``"T   2|`El"*:'` (    !> m", , p  @ Hp@``\@` `ނ ۂ > D`؀1 / Hp@*`  | "| @dϔ  2   !> m", , $ @ ( |xHp@ '/ #\/ > m ؘ@ 0X  4        $ ( , 0'> 'بc<''''''?''''' Ho4(@a>;@@@ @ @ @`(`@ '@Ā`!  @d^  2  $@dW  2  ` $$ 8Hp@  Hp@ 1 > =6"p> c<' '> D⾀r(( @@>4(`@ `"C HoF(@ `"K  & `& d& & & & & & & & $& (& ,& 0& 4& 8& <& @& D& H& L& P& T& X& \ 4⾃(0` (( (`?4⾃Hp@ @ "> =a `2 > 9bb` ``'''' /! Пa2ܰ "㿐#> Db`$7>4 c@ b(0`7(0(( @@(`@`ab(0`7><>;a @ `"`+`@ "` 2 "  @2 2 2 `a2 @ 㿘V`. P`:)`% *> D`  0> D b $>;@cY! !><@cT!> m!> m # b>Oc8> 'bА#8 2`@R:` -㿘   ˖ wD? x>;a`0 > @#<8`0'  w  d>  c ($ $  沖 y W$u @@I{ؐ "< 7`($ '؂    //'''''';   >4+`#@>;&@9 ) a@)  ( @(` +@@@(` @(`!3``> Db@<` `` 7@<`` > ={ `( 7vİ 70#p> ;> D8b<' (` 2`A >4(c@( @(`@J>;a@ 0@< 0p`C >p`;> mb"/  `@3  (yb  "$ 7``"` `2`\ {D (  7> D`dЀ`l vs 0 >;a@`0 `C 8`0p@>p > =  `߂ @(`@` `0:@ 8` D 8`0`h@@>`C`>h` `'Ԑb (0`Ԩ`h- 0(`@`<0 (@@b) )  (`` 8(( @@(` 2`( `l`(`8 @@@<`(C`<`8xb@z ` `'|> Dt ` ** b @   h(0`@ -'  ''''''/؀dI/ـl2  2' ''' > Db@k<  6S  ` 7@M< `"'@ʄ '` + +  <`8" >0c`@]8`,Ԡ(`>0~`( + ' ' ' 'Y#@(`@`(`8:@ 8`(D $8`8㿐     $ ( , 0%>;@@>;@@@ @ @ @`(``C 2<@  $ -@ @a"  2  $@a  2  `2 Ho`4 8(@a 8 <4 8 <f Hp@ @`@8`Ho(@     $ ( , 0@@@@ @ @ @ `- `><> =ax   $ <``m-`@`͔  2``$@`Ɣ  2```(0``Đ 8`> #\ #`<$@ $`  $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8$``$`d$`h$`l$`p$`t$`x.` "$` ` ܔtG 82 $````-`"Hp@ af J>< $a < C  @`F  2  @`? $   <$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8}4 8 x$ `$ d$ h$ l$ p`$ t @-@$ x Ð   88  2 Hp@ 7 <$  <$   $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8<4 8$ `$ d$ h$ l$ p$ t$ x$ $ m&p> c<' ?$ (( @>4@@(`@` 0  f> :atb> :a|)  "   `Z%> DT \`  - eHoA(@> 9bb` ``'''' /! a1Hp@ Ho4 (@a $`,@$`8$`<$` $`$$`($`,$`0$`4Hp@ > D"  1"a> 9 ?>4@Ϡ>4> = b@_ʔ  \`4 \4 X4> =9#p> c<@' Ho 4> =(@a> =b䀠H>4'> D#@ @_,> m4 b> m#>; a`"` " `sK ڒ 8 2`Ӓ 8 2 @_$> D?> D0b > D bHp@ @ 4> ='> D⾀`#@> 9b b/ `(0`,`0(( @@(`@  `` '?' /!2#( l > Db@ ?`(` -  `8  >E @>Hc  `[>Gb  `[>Jcߐ  `>Eb@1@Ґ  `>H`PȐ  `>La㿘> Db@   ss & k -x>  c<'   `"  .  ` ` `> D>0c`@`> > D4@ s;`@[ Ho ^(@       # ''>;@@@>;@@@ @ @ (`@`C %<@   " @ @]  2  $@]ݔ  2  `2 Hp@40@@`C <<  8  1Hp@ 7 a ```2u  4 "   `0> =aڐ  沖 t 2Y 80ƀ`"b `\"[ v_ (        # '@@@@ @ @ @ /`@ 6   2  @]T  2  $@]M  2  `"  ```:`8@ 8<8qZHp@z > =,#@  8W    8qD0c`'8   (t   8q2 80N $$$'؂  /''''''/٢ U > Dⴀ`d`lH 8q 8Hp@+   ) )  > Db7>4c@` `@ ⴄ(0`@2`hⴀ`d `l"3 > Db؀ > = )b` 8@<`pΐ%  ++ ʈ ) ܄  @ <@\   .. ..$  ><&x?`(68@&%@s&㿘Ho4><(@a><>;a>;a@/ `@ " `"  x`" `& x @pn` 8 2@ @ @= @, $@ 8@Hp@1> m>O#c8烔 > 'bг86`@>`B#!MD!M!L!LL!N`!M!K!K!K!K!K!K!K!K!K!K!N`!K!K!K!K!K!K!N!K!K!K!MD!M!L!LL!N`!M!K!K!K!K!K!K!K!K!K!L !L ![`![ !Z!Z!Y!_!_H!_H!_H!_H!_H!_H!a`!_H!_H!_H!a !_H!a<>Ic"><>Ib"㿘 `( &@  oR  n 7 ? 4  c 4   , & 6  2  @$   `$  ؄(&  &  ($$ g (&@㿘 沖 q 9``` `'8 `so ( ,` `'&`` `"# `"`"%J  ``2( ( ````((Jn n}``뀠`2( ( ``퀠`(㿘 2 0?  @   2 5㿘 oV  &     -" ` `"  " ` @`""`X"  " `  `" " > D`" 㿘 @Z p?& h&& d㿘8`? 2 `." `/?`= ?`0"! `1"1 0`#"7 4`3"= 8`2"M `   { & ? &? & d "   8`;" 8&     { &  0  y { & 0 4  p { & 4 8 " <g { < & 8 8`" 8& < `2 ` "& `T {& `& & <㿘\> = ɐ#P?퀠`@ 퀠`+݀`8  (~` *`+(`>P` @ a&d ـ``(` 1; {R &0 n  @`` / `/@ a& `."`> :at > :a|) ``   {  & ) Ԡ `(```0`| 3ϐ { &8  7 Tki``(`c`#4`2``U  {Ŕ '@ X H@ `(&h @&h :``";` ``2`"S` ``,~ 0@ { & @(  `" l@`l`&l &l  8`4`T `2```2```2`0 1B  3<  06 ``> :`at> :a|) `6` `````@```` ````` ```2` "`@`````` `"`0㿐 #`#\c  {  p&#`#\R 㿘 ?в {㿘@`d`l`&& d& l   {ؔ l& `"" "  " " ``  {@Ô$  V`W `0` {``(`$ 0 B`0F`4` {``(`$ 4 2`42``` {``(`$ ` &``!`8` ` {`(`{$ 8  `8  2`0?L 72``㿐 B`A 2>`28  3 . `% & "@ `)2 #`#\  `ߴ  1  "0㿘>`0 8`?`$` ``   P` $ {   P` "$?| { p {Д ɠ㿘'`" & `4`C `8`o&`8&& & & & & && & &   . . & & &  & `(H |``l`"@:  `''@@* `@@VM  2`8"`<|`@l`":`\`"ׂd(%:҄ `X`͂&`\ ˄  Ȱ A*`\`&  `> @'̦c<' >`0 `  5 8 7 > D&@"` " * * `(` -'`"   > >>PL> D@ ` `@ 5&@  `"~ '̀  ` `2`2 `2 ``  > :at > :a|)  T\`& 1'̀˂  `ǂ V Ȁ`8 ,   ` E a > D{,   ` 0 Ā  > :at{ > :a|) t P\` 1Z$`2`2 `2 ``s   > :atQ > :a|) `J `"n  ` 1 ` @2  @U  2  "    ? & {& `m`"s `2@T`Q@ @2` @T  2` 0' ''''''''''  //''' !'Ѐ 0 1` <2'T\ 1'`, ``"6  "x ' " '̒̀ " `"    $  " ``2 X6```2 X6p> c<' ?''Ԃ݀`(`> =#p>P` "' l` 'ؠآ    .  4 "*  `(`h ( iz &$&` ` `  m> >   0 2  i\ &      h(&`   ` 2     8 2   - d`*  d   "&'  ""'    Ɛ    "Ԡ h   'آ      ''''      А 㿘)`   h   *  g0  ` P`: Ԑ hВ '  " ݶ   "ٰ `" gֶ @ ` P`:  gȶ g¶ 㿘 h  8  `$  5&  h%( ``g 7 7㿘( ؒ (jJ  &@`2` hm    " &&  7e (  @& ``& &` 㿐 ` hJ  0  " , & ?„ , , ` 'ؔ `  e 4` `   h'     g(`g 7 7``@$` ,  ,``(`Υ$ f& 㿐& & a (^ 2 2  `2   gB O$@e  I>  㐔 ($  ($ J 7$(`0`0`(/(%@(`0`0`,`,`i  `2` $ (`(((( (@  f  2$@ 7(@`(`0`0`((@> `c<@' >`0`' @ )`   @ > > f|0   ;)  * (` ; : *fd0܃) >Q>P l   ' g7  '"    Ho4 Ă(@a Ā`$ ` ' Đ  ' ''''' ' a/ ag''  ( (" ͞Hp@0 f ' 6G" 6=752  '  u '`p 9  H   f?c '''''''''fÐ '   Z 0K  F f '" ? 퀠`r (`>P G/ 7c ) >P B "   `"<   `5 0$ 䀦   `()Ho 4 (@a $ o  jb Hp@0   `@'6"> =75> =j * < (@$ Ȱ  ` @'! ݰ lհ   `   ư   `@ *'   `@`X'`O` l $ l  7@') >P* >P l0``' l0``' l0``' l`' l @@ ' l0``~' l0``y' l0`u' l0``p' l0``k' l0``f'> ;c@ `' ]' l@$ l` =$ l ; l@$ l`0  /$ l l@$ l` #$ l l@$ l`%@ $ l  l@$ l`  $ l" l l  @$ l l @ ($ l >`  ,` 0` 4` 8`> ;cذ a8԰ $ Ѱ " l l @$ l lð  $ l l  $ l:`Ԁ" l l  @$ l l ] ($ l l2   /Д  l  $ l l{ m (t$ l lo G (h$ l߇ 0 <2  ' ' ' l ` S$ l l ߂`M$ l#<T> =a؀N, 5 < "N' K'à<, # * > =aԀ.,  2 aЀ!,  2   ( $ l ($ l ($ lݰ  ($ l  ($ l ($ l ($ l2  > \c<''|'x' ``la*``S 'T'X'\'``L'd`0`$X `j* 'xXc c\b`bdb @À@"x U> >`4`" `8 `\C* 'x`8`" `` ``7* 'x``` > > `d+* 'x> >`x`j Ho(@g h " `(+  ` `$l֔ ҂?h <h !  "  h  ``    !$! @NQ  Hp@  xx 8`q" 8Hp@x`k  X` ` \`"`` ``"d` d``   AT E'x1' 2 8;@ @ ?c؀,   T ! 'xT 'Ȓ  'x,`,`0`0`* * d  > = d @d ` <(,X` > =` (,X X"X\`  <` ()\@ \#@\``, ׄ +` ()@` @`#@`   ``2`  ``*Q `(`@    2 `2  `2 `2 `2 >0c` -'x@ 8``>0c`X@8`X v'@` `8``<`d`#   ((`@(  ` " @ (`@0`0`,,0`,,@"] ,@`uHof4(@g `(L k_ N!! H  BW @0|0` q@ 'xHp@xȫ ! 'LHp@@   'xT '"'xX `@ "a> D tHp@ A`'x܂0'xFx 'Ȓ /'D'''''' /(#\ښ| $'x A >0c`@8``"b|@ X@9 Xt @#\#`  (x o |`"`P@8`P 'H` |b|@ P@9 P| ``"4` `"4`|0`2'@tp k'xte( ݆%`" `h`"'t  ˀ``\` `Հ`" `ǀ`" X```@0l `*hܫ F`0`   AL ; :!`! `*:< '''''''''> =#> =#Hp@`z|b0 " T \"|@ @9 T \`>0c`@ 8`"|@ X@9 X 3'x`2P0O&& &&&&& |`2`P!`U`"J `?`Z` ```S`  > :|(@(``2GF``@,> = (~#%`h`4%'t/  ``;X,7, ``- , ), *:`(`l`%p` ("|``  l`"@ @@: (G'x``Ѐ`X,,p`]t[@0'x``` , ,   2> D > D`" ``2  `D> D`D`@J۔  2@  `> D7 ` \`  `` ```^ޠ 'xW  (`"Q?c8't``"\` ,(t( ǐ 'x`"  b|@ `@9 ` '^$  2 gxc`x@  8`x"|@ p@9 p@H'xM' " x`>0^ ('x|@ h@9 hz> D`"~ > DbxH2v  "o  ``` ```2  ``2  @ @x`E>0c`p@>8`p (>0c``@8```2f`X`2b`  ,a,`"q b|@ h@i9 h㿐@  `  &>0 `)>0c` @8`"  ! df   *>   2 >0c`@8`! @`(`&@ Ր 㿀   z ं`@? ^'  p ^ǒ   (`$@$`!< $`($` @$`$` * , , ,   :```* ,  0ޔ t  ה  $ ........Ȕ `"9  : ( * 2 2 ..> Db.`>,a  '@ '/@ 9 '쀥 /"|` @9 ``*` > m#\`?c  ' ``Ȑ. . 퀠"|`!@9!䀠"|` @9 ڀ"|`!@9! e > 9 b^ ]>㿘 > D`X2` > D`X6 $` @H   ``. 㿐 ` C  @`P>, `" \``@`F` `@``` ``" X   ``" ``"   2 ``` ``.` .`  c$   `*>  @`2 >,ah @8h  \```"`` `2```2`````"`  `@`"```"```2@0``` ``2  X.` Y.` `(`#,@/q  X@ > Db2`` < +> m`/``, K (`@( 3_ $ ( %c "!` @H   " ``$`` `"`@G  2Ҁ ``+Y`  `N ` K ` @G  2$ $$ (?` +  $ ($ $.` Y$.` 㿐> m !> m#,  c,   , 7, ,  É > m cP㿘Ho 4 (@a > D`Xbܐ 2`@G  "& $ ``  2ݐ 2  & $& (> m cHp@& $& (Hp@㿘)> m#`6Ho3(@>4`h%# `; ` ` (` `$$ ( %# ` ` ``2` 2 (Hp@a>4`h%#   $ $Ϥ 0!!!!!!!T! h`G`` ```  `5` 0 """"" """ "$`" "" 㿘Ho (@a   @><c`  4 ( (@`,  ( $ $ $ $ $ $ $ $ $ $ $,  ,`$ `  $ `$ `$ ` `, `4 `$ ` X4 $&@@? Hp@&@ Hp@㿘'LHo` (@a   @> Dc\' 78?c "T<* T < (`0`(`(` <䀦 L&@@@? Hp@ <@F[ $$$$ $ $$$ aL@@@@/@0) @@@$ X, 8$$<$(`X488" $,H':$,$,\$4P,!$0T , `  %`,`0`(`(`  @  ) -@ !  ! ! !  ` Ē`` ߢ+`m4:ݐ> >`PD L&@ Hp@㿘 @    ް     * w     퀤 #  0>`p |㿘b  hY ``0 `" > > xY  3*`*@ *` *`*`*` 2 U 0> > Yg   㿘> Dc` > m( (㠂?(2(1><><#0 c c>n ` `#cs.ү3> > `㿘 9> >7> > 2 ` @: $ (``@ @    $        $        !! 㿘 z> > `x> > `g> >> >a %> D#> D`b c $>, `U  "8   (@`62"*`* `"@& & $c $ >, a @@> Dc@ +;@ > >a& `*`"c c`c >,!`?@9& $&& & & & & & & &   & $ђc&z!Hx!h0   '> <c<@' ''  /''''/ؐ'Ԁ  4d2M8`"J8 8`w" 8'Ԁ`  @ o> ? " ''''''''''''''''' <'zd'> mc''  QԀ ϰ ԀH?08 8 4dd` 0`" H`" > Dc א> >b0> > b8 0`逦 @` ` > DM'Ӯ 㿘 `A> Dc\ 2+> D (> D@ 2  P`"   ( 2   , 2   0 2   4 2  `><c"X  @  ``> D `X> D0><H@  @ 㿘Ho``(@a`> '> b4@*t& & Y $Hp@& & 2 $Hp@㿘`H D l  4``X dda H b `> D #`  ' '  ``\ (`8` 8`"7  " W `'  `   \̔ `\` "Oa aӰ V a@ 0  O `\`ڐ A * `\`ΐb|`2ɒ  > >  bHɀ(:  " A 8 <$ 8 4p , 2p HѸ (`48 > '7 > DMcs  2`\ h "  0 4`M 0(  $ h 4A> '7 ' > D(c R(`' b|> 'b @)l# @ ɘ p> c<' `0`H`<`4    M  7 .! )> ?`4 ` !> 9 "@A  `  `"  "@A  @ 2" $`4̀$"\`"` \`` `0 `8 h0> > ?b0 2\ ;&`4,X4`  < &`H > m#> mc` $c @A < $$ >na ł?4 $ `4> Dd&`4  $ $  > D`܀c ` `<` "`4@ϐ?. $ ` 4   i>@ i,> Dc a> ```@\&`< `" ` `$` Q&`@`N)> mT\`&` ' ''?'7X 7''؂?/ > m`" ``"   2> m `@? `$` `4&`H{&`4` "U= 0 ` > Dd< h`0`,X4 `4a"*\02  `` "q` `"m`     "  # "&#  `R ` ?2 ߐ 4  <`4? $ 4 T\` ' ''?'7 X'?7/^'耢 > DcЖ0> > b0> > b0 l> m i> m @@  2^> m)` 㿘 0` 4dd" H . 0`*``&V `񀦠2   > D`& @  6  <> 'b|8` א  2 4@ > c<'  ' > D'` ' ' HHo<(@ <@  "BT`  2ET` <@(@b4`@Hp@  < @''''''''''''''''' v< _  ;a  <@  2 T`` <@0ŀ`2 <`" <> '1> b!4> D!4$Hp@@cr0> ?Ͽ 㿘 Ԁ`> >@```""` [ "[ 4h dd H   0` ``" ` H `` `ݒ  @ @ @ X 2} i`0 "  , `"*  > '4> DCc ` $  2 @E     4߂ ? 4 "L`5 "4T`> D`> D`@ ` i`@?@ " %> > c@0  S0 $  π`"4`ɀ4 `,` i`@`   4 4> > "#㿘#><c > D $` @Y 2 $c > D $` @F 2 $> Dc\ "  X@6  2 X><H@=> D`> D> D`/> Dc c  0 `  X퀢 @ 逢@" \ː @ @ @> D@  > D㿘 h`` l&``> C` > > 0 Βcp`> C` ځ loav8&`&`"|`Ӟ@㿘  |k 8  @* a0* )a"  #| "@& # $ $ $ 㿘Ho!><(@a!>< #0>ng`#0ˢ.> :a)> D|`` "`q`$`2|Hp@#`4 )$``, |# @%$` 㿘Ho`4 (@a ` &  Hp@  > > <> >| H`` @> >z> ? `(`0``߃(`>eP > Dc6-& > ' |b@$Β#F @+ 0 > Dc6 &  <$  Ö  2Q& + 0   `* > '6 > DGc0 ` > ' `  0& > ' 1b@$# @ 0v  & 6 b#`#] Z#㿘Ho!><(@a!>< #>o|`P> Dbʶ#><c #> >4 >4 a4: @' 2 >4`h #> D#> `" > D  a4 @ - " a4 @  " 2 > Dc\ #>  8"   Ha4 @   2 8Hp@ǐ @Q 㿀> c<' 0l0 0HP\&M0JaJ1aKY  aL"b&`(?0aNׂW |`$` ƂO Ho(@> Dc\'>4`h   `@  @ 2 @`2Hp@ UV ><cH&` @ Dc\`m8?7c/c> ?`p  ` `L,,(  @@ @@1 @ +`@@@ # `X. $`8 & (`<& ,@`X6 4`@& 0`T *  .@#`8 `8#`< #`@#`D `9``" 3`: 8@^    $  6 6. %`` Ȁ $ Hp@, d ``2Shb`@@B `````'''쀣`'`"`Ho Ă(@S  H R &`( &` R &`$ &`,Hp@  @;!(Ho(@><c#> ?`0 ,`" @ , 4 "$ $ X4 ( ``     `,` ``܃,`4 Ho``(@@X><c @` @Hp@ @ `0` `4 ` ` ` ` ` ` ` ` `$ `( `, `0|`l@* &``"8&`&`| `&`|`&`|` &`|`&` |`&`$|`&`(|`X.`,|``Q 8Q a0ad> Da> D``%怠`"X7Hp@" ````> ?ʷ  h`G `` ` ` `5`" > mc2"@2>9a, 㿐 "H3> ?  0``` 0#\ > ?a  `&  s 0 > ?ؒah  0> ?Ғa@""`` `? &@&`$ | ` >,&  ͐>,  `> m c@㿘 " > ?  `" I!㿘 > ?  `2 `" 3!㿘> Dci u"    ? $$ ƒ | ` & >, o>,> m c㿘 >y c/ i> #> c<` ''''''''''@' `@ gL N=  c`8В $!<$(@" @$$ c :$),,, ```),?,@` ``'' ''''''''''''// /ـ/  `Ā` X 7Ƃ?'7''ж. ĐÒ) (#\   Ԛ ' '' ('?,(.`0 ``l`"` "  ```"h`  . h`, 0`0`,,66.`6 : (.`.`.`.`.`Ð* 2 2 .`.`#\   >,"|` @9 "|` 膀@9 >,adX@ 8dX 8`q" 8@@ t> A M(`2.$M0?b4/'*/` `` .` .`  i2 ``@`" i  ?@$$ `@8 <  ,`.` i r`~ h}| |,   8`%" 8L0> Dc"> ? bh```I .` F.` 0Ð0p > ?(ʐ"> ?"@ > c<'''''''''' #>  ic` `@ M Lϒ  c`8ߒ $!<`$(@`" @$$ c :$),,, ?```),,''  ''''''''''''///؀`/` @``''''ТĐb  y v `(rm h H '''' <?,((.....00 ``" o  (`0`0`,, : (..j* 2 2 ..@ #\ 褚 >,"|` @9 "|` @9 >,adP@ 8dP 8`" 8 > AM (#\    W' ' ' '?b4/'./ L"(`2$K0  i  ?@$$  @7Y<  ,`. i  y ``p . l.   X'7Ƃ? /'7$'̂```\ . Y. > Dc  8`" 8K400~> ? zc > ?(["> ?"0 ` `  \``@2`0`  >sc 㿘> D㈀`2  > m  c ㈂c ` 5> D& Ȁ` `l> ?`\`Đ 0 > Ѐ cX 03> ? %cP  8 |ה A & ` ` ` ` `&> m>,& @a> Dc  #a& ``& && &&.&@ > '!b&@bБ0!:  x 0 0> ? ݒc&m 0 > Ѐ cX 03> ? Γc{#_ > 'b|,`@~#l>  c<'     Ԕ  '> D *` @`7>, Ē`  `3+> Dc`` >,!`@J09 > AP    *>  @`2 >,ah @8h `耠`쀠``?c +> Dc`> @ H`H^c "d+> DĀ`ŀ`Œ`h l  (``R `O`K`GE+> Dc`> @ a%c> @a > Dc"x >,> @a o >,> @0` c`^ >,y> @a Rcc`O> @ ג`xc h`* 0 ' ''' `D"a i` @"[+> Dc`&C i> @ aHc z Ҁ '' ('''  ''//  `4`0`I(0+> Dc`> @ q`c``4X17 > Dc> @ ^`0@4  b` 䀠`耠`쀠``0ʀ`2+> D܀`2+> D`2+> DĂ``?`- `耠`*쀠`'`$> 9c,c,` ``''''X7怤 `@ *˜0  Κ  > @a 0t ]  l`0'   8>  c<'     Ԓ  `(> Dc >,!`@Hj9 > AFC 0> @ a >,  b @`k`Đ ````ć((`@( ``4``Ń4``Ԁ`a> D`1 oԀ`^  (` j``8> @bZ H0ł``σ4` X`7> Dc" >,ې> @b0B } >,N]    *>  @>,ah @q8h 0ς``Ԁ`2> D Xc"Y >,> @ b`S >,2> Dc"K >,> @  bE >,> Dc> @ b0È 7  > Dc"0 >,> @ c* >, i` @> Dc" >,s i?> @ ؒcH >,   x`H`t`0`p`(` 04` i`-` ` i` @ `&`6`6``4'`4` N&`&` ` ` CGG?&` D  ``   ` i`@3@@ @J > >c@ s 0  i `-` i`@7` &`v6`V``"6`26`` Ho 4`<(@a`<@  "i> D@ Hp@6``42-`0@ ` 2V` р "V` > '6`> Dc]V`2< `耧 0倠` > '6`> D{cG0@`4d\'`4`<> 'b|h` 4K > '6`> D\c(?"|> '`Q V```<@g0㿘Ho (@a   > @ = b``L> D`` ```@ @  ?> D& `2 @"`` `? $@$` | `V& >, Hp@ 0 > Ѐ cX 0> @ zcHp@c2G @"M`` `? ?$`$@ 0 > Ѐ cX 0 > AS`Hp@> @HcHp@T>, 9c0̒ > 'b|`@#ِ0> A0`X$ @%0> m c@ 0 0> A `m@> m cn@  T  @ 20 @  2 ` > 4@`  "@> 4@"`` "@"` > :at > :a|* ` ><H@   H> :a|* > m cā > m cā㿘><c 2  " @2 @1.  2P 0` ``"` @1  2  4h`"   D@1  4  0'''' @ _ 0㿘 ) Ho 4(@a`"  Hp@```X6 >{`x0㿘 < 8  > Dc  > AA`  > 4@ & D > 4 @ & @& D& @ >  Xc<' ܐ ` }\  x@0 0@1T   /m/l tVtx@ |@ 't'x'|`f' `'<(@x(@t@(@(@|@'t''x'|//  < 8'Nb''TaI`@'Ho (@a Hp@ 50> Dc=0  ?`0/(@'t`4/( @'x`8(@ '|`<( ' < 8'''@s"X$'> Dc"Ӑ  > A[aȐ  > A#aHR  > Cؐ!㿘> Dc\   @2  X X2  , " 㿘 T    _  "  H "R ` 2   ! ? @ >`p |㿘> Dc\ 20.,@  `"&  P`2  T`2𠔠  2ꠔ`"研`  `@"` @2`_```2 PΠP  D@/^` `0``<'''`@''`4 Ú  >  Pc<'@' > Dc  .  X> A 씒a@ m> Dc\   "  P`"  X X2 k  " ܦ ݒ  "P  ( , 0 4''''''' /`緬!   >'''''''''''''''' '@''!<   Ԧ > DԀ`" Pg  P`& P``8"`8> C!c Ԁ` > D@`" (``2@> Dc"w   X 0 > A a0k @ X #\#`#d 0 > Ab@ԝ>  Pc<'' > Dc  i  X> A ϒb > CO!('آ  //ؔ '''''' '// (Ĕ ''''''Ԡt  D@.<؄'x'<   1> D P`& PŐ > Dc\ > A0b/> D"  P`2  `2  X X"   8`` 80c" X0> A c8WJ "  " `" ؐ X#\`0 ; 㿘%> D\ #  L " \ L@"  " \><c L#  @"  P`i "  P$ P  "\ `2 L ``2 L  2 \ &> A% c'> D@"  P`\2  L@B  #>4 `2 L ``2 L  2 #>4`h ` `@"   "  2=`h 2 `hK`@" 2| < P`" 0 " `" +  X ꑒ  " P` P  `@"  "  J 3 $  2 `$ P  X ax P  @"   P`" $ P  "X\ `2 L ``2 L `$ 㿘 ` 0`F`  (`2  `2 `@" `2  %  X2  0 "  `2  @2 ` @" \ \& \Ғ  " "  \`& \ǒ " "  \`& \㿘 Pb|& 80& < \`Ho`<(@    ? @ T&  & }% | 2 `*$ Hp@ |}{ː " \> Dc" \:  X 0> A 青c \a > B0`鏐 0ҝ㿘  |{C "  T`" T `& T T" C㿘!> D  "|` 0@8`K @E ` |{ >G `2& X$ T ( ( @  Ho  (@> D\\`$ \   \$ Hp@ L``` `$`  a> D ` q 耦`> Dc"〦`  X 0> B `(ր`xHo(@a  (`?  `L@  L@ $ L`L@@  L@$ L`L@ ``8`<`D`@`H$ 8$ <$ D$ @$ H`L@ ` P`` "ؒ`Lu y `  `;> \ `2`2 `X20 "`@"''''``" `8:`<:? a4 @   a4 @ 8 '쀡* '쀡8'쀥`"'''j&&&&!4&"`8``" " `8 Hp@`8`  \ ` $ \>F   \$ \Hp@y Z`> Dc"U`  X 0> B `xH``8`'`L0  > Dc`@ `X#\ 0> B `0])`L > D L`6" 8 `<`8`<X V`<> 'c<' WX   '' ''''''X'h'l'p't'x'|'''''''''''''''''///  ' ///''d'\' '`'<  8s`" & $ 8` `& $  > C 8& $> B!!@㿘><c  '' '//'''''''''''''''X'h'l'p't'x'|'''''' />  c<'  ///'  '?؄'\'d ''`'Ho 4 (@a Xa<  8`C 8 8` & $Hp@ > C}!X㿘Ho`4> D(@a> D`P> D> D`K> D+><c J> B a "_  $@ `" C` ’ 퀤Z   H R ` ϐ@Hp@c> DHp@ 0` > B|a8Hp@ 䫒 " $ H " $R `4 $cc㿘> D `b|> D`: $`+ ".    ? @&& > Dc\` 2 "`#```" ; `$ y |Sע >< c  $ > B0a   |yk㿘 b|Ho (@a A h`|  $. 6 U& ސېE"L  %><  ? &&  "!$@Ő "$@6 $@$`  @$  `% Hp@`$``  `> D` > D` ,Hp@0%>< ``> D`䀠 (  |w;  (d%><Hp@  >  c<' "|``H > D``2 `<@ > C > Dc  >,!`@;90ːȐ` 0> B ,a >,䀠`> Dc" >,> Bb  >,``> D   @`0`⽐ `` ` ` ''''''''''`5> /4``(`'܄7֙+ +`) @  ' b8` "` $4 |( #@3> D$ c`$` ` ``(((`@2$` 2,< +T(> B3> Dc\p (` D `2  Fc`"  > B䑒bpT!p>,ah @58h D"4`"4@?(` i` 9> Dc", >, i?> C d`! >,AX X  *>  I@ `(! c`"  > BGbT> Dc> B =b@0    0݀`w`p`` `@  `@&    /i/h '\ 0`(`' /0``(`' 4/    ((`(@'  ((`(@'' ?DT((`(@d8> Dc"\4i> B ϒcR4 $ l %> D@F$C4 `` c`" G 㯐  TT ޠ ܠc"$41> B 㖒c4kc`" ! > B ㇒c@T2 X>  c<@'  `^ > D`> D`2 `:@ > C > Dc  >,!`@990ݐ` 0> C A`X >,䀠`2 耠`0   D @ 8 ަ &A@(` i` :> Dc" >, i?> C  ` >,`2 ` > Dc> C `0>,ah @8h @    *>  @   婚 0pb!ℐ "#"#$"%"%"%\"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"%0"%"$"$"$"$T"$("#"#"#"-0","-",".X","/"/","-",",`"-",","-".D",`   @` -   >< #P>)c 8㿘): ' #8ݰ i e`8  # )Ю  % 8> c<@' 'X'T'H'L'PT 'x''|`$`` `P`2 '  8gR?8_@ `` P`: (;(  , 7   |`'` "` ' ` `@ (;  2  7<  2  7'`'`#\`H`,q V K `H"`p4`2I<`p</ (@0```0// 0/ `v/ N|/ `  P`: `Ԁ`  `( >Ut  t4@ e (4@``l& (`2#\ Ԡ` 'P`:><cP`0@[8`0'|`S 1Q'> C!|`(-b|` @9 ->|` b|` @9  -|`" >,b|` @9 ->,a @9 |`-b|` @9 |`-b|` 膀@9 |`-b|` @9 |`Չ-b|` ؆@9 |`ʉ-b|` І@9 |`-b|`!@9!|`-b|`!@9!|`-b|` @9 |`-b|` Ȇ@9 |`-b|` @9 |`-b|` @9 |`}-b|` @u9 |`r-b|` @j9 㿐``"@` ?`(/> 9 + > Da@3"> 9` '>< >Y`㈔  ̵   v  @`?+>Y> 9 c'><>Y`#\㈒#` z p> c<' )>< #P'Ԇ@=#P``2`` `"```2'``"` '؂ '/''''' / ت`;><ccЮ` #P" , F @` 2  la"  v`@ ,` , 0`"Q 4 ,@"*  2  `   ` $`" ( @"  2  Ԁd`@?`@ " Y`@?`0?l=@4 @Ԓ P 6Ԁ #P6 #P`(@ 8`(` , 8`" ?@@ !?c2f'50?c2V`0@3@Ԓ PY 0€'沐 8  0?l@T@3Ɛ@Ԓ P= @5Ԁ "`(5`('Ԇ@?`(?`"p g #P @9  b; @9 ; @" `b|@ (@9 ( #@   >0c`P@8`P?M@'5u>0@> CH!>< >]c(#h> 'Ԡc<' `   (``0`> CR!.`> -'Ԁ5D O`#> Db`؀ qޒ '`Wဦ ` 'Ԁ`  Ho`4> D(@a> D> D`M& 'ԃHp@y ^T 9 `Ђ ''`' '''' /'ԐxВ `> :aR 1` /```#\`H`,Ԇ '`,'`0'`4 '`8'` '` '`$O'`(dNp` > 9 9Y'Ԑ0X; 8O'bb` ``'`('`'` '`$ B6 @'> :a 1`" 14'Ԁ`2Y` `2U`?c򀠠2M``2I`'`, '`0'`4'`8'؂  ''''''`//ؒ '> C#!`ؐ><c 5'ԃHp@ ?. v& Ԑ  o9 & ؀ # ?( 2(ۀ  1 `" 1'> C!Ԁ`Ȁ 1'> C !4 'ԝ>  @c<' `'d>`0 ` h2 Ț 'd 3hђ?3ސ d "  ` 'd`n /'d`2 < `2  < $`2  < (`2 < 9'd ,  06   7` >`(0`(?c@E4 4 4  p`<.(@0```0..0 .. H`" `4`" `<ܐ.    (4 *  >?4 t, l` , 2&`( #\ H 3 y'd4 `G 1 ` 8 `  8 $` 8 (` 8_'d''' ''' ' a   #\ H ,d  d >`mxG g'd0.`, 1*'d('d> C!㿘> DР  @ ` @ @@". 4(( J" m*  9> Dc `  4@6 `& 0 4 2> Dc  "$ o J$ $   JmӔ  > D#g 4> Dc  "& oj J& &   㿘 > c@> D c@ @㿘 > D(c @㿘`  +(`> Dc 0~$ (`$㿘   `2 2t ( J mv   1ɖ`  P`> D(c@ @㿘  沖 4 #Ho` (@ > DcL  27Hp@ 7Hp@ ;aߐ 㿘 `(0`B> D8c`;`%`  m &   Ho&V(@  y Hp@ "K``n "`Ho&3(@yӚHp@ +@Ho&(@   y Hp@ gg̐g> DcL `` `@4`P(` `"<"t> >a` l.*@  "> >a\ 3"*@  " *@  " *@  "> >aX΂ 2*@  " 㿘> >`   " @2 А@ Ѐ 2 㿘> m o#ȁ > m> Ȅ>b\  >>b >cX 㿘> E` `  "  @2  > E > E  m J 㿘  Jkܔ   !> E  >" " 0  `4"  y`$`$ p>  "c<''''''''    > C $  //ؐ h Jk 'Ԁ  `&&`Xـ`s`  ( , 0 4 J''''7ڴԒ@q`l&`Hـ`"m X`  X \ ` d z''''7@Z`d&`Tـ`"e ,`  8 < @ D L''''7@C`\&`Dـ`"] \`  h l p t |''''7@,Ԃ &`P0ـ`"U `` x`" $ H( $ {( $  //  ( 2'7ڴԒ@`&`Dـ`` X b'7@`&`Xـ`` , 4'7@`&`Hـ`` \ d'7@ڒԂ &`P0ـ`` ``" $ 0(F&`T"㿐 ``" a  a` p`` }`" `` `" P``` `P```2&d J j S& a'`d }`Z  0@>`0`t- F `&`( Q `'Q ``0`0 0 `(R `  `' &`, Q `'Q ``0`0 0 `,R ` ` }`   | ( (&`@' | &` `@! } '` @`UT  @G " ` k J@  ''  ''쀢 2E/ 3? lB > @ 0`/7[  `@`&`&@ (@`20`"(@D @`@ &@&`   ``@&` // /㿘@! 6I 㿐 ` P  ";  P `2   "&    䀐2 !%`"! !$``! `"!A!``!A`"!!@``!`"!P```!`"!|P```!|`"!P```!`"!P```!`"!P```!`"!\P```!\`"!` ``!``"! ``!` `Ԁ`  !`"! !`2 H!`2 2& Ji '  &&`@9&`@  `  " &`@ڔ  `  " &` @˔   䀐&`@Ȓ!$&`@Ò!!@`!`&`(@9 !`&`,@0 !|`&`h@{ !`&`l@r !`&`p@C !`&`t@: !\`&` @є !``&`$@Ȕ !`V!`L!`B!`  2ې   ܀" Ԑ  Ɛ P  Ԁ 0 P&`@t !`6 p4  ܀i  "j b ԀO  "P H&`@Z!&`|@:! !!@!&`@!@V!&`@ A` '􀠠! @`MT  @Z " ` i J`  !0`''@/7  ''//L  `@`&`&@ (@`20`#(@5 @`@ &@&`   ``@&`㿘  1  &` ? 㿐  (@`@(`#( J g 1  )4 4  ` 0` * (```#    `n`=`"  @Gi  J   @;  -5`% - 5  2 > E`  `"  " @"m 2 +c,'ʒ > E` 2 0& $ @2  ,  @  -5`% - 5 Y 2  22 + 5> E  ,@  `" @2"  " @2 {   ``2 n !`3``2 b` $ `@ J`p f K 'h @ 'h', ,  > E,5 4 $`'l! @ ˒'p@ { .`0``(``? h@ o'|@p$'@kᨐ   Θ   @Oh J`l -` - > E > E&`! 7   ```` @```P@P``@``"`P`````"`P`````P``` J f  l@  'l, 4,4$ ``2<`3`lJ '0`4 `@'`04@``` `'P`0`4`6`R `l ``'P`0`6`6`R `V ``"`'P``06``߀`2R  6`R Ԃ`@: ``"''P``06```"6R ܂`@! '  .6 )> =+> =/> =;> =-> =9> =(1> = 4 4 ,> =|`$ !$ a$ 8`$ $ $8$ a$ ,8`$ ($ 48$ 0!$ <8`$ 8!$ D8$ @@' H4 > =x`" ` 4  ``2/`l<> > > aP @%7> ŀ Ą P> C @b؀ 6  4 4 ,`    ~l @fÒ J ,> >  b@  $  , 4 !4 > #b@  % 4 4 , P> C @b耢 -  4 4 ,6b`> > C b@Д  +  , 4 ! 4 > > C#b@  > ł 4 4 , , 6&`P> C @b ! 4 4 L,,> > C b@    4 4 l, P> C @c ! 4 4 /,> > C b@   @ 4 4 Q, P> C @vc > =" 4 4 ,> > C b@g   (, 4 !44 > > C b@X  ,> ł  (, 4  $4 @`!  h  @7@'h "`h ``a   e J㿈  ` /''耦 '>`0 q```(  m =Ho (@a>-apHp@# @&Ho (@a>a Hp@&&㻰> c<@' '''  @'> E 2     @2-> E `D  Jc  ' @  4-5 >-`0``4%3`' &```"@`@"`@`2`'(p@Y e J'@C' i Q O7"N @`@2 @8 @-  :'&h> >H`!>  M  @"  $ $   0$ /d   0/e7f'h 0Ȕ 0$ h``(`>ƣ Hp@ ' "d Jd J> c<@ &> C  ` (`>Hp@ ' j@''Ho (@a>,Z`L'Hp@" 7a '     (@ ق  (@#( > E(`8  > Ea@  @ G0Ho4 (@a ``  3`  2` ` ` l1 ͖ '@?``Hp@ 0Ho4 (@a ``  3`  2` ` ` l1m g .Hp@В l`~0d`h`p`\``` ` > >a  `2'Ho4 (@a  `  3`  2` ` ` l1#  'l`R0d`h`p`\```` > >aņ  `2'Ho4 (@a ``  3`  2` ` ` l0 ۆ $`4`W8 n' "0@ / , ' 6,@ 0@ X``#\0ߐ'    Ja ''''X@ |2` Ԇ '   0Ho4 (@a ``  3`  2` ` ` l0q jdt``x  3`  2` ` ` l0Y RQ  `"  J `` " "  "" "- " $  h ```  ` -h0` `,` `dl\p`#`#\@ 'd'h'l'p't'x'|'''''','0'4'8'<'@'D'H'L'P'T'X'\'`4k 0Ho,(@a,x'0,   0 8A`" 8@ 0  0  ]"Hp@  >'    0@ `@ʀ"$   `% '  j  (@c$`"d'Ho`4> >(@a> >`   `  @ 2 Hp@Ho (@a>)̒bHp@ْ  ` @`> E$ `  J`7 C' 2 8 > C\b& 8'T J`& 2'`  (@$  0@ 0 > CDb^ 'P J` ' 2> C b3  '@ʔ 0 K `H  ``EHp@~ " $  *(@" '&' l`@0L`J@"@`@2@"` 2@`\ @d` h`2'p`2'\`2'``2'd` h`2'p`2'\`2}'``2y'3-) 3)'$x $   % >30T , `` `, ̐ | a `    3  2  ` `l , )$  @)$ @` @ n(`_9 =$ `2  0 `   n  R`’` D` n@(` _ !$ `2  0 `   n  R`` "$ $ , $ `$ d ` ` ` ` ` `Q2Hp@ 7'  D@ʐĄ''d(''Ԑ  8 q  !' "   Ȁ-  ̄? @$ $  " )r ")l>< 0> >`$  $ > >x` x>( 0  Ȃ ! $ | | ` ` ` ` `2 ` #,   ,  ,  , , #\ > HcH  ؔ  ͘ 4 n `Ć *''''' !,! ' )T'` <`2'@`2'D`2 'H`2 '@,  @ (@ $ @@9@l@D0)''''' !,! ' @,@ !$0@!4@!@ @s (@o $@k 8@ <@ @@ D@ @J @F @| @x dhl\p`#\#`!@!@ِ@ @'8'<''$ 'x d'*[$ +w|'@,@!$0@!4@!@ @ (@  $@  8@ <@ @@ D@ @ @ @ @ dhl\p`#\#`!@7!@w@@'8'<''$ ' ' (T''+Hp@ '"y"~"~"~"~"~d"~d"~d"~("~("}"}"}"}"|`"|`"|8"~d"~d"z"z"~d"~d"~"~d"z"{"{"{"{"|`"z"~"{"|㿀> c<'  @ `( & (`@2  `2  ` ` >`0` @4"   @ `> C`7` 7+`> E `(@ `R?`  (`@`(`3``"݀`ۀ` P  (@  у3`>  `?耡 "8ư ) `2  ``(`&&@`?`( (` (`3``"``   (@  3`ʀ "  (@  (@  H@` (~ ``8z ``u@` (q ``(`k  g e@` 2a ``[`` (W ``R3`@` @  `D``@  &; `27   y@ (. ``)? H@z # H@֠@ "g` ````8  `"[`  (   ` ` @(``@L` ( ``8 `` >@L?`2 @`  ? "3`  ( ```??8`(`@"d`ٰ  (ְ ``2Ұ  ```2Ȱ  \D ( `@` ` ` 2  ` `8 "  ` `8  ` `8  ``@``s#( (> E`@  @2 ``` ` 2  }2|  `w 8   (@@ `( `k`(` fd 8   (@@2' `2Y '' @ '  O``"("""""("("("("("(""("("("(""("("("(""(""("("(""p"d"X"L"@""""""""4"(""""""""`"l"x"""T`G"? ` ` * ` * ` *`" `*!` `` $h" $` `` $`@" $` `` $@" $` `a $@" $` ab $@" $` bd $@" $` d2  $ ` ` $`" $@" $ 1`!  a) `$N ) a`l"O` ``"`@`V(```"`$@`(S(``$@ `! `$@ `! `$ `! `$ `! `$ a! `$2 " d! `") a`l2`` `"`@``2` ) b! `$>> )  )  )  )  )  )  )  )  )  )  )  )  })  z)  w)  t) ?q) ?n)  k)  h)  e)   192 ! ! ! ! ! `9 ` "`! `9 `9 `9 ` "`$ba`! `$a``9 `$`d`9 `$d"`9 ` "2`$```! `$```9 `$`` `9 `$` "`9 ` ""``` 0  (.) ",``! `! ` ! `$! `,1 ` " 0  ( ) " `` ! `1 `"`! `1 `"`! ` ! `! `! `*1 㿘' P 1``A) `,`"+`&' L 0`"-`2((`&' T ' D ' X ' H ) `&' L 0`ـ`((`>T )  )  )  )  )  ) ` ``0`"2 `0`" 2 ``2!a 000`"``"!a  0`"㿘a`@  $`0`4@&㿘`B`6!㿘```0`0`(0`&a`J```&```0`0`(0`&a\3```&㿘aaP`00@`" 0```20`&R   P`&20㿘aaP`00@``"0`&R  P`&0㿘aa|P`00@``2 0`&R  P`& 0㿘@``0`0`&@`@) `&㿘````  ` `  .  {.㿘`/%! n*  Wѐ?&@(`2  " @2@@ 0@@  @ n @V`O` ݲ!"@@YS n&@㿘`!!| n*  W &@(`2  ``"@@Y5 n&@ 0@  @ n @ V`` @ 0@  @ n @ V` ` 㿘`!! n*  Wc &@(`2   " @@X n&@@ 0@@  @ n @V`` 㿘}\&& & & & & & & & & $& (& ,&@&`&`&` &`&`&`&`&` &`$&`(&`,` `   `ZV``R 0 .@.`. . `K`G  yc  y^ eeޔ` 6 ?.  &  &  &  & `& ` & `& `. (& $ 6 *`6`6 ,.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`(ee` 6 ?.  & `. &  6 `6`6 .`&``&` 6``6`.`㿐`6+3'l``t&  $ & $`j>  & $` A>  @ 8`@ h& $c'+_ (1 $`& `> `> `> ȁ``@&  $"& $`6> !& $` >  @ 8`@ 6& $c'+2 X $ ?& $`> ؈ & $ ?& $` > Ј$& $ ?& $ ;& $ >& $ $ =& $ ?& $ $ ?& $@ @ '@ @ '8@ '8@ '㿘`&a``&a ``&a`` &a`@O&a$ +`+`>Ț`c$   ``&`!&`!&` c! &`> &`a &`! `!8 @  `$`  @$ `+`$ +`>Ȅ cp       !8 `@@ @88@$!$#``#  㿘`&a``&a `@0` (` &a`` &a``@\&a$`+`+``&` >Ȥc `$ a$ a$ c%a $ $  $ ``@B`+`+``&` @ @`@$ a$ a$ c a` ` $ $ $ > `aba (  ``@``&`+`+`>Ȅ cp      ##w``#s``#o``㿘`&a`&a `&a`` @&a`&a$``a``  @` 8`j ``@Y`+`+``&` >ɦ` `$ a$ a$ ba%>  $ $ $ ``@6`+`+``&` @ @`@$ a$ a$ b|a` @$ $ $ ``@ ``+`&`+`>Ȅ cp `  `a @   # "``"``"``> Œ"   @2  *@ 2"=#`= c   0 $Te '*(`` $ ,(``$@d`X L`/` U 5H/N`/2. @ '؂?'''''Z 2 /.`X @  Z'w "U' U0J'''ܨ @ ''?Y' 2'd''l'h''YՐd !`} x`}y   `` gxg'g`gx{ ?U^ 0 '''`@ (4` >`0 };X @8*  S ~` z' '''''>`0`''܀ ?U '}͚ sФ&e  쀡 $  /   ' $.@ 쀠`-`II@` 8   5 2 @ݨE#@`?'$@  `䀦 ">@ >T >`0`} T 8 `@̔E>@ "   x@`` `d{  ?` `Nߐ @ 0 , +@`  | ?` @c ?`   ?"`"@"`"` b  @  "`"@"`"` 䀂b倂`@" ``` ?š@@)++@ @@ (@ x` @`` +@(` @ @ @`  < <` ` ` @ ("`(0(0 *"@"`"` b ` @"@"`(0(0 *"`"` 㿘  3` a` R 2` !`"`"``@!` bV$`` ; x@@2@@@@ @9 2l  @@ @@ @@h@> E@> EbH(0` @`c ` @@> C#@2ɒ`Ȁ 2`2`` `> c<' t@" 8 c@" (c@@|@h?   @ @u@2? . . . . . . @ O Ȓ } ,N`倠`'N`4 '`> D(` '/,/V?? c& xD  ` @0b@@{@2?  @& > E: &bH2> C `@"?' ?c@`  ,}5 ~@@}@2 ?(c @& xo `0a. . . . . . NR P. `"Đ`0DB > 49& . . . . . ,. l 4 &%  & Y`b0  . . . . .  . 9> C8#t? . . . b.6  &> D(` '#P '#t? > C0#h(`k& x(`*f& x㿘> D``> > D`X ~    . "   @"cf > [ ,@   値 > M ,@G,@ˢ` ?=0€ 7??  @ " >`0 ap㿘>`0p!|@ڒ#) ) ( @@#(`@$* ( ( @@$ 4$pc$p >a\   @ `@ `@ J` @ 2 0   J`@   (``   (``"8`@ 2   (``28`@ @ @ @ @ @ @ @  ` @  2  ?  @ @`2  ?    @((` @`2    +@`` (@(` 2  @) "@2 ! (`@(@ނ`(@`0 @ @J(`8`` 2  ` @㿘+N`(`" 2H J `  (?H` (@@     ((``2 ( (`` " ?2" (2 @ @J(`8`` 2  ` @  @`((``2 @((0`J`2 J` " @@:" @  " @ 2" `@2 @"  ` "" @2" 2 "   z`  @ @ ````怢 ``` @  Z   㿘?6 c`V U a?GbP![          @@@@ @ @ @ @ @@@@@@@@Ϯ@##@a@aN-@@`@?c?`@’c* ````````` ` ` ` ` ``@`@@@ @ @ @ @ @@@@@@@@8@ @`@!?@|##@x-@@c@?`(?`(@㿘 ?@ᦖ!? # {@P##6`6 @#@&$8$c…8&?c8&. > D d`S @8> D`d @ ``(`@2  `(@0 ``(`@0 `(@0 ``(`@0 `(@0 ``(`@0(@0ƒ`"8> D`d @2 `(`@`8` `2``2 㿘 $  2㾘;;n c  'x @`@(6>@ `, 4`< @"ɒ..6>@"$"$""$"P"$"$""$"$"$"$"$"$"$""㿘?N`1 @ ,*`$)?`4&? (& >& 0bd& ( ,`2 0>ɂbP$ , 0  ?0  $ $ " 4(@" ," $" 0" " ( ?㿘 2 $?` ,`@ 0& $ 㿀 2`$? %` $$,$@ '`4(  `(`?%`%@><   @`'(  @ 'ް?$(L!LT ( (`` ``@'LT( (@ (`@ @@@ '??( *>4   ? ?5 @`'(  4@ '?`    @`'(  @ 'e?" "_ ]??5 @ > E%`   J$ a5 `$``5 $d``$\5  ?򀠠8> E$h` > E@`('  @ '"?> E`%`   $h> E(a@\ ($h0p5 ݠ?80(@ (`$h@0`p0'$l$L $Tp'lT''  @  "`> E`%`   $ 5 ? $%`%@%`%`(,$8@ $<"@$,@@`'``8<`y(``@  0`( 0@@(`@@@  (`@`'L( 0@@(`@@@  @~@ '? $5  `"v> EK` $1 w?$@K$ (4$,   v;$@'@& $@`'݀ @ ׀ 'H?$0`5$@ "?(@?-  4$`2> E`h%`  $  $ $ $0`5$@` +`@  $ $(`0`$@$5 `0@ π b<$L > E$Tἄ  $P$X$4$, "@?" `> Ea@%`   $$H'`@'H( @ 'а?@ $(@@5$@PX ( (`$``@'PX( (@ (`@ @@@ '?:(@ (0`@0@@(`@@ @  #$@`'P( 0@@(`@@  @ @@ '`?$5 5 @k$> E`%`   L$d$h  8 TL( ( "(`@'TL( (@ (`@` @`@ '?(0``(!h`̀`` h@`'( @ '?`d`$(`5@$h 0`p($H0`$D'`@'H( @ '˰?D $(@@5$D(,@ "@ > Eax%`   $`@( "4D"@&%@@8 @ & $@ ( @ $, 2?(h5$0`` ` d` @ ^`) )  @$h 0`p  aa` @h@`'( 6@ 'L?` h@`'( @ '1?h$ 5) `n@? 5 `h5$0`` `> E`%`  $  $L$l$T @ * > Ea%`   $l`$Pd *``p$X  @ X  > Ea(%`   $h $`(`0'`4 ' `,`T`X '@> (@(@ `8`<`L`P'&@?'ܲ#''''Ԁ   (@ @( @ @6@o(` 0(@@@(`@@`$4@` + a 4  %& &($  @ & `&    @ " a& %`< (@@%`8(`0`  (@ @ $(@ @4@ (1 @(`@@`$4@`40` (($4@$@"(> Ea`&  %@ "> E %@ y 4  (@ @( ɢ@a@&  %@(( (@ @ (@ @(0 (@ @@$4@#5# "耠@ D 䀡 r@   ? .` .` `.@'@< ?* @@̘ E  + >:`?+ +   + / + ($`$ؒ#@ ܀ @!    (@ ܆ (`Ԃ !@# & @   (@ ! #    (@ > Eax&  %@""ߘ"4""""""""""0""0""P""""H"|""`"""""X 2 $?  " " " " " " 8 0  ( , 0 8 < L l P  2 $? ` <@`  8" < (@ @ (@" 8 㿘?N`128?@25? 2? (%$  ,`> 0  ?0 !`$ $>```/"```8 ,"`$"`4"` bP$ ,>$ 0bd$ ( 0@?$ $  >b 㿘 2 $?` ,``4 0@ $ ,@ 0& $ 2 $?  `" "`0  ! @ `"    `! @ `  @@ 㿐 2$??2<`?`h<8 `$<)$$8  * 8<1 $8$<`$hh @$@<$h`ð?ܐ  << $ 2 $??`  <`?㿘 `W?`$`2`(?N?`,`J `0 ?0 B`4`@ `$`(`0 *@ "1`0 @pƐ3 pa0`Le0*`la,@8 `l`P0  @$P$L`l @e0$l`$`4 p*$4$ $ `,@?˰ 㿘 $ 4T ("! $&@@ :( 0"@ +"@p{@26 0 (@@)$ 0 ,@ @$ , (@$ 0$ ,$ (&@@ * 0p["@  ($ 0$ , "@pR 0 (@@$ 0 ,$ 0@ ڰ  4"@p@ ($ 0$ ,  $ ( 0  (@ $ 4  㿘 2 $?``` @`     & `( `4@p"@`($`, $`  @p"$`,` ؒ   `ڰ?$@?㿐 2 $??  `"  y  8< 8?(>`">  @?(@`   `!$> GbX&  $">  @?(@`   a4`$``4 $d``$\4Π?򀠠> E $h$h\ (> Gb "g>  @?(@`    ($h0p4?@ (> Gb(`$h@0`p0 $L$l$T p lT@ " > E`&  $~"+>  @?(@`   ,44?c ( $& 8   $ `   $& 8 $`2L> && ($8` $<`  @"        & &@@> C > @$ " ` "@$& 8<` @ (`?(`& 4`"?0 8 ">  @?(@`   `2 `b4  $ ">  @?(@`      4 2/  $   `  ` $* @``   @@ n|2@% @@$@`M $@$"  D  @```  ` @)$@@2l@(% $@$"   @```$  `(@)$@À@2@@% $5  8 ` ,   0   $& 8 $:">  @?(@`    `$@ `2/ Z ">  @?(@`   ?c> Gb&  $ `   4 ?$">  @?(@`   $4`9 ` $0? $H$H :@ ">  @?(@` @ $(@ 4$@ $XP (@ (@` @` "d>  @?(@ ( `  ``-( (0` 0@@ (`@ @   "=>  @?( 0@@ (`@  @ ` @$4 4 @7$> Ea`&  $m$`&D:@0 @b4(  @@@8 '@ $@ ( @`@B$'?(0`$D$H $H"D:D ">  @?(@` D $(@ 4$D, @( > Ex&  $$@   $@` @ `lʔ@ @%$@@'@   $ $h$`dh  TL( (`@`` ">  @?(@ (  `(0``(˃+ `*`C:$ "c>  @?(@`  $40` ``    h ($h@0`p   ?  4 "9>  @?(@`  ?4@ l> E`&  $t ?$ (Ta(T> && $8$<u  8<[  $S">  @?(@`   " "c  $? 0x> G4  * @ o> G `B> G$4 `> Gbx&  ?$+  $( ` #$">  @?(@`   @> G&  $">  @?(@`    & @> `@  $`G ' $& 8` 44?c (`,f> Gb&  $`"k> @/  $>\'O4/c $ Ѡ *, >*  $  "@Cg$`"yi?`/  `$,`  `L (@ (@` @` ">  @?(@ ( ` ` ` (`   0`( 0@@ (`@ @  ">  @?( 0@@ (`@  @  `(`0`$@$4 T0@  @"= > E@&  $ڔ$Ք$$ 4/ʔ -$  !@> E`&  $$ @40`p$h 4`2> E`h&  $//44// $$0`4$@ $І&$8"q > Gb&  $b@&  $ $> G$Tc $L$X> G c$$P l $/ /d  $$   Q' $:$ "<>  @?(@`  $ @4+ `n@? 4ֈ`:$ "!>  @?(@`  $40` `` H $0`44$@4` b25/  $E & > &$<$8+ > E&  $<U 0$L$l$Tl pT@E *> E&  $#> E`&  $4/ڔ $ (@ $ Ȕ $ & 8 @? `` $l`d$P *``p $X @ X " > Ea(&  $@ 0@`` 20@"@ (@ ( `0@ / @ ?/  0`(` @`(`(@(0`$ %@ " .@ڶ.ڂ (`@ І`ƀ 7@0   +@ ( ?`1?(7@+     (@'''  '?  '"    `(@ (@. (@ 2@ @" @(`@`0((` (@ 0 20T * (` g` (` @>0 @8"'@@(`@  (  @ . @.  @ `` (@ ( +(* (`'@$@80 }@ @ ";7?H> I> Icބ''? `? (@U'"&   @@   @2@(`(@@(`0` (@ 0 20 -@$%@ @ @ր> J> J`\}''! 2 $?  `"  2 $?  $  (@ @ 0 2 $? " |" " "    2`) (" 㿘 2 $?`` * E I [ g q"`"`D , 0@ $`D"`@ , 0@ $`@"`8 , 0@ $`8 , 0@ $ ,@ 0 q& $` ?㿘 l 8 , | x   @@4  6t8@ (`@@@  @  `@ @ (`@@ 8@ ۂ@  ւ@  `/`*`%` ````@  !`Ո!a@"p@  8 l@ @@E@ @  4 / * %       2 a t "p a 4t 㿘`  "l?`$  @?fِ 0 ( %?@ Zf&`$`,$@`(`0@ `,$`8`(`0@ `L$`@`(`0@ $`D@`(`0@ `8 6$``@`"3`D`. "-`, 8f* @`,`@f* D`L`Df*` f`   `@ @$` ?@) $@ `$kij|$@ $k$$k0 d?㿘 $ 8 2 ff  $&  @!    $!@& > ` @#` $ ` & 㿘 , t,A `p 8 l t  $@ $$ ``a`"e 8f' @@$<  t@ & t 8 l X T& H(@ @@& H!< `7 , l < @  8e p l \ L D @ & p& l +`& \@ 0 @@ !0 ` 8뵔$ 8칔$ 8㿘 2 $? ` ``B` 8뗔& 84 ,~1& 8e 8$ l$ \ X$ H T( ?@ @$ H X T H(  D@ 4@$ H(` @ (0 H D(`0  : 8 Ҳ@ `* 8㿘 2`$?````> J@`"``@ ``*($$(`E"`I"E`["`g" ``2 @42l> Je`2 t`2`> J((` ?`" "~` z `G `C `2`8`8 (@$`8 0`( $`8( $ `8( $` ( $`` + 0`@* $`` (`@+ $` ` (`+@$T` $`? ,` q W`8 (@$`8 0`($ 뙔 $`8 qi$ `"F> Ja$` ?"E`> J``2а ?$( `> `)0 l((``  q` @я$$Ql`  `8J`8?cD@   G $`8`׀`֐ @`` @А ِ``"?` `p?  c@( @ ( `$ $ @@ ( , @2 ,` 8   ,`" :  `8#  $`8  " I ` [  $ )`$ @2 ,` # `8ђ $`8h   ,` * "J"t> Ja$` ?$ $`W g $ `$ )$ @2 ,`@*&+   ,` @* " M`8# x f$`8 g$ [$ $`8# k@ $`8g$$  @  `"L``_ׂ?$   `8$ V$3`8?c-@ 0 9 $`8 ( ?( ( $ ,   $@ @ @ @ ( ) ((`@@@@*$ )$0`($(@$(@$ `o ($ (@`$ `" , (@`$0`(`$ ,`2&`8 E$ $ I$`8# 鿒@ $`8=@ 50^`8# 鵒 $`8D(`@0LD* f0L$`8 (@((@((@$ ` ( ( q $Q$    㿘 2 $? "?5`   `2?> J .``.`$@+``+` "    @  $@```& & & & & |& ג   ς 㿘 t> J> JbЬТ /bbb! ( ` l 8 H X T D(@@ 4& H @(`@ (1 H D l((`01 ` p & x& d`& ` l`( h `@ 8 h d t" (1 @+a(`&@` 0`+`3``ϖ (`@i0i t x l  @?& t& x & l 8 H X T D(@@ 4& H @(`@ (1 H D l(`1 l x(0?& x`ވ & h& l2& ` t!w W t`"9 l h`2 8 \  8 l`"`?@  l & \`, `   \  8"@   l& \`2 t `"@ t 8(1`(&(`0@"7 \ l t?& l& t`!    l ,"~+` `*Z& ` ``(5  x l?& l & t& h l3`@2a  8 l"@   l& \ l  `" p x"@( x x & ` l2 x& ` l⠂  ( ?3 *)`& `0>& h㿘> J> JbЬТ bbb ta΀`` l 8 H X T D(@@ 4& H @(`@ (1 H D l((`01` l ,"~8  ` `ϐƒ l& ` ` p p" (`0? @+a(`&@`0`+`0`0` (``0 t ` ! `?@`& t (^ l& ` l 8& l H` X T D( 4 @& H(@ (`0 H D l(1 `+`& ``3` l& l"u t \  8"@  l& \`2b t  8(` 1(@&(`0 t l& t`?& l l 8 & `& l & H X T(@@@& H ta``"˰ `*` \  8 l`"`?@g lb& \`, `  @Wa27 `24 ` l-& `㿘 ?8 t> l \@& t& l` 8 ,"& l& t  8 @'  l"& \`"  l \ ,"~* t  8@  l & \`2 t ) t`?`" l`" `" l \  8 l`"`?@ l& \`۱, `  `0` `?@0  @ $  0`" P`>сc\ 㿘 2 $?  (` ,` & & & & & & 4  $ >$ @?`G`*1$    & 8$ (@ , D L(`$ <(0 L D* 㧔 > J(( @@```$  $ $ $ |$ H$ l$ \$ t$ h$ `$ x   ̐ & 8 $ 㿘\``?H@`1@ 2 (?`& ,`>ɀ" v  ?`8?2~?${?4x?`߀` 4s?`ڀ`n?" (0 )?@" a $$ ,@$$T,@?$P$L$, $4$$$0@ $X(0@ ,$8(0@ L$@(0@  $D,@"$(0@ 8+`$$$ @`!> JD` "" +`@ ,$$$$$  bP$,>& 0bdy& (> Ja"$$ ?㿐 #\#`  P > #  > J a(@ >`p 㿘` 1ו  x0` x0i L0j|" 2$⬄""" > EbL"+"+ )> Eb`"+$"+,*|> Ebt "+0"""+8" 2"" ʞ@㿘;`P..@;k\*`X@k\/ (`@7`@8*@@*@ .0 k\.) @k\ .\./ ((`07`@*@@@7`@ܸ@ k\ @ @ @ . k\.@ k\@  (@㿘`(`    +`?@`<0`0 ? |0| '    @(`` (`7 " &( (|`0|꼀 `3꼀    @ܲ`4 `3  ̶ `3ĝ㿘`(` `   `0` b? b(`4  "7 9*@|   /@6 (   0/@  &@& ?6 & ~  &@@| (@& @6 l      @m k !* @~ &@@$||   /@6 (   0/@  &@& ?6 & *  &@@$s**   /@6 (   0/@  &@& ?6 &  $R    (@6 /@   0/@  (& ?& 0  @8 6 1     @48**  &@@4{** &  ( 6    (@6 /@   0/@  (& Ȃ?  g  (& Y6  (& 6   &@@4&** &  ( 46    (@6 /@   0/@  (& ? (@& @X6    /@6 (   0/@  &@?6 &  &   (& 6    /@6 (   0/@  &@?6 &  {&   (& 6 bb(`b0`(`"*`0@`?b> Jc@ "(``02`> JaЄ(`0@`?> Ja@ 㿘`Р> Jc> Lb> L> J⸪ܮaД ⤤☐d%⼅.` ` &@$    /@6(  0/@  && ?6& :d* (֔  (` #@$  /@6(  0/@  #& ?6& @ $2> L P &@#@$  .@6(  0/@  #.0`8@& 6& 2`6` (` ` #@$u  /@6(  0/@  #& ?6&  "> L < &@#@$a  .@6(  0/@ .#0`8@6 &  g& d` #@$Cdd  .@6(  0/@ #& >6&`b&(@& @b6(@& @.6(@& @6@|a.& @p6.& @6(6&`b&p`@` @"=PT&&?'КX   `( (` \'&   `0 b`P`Xb  ` `&ЀEЈ   (@ k\ 5  (@& `@  @&  ``&` 0@8`  ?,`X`P`T`+`(@k\&+`& +`(`&@( k\( \, @@4  `@,3`1 &+``ͤ`T+` &(`@ k\`@`'  0k<  T(`@k\(0`<, "k\@( `(`` `1 (@@k<`3k< ԃ(`@[В&  [Ɛ@&<$@`K- ? -`k8<`  ) `?`+`(@0k<<0<+<`3+< ' k<@`",kX(`@ @%[&4`?`+<  @(`0Ѐ!  ` Г) @   @ #0(`@03`2Д`(`'Ј  ``   ( 0`" 2"   ( 0`( " 2" 㿘 $~⸖    +@ @6 )  0) ? &  @ & ;@6 > K `Ж"d  "@$T""d   , @6 (   0+@  "& <6 & ⼄ ` @ `+ ?⸆ (@ @ 6&  6N⸚   ,@6 )  0) ? @ & <& 6 h b&d@ , & @6  & (@ @6    +@ @6 )  0)   @ & ;@?6 &  ⸆@,& @6b`` b  )  0`( " bb"2b  (@" bb"2㿘 $?⸚   . @6 )  0) ?.& 0 &  @ 86    b&+@ 6) 8+@ 0) & @ @ (@`@& . @ 6& 㿘 `G2+1.+$+ +()+0#> L  @(`@j~`2 @b b`(@&  1 0:@8 `t+ @` `ր ⸆(@ @6& ++(``      ?( @6 +@   0+@(0&  @ 86   ` &    .@6 )  0) ?& &  . 0 @ 8 6    ?( @6 +@   0+@  (& 0 &  @ 86 3> LbȖ b (`@j~  + @6 (   0+@  &  @;&6 `   (`@j~`( &6  g)bi@`4`+ ` 2  ̀`  2 ̂ `?#`4 ⸆& (@ @6> K> L`ДPА0   ( @6 +@   0+@  (& 0 &  @ 86    ( @6 +@   0+@ (0&   @ 8+6 +( & ``  ?(@ @6& ` ⸆`& .@6 ⸆?& (@ @'6  { 2  2 @@X@'Ȓ?''''>  @ J   흐 ?Ԑ&@>сct?><c>  < @><c2@ *`@?"0 `(@ # 0 0 ><`c> a` < @"0@(`  0 0  4@㿘> M, 㿘> M' (㿘> b@ .@s> Bc> M P㿘> 3a Da`> B؀`?(@(  &`'` @` & 1>B> M`> M`8#@ @ @` ܐ > Mِ h㿘`,`.> M` -> %08  yHo` o ~ Hp@ "  ߦ&`,&`(㿘`>  ֐# 㿀@ @> ,a> dc? `$H/` / ` ``  `#` #\#dn Hp@'@\ @`㿈> a&`,#\ # &&&`0&`4&`8@`2`8> M> M`8ݐ @''@`` &`(&`,0 㿀``,> a #\  D`@>bl"=b`,?(( 0`,(`(`@@ `4`,(( 8`,>B`&`, @5>> @''@@ 2 b`,㿘&`,&`(  2 "   㿘&`(&`,p ’㿈#\@X ` `  ` \ ? `0 ` 㿘> 'a􀠠 `؈``?@><`H c>< c`>> #c\> +&`Ll>ӂc&`P&`T>>҄|a&`X&`\>>҄ bT&``&`d>> ,`&`h&`l> +>҄0ad&`p&`t&`H> +>҄`&`x&`|8  @W30> M&`0`@B>&`Db"&`D`D/> >< c> M@Ba`0&`4@0(@&`8   @''#\#` ? > Bc@ > M%>B 8 &`@ 8`@  @>`"̂ (`@`@* `8@@* @@>-?@>`0$U|:  0$ „D$`@>`"h?&`8&` M `!p>>a&`8> Mגa ( '@A֐ > )>Ҥa(@AԐ @BU@E+ 'n' 0> ML! '䀠`" @`b  ƀ@ Ġ@ZS㿘`>  h# 㿘 `" 4 > Z# 4> MV!> 'a􀠠 > MK!ȁ > Ma& 㿘> 'a􀠠. > !@* >`%(` !  ?05?c8Ɓ6@2@ 2  @U  <݄.㿘 <`*?`4@ -?(@` Ј =`?`( 8 @     2 &`0> M!㿘> 'a` ` `ִ``?`֬``?P> 'a􀠠"`> #`4> 8  @U0&`0D  @Uy<%> M&`4@@ɐ ><@  &`< %k&`8 2@A>< c`0> M" `8 > Mhb( 2' '> Mb0#>Ւ`'' m> Mb8'`'m '> M(!> a?@>B > 6`#㿘``> '1> P#a􀠠" > I 1><#`"$>k"$ށ> M`b( > 1> ֒ % &#> M"@㿘``> '1> !#a􀠠" >  1><#`"$>k"4> M`b( > 1> ֒ $Ҕ &#> M"hP!> '!````$> > # В>ؔk^"D!`"``4> > ֐ 8 N> Mմb 2' '%> M@? @@  &`8 $&`4 w@@0@?> MHbb(> Mc>aL``@A R@C. "@t 'l% '쀤`> Mc> )> Ma>ըa9> \@@3`O 2@? @B =  Ԃ`' @5 'k 0> MD"> M"㿘><c` cc@>b200@02 8 #  >ׂb" "@Qԗ ޅ.`> MȐ#P> MÐ#(> M"㿘> Ecd. > '@(`)`2><c4?"'> M><c*    `" 0@   @ 0 2 @< 8@TK?><> M#x > M~#`P` @S> ' ''쀠s'.> EP'耠`  > a?@@Sj ` 'C'?'` '`8 'U]A'@'` @"'쀢`#>հ j<<@  `2>b '''' '>հ j> M$b 2' ' $*> Mb0 2' '> M b8 2' '>ׁc >ׁc >ׁc 㿘> 'a``$`"  > M#`?> M#ް  > Mؐ#؀`?㿘><cԀ> ccЀH`> 'a􀠠8><?8(؂`(@Hp@H`> 'a􀠠><?8(؂`(@Hp@> '>*b01><Q0(2 `l#><c?8((c><c?8((c؃Hp@㿘1> '!`'5><Ԁ` ,1>  ?8 @RT !`5?8`@&Ԅ><(c><>ؐ#b^n > ccЀ"1>  1> > M>>#aHӬ  25><> MC#>< c><c`21>  ,  @R &@&Ԅ><(c؝㿘 ><#Ԁ`> MH`><#Ԃ(@()Hp@><c؁# ><><c  H` @( )Hp@cܝ㿘H` > m> mc c` Hp@>> `?Hp@>>><b> a>B # @ > 'a><c>=** * * * * g** * * * * ><cH`><c ( * c(Hp@><cH`><c ( ( c(Hp@> F|> F `x`x>0a$ |㿘!> F> M b x#> F x!`   WR$`|$`|  % x㿘'> E 2 )> F `1,> M@b#> '" ` N@ 2(`8`@ .@b@ W@((`"洆  `    Ѐ㿘> 'a6  2  -#> Ec`' %  Ô `  c@(c% @@8DX  `  "H _㿈2/////`P//&㿐> F`> > ` ><cj`><c쀤]   ,@  @, , @ @, , @ @, , @ @, , @ݐ @v, , @Ґ @k, , xP@ * @,  `,2㿈/////7B㿐><Ya  ƀ a@ > F`;> aa`> > N`0> #(> N  @8`"b> N@X> N``T@a> N h> > cܐ#(> Nِ 0ΐ  ' @,' ' '`0`(`(`@@/ ' '`0((/ ' '`0`(`(`@@/ ' '`0((/ ' '`0`(`(`@@/ ' '0((簄7 ','㪐> a0> N s> F> N> `0#(> N| 0~㿐> F`=!> '!``?> Ec̰C!><c ?(`  ` '0><c><'!c>< `    ><c(   > N 㿘> F`!#> '1> '"Ѐ`d> N) !><> # c d &"> ' Ԃ  L) #  L(# (bВb@@ǐ O1>  쀠` b&  @ + >  `@̐> Ec̃2 @8``d$!> '8@&8#c!> '!`;` c> 'b?(  (` c><8`"; > Nΐ! d&  >  `@> Ec̃2 @8``d4Ӆ8!> '> N  d c$b1> > '  쀠` b><> 'c><(` * !c><8`"L+ !`L 㿘>  А0  @NW%> E> F c 㿐#> 'a` 2 a`#,>< 5> F &t%`&t d'&@MC@8 < @`dtt1> NT!h? @N  ?` ٲ`> N!P$(`(`?" @N 0?  @N   ?! ? ><>< c 㿘> F0    @M `>=`` `` `(> ) ( 5>< aD&K 1> F & tc  (`(`` (`` (``Lݐ  (` t` `$t t> N`a> c1> N!1> N!㿘> 'a􀠠 >`( `> Mα#`?> NΪ!  I 8@ > NΛ!؀`?㿘> 'a􀠠 >` > F > MΆ"`?`<  Ib 8@ 㿘> 'a􀠠 V``>`> F ``  IC 8@ 㿘> 'a􀠠>`> E Ec耢  I( 8@ 㿘'> '> Nba> NJ!> N+b 30  @M0%>>#>B c@ $0c  ` '>b>=!`  (((`@> @@>< D   @Lޖ(>>b >B# > E  c> F `  (((`@> @@>< D > N@8a㿐H`> F`> 'a``?`'Hp@ ><c'0><c 'J?J1 0> F`:H`> aa"`" Hp@> m#܀@#܀@ "@#@`Ђb?#` ?/#@a#`@##`"   K;@> FH`><c"@(KI@㿘 0 @L2 ><  c> F1> (`Z 㿘> 'a􀠠 > N4" `?㿘 2  8@b > c& 8#Ѐ`"& 8Hoo> 'a`"  8`#> N 8 4b0@1Hp@ #Ѐ` > '>*b0 <J(2 Y؁> Nb0@ƨ@0 8b0@?8(0㿘`<&`0>ߔWap> 'a􀠠" 8> cc> F 1>  А0 @K &`4㿘``"` `  > 'a􀠠   > N̶"(`?"&  ->&""b"""" ""$""(""8"",""""""""ȁ"""" """"$ "" ""8""("","" """"$ "" ""8""("","""` """"$"" "" ""8""("", €@ @ &Ā@Ġ@㿘> G`  H`> Gb H  Gɔ" 2Hp@ >= `(!`H!8``"""!"!"""""""""""""""""""">`""Ё ""  F @@㿘> G``@2@2 @ 2> Nǔ@㿘!`ĐH`4 < )> '`!?`?> G!` @"  "  @ @2  @2  @2  @2 &!&!&!&! ``@!`" !Ԁ`2" `&!"`2" @&""` `&" ` `" ""`2"!`Ɛ"`" "`" "`" "`" "`" "`"z "Ā`"s "Ȁ`"l "̀`"e "Ѐ`"^ "Ԁ`"W "؀`"P "܀`"G "쀠`"" > N?@5bP?u> N?@5bh?V)> '!?`X? @`O4 < P``H&"> N?@5ԒbP?V> N?@5̒bh?X?> N@5Ēbx> Nb?@5)> '0> G`D&"`&!`@&"`<&"`8&"`4&"`0&"`,&"`(&"`$&"` y&"`r&"`k&"`d&"> N?@5bx?*> N?@5b?> G< `4 >a> N?@5vbh?>a#> N @5lb 7&"@5b@5d 0&"ا4 㿘@5> '`> N` b @5R &!&!> N@5Kb> N&!Ԓb@5E &"㿘 @>@`,#@> N Ġ@"㿘 ƀ@> ""  &!@&" &"!̀`  &"> "a &"&"!̀`  &"> N_"!̝㿘΁㿘>  M "8`9"0#> `c> Nb> @#("<` c"D8`2> N#3: > aX"T` "\8`2> N#(%: > aX"l` > N"t8`2#: 1> ! `> N"`p"> Ncx" "$8@?2` @ h:` > N#> נaX""$8`> N2`#@@:` > ɠaX㿘`:@&"0> N@4cȔ &"> N@4cؔ > N@4zc> N&" c@4s &"$    (@4> O"&"((@ &", &"4&" @4Y` "`&"> On 㿘!!!!> Oe 0㿘"`> 'b   1>=@d3> O ( ɵ`p㿘!>= B   `"")  `!`#0`$   &""&"&!܄ ?&!Ԃa0&"!&"&"$ @&!&!Ԇ!} b@&!&"&! d&" &"&!Ԅ!6y&!܂a@&" !,&"!&"&!܄ _^&!Ԃ`@&"㾐Er'pp8```&" >= `> c<@'  \&a &a>D 0>D"> 'a```^> Oa> 6`b`@Ő>=`> 6y`b@57a` d> O> O В >=> O 0>>H>=H`L`> ސ b`Aa`#&`0@ Q> P> O @3n` &aăX8``` a`> '> F` >D"b`H/` /b@@dHp@0Ia> O > > O> F`z > O> F`u abe (X! `㿘`^``?㿘`> O@2`> O&"0`@3    &"8&" !> O@2!   %> O@2 2D"8 > O@2a> O&",a@2 &"$@     `  (@" 2z> O", &"(> O@2ΒaВEE&"!> O@2_!耢 2+!"`1> O"@2ۄ߀`" ! @2> O&"La @2 &"D@  J  @S "R&"H> O!8 @2> O&"|a@2 &"t@     `  (@@@ "&"x> O"&"x > O@2lb("|&"EDEB&"l2瀤@X&"8{ `  (@@2@&"H > O@2FaP"L&"PEE&"< @2:> O&"dah@24 &"\@     @ "&"`> OC!`  (@@2쀤@&"` > O@2a"d&"hDD"H"`@&"T"D"\&"("<&"$1&"㿘> PM p> P> P F> P > P?耎`> P> P!㿐>b ''Ԕ㿘 + ` ə  > P!`> H`  > P!(> Hࠀ`+> H@" ࠄ €d ޶ 㿐>b > P2`! > H @ > H ? ! > H `> Hਂ @? ! > H `㿘> c> ab(> P> P!> P> P"@X>=`؀`" > P@> P> P"x> Ph"㿘> 'a􀠠2  >=`؀`1> &  А`>=1> ` А0  @EW >=> PH"㿘> 'a􀠠2`  > PW"耠`?`O``?>=> H`?c " (" `>=`   " " 㿘`" > =" > P7# 㿘H`#> 'a` D a. C Hp@>=`܂ߞ@㿘H`#> 'a` C a `CՐ Hp@ >=`܂؞@ > '(@`>*b 㿘 > '@`( C  > '(@`>*b 㿘> '@`( C  㿘(@3> 'a`( C (a`C| (@㿘(@3> 'a`(Cn a`( Ce  @ 㿘  ߐ  0`*`@: @C`㿘>=`%> ' @` C? `> eax@r'@/ X`> H" X`   >فb 㿘 X` !> H!`  $!& X   !㿘`  > P@@.`? 4 @: <` ,<,= Ґ#㿘'> H`  ,` `@ 2L `L ܀`"@BC 0@㿘 >=. `@ `  @2  $@ > nc> <' 7> H`^LHH@H@ `> P#?`(`  ``0> Q @/   /`> H> Q 8 "/> Q>=& `܈ , >=`( @ @ > Q>=` /`> H> H> Q@s 8  >=> Qi H0@/^!> P@# 8D> P # p@  @ 2c> PH#`?> P> P> Pccp@  @ 2%> P+@/!@ ( > P?#0_@#0?> P@.Ԓ> Pc >> a@N @.Ȑ> Pc 2E?Op`H`2H`:6?H``2?`z/-?> P@c > P> P@.c> P’c 2?Op`H`2H`:?> PH``?`z~> P|?S`! 㿘``Ü '``> '`(>  a >r&88@ > > 'a􀠠> > Q?@.8``V``?㿘Ho%(@f@Hp@㿐!> n#`H`#``  #Hp@ " Hoo1> '!` #`P!`> \`$(Hp@ > \`$(#`P!`> \`Н㿈`>=,`@``2a0@`> Qa0`> Q x`> Q  > H>=`, > H> H7> H;,`> Pc'@''..$$,  0@ $$ $$ $ $ $ >F 4>B `Z?$,H$,K ,J\,G> Y^ a â`> m쀠`z> mc耥>`4`h@@& &`0H/` /> H` `  `  Hp@> 'a􀠠"`> Q @-.`؀ y>$X>X$T$P` `T `P `X$ఄ?$,H ,K,G,J  > Y 2` Ho+(@l Hp@> PcO'@/q $@  > m > H a@>`2>@> Q`9'~ h> Q~ 㿐`/H`> nc(T@ Hp@@Hp@Ho4 (@l @* I@6* G@@? * J* K * HHp@  * G@@?@?? * J* K* HHp@ * H* K* JHp@  * I㿘  N `2 D   \. ` , , `""*  4  * L * L * L㿘  ۲ ٕ ` % 5`* %* 5>cܒ  5* %* 5>cܒ 㿘  4Ԑ 8 ` 8 2%` 2` `@ 8 2`D 2`D "『 `D@݀ ` 『 @ۀ ` 逎 @ဎ 㿘 g`  B p ` I 0` 㿘 0@ߐ 0   ;  !  F $B  *>  # 9  %  4 &0  ',  .  ' +#  ,  -  .  /    #   %  ! #,#P#`#p###Č#####t###Ġ# ##< `p2`` `" `*`*` > H a؅(́> Hb 8`(`    (@ऐ @ ࠄ( @ ँ ं(@ ࠂ@ ਐ??  P`  D` ``  (@`4`" ` (@@( h(@(@`4``䀈`2  ( >فa >فa 㿘> 'a` $`"`P`?`h (=`h ( Ő  =  㿘ab= ? ` `` d (@?㿘 P`" ` h ( `? (= `(@ P  h(㿘 ! 6`Ă (@&(`Ć&8`Đ&,` &4`&0`$cpXt&&H\ڂ`d  ];`ao 4 p \!  aW! 6r&&! V$ <6  ?(1?0`#. 3>6@7cL㿈 D> Qa0  L> Q{x!8` ` `21> Q1> {n {l"`   | } ~ #`> Qb #d#h#\> Q> Q> Qh!{Y! } |5> Q1> Qh{P!P㿘`" > Q {E" >> >`#L >> >`#L㿘ab  " `d ?(|`` @Ѐ <?2`` > Q|%b?$`?$`> Q?|b㿘  P`2: h 뮒  &   c#a" <Ð# ``Ѐ`<bՒ  2   2  |`怦 `  P`  h( (@(< Ē   k |`` `?㿘  ?p  ` d    _   P` u E 0㿘  $ ``&  & !  ? & & `X` &  H&  H $ H А&`@& `X&!X!K $ L А&`@& `X&!<&!X!Kr $ L㿘 D!X& X 쀈` ` T"1 ` `0$`4d$`0 T& T&) & L& T  `  @*@? > > QcY> y А> Qxbք `" | & L& Tɀ` `" | P`@?& T& L > Q yؐ" `؀`@2 P }`" P> Q yʐ" 㿐 p`"o L& p& l '' D"/& LX "N 0@" L H' L` (`> Q #cP>JC P i& L `"8 |] D2X& L J/ P `& L0 WȔ  ` |``  @ }(:۸$ $ ? @$$<$``  }`Ĵ0$䀈`0 P`" 0@" @ @ ?$& & Lp@Wm Qc8 `& L& T$ <$ 2` * *@ *` @0:<I䀈 `(`@`4 " 䀈`$ P & L.$I?   & L& lJ& ؒ   Ґ Iu & Lq: d  & l& L В!I& а I] 0 < @ 0 V @ x D  &  & l& L dI 0IB < @ 0 @ Vݐ ` }`A` |`"  T` 29 } \`@"5 } T`2o X & X \`@& \& XȂ $Ԇ$В 8@ <`D  D` `` & L $=`@>  a С( @ @ @%@ 8 $"  <$@9'@99@:`@> Qx # H 0@& t `& x, ( & l& LV2& I/ 􀠠) M ē,`@ `  `     MÒ 怢 ,`@ `    `  ` ~ x r l f0> Q& H$:$50y ŀ N&0l` Ag  < & l`  5 Z / @8`( P %0` \`$ X``& X & L 8(@ $܂``@& \& X> 'b@   G  H5 GĐ! $ $$` @6:% @`  @*@? > > QcV@> v & T & L ᰒ H  L`> Q>hb#`"@ $ `D"!<" `H " `H #`H>bА 㿘 > H D"`8`@6 "(`    <` (@@u  4` 0$  & 4 0d& 0Ho$ (@ Hp@e0<, ,` @@ ۀ `$@`* !80`@8` : 8`@ 3 - ` ` 0( (  7* @:& @Ho$!(@Q\G<`$`L`> QvS#x`0( "& @`(` & <āeޒX0㿘> Hb 8`(` Ē   7 )$,$D`$0@`77``7Đ@`  7*@: 0`@8`8` $$`($H8$<ؐ  {㿘> Hb bA @8`(`z@ a@"SR$  )b=@"`m b@@"_'ee@Jr@A b>@2 Đ 4̔ 4 `q@  `h@2ߐ  "( "p@s@2ΐ   |! Ґ5 !   ` t    4!  `n F  " $c@`   W  e`g@6  ?(1?0#@`@`@. 3>@@0cL㿘>acDDa%>D? "-> Q 0  > Qu;#?&`&`&`,`@  `4/ , ) `&`X&`LT̒`02&> 7 "X+ &`u#ۄ?㿈 `"8&`0`P&`L`&`l&`P&`p`D&`D&`H > Qt#؄``> l bt&`>  b|@7 "`> Qt#``]0 >@6^bx`0&`Ȃ&``&`d&`hX `P 7` &`P X)&`\ Z`P`[ `7> RtĐ P8 !'> 'a> R``> ͒c 2``T` 0"]4` `"'`Д>Cc\`>Cc> H>'aش`'O( ``' @" (`h`2`P`0&`h&``&`d 2> Rtq k> " `7> Rte 0 `70 @7/ R&`0` <@ @2>' @'㿘> 'a```"> ͐c      3 8@ > R`` `> ́ 㿘Ho$(@e  $& Hp@㿘 p```> R Ls pHo$(@e,Hp@ L> Rs 0㿘Ho$(@eHp@㿘Ho$4 D(@e D`" LaX`"& L L`& LHp@ p> R s & L㿘 $Ho$4 (@e &  D"  LHp@`0㿘> H` 8`@E⼃(` ?? 0`@ `p06( 0 䀈"  Ā  ( > Ha؅( $ Ą?$ 䀠`$ ` (  @$   @$    $  ^  `㿘  > R@!Βaa<:  `> R s!(㿘 8`26`0> `4a  +@ O> '`d> R`0&a@&a<`` +@+@ @ &`4&`0  @`  (+@ @ ! @! <``@  `4`&a< &a@  8 `0 4 @ !  @  2` 8@&a<  +@(@@&a@` `4@"`4 4"`0`̒` 0si!h㿘> 'a􀠠`"  8`y``?` & 8  㿘` > R r! > P@!<cJ`> Rb @! !<: "!@> rj#!<!@> R rd!> Rr_!> RP``$ `> rR##> Nb@ ? s&`0@"`0> RrA!Ȑ> R @ aؐ ?&`<`"Z <8> Ra耢 V '#> M@ La @  &`8  N&`4a@ @ B > )>a|> R!> 'b@# @ 6 @ !`ג @ % ˒ 'L| 0&`8 @ &`4& 8'@ b_^@ u@&`0> Rr!㿐Ho%(@f 0 & P/ & LHp@  * 8`80``"@" "@"㿘 `- &  8㿐 <`   0`?` /  㿐& 8`(````2`2 0 //  @ ` * @ ``* @" < ` " H* @ * @* @ > R>hb"㿐  /@@{ :Ho7(@ L` P`9 `ZHp@ L`> 'b2@#贒 $  0 & P& L  TAHp@f L`̀ PA TȀ`0Н㿘 c @0@( c@ c@" ?@ @> & ``?" p  H`    & 6 & 㿘 H`  >`$& 4>  K<D& l>c& 4>  K1D& l>  lc<@' ? p`C> RbX lh 4@h "`?@ (x@l`G(x `Ho4 l(@f l@|pHp@@ ,> RHo(@f@lh@ 4@ llh@`@2@Hp@0Ղ (xC"H#####c @?  "Ho(@f?" @ P T! 'Z'  Âa?7 ?& 0& <``0 & <`& @@?```& 8 & @`` @`& @  @`& @ X& <@ d < 8@@* X p @ D H?#\& < @ & D& H H.`8` 8 & H@& <0 D.`8` 8 & D@& <0و?'b@'㿐> oS Ђ & 0 a& L X>>Cbw P''>  Iܔ& p㿘 | k`?") F,``& 0"" F D F@` . D E@. E | $ |. L`쀠 4``$ 4 |$ 0`$ | . L㿘 (9 1. 1㿘    0 `(`,@   3``@(  H `p`  0 0 |`$ |$  . L㿘> Q `  ` 8`  f?㿘 xHo+(@l1`(1Hp@ 㿘 xHo+(@l1(1Hp@㿘(( > H c((&@&D4&`xHo+(@l`  츔eh` .e.h 2aNHp@>ap&`t3> Wc㿘 xHok (@l0f  L ( &  & Hp@㿘 Ho%(@fHo(@l|$|Hp@(@, @``  *``2`> W$. EHp@ Hp@ cn瀌` @@ 8`?㿘> HcX . `0> 8 l`ȅ(㿘> HcX . `0> 8 l`ȅ(  4HG(F `"?I(F?F  ? ` ߁(? 4H550`*  D`2 @` 2 㿘 4Ho4 E(@l E D, EHp@ G@2`l H`` . . `l> 8(`Ȃ@`> 8(`Ȃ@`  H㿘`t&`t&`t`l> 8(`Ȃ@` `P`H @ `l> 8(`Ȃ@` 4 K `` % 5@* %* 5>cܒ  58* %* 5>cܒ 㿘/> H l8 t`l (> 8` 4 |s`t` "T-O79@ 8( x(  p  @ P X`& Ps& X @2@ 2@@?2 `^,@ 8(`$& lHo+%(@ t h @& t t  `N `2Hp@8 l t h @& t t 0ك(`$ T X`& T& X 8= <`t . NHp@ `. ̀= < @ . `1 /`1/`!꟔ 0㿘  0Ho%(@f ` ` `. Hp@. 0. #0㿘 ]0 L\``,``!> 7`2( F D@ ` ` ` ` ` ` F ` . D E@. E$$ ,. LcL``" D F D @? 4` l@m@k@" 5 @`  `  ! !  " @@(@* 5 5@* 5 5`}@* 5 4 J` 5(@* 5 @` `   " @@* 5@㿘 @`*  `2  12 `,  , . L. 1. ! ” `0 @  $ $ S& @ $ $ 㿘 p|t ..(x鍐   髐h`p`?n 0.$p$t ` ,,`L ` d   `, `1,`1,`!g  `,뀤 㿘> H scX( 4Hoe4 t(@f ta ` Hp@0 H` H P Hk4$ (l$ $  t `& t, 1 @  $ $ Hp@,1,!   㿘> H scX`((` 4``$`@" `  ``z  \`w  Ā@ @ b 쌒 Ho+(@lِ 3 5`?cpj"f 4,3,5d` `@"@2,4& & & @` @ `9 $ $  $@@@*> H $ d`$ h  , , ,L `* Hp@` `ڰ @(@c<> H$ dc@$ h @,  , Ӑ@``@ 㿘 4 0Hok(@l `. e . tb \`"" 1 T X`#> W 4Hp@ > 'b> 82  \`2 T 1  , 1, !  Tjv#㿘> HX` X. @0> Xje 㿐Ho4 P(@l P T& X& P& THp@> c> c> `c> c#\ > X j`h> c<@' ` `8>8b`$`,`,`> H$cl (! D! @ 4&`4 > H&``&`\``?c(`\  `  > H! ``\> X`P  ` x > H!> X `X@ `> c> Xi( `> Pc "\> Q` U> i { >bh" p" >> Ђ`" " !> H&`0#8 * Ӕ &`x#8&`p`p&`d&`l&`h(`&`|#8$&`t @(`@ s `\`;`@` Ho+(@l*  )Hp@@ Q> X> OhÐ >  !`   ` !  !p  *# L P'''Ho#(@ e`. eHp@&ĐȃHo+ (@ > Xh @B`\l l e& P< p㿘> H sX`(`4 K` Ho+'(@``(Hp@ ` (() L`(%0えl`0`(0> H scX(Ho4 t(@l t`   ta`" tHp@ 㿘> HcX . > 8 0` l 4( &z Ho(@]@" `" y@"B*zx@"  l &Hp@0  `\@'j@2 .& @!{@2 % ݐ c@`8ؐ Ґ  ΐ   $ `   h > H#X> `<' ?0` @ @I#X(`"' 0 I4 td d ݒ 2 Hoe(@ t`  7` t` 1 Hp@  <> Xf t`  $ p`P`"'@ "'Hp@> ɒ (g) 0ڰ ,`M`` `M- (` > 8`2  t @Y  t`Ub%$ tL`M`2" Hok (@l Q>Hp@ 2 t``"  t`$ t @2L`M t`L`M`2!o   `M(`  2 t `M(`"  t L`M` Hp@ "s l t` e0a `'`'``` '```@@'``@'ЃHo4 `1(@l `1`,`1,Hp@$ Đɒ\`2C$  c $ $ %$ ) 2 t`$ tHo+4x(@lx$pp> H$lc8$t* ,0Hp@뀤> 8(` 2 t0$ t$ $  ` Ho+(@lu Hp@ t}O$ t2,`M t}R$ t9 㿘> HcX .  0 t`  4  l> 8(`Ȃ@`Ho4,`M(@f,`MHp@ t` ߰  tHo4 E(@l E D) EHp@ H@@ `" *(ہ*(ہ`>=`   t J` 5(@* 5 @` ـ`   ȁ" @@* 5耞@㿘 @`/  Ā`2  12 (ـ`!,(ق ,(. L. 1. ! 㿔 (ـ`0@  (Ђ`$ @$ ($ K& @ $ $ Ă t K h؀` % 5@* %* 5>cܒ  58* %* 5>cܒ 㿘 tHo%(@f(ۀ`) Ā`%Ho4 (@l .( `1 &@  (Ђ`& @& ăHp@Hp@,`1,`! ?  (& 㿘 ( ` F D `. D E @. E$`$`Ȃ ,h. L㿘  ..(   ֐`p`?ܒ 0.$$ ؀` ,,`L ؀`    ذ`, `1,`1,`!Փ  ؐ`,.뀤 㿘H` t@ (@&JHp@㿘> P Ac  ` 8`  f?P> c<@' > H c  t%z  49;@ x( ?$@  p  @  `& W& @2@ 2@,$`@2 @ڤ$x& Ho+((@   @&  Hp@@ ?> X(؀`-(؀`(ؐ.(0䁈l   @&   04 < @  `& &  x4 < (ؐ.(1 .1.! 07L!H㿘 Ho%(@f(݀`(܀`(ڀ`2.(ڃHp@.(=(܀`.(0㿘 t$Q "  > Xcr  sc ڤ Ho+Ƃ(@ tHG(F(ހ`"?I(F?F  ? ` (? `3 `5 `4`@`?`,`3,`5  ,`4(ـ`  & & $`@(& `& (؀`E Hp@(ۀ`xH` )?& 8& H #@$#蠄?"K@``@ @` :#@$Ր#蠄?"4@``@ @` "$ <`2%& H$# _#@$#蠄?"@``@d H ?> Xb Hp@(؄ .(.(,`L(؀`"~(ؐ.(Tvl tHG(F(ހ`">?9I> Xb .(Z0h{0O8@H` t@@Hp@>c 㿘Hok4 Ă(@ l Ăh ?"   (Ԉ (((Ђ`@"((̀"(ԃHp@   㿐Ho4 (@l  & & & Hp@> c> c> `c> c#\ > X c'`㿈> `` &`0`T>0cx`x> 0a`̄h&h&h&`&h`,`,`> H$c ( D @4&`t > H&``&````  ` ?> Hc @(`@a  `!> H# *  &`#&``&`&`&`(`&`#$&` @(`@ ```@1 .$Ho+ (@ Hp@l` Ho+m(@ܒ Hp@ ւ$ @(`@`e`U(`eǒ Ho+a(@Œ Hp@> '&`Da􀠠Z>=`DҐ`H` @'`<> XaV!`<`4``H`H> Hca '(> Wb@2 > Hb''> a> ЀC `a> a a> bZ > Xa( F` ##0sl> Xa `H> Hc a'ȅ(lU c0> X@Ē` > X` 2`D &`D> H@Ɛ#> X`!0`H㿘` @ @`㿘 $ & ,& 0   "  P@  " 0㿘 $   P@  0 2 P㿘 $ & ,  & 0 P@  0 2 P㿘 $   P@  0 2 P㿘`"   (`: > X @2`!X > X `z!㿘88@ @ `" /> X `# $  ` 8@ ` 0 " 4 4$ 4 4? & 0& 47  ` H@2气 뀤 a!㿀8@ i`i` `@`&`$&` [?> > 'cd c`$`$" `480@f28`4@  3䀢0/``1`4 @`4' ` '`@''': "`$`" 0`$ 0 4&`$" H" 4`(`&`(` '2`4  > X`!㿘 (`Ho&(@ X T 8& X $4  P T@ Hp@g X㿘 P@ ``"   c(8` 8@``"  @@2` `2`   㿘 Xa0 T 8`4 $  T`4 $ 8  X`2,  $ $2`( ,l1*  $ $`b ,h bbb  (" ( ## A&!  ! &   X`" X>9a, l L>a T㿘 X`/ l 㿘 X`P T \h2X L!@2` L#@2< L5@!3 @2- L `<" \i2x X2 X2O X \`2 L .`` i  L(``&@  `  \3 @" ` L*` `(T  `*` `&L  \ L*` `"C  \h! L*` `#8  \!@# L(``#@  *  \ @& h& Xa& L`0(    \ X L`& X *`& h`+    ` X L`(& X & h`+    ` X @& h& Xa& L *` `0 `"o \ X㿘 T`,``0  k@" x, k  x@" |< x `0  @@ < x  㿘 T `0*`А`<@ $`0 & `,& Ho& (@a+Hp@gaHp@0 `,Հ`㿘 T X8 $ 8`! @? !  T  d"  L T 8`4 $ @# L` X`" T 8`8 $d 㿘 X '` ". \ `  @ (``@!" T`2 T $`8 8* 2 T $`8 8 `S  X`;`Z??!b8` 2 `2 T $`8 8* 2 X`@" T `@0`ba T $`8 8   T $`8 8 À``> '& XВ : X> X&7s?a  T 8`4 $ ` # `& X l> ,c.)!?㿘 T\`- `"4  8 $@  T`4 $ 8   h2 d & h d`@ & d P& d`< ??㿘 T ``7` B)  > X)  @@` `> X]!@ 8`$`8 `T`$`8`8 `X`@2`T`8`8`$  4 $ 8  Xd > X]X!㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8 " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 8`4 $  T`4 $ 8  X`@ !3"`0`$`02 `Š!$`0 `   T 8`4 $  T`4 $ 8 " (!`0`$`0 `0`$`0$`0 @`0`$`0!" `0`$`0 `0`$`0`0`$`0 $`0㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 $`4 8   T 8`4 $  @ `0$`0$`0 8`4 $  T 8`4 $  !" "`0`$`0$`0" `0`$`0" @`0`$`0" `0`$`0"`0`0`$`0㿘c T 8`4 $  T 8`4 $  T 88?b  $: 㿘 (` `"`" `z  L0`@=   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\ T 8`4 $  T%b`8 $ 8 0? 㿘> X1bЀ@?? 㿘> Xb&   > XZ" (> X&`L&`8&`P&`T &`X&`h@`T`$4`8  ?b&`\㿘 T  $ ,$ 0 T 8`4 $   T 8`4 $  T`4 $ 8   ,`$ , T 8`4 $ $ 0$ ,`$ 0 0$ 0" ` " 0` 0$ 0`$ 0$ 0`$ 0$ 0$ 0㿘 (` `"`" `   L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0ِ? 㿘> XNcH@?? 㿘> XcHC   > XYА" (> X&`L<&`T&`P&`8&`X@`T`$4`8  ?b&`\㿘 4 @? !" 4 @  0 㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0@$`0"   `0`$`0$`0 ` $`0 T $4@ 8 ` ހ  `0̐$`0㿘` "/`   ` L0`@ ` L0`@"` T 8`4 $  T$ 8 $`8   L0`@?0`\0㿘  `> XX#x (> X&`L&`8&`P&`T &`X&`h@`T`$4`8@ ?a&`\ \?b< `Ɓ`T`$`4`8 &``$A$@$@$@$A$@$@$@$@$@$@$@$A$@$@$@$A$@$@$@$Al㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0@$`0"  2  T`0`$`0$`0 8`4 $  T`4 8 $  ?`8`0(`> `0`$`0`0`$`0`0`$`0`0`$`0`0`$`0㿘H T 8`8 $  㿘 (` `"`" `p  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0? 㿘> X4c@?? 㿘> Xc)   > XW" (> X&`L&`T&`P&`8&`X@`T`$4`8  ?b&`\㿘 T  $`,$`0 T $`4 8` `,`$`, T $`4 8 $`0$`,`$`0`0$`02 T $`0 8`4 $  T 8`4 $  2`0`$`0 `0$`0 $`0$`0$`0㿘Z T 8 $`4`8  ? Ā㿘 (` `"`" `{  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0ʐ? 㿘> Y?`D@?? 㿘 (`9 @2d( #> Y(`D   > XV"`( P& L& T& 8& X @ T $4 8  ?b& \`2ڐ> Y`8& P#Ӑ> Y`,& P (9 Ƃ@㿘` "'`ސa V ` L0`@ ` L0`@``\z0 L0`@>?0֝㿘> Y`@?? 㿘> Y`   > XV6" (> Y&`L&`T&`P&`8`&`X`T`$`4`8  ?b&`\㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 8`4 $ $ `0$`0( $`0$`0$`0㿘 (` `"`" `  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0^? 㿘> YӒ`Ѐ@?? 㿘> Y`Ȑ   > XUU" (> Y&`L&`T&`P&`8`&`X`T`$`4`8  ?b&`\8 㿘 (` `"`" `  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\ 0Ԑ? 㿘  `> YTڐ  (` c> Y2:` !TВ@ (> Y&`LX&`T&`P&`8`&`X`T`$`4`8  !&`\ \?b< `" 1> YT!8`T`$`4`8 &``㿘 @`" T 8`4 $  T 8`8  $ *2 T 8`4 $  T 8`8  $ *2 T 8`4 $  T 8`8  $ *2 T 8`4 $  T* `8 8 $2  㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8 " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 $`4 8   `0 $`0  $`0 $`0@$`0㿘 (` `"`" `PҰ  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\֐0? 㿘> YbD@?? 㿘> YbD    > XS" > Yc8`&`@ (8&`L&`P&`T&`8 &`X&`h@`T`$4`8  ?b&`\t$W$Y$X$Y$Y$X$^$^$^l$^$]$]$]H$]<$]4$\$\$^$]4$^$_$_$_$_$_$_$_$_x$_$_" " " " 㿘`> `& &   ((((3 (  h" $" " "   ` @@     ((`@` @@  㿘  $ & (& ,. F& 0@㿘  t`& 㿘> YS"㿘#> m c  ``  & `` > r(b(@  `*` (`(>   M`p2@&(`> rbh``c`2 2 cɔ 0 > YRe 0c> Y R_`0`> r > YRU 0 > Y(RN 0 > `@c@> Ycx+ c3  > YR? `` > Y"@R40+ c2> Y R,0+ c2> Y R$0y 8 ,`$> Yc  > Y>hb#㿘 4 ``q 4 > Y@#> R8c``( N 4`&R  > Y@> Z#aHR% q 1> ZR H 6`2F> Z 7 8 : 9(`((@@@"  ;N 4> ^`> `8> ZR  ;` < = ? >(`((@@@<> Z J`0 B`(> Z J`1> ZQߑ!0  (`.`1> Z@@Q֑ (QԐ `N 6 6`& `@2 `,`  `,> QŐ  7Q!ِ> ZQ! BQ Ő> ZQ  6 ,> ZQ >  > ZQ p 6ג ,㿘 ````> > ZbPX` !  ` ?.`.` @?(`"_* 㿘 4` ``      ! 6` 8 + >     @ A(`?@@`(`$`" 3`$  `$`Ѱ   !b @ A(`@@°   @ A(`@@ V   @ A(` @26  `8   V  @4 `  @ A(`@ ?񀠤`8 0 ( $2 & (}  ~  {?" r ?b`8l `$ U3`$j  㿘  `   ,`  (`q  ,> ZPÐ!` > , ? $  ? (@㿘 p  > Z@ `& p @ёQW!㿘  @    6  @ 㿘  @Ӑ  `" *& `> ZQ4!+   ? @& ?&&  @ "    ? @&&   4 (``2&  b &   $ 㿘@  & P& @q@@㿘 @ @_@ 㿘 @u      ? @&& & @G$ 㿘  @Z ``> ZP!    ? @&& & @($ 㿐'' @; ,> a!  @??      '  &  @??    > ZPy!@20"?!  @ @  ?' @ @ 2㿘@@?@&@`?㿘@Ԑ@ @&@     㿘   @ < " ``@( 2 Ē @㿘    2  @p     @  `2    |!   @ ?  `  `    `  `2    |  6 &  @/   㿘 @D   6 (``"  @   @ 㿘  `" @#  `2  & &    $ &  @ x㿘 D㿘  @ ``& &    $ & @װ-> ZOZ"(㿈 p%''􀠠/' t`)> Z `#`> > Z` & th& p@Ґ p`  X  p`@?"& O$"x> ZO!"P㿐 '' @ |,> a!  @??      ' |" &  @??    > ZN" 1> > b`Ѐ@ " "(  @ @ > ZNА"؀@ N  @ ?   6   ' `> Z c Θ  `@20"?!  @ @  ?' @ @ 2$ 㿘@  ` > Zc   `@݁h %'''''耢 `̖> 9ِѐ㿘 `x>=C̐!  ’㿘`? >="@D!    "  G" " $ x" "  j0` %'''''耈  Ĥ> А'܀  ` @  ` Y0 yq`2֐ /Ґ 㿘   && &`&$(( (q.㿘h `\'` '` '`'`$ ` Z(((?c 2((KZ2((@O0㿘vh `\'` '` '`'`$m ` (((  (. (%0㿘K   &&`a0 c& (( 㿘 & )  &oc && ((㿘 $h?(     c ' ' А㿘  ! $    :  `  ` ` .`   (`(`(`ݐ`$㿘̰   & &c&(㿘   "> Z @L# -` "" " " "  ` > 0ct 㿘```>=B;!Ђ88`?`?` `@ `  @ -@ u@ (㿘`>=`B!Ђ88`?`?   @  ``@@ @㿘>= B!И   " " "   >  W 㿘>= BԐ!И   " "   >  xB 㿐> nt`    t!>= |! #\> ZDc@! D 1>= !Д   > ZcH#\Dz!Dt 㿘2&``?  $~F h  > `$`$`$ % $` $`( .   (`((@@ @     (`((@@@&E  >> y`88"v`E  Ey  E  i `$`$`  $`$`$( ?(( ( ( U(d V         (`((@@@&EA ` ( *    (  `    0((@   3`` 0+ +`    ((@B   & E 㿐& \dh'`'@'`2$`2$@ $\ <``W > y >`8K b #\ ] O(`@`7 ` $@`$&(` @`7`2% <``;  `' ` ` ` `(`(@@$ ` ` `((`)   ?@b #\  C ` $ ֐ & ' `   (`(@@$ְ   ()  ?@㿘   `&& (`@ `&&$((0` U((.2.A㿘g(    ' ' ' _' $ ?(66(6( (((㿘`*"2 &` `"Z U```#> Z    (`) (  >@    (`() @@@&`(`" > ZJ-#X    (`) (  >@  (`@&   (`(  c  >@  !&> Z        02( (@2`+`,`,     @@ @ @@** @  * *`@@ >@    (`((@@@&$l$$$$$$㿘`@Z   T? (`2P@ ((`(`(`(` (` 0`(`(` ( $ ` C@`` $ @`"A `B  $  $ $ " .` , (@`C .``" @`2.  C``  ((`(.`CA $  `$ $ɰ ((`  2  ` Ұ㿘``J ` @E   ? `\``$ ` <@`` $ @`"> ` ]  $  $ `$ $ .`[ F.`Z ,`(` .`[` " @`2I  B` > BҒ $ ` $ $@`ƀ` ̰  $ (.`[ @&`$> wH"(  4.`Y`(i  .`[ .`[ .`[  4.`Y`(Z  .`[` 2  `㿘 a@@$0a@ 0a@2  0> w`220a@60a@& a@"1 $> wHw"8a @"  $ 0``< @ j"& & 8" " "  #  8" " "   2 $`2 $ $` 2 $ $`@2 $  $`2 $$$$$t$$$$$$$$$$$$$$$$$$$$$$$$$$$$ 㿘`   "   "@ 2 @` 4 2 0   @ 2 @ 2 4"@" 4 4 2 @@ 2@ ?"@" 44 @* @`  `  ` `"` `*`  `  ` `"` 4*?:``   * ؒ` @` ` `\`` ``_(* \* @00*  @`88``0*  @0*  @ݐ * \ \* א  @Ԑ  `*  `* >`p 㿘  V    * * * * x @㿘 A& !> I!\     (`@ @ђ  A !\  @@    D9 L 5 `1  `   %xڞ㿐 @ڐ '> I\  "  @   (`@`@\ A  $@`@ $@ // `/ 2/ 0?` `@ `    `@܂$@` `  ` `  ` `` @ 7% x@3   㿘 x` $@d  >> y`8-> Ia\ $5 2$``(`@ 8 "   "  @```  " ? $P " 㿐N '0`?     @6@@@``@@`@o@ 퀤@` @o5 ․@`@o*'֒ ׀@@`@@π@'̨㿘`> wE!#` >  <c<'  =@@> `"> w> x> ` D p L  \   > xD  $b"s >> xD -> x`> x`> xDݐ  x`C @`?`"> xe``}`2> xDɐ! x`c`+> xa > > xa( ``_ND x`@  `` `$ @"D x`@  q> yc > xa0,> {c> !> y`8> xDu -> wE6#pE4#2> xDi  xDe x`> Y cX@`DZ x @@0> xDP! xDL! x> wAc> x>`> x;`> x8`> x5`> x2` > x/`(> x,`8> x)`P> xD h> w#c> w c> wcÐ! 㿘`> D#( 㿈 *   ذ  0 > `4` 4` $`$`$`$`$`|$`(`|$`0`0`"`@ " ``  Z `ѐ $`&`4`& :> +> Ia\  :`<4>> : " `<" `$2`0`0 `"ѐ@͐`@"`$`` "`$t `? "`$h2`x ͒ < x  "Ȑ " " > y !a@   `>> ya8@u `C`& ?4`& ?4`&  ?4`&`  4`& "L`= 4`L`=`&T`$''> !!t f`$hFa\ > $`$m `י i0> Ia\ B :tX`$`oS`$ ݔ  $`> > T`$@"4`$`&!4`&`4`$ʔ   ` ` :=   4` a\ 4` =W :> B֐#`x "`$<`$ 2M f  G <M : 2@ ` 0"  @  @㿘`< 0`"@66 ` @ 4&0 ` 6, c )$`! *,ђ $`0` `"x@x "Tܒ  xҒ `0㿘`( 0`"@% ` @! ` `     " ` 2 `  @ 㿘 0`"`  ʔ "`" 2`" @㿘  0S  d ۰  ]$j" > `  @P 7  2  > y`8( (<  > Ia\! ( c 2/   (`((@@@0`` @  ` "@쀥@(<  <( 㿘 0`"`  `" @ 0@@ 2 2  > &a О@ > &`  @> &a8 K@㿘,  4`2> > x> x a@`BT!㿘    ,   H``  h㿘 0`   ͖ 2 0  @㿘 8`   2 8 @8 8 `?`?` ` > 'b > 'b, > 'a ?> 'bؒ?㿘> 'bȰ> I a\&8 .& 0"`2 0 6" 0"6 8 2 8 (  8> x@! 0 8 @*> x">   > @ #& 4> '`X > x @!@! 0 > x@!> $$$$$0$$$t$$$T$$$$$$t$$$$$$$$$$@??  `$ 6 4``` ֞@`" > ``@ @ A(`@d `" > `   㿘 Ē(    $ $ $ $$  B`( @7`(((((`(㿘 Ē" 'z$ 㿘 Ē     '$ $  K(e(t㿘 Ē  b  $  $ \(( G((((I(X㿘 Ē }  a@ $ $  E6`(6`((6`6(((*(9㿘 Ē ^  a@ $ $ ?((("㿘( :S " A(   $ $ ($ $a0$ ?)@)  $) 0`) " @9( `(`@&` `֐`㿘  : (  ( '  $ $  $ $a0$ ?)@)  $) 0`) ǐ2 ` @(@`&` `` 9㿘( 9 % ђ(   $ $ ($ $a0$ ?)@) `(`)  $) 0|) `9}(`k(㿘  9 $ (   $ $  $ $a0$ ?)@)  $) 0`) `K) Z" `9L .` `.`㿘  9  o a0$  $ $ @`   4 9) (`> ( ?+` +@ +` ,``,`  $ $$  ?+` +@+`   $ $$ А `0`.@ `0.` ``.` `.` `.`?+@`(``?+` $ ? +@+` `(``+`   $ $$ Ґ ``.`?+@``0+`) 00) )  +` `(``+`   $ $$ 2| ``0`.` ``0.` ` 0``.`k? +@+` ``(``+`   `y,`  $ $$ tp  K.@? +@+` `(``+`   $ $\$ k27``O 1? +@+` `(``+`   $ $A$ P2``4 ? +@+` ``(``+`   `$,`  $ $$ . .@?+` +@ +`   h$ $$   `0`.`.@㿘 T 8C r 1( i  $ $  T$ $a0$ ?)@)  $) 0`) `) 2Q```T&@&`&`&` &`&` @`.@ @0.` ``.` `0.` ``.` `0.` `0``.` `.` `0`.` ` ` ` `(`((&` ` ` ` ` (((`@@@&` ` ` ` `(`((&` ``0`.` @ `7 T @`(` > (j@w@@ў@@㿘 )   $ $ $ $ $   C`(7 ( (((JY`(㿘    в    ' /  㿐2 /  7d#$ ֒ 2" @ " ``4&(`` ` ` ` (` ` ` #\6#$ `` J ?  ; J㿘 Ġ( & >  &h    Ȁa> Ѐa" &  Ѐ`" Ԅ > Ё `c 㿀 '6  ! `Ă #d#\#h#`      .@ .` .`.` 6 㿀 '`$5   6Ȱ . `Ą#\#d#`#h  z 2􀠠" ( `) @ ``Ė " 6Y  "  6M㿀 ' 6 GĢ#\#d#h  N#` 5 4`6`` ` ` #`#\#d#h    􀠠" @@( `( `@( `(`Ė " 5  5  ^"  5㿀 ' 6" +`Ă #\#d#`#h  Қ 2` (`(` ( (``Ė a" 5  "  5㿘 !~ې`Ȅ d&(&8&, &0`Д @bB d`&4``$dUaP&HcD T M 6Xct&]ao \#`#`#` `Ј && aW&<6p6r&&G 65#$  2  ` @$ ` `` (#$5E 5A#$6  ?(1?0#@`@`@. 3> 3@@'acI&т`-   6㿘 D? ` @> I2`!t@͓2`  `"    <(( @@&$ < `0@ > -> 3 >`! > -> 3 >`!㿘  ,`,  p 0 <d$ 0 $ @$ 4 0 (`0  @ Hod(@Hp@́(> (e0$ 4 ( <$ @ 0 (`0  @ Hod݂(@0 &  `#&  "$ 4? & &  < 0 (`0 @  X `֒싐`aa&` œ _ 䀢?㿘 ,`@U$`Oɐ L`(`D4`  @a  `<,  @ @e]@`0$ b6 @?``(4 (4 ((4 (((2 ( %  @?hh@% 0% `H0% `<> .`% $% t% 0% p朐a&~%$&2 ?,@2  @2  @?``4 ((((4 ( & A ꬑ㿘? 6 > I!t4`   `@" 0 `: `"    Δ!` `$0`$  $a  !ɐ 0졔  $~0$㿘``"     `@& 賰 `  Ĕ!좰 㿘? 0`@> I4 !tI  5``@"``0= = ```?`? $`    2`$`4$``q$`@?4$  촔 '  ܒ` C!$4$ ;! 2`$ `a4$H   $4$  !װ`w 㿘   > /?" # 0ϰ 㿘> (&` a$ ,$ ( 4 ``&`L?  $b> `> ya8@``&`8o В> .` a> ^cP &`X`0㿐  > z`X㿐? 0`> I@!tz4   `@"  $&@" I @"@"Dт @"Z a@ۂ `) ֐a @ D c@ a@  7`@` `"ޠ  c@"00 c@"8wc e`e@"=`҂`r @  `q@т D0 a@ c @ c@ƀ c@"-0 a@"V `h@ ` &`( [&@" S@"  P@@q  2 $E`@ {0 a@ `p@| h7`@`xr @"ڒ8 c @H  @J0*E@<@2 A @"H *K p@s@   ! `!˛  c@"^E00c@ #$1˒ c{1#$ ̐c @ a@ 2@   V n Ԓ 2    p  6 1  2`,  }1q 0y 2  (`@`ڐ1 0_! Y``     I`ɠ  19#$    @ 2/`&d? +`8 `4) @8`@4 `&d ?`(@8`@4(`0``  ` &0#$> *0    8 2``& ?`(@8`@4(`` 0 ِ鐔 ԐϠ 2 $ϐ *  2 $Ȑ@  c@ FƖ  c@`Ԃ Ԡ `0 2``'`@ 2@ @ @  ܔ  ؔ `q@ c@  2l#\` @ X 2E`" ``& ?`(@8`@4(`0`'ה Q `@ ??c+ `@ @ #``&d?`` `() @  8`8@3`3` + `ĝ㿘 D? `> I @!t2`@i2`  ``@" `Ă & 4 0 <d& @& 0Ho$(@Hp@` e0`$ & 4`?ݒO`ؐ`/ > Ia ? 2 *  0$0$ H@  @ * `# `"(`@2 " "*(@`` 2H@ * `# `"(`@2 " 4`$ 6 `` `I@` `@ @ A(`@d `" > `   㿐> I& da  9` & d㿐  > z)a㿀  /F Q 0 #\#d#h#`   ?A  0(`@$ 8($ H(`@$ < ($ L   (`@$ @   ($ P(`@$ D#d(`@$ T #\#`#h`  " $ X.  . $ \` ` (X  (\  0$ `.0$㿘 0(İ "  $ ab$ $ $ $ ?$ (6`6((7 7 ((( (`(`(fu㿘@`1 (``@H) `08 挰 !   $ $ ab$  +)`4(0) ) 00) ) `` `) />㿘@i` e`a*`HW+ `  HP*``H@I\8@ `G\8@ `B  08 8`86 4   $ $ ab$ ?*(`40*+`3`**) 3 1 **01 **3`* ``` `* `` `* Ր  㿘@ K``G+ `H@=+``  H6X8@ `4  08 8ٰ '   $ $ ab$ ?+`4(0+ + ) 3`1 + + 01 + + `` `+ v児  㿘@(`@ H`  ` -$ 8 $̬ $`-WP ```(-H$ HN  - 8 H ݀` H ` `(԰ ,,  ``  @*`@P ` ,  @ 0``Đ> Ia? 2 cF@*   cH@cD@#  C@. cF@* cE@ cD@"6 8> c  0 H@  8 @" 4cA@ cB@H@> 5b > 4bԒ  8 4 @" H" L" P"  T"> 5ah > 4c  4 @"㿈 > I!`? 6 @:!(`   0$` `0$ 0 ! 2  0 H' L> I' Pa\' Th' 2 0  `H   8& 4$0$Ґ 㿘 &`0> 3cP , (0> 1Ґ #$h$$$$$|$$$$ 2( (@?(`2`(( "   @?``((((22((23 (( "   @?`2(2( (((3 3 2(((3 ( " 㿘 6@?`) )6.6) .6@7 ) ) ) ) ) 7 ) ) 66@ 7 ) .) @)  &  @` ```_* 4 @*㿘  &a  5 (  & ab& &   $ 㬁㿘+> n`x`p> Ia` ?0` @6@a%`xa܃(`[ (@]+ V4`.` ,` @@X(<(` @ ```A`@\v.`0`: C @2-@$(%`x㎒  ,  c' ' ' V. 0`  ' $ B@ D 4C  %`x ր    㿘``?  +c"@   ` 8  +㿘``?  @"@+I ` @    (`@`<"  -* @   (((`@@@$a    (`(($a *ؒ @0㿘` `? @ +  A        (`@* * *  ͠ " `*`2   `  @`` - *㿘 "i K㿀`> `?c<'   "@*~ +  ⓒh "?''' // '//// Ԕ   $ b $ $$ $ 8G " `*9  J`@`````3` + @ 2`2(,`,       +`  **   * *`@ @>!` `` ` (`) (& `0`` `& & > z!㿈` `? $@ *~ A  h 8 %77/777`Q  b &`$&`&`&` ඐŐ     (`) (  @<    (`((@ ?@ $@$) 㿘 `>> ya8@   !`!`p'''''֒ < 䀈` )  "4`   #\#d#`#h  R 2 `"LL` $0$  $hm(```c   )4 ``2 `  `   ` 䀠""&` "~"    `@?c{! " `&@ ?f&`@` `@U `&` &`&@&`d    )& 䤒 2 `2 <``8 <```}0bb #d#h#\#`  㾚 5 "3 `?`2.    (`( ﮐ n` @UI g i0&` `J $`I0$ &@&`  #d#h#\#`  z ?  < `?`8  (`@    (`@'``&`^ >` #d#h#\#`  F   쀣 `?`2 ``#     0 3`     ((@@2@+ +` @  **@ @  >`䀠`ٰ  (` @ '䀠@Հ0㿘 D? ` @> I2`!ܒ@ 2`  䀈`"    <(( @@&$ < `0@㿘 `$ 4`, ``( 6ّ`` ;` A @(`@dd"`Ɓ ۛ  !  ?㿘 䀈` > c4  !ʐ!ܦ!,֒ > 㿘`` `"  !,`@& ܓ   !g  䀈`    !\   X> c<'  !p`&(`&0`&,`f&4 &8 d&8 6`<``YԂcI&as  ``De ``L_  > z,   pې@Va && aW&<6p6r&&&X6 6 ?(?0#@`@`@* > A@@`  cI&X؂`tl  > z!(㿀 ' $h7 -䈖 0  ' )%> I\`` #d #\#`#h  ƚ 24 `v @0``u@"&& &@",`' ? (`(` \`  6" ްܰ `  " Ӱ`((ր`ɐ㿘 & $ !@o `D  `@`L  ``\   $ x   a Ք  $&M a> zoa $&C 㿘? 0`> I@!ܧ4    䀈`@"  @ v@"i  `q@ h@*`(&` &&  $ e r@"8 `u@k5P  p@l s@p ް  a@" `p@a @˰ ɰ ごŰ`q@0a@ e`t@` e@р`!D 0a@"*V ŀc@``0  b `` r  e`g@"A` J0" `| "y a u2 $ ڐ! `k! r 0b  0\ k@ V  PK,4  (?c> A ` * @p > ;|> A >`  > ;|> A >` 㿘  ,`, % p 4`=  0 <d$ @$ 0 0 (`0  @ Hod(@eHp@(> 6d$ 4 < ($ @ `ߒ ?2+&  & e$ 4 "$ 4? $ 4& &  < 0 (`0 @   `'ܐ`a`&`  & 㿘  ,`䀈`@V $`P` L` G(`(`@``4   @@QS <@ D@U0 $ bA ] #:$`$H`0$ <> =c$0$t$$<$p`` %``䀈`3%`c`u:$b`$H> =$ <c$0$$$t$p`00 &    @2 @2   ?c @ ܑa,㿘? 6 > I!ܓ4`Ұ  . 䀈`@" 0'Ð `j ` 䀈` %  $`  $2 $  $a  !!, ͔  $~0$!`   㿘? 0`@> I4`!  B 䀈`@5 { T `  `?`? ,$`` 0  `  `$I$4$J`"в 0$`"̲ 0  `$2 $@?  c$``4$ ٔ! " $`Œ ,``4$ 2 $ 4$ [! V!$ ް   㿘? 0`@> I4 !?  ?`䀈`@"`??F  (@@)``$2`??  ?, @ࠀ2? (2     @@PRB   % ɰ?`㿘  > ?!!`> 7C"X 0 㿈> Ia\&`$> ;$,a $(bLC`&@4&2 5> `> ya8@"h`5> (FРa,> >X> a5cP``$j$`a`    T$`K = `a@S @O= #\`> z(!`䀈`H ( В&`LÐ`''`u > 7`A  "X> ;̀ /&a`0> z("`&` ֢`V  `۔ L` *$&ak4&> z '!0> z'"0a`0' B`v> 7㿐  > z;a8㿘 D? `> I @!ܓ2`@ʓ2`  `䀈`@" ` & 4 0 <d& @& 0Ho$(@Hp@`e0`$` `  & 4& 4`?ؒ`a,؋%%%%8%4%L%8%$% %%%%p%%`%%$%%%$4%$4%$%$%%%$4%$4%%@ D$b" H 0 ``>" 0 <"" 8 `, (`0"%" 0 2! L < (( `"1 0 4`9 ``"9 0bd2% 0 0" 0" 8 `(ڄ " 0  < 0" 8" 0 <" 8(`02  0`Ҁ` 0" 8" 0 ``" 0"" 8` 0" 8" 0 㿘 `$ 4`,` 6`` H` C (a 5 $(`}& (`0 `8@Q(`&b`h`@ Z $`0 6` 7 2%L 4 K ` I`> z &"` `@9 @ A(`@d `& Г `&` `4 ` $`0`$` `8~$`8  ` ( $  `2`4`9&`$`5&`8~$`8  `$`l$`h  $`0 6 7 8 : 9(`((@@@& (`0 "  (`8秐$ (`8@P (@(v`0$ (s`02T"$`0 $$ ( ` 2`4> z`& "`0㿘` ج D  ?$ l$ h @$ l$ h &``&` 0}$ 0 6`(6`(((JY " h?$ l$ ha"a$ 0 0}$ 0$ 0㿘 *  0", 0`  b0`k}& 0  DW '?$ l$ h  0` ``b$ 0bހ`܂}`$ 0` (`$ 0 4߀`逈`& 0 )6`) ) ) 6` ) 6b&& " ?$ l$ h`& 0  l@`$ l?$ l?$ l$ h h@$ l$ h`` b }$ 0  u  0w$ 0㿘 0ede` &  &`  Q   &㿐 ۖ  0 D}$ 0׭  &`a0& ((`o $ l$ h6b㿐?& l& h`    4` D{ 6b && (1(@`  㿘 D\  & `( (c & (6b&㿘 D`$`.   B 'h1  `&` &`$&` a0&`(   ($H   (`(@@$Lڒ 㿘* `D # & &$&&c & ,`0`6 `, `8`""@O2 , 2 , , դֳ6, , , ՙ֨" t P t ` `  p*  "  " x*  * |`* p ' D  ` #d#\ #`#h jఒ c `2 ` `(`` $4 $$d ` @~` ,@0  ,`  ,`k`D L!0,`0`,@0  ,`  ,`,`Q`D j!0   (`(@ @`<㿘 - ; $  4$$ $`8! `0T$`0  "   `8ဠ`0` $`03 n$㿘 D? ` @> I2`"@`2`   D`0@l > E> H >`" > E> H >`"㿐 0?& l& h D  @ 0!@` 0w& 0 $4 $  @ !@`" 0  @ 0㿐? > I2`"@2`   0 @ 8a@' <@ 7b@`(  Dږa@2 D` (`> A8 0Q  &&&&&&&& 6 8& <& x& |& D$`" 0`6 0h" >`6 >6 @6 h& l& 4 >4 @   &  Y     J )" 09 2M> zVT <`, |,  Ė   ( y4 t  n  i   0c Ô _2( H ?" 0 0$ 8`$ 0" 0N * < G !", <`$ 8 0`<$ 0  8`$ x6,  L`  ,  L( $ 0 0"$ 0㿘? > I2`"@ 2`   0`@h D   t p @ $ 4  J  4`.`$b$[  "' d |, < 0 +$ 0 x`$ 8$ 0~ "> z !C"0 0 "`$0, < ԭ!@ 0h$ 0`$4`$ 0؝㿘 ?> I "2` @2`  0`@  D`2 `$`$    `4`$ Ք!`$` 2`$ 0h `` 0`$ 0R ``$4`$  倦 㿘? 6 > I"4`C   0`@a`2 D ``"% $`   $ W6 $ 2 ; `" $ ܔ  $ ֔  $` ͔  $  Β `㿘`  0`@& 0 㿐> {a  $ `  & P & pJ& 4㿐  > {cX㿘 ɐ%> ] H(`> \ aT> Gb@ H @4%> c `> ] `L> Gb@ 0  @4  H  㿘> A&`DcL$`,$`(>   Р`> IŔ`> ap`Ē ?&`l&`h`$4`$㿘 D? `> I @"2`@l2`  `0`@"  < & 4 0 <d& 0& @Ho$(@DHp@`-be0 "& @`"`H`8@L 2 ``I `L > z`# & 4> z`"Ђ & 4㿘  ,`,  p 0 <d$ @$ 0 $ 4Hod(@Hp@(> Axe0$ 4 ($ @Hod(@0 & W `&  "$ 4? & & `Ӑ`0@`&`0 ͦ 뀢?㿘 ,`0`@ h"$$``0$ѳ` )  0@"@ 0 <$ 4$ @{$ 0`0$`0Ho$(@e}Hp@ `0`4`` "0 0 <d$ @$ 0 $ 4`0$`0Ho$4ݐ(@e֐  & `0 0 <d$ @$ 0 $ 4Ho$(@ .. . . . .  0A  .h$`0`"B < `.  <@I`82 . . 2 . `l? `0`5?   (($`l $c $ H$  <$0$$> I`$p˃$t`0($`0 .`0~`$`0$0`. . 0`. ւ $`l2 ϝ` 㿘? > I",6 ے   | 0㿘? 6 > I ",ð  `0 $0$㿘? 6 > I ",  `0$``  0$㿘%> ]H` > \ aT> Ja@ H @4%> c `> ] `L> Ja@ 0  @4 µ H®   "`0> ,0>hb %/`%/%/%/8%.㿘 2* B*@ 3`+ +`@ ` 0((@ @c@ C 3`+ `@+`0((@@=B?@ B@Dٖ   3`0@㿘b` ` 6 4!Ȁ  b0@ 2 Ȁ@  = @ ,@ * * > '*bȲ `#!0   @ `    $ $ $  @$ $a0$  ;((((Ր 2 ǒ @0b$@ > Jc 㿘 4> 'b 0@? h# Y $` @`$`  < $`$$`a0$`  < )) )  <(`0`0`) Έ) ϗ : D`$ > J c   H@ D H` $ D(` L @< 0 D@`P  `` (`  ; @?` <  `P( L@`A` $ 0$ 4$ < L@` `0  $ D$ 0$ 4$ < L@`"$ `   < 0$ < L@`" !` `"($ <  `2 D   < 0$ <2 D$ D $ 0$ 4$ <2 D   < 0$ <* D`!(Ć`2 D$ 0$ 4㿘 @ 4  )> 'b 0@? h#    $ $ $  @$ $a0$  <(((((ِ`"  ʒ @     & < & @    @@* & D *   & H T `Q   H> { cx$ H @ @$ L $ 8  ` P > { c $ H @  $ L$ 8 ʔ ` P @ @& &  `6 `#` `` & & L0`&   $ H @$ 8@$ L   P @@z&  $ H @ @$ 8$ L > { Pc_   $ H @ @$ 8$ L > { Pc_֔   @ <! & DS& @㿘 4 Ȁ`$ D D`$ @ LĐT  D`$ H   H-  D`@ P H  @ " <ư 㿘&`0`4 ,`> h А& @& D& Ȁ 251> { D` > K ?a 0&  D` L   L HĞ  D`@P@ Ȁ`> KԴal ``" @ <& @+#> {(#& Ȓ> {"# H& & D   ȝ㿘F ``A> ya8@`: `" ``1 ` 5, :8 : :   ^ $> 'b@? ͕h  c  &ǟ&JY  , :J > | ^X`  :> %98%9$%9$%9$%9%9%9%9X%98%9$%9%9D%9D%9D%9D%9D%=%=%=%=%=%=`%=`%=```  `> y`8 " > y`8 `L`0 :`0 <` ``L``(``L``(`> M> M Aj:`0  5:`0"`0"`4 a⠁:`0 a⠁:`0`L `2*B*@0((@ @c3`+ +`@ ` @ 0((@  0@C:`0㿘> 'bȠ`#`  0˰   $` @`$`  D $`$$`+$` (( D(`0`0`(t(̃@ 㿘> 'b 0@?  ̠h#  $` @`$`  D $`$$`+$`(` (( D(`0`0`(H(W@ 㿘 4?А " H  b?@  ?  2 ((`<(b``(q А `(0b$@ > NcT 㿘 4~ F P B> M c L@`8 H(`@ $ < H``(`"  P 2 L 1> |O @ $ < H`뀠`ǒ P $ < $ < P P㿘1  `  ]M  P H& T& P& H& L @`> |> |`h`>  c @ `  8h @$1` @``" `W ``O`2  X  %  , H$ 8$ L]  $ P T P$ T T @& T `@4բ`@`! ?   ?  H" P & L! TT?  P T+  PP T& TP  r ؆ ""  L"  L & L ` 㿘( G  +> 'b0@? /h#   ($  $ $$ $ +$  `((  ((( " @ ڒ(`2  ` `(`8  ``    @   (``$D  $@ "̐D@ Ɛ, `㿘 4 H`"* Pr H2" P! ?    H" P & L?  o  H2 P`"0 @ X  P % @ T T? $ P$ TS  P " @z P T& T P T? $ P$ T>  P  @ "6 D  p> c<' &`0`4 `,`"`0В`D С> | !\Y`p 2:&`< > &`<  9`P`> O r` W&``P  `XՐ P x`H`> O`p 2#`P`"`H T> |> a ΐ "`P> {X#0쀠``@`D&`@> |L x`H2`P! ?    `H"`P &`L> {.#`P2P`H! TT?  P T `P"`HP T&`TP괐 0 > Ib> R> QaT" \" h> Q> Qc(" `" d> S> Qc<8" l" p> R> Ra" \" h> Q> Qc(" `" d> S> Qc<8" l" p 8`  8@  8 b " <㿘 8> |}  8  ` > |  \@ 㿘`"!@ > #!@> R !㿘 8ddaf{  8d2? \!,|` " 8 @@> "c 8  \ 8 @@ `(" D,"! D#@ @,2& < 8 `& t& <(, D )" 8` ވw܈h׈!W> |> |!@2a`> |/! 8> Qc > Qc 㿘 8%> .L` 0`B <`)> | 8d" @da  8d2?  @,  n`@" 8` ` aÐ  8` 2? }" P)& <L`# ؒ @آ@ ؠ@ ؤ@  `, > |! a[ 퀈`"2 P@  L`q`[> 'a􀠠"c H X @  T@ ` " 8` 0> |> |  x!\`B @آ@  `@[ `(`@@ P@@ 倈`@      ؐ@  " L`" > |A"  T>@@> 'a􀠠2 X H " X L@ P Xؒ @خ@  `@ > |"0z`  r ؐ@  * ؐ@  > |  > | 8?}  8`` 0A!> |> |!@a`"<> |!> |> |!@a`ܔ"<> |!㿘 8dda֨  8d2? !> .|` "& T& X L`/?@@(@ 8& P' @,>> 'a􀠠"J P T 8@  @"O T 8@ a,b"@ ~@> |@ "h  T?@( 8:& P' L`" @ P> |l" @ t 8`  t 8  8 `> 'a􀠠2 T P` T @@& L && H 8 ` @ P@> " 8(@ 8 ` @& P' L`" @ P> |> |!@a`/!> |!> |"㿘``X  @ P `"o8,`"k8 '> |&`8WȀ p%> '`" <> |"`8 @<@&`@@`(@,@$@"> |> |#>  Ґ`"`8 > |Wc  @'젒 "> )> Qa@ @|@R  ' J@   @r0&  '> |&`8WȀ > |@Sb> |Wub 2w`8@ @e" %> '`> | < " > R?@a؀?k&`D`D> |@"n&`D`8 @<@s&`@> c H> ` O`28`> @#Ȁ &`0"% > @2d> |> |G"b> C#^> > |W#c k W e '@a f> )> |Wc "`> |##>> > #9> "5> > Vb 2`8`8( &`D㿘``V `>  a &88@ > | Vѐ#  `> @ 㿘`"!@ > ֐#!@> R ѐ!P `"R8,`"N8 &`<8&`@ < " > R?@^a؀?D&`8`8`@@8&`82`> |@#(:` &`48`5` '@ %> )> Ua$@ϐ @P@& m ' @ 0 @F & &`8'㿘``VO  7@ 㿘`0&a< L(` P(`@ ` &a@  `H`0`L @  @ 2` ` `4@&`4`L&`0 ٲ` 0㿐 jH  : " 8"   `$ .' ` j 0`"  (  j] `(  Z$ $@&@٢   j?( `Ŕ'Ô i 㿘`  ` `4@`i㿘 0  $@0Ӗ?( @`  D@< <$` `  D <& T@<{*`$`` D <& X@ |#H㿘`"!@ > #!@> R |!㿘 4#> M@a B & L ? @<& H 4a@ H ` `8$`4 L   @   @ `  @" `4 L@ ` H@Ԑ 0 1> |,#`P 0 @ &`0D&`<4&`P4`"l&`4 < " > |?@c?]&`D?`8R> R?@a؀?V&`8`8`D@&`8> `<c> c8> |2`#Ȓ@:` &`48`@` '>  $@  %> )> Wax@  &@@b f ' Z@ > |#&`@> |#&`8'㿘``T  m@ ##" #|) @ h #dd`# h#dd@ ` C !: ` ) @ 2 €@   "#{"#2 Ć ?#X"#p ##\    #d ?#d? ##l`#\ `( ! #\ #d #\`#d##\ `(! #\#d #\`#d#㿐 Āa#T `@$  $  Ā7?# 777 77 ;n c  S  8?  `3  3 ``1 2 3 (3  (@@ 0c$@$D$H$L$@$D$H$L Ă}6 ā?$@$D$H$L Ăb6 ā㿘#l``  1> |# \j g d  ` <@\ `??2<@` >@R `??2>@ KH . 0`>A `>㿐#l`#\` > | z# $   'Q  $  '0 $   'A  $  '0㿐#l`#\` > | L# $   '$   ' `@  $   '$   ' `@ 㿘#l`V`U В ͒ ʒ  Ơ >’ `??2>` >@ `??>@cl`   *_\  Y *??QOM `> |1?Ȑ#㿘c4`` H     1  : Ѝ??  c4`<`>`*@*cT > } ? *  Ȑ h??& ]$  `> } y  ̒`> } p ! b ?ʐ~ǐ 㿘 4a !")  $  ``&``#&`  ``&``&&``&&``#&`㿐#\ʐ#`  1> } @&`` '&`` '``  ``?&#l&@@'&#l?&@@' 1> } `㿘e > }    @> #t` h*` ’@ "   @ > :  @> 㿘## c#|, `Ȕ #| `(`  !#| , `&# 㿘#`%6 #T b #T `  0 | #T `2? #Tc   0 l #Tc ?)##T㿘`$ \ \d@`@"!c+@-8"`= > D"`H5  D  t `* ~|,` @ hX` a ` Ӣ @ \d6 \X $p @ 6 Z$$!`2 a؀$X $p !`2" " D؀  (`@ a$ !&!@ " @  a㿘#T#X#L hHo4#|(@g#|`#t` @#x#|+` `(` @ @ #|` a2#x  ` @a#|#x+` `(  ``#|` @a2#|&#&#&#&###(`@$c##($c##(`@$c ($c ho  $b  $bP $@#$ #h$ T#d$ $ $$  $X@$ , ,>$ (a_$a$ ?$ &#p$ $  $b,$ 0b `$b c $c  Ă`@{6 ăHp@ #ݐׁ#t @ y&#x#| @ߖ o&#㿘Ho&(@gNHp@㿘f > } ` > }> }  & ؒ> } "!0װ>  c 㿘2 `  ` `> c> }> }!@ !P> } !0`> }`㿘 >   a!@ Q x?> }@Ga&c`> ]cږc   4@g0 &cX #`@a<   &cT@[H&cL&c\ 0&cP> }?@%a?&cd> R?@a؀?&ch 8ch`0@&ch> \c  &`0&`4`@4c|: c0> Y> ZA 1 ?N(2x #l!2[ &O! D 2:c4A` ʢb\> ^`&b\> [`8&a> \b&a&b? "&bL6`Ġ`h&`hWUc`O> } !8 > Na `"&  A  &c4 ( A  (&c4 &  A &&c4  A! &  A &&c4 #  Az #&c4  At! #  Am #&c4 8W&chM&cd㿘`N``?㿘#THof(@g@DHL! @C >!"@"D"H"L$ hHp@ ґ#㿘Ho&4 (@g a"3 \80a "9 \c`h 4" \Hp@a50 a6 @}c0 4 \`@$ Hp@`A`@#`^ `6 \`S`h#  Hp@ \ 6 \ #"`c8`@ (```"`"`"`cp`  ``  㿘#8  , 0?  `   $@0?@` 㿐 #8ba# 7777;n c ? `Ms  2,?  `3  3 ``1 2 3 (3  (@@0 `MJ ژ?6 Āb 777 7? d,0w? (``  ,2? d,0_? (``  ?,?㿘e > }  e  @> #L` h*` 6@ "   @ >  ] @> 㿘#h c#T, ` Ȕ#T `(`  !#T , `&#h 㿘#8#<#0Ho(@g #T`"#L`"@  #T#P `+`(` @ @ `a2#T#T#P  `  #T  @ ) (` #T#P@  $#T  )  (` #X d$#Xh$ &#\&#d&#`&#h$$$$$0$4#@L T$$$$ $ X@$,, `$(,`  \,` ,`,` ",`  ,` ,`?,`0ʎ?"# `(`` #,`#,`#,`#,`#,`#,`,` ``@{6 Ăa@?,` Hp@#L @ u&#P#T @  k&#X㿘nS㿘@ @! @>!@ @> }@@> } @2 @2 @ !! @a>!C >!@> }@> }@> }@@> }@ h!  @a>!C > hd  @> db  @> bz> }aj> }``@  @> `@`  @> `N> }`A> }`4> }`'> }`> } ` > } !! @v>!> } ܐ#` א#   @>  ͐#h   @>  Ð#P   @>  #0   @>  #  @>  # ! @`> C >! "  @>  "!  @W>! "!  @I>! |"!  @;>! "pq 1 > } k"X> } e"@ `"(!  @>! V"!  @>!> } K!!  @>!> }A#Аɠ?0R㿘 \d@`@;d!) +8"`5  "-$d"`Q  D  L `* ET,` '@ h<  \`a$\` Ѣ @ \d6 \$d!`. a؀ a؀ " D؀  (`@ a$ !&!!`"@ " @  a㿐#`#\$#T) @ h'` h'􀠠` C !&#\> ` ) @ "6 €@ Ād&#` { h6 P 㿘#4#@`(0 c<c߀   . ?  " 㿘 @21> }U#?> ~@` &cD  8@0   &c<@<&c0&c8 09&c4?> }@ߒa&c@ 8`0&cH> b`x &`0`@&`4cw[`Œ > a> ba&a&a> b?c4"cl&b6`Đ<&`h> ^> ^D;  < # #<b\ `&bL&b\`h 75cD/> }!8 > ~IԒ`  `"&㿘`I``?㿘  > a!@>!Ho&(@gOHp@㿘Ho&4 (@g a"3 \80a "9 \`h 4" \Hp@a50 a6 ;cl 4 \`@$ Hp@`A`@#`kP `6 \`E`hF > Hp@L \ 6 \㿘> I-!`?㿘0 `@&@4@ `8><&cP `&cT4E`> &#p80 @ 2&#`D< @ *&#\"> ~`P@  )#` d@#P#`@?`@ 88` ! &`>` &   @Ė I1> ~ h1> ~ 01> ~ v#`㿘> ~HȐ `?㿘<&b `&c$4L`E<D @Ǖ 5&"80 @Ǎ 0> ~#|#x&>a@&   @| "@`&`?&` "?88`@@&`8@А @.#! 2 "1> ~ h h"D@ᾁ1> ~ 01> ~ 㿈 ` k  h"< @1 `< Y@?M `D` @ ߂`۸?쀧 8?c@.?0`  0/&/7 '') 1 @@@@@.0?c00@8(``  $`6 $ @Ÿ?# ` # @#    # b !$2!$ } !$2!$㿘> l &` &`㿘# @`` #0` `    #0``  #``#?c!   Ȅ! 㬂 㬂Ŕ@㿘#`#(.`@@$` ` @R  ` @H?   > ~   $`~    wt q  m >@i `??2>@ >` `??>$`|* xuq  ` ?c㿘#`#.`?c($  @@A   @< 1> ~*   $          >@ `2>@ > `2> > `2>$  1> ~ 㿘> ~    㿘# $c0ľ? c` 1> ~ґ 㿘# $b0Ī? b` 1> ~ 㿈#!$c '}6!$'''耈@6!$$cL$cH$cD$c@$c #`6!$?c''''$cL$cH$cD$c@$c # ܤ   2 (2   (@@ $cL$cH$cD$c@$c 㿘e > } ] !P@>!P#.`   Ȑ ^{ !H@>!H!  R !P@>!P㿘# .`.` @((@Z   Y@ 2 㿐#̤)'!# , t@`& &#@!P@>!P#'@ a   #  , W@`&#́ 2y#㿘#`-# "/p#&#&#&# @(( (@ (( h h 2#&#̚ !#+`+`  @ #`` 2## @; &##!@ @4 &#㿘B !$6!"{ l6!$#  #` l #@    1> ~! 㿘#####Ր?c$ # "p`$ #}#|(c$bP#y#x (`@$c #{#z($c#}#|(`@$c%$cc$b0$b, $b$b#$#h$#`@;`  % a%! $,!@`$  $ @ > ~"!@$c c b  l$b #`@?$@b `$b c $c / > !$`@{6!$` % $ 0> ~%  !(% 㿘 \`l 㿘Ho&(@g;\Hp@㿘@!P.@@>!P "?!`*@>!`?b  > ~> ~!`͐ 㿘 >  a!`@!h bH bL bD b@#Ȁ#!$#Ȇ{@ ?>!X6!$&#Ȃ `  #, ( `6!X&#q #Ȁ`"6!" 㿘#?b   @ސ㿘4`1> QՑ x`1> ~Α"(8  @™0&#D  @“<&#P  @H&#\  @‡T&#h  @`&#> ~& hbH@N? }&#?` !&#> R?@?a؀?q&# <#@&#> h& 4b|& 0 0  @T#x> ~`P@  } #> ~u"P> dc> e& l> db l& & < > g& > d5Ԑ???"  `46    "> h` &"> i&"T&"X> g?c"&"`6!$  &!&"q&  o8" > I3> i %c4 &# <&# " 5 5Ғ "ʒ  |&#cB &> ~Bbp "&> ~Bbx "&մp10㿘``Bݠ " > ~B֐"x  @ > ~ BȐ" @ 㿘Hof(@g  lHp@  㿘Hof4 (@g a"3 \80a "= \  Ȁ 4" \Hp@a50 a6 4 l 4 \`@ Hp@  @% Hp@``@6 \`2  Jܐ "ڐ ֐ ݐΐ %*` @%*`*@% @%*@㿘% d@㿘% \@㿘% h@㿘% l@㿘% p@%`8 %`<㿘4`"1> Q x> ~&e"&e` [&e@&e<e< &`$@(˒b@&e<`" `"8&e !> |`# A 2U`&e& 0``"> Ic&`e@`؂` .`.` .`  `ؐ@ _ "`&eDe<#@(eD`R&eL``J` I@e>bl&e\&eXeX@v ` 8 > AcȀ "? eD` eH`&eH> Ic, @ @:# &e" 0` > AfcȀ 2eD <"s@2eD `2eD @ eD@&eP@&eP@(:$&eL`0i&e<2eD  > ~@b&e@e> N?@bT&e<> ~A0" 2[ `"D x1> ~@"> ~A"#p b> I> J` `&`؀`2e@&eL&eP .`  `.``  `؂ .`  `ؐ@ : O&eD0 @ڔ &e @  Д M ``A &e80 @” I$`8<@$`0$`@> '`"' <ԐD< @ &e1> ~ؑ#0``؂`@.`.` @ `؂ &eD  P2e< &eD " > R?@]a؀?$`D`D$`D1> ~">  > ~n#X1> ~#$`D㿘``@` `">b >  a Z&88@  > ~@f" > ~ @^#p 2`0E@ " l" L" P" T" X" d㿘Ho4 d(@m d h  L@  l p  T@ Hp@ 2  L 2 T@ X@ P  ` @ `*@㿘 `   * 㿘 `ߒ  㿘 `ې ֵ.6ӓ 㿘 `̴ʓ 㿘 4` @ !  & 4@& L& P& d& h 㿘 4` @ !ݔ  & 4@& T& X& l& p 㿘 0> J ͒`㿘㿘 @㕐   `> lcذ  $ x$ | x@ 㿘  v *` `` `8  e ` `$`  X ,``$`@`P` `P@԰ 㿘4`1> Qu x> Q o &`t "70> J`\&`` X&`@&`> > l`@l ``> lcؐ&`x&`|`x @` > l@Œa1> J&` Q>=` b`㇔` > l@a1> J&` A  @ > J㿘> 'a􀠠 > ? #`?%h%%%h%h%%P%%%H%t%t%%%P%t%%%T%|%%%%P%%X%l%%%<%`%@%%%,%T%|%ä%%%4%l%l%%%H%̈%%%|%͈%ͬ%%%%X%%Ϝ%%%4%%%,%\%ь%Ѽ%8%%М h(@ h( h( h`@a@.c` > ~ p!p?- ! 8 !@8 ``?``$`+  @ ` " " "@  8 ``?`+ 㿘  ?  @ ǐ ?`0` @ N ` ?0`@ ` `F`>`"7N   `   {  `?` `? t p  δ 00` 0@ 0 [X @`2ʦ ɔ N `2Ĵ`Ô N `2 㿘`  (`> m`K`x  `   B `   : `   2 `   * `"`ڐ     `؀`А >] aP`̀`Ő >] a| ` >] a$`  &'  @ ` &  @  ' ' && & & & ؤ Ԡ `  h?c  ((("   h?ۂ`  (( ! 㿘 h , , & t㿘 0> J aa㿘@`  (`> mH``"`  `` ``.  `  ``Ԁ` h (`  h`( h(`  h`(0``֚ ```Є  h(`  h`( h ``Ú `` 0`` ```  h(`  h`( h (`  h` (0`` ``  h(`  h(` (0`` ``a`` . ` . ``2 ` @ |. ``2x ` @ r. ``2n ` @ h. ``2d ` @ ^. ``2Z ` @ T. ``P ``1`J` . ` Q. ``A `` ```7A. @ . . ` . ` 5.  h (`  h` (0 h ` . ` $.  h @` (`> m`` ``" h ``2   "`` ` h (@ h`*`  h( h`*` ``܈ ```ւ  h( h `*`  h ``Ȉ ``È 0`` ```  h( h `*`  h ( h`*` `` ``j` Lj *` *` ``2 J  @ "```2 J  @ "```2 J  @ |"```2x J  @ r"```2n J  @ h"```2d J  @ ^"```Z ```T ͈ *` N*` ``2J   F"` ( h 0`>*` ͈ :*` Lj 6*`  h ( h `-*`  h  h  㿘 `  >  f  & &  & @ 2 >  O 8& $ $ $ @$  h `( h , h`D`@@ #` X T  W  L  h`d   @   $ #`( h `, `( $ 㿘 ` h>   `  > x& 3> 0> @ 2& & & & @&  ! 8! <``  ?c!  D`!  )?)  ))  ) )`)   㿘 h@`$` @]  @" " @9$ @"# @ $ #c  @A$$`($`,` @ #@$$`8$`<x`԰ @| ``ǰ  ,@ ` 1  ,` `8 $>  T `( $ m  h ,`$$ ^  Z ˀ 㿘 䀦 "1>  @ @"   2 1>   @搔 $㿘 ܢ  @敖  $ $ `$$` l㿘@` (`> m? &``&` &`$&`>  a: ? &``&` &`$&`>  `H9   &`&`? &`$ &` `> 9``( &`<>  aX9߰   &`&`? &`$ &` `> 9Вa`(   &`&`? &`$ &` `> 9`0`(ڂ   &`&`? &`$ &` `> 9a`(ʂ   &`&`? &`$ &` `> 9`H`(   &`&`? &`$ &` `> 9a`(  &`$&` ?&`&`  `> 9`X  &`(`,> ^9z``D&`@>  9t`8 &`X &`$   &`&` ?&`$&`   &`&` ?&`$&`   &`&` ?&`$&`   &`&` ?&`$&`   &`&`? &`$ &` `> 9<a`(V   &`?&`$  &` &``> 9,`P  &`(`,> 9%`0  &`@`D> 9a  &`X`\> 9a`t&`p> ǔ 9` &` ? &`$&`  &` &``> 9a  &`(`,> 8`8  &`@`D> 8a `\&`X>  8`@ &`p ? &``&` &`$&`>  ``8ܰ ? &``&` &`$&`>  `h8ΰ 㿘@` (`> m `>  8a &`  &`&`$ `` `   &`&` `>  8a0  &`$&`&` `>  8`p  &`$&`&`ݰ `>  8`  &`$&`&`Ѱ `>  8`  &`$&`&`Ű `>  8s`  &`$&`&` `>  8ga  &`$&`&` `>  8[`x  &`&`  &`$`>  8Na  㿘 ܀`\ h   (`@\HoQ(@<  @,@ I,@ ,` H,@,` ` `Wc?I>  @`  \,@,` ` `Wc?=>  @` W,@c?5>  @`  W,@?,>  ``  Hp@& ܁ m`Ho4(@ !8 \ !XW !xς  !0ם㿘 t h`9  $$t$$$x$|$$`p  $`l` ` $`f`Wߠ$`0^?">  @`    @ ߐ     _! 㿘4`"1> QT x 1> M!8  @0&`h> R&`la@??#&`p <`p&`4> q&`pc&`0 `@`0> ,"> J3!? .`.`.` .`.`.` <&`p㿘``6  > 6" `?%d%%%%%%%%%%%%%%%%%%T%%D%0%%%d%T%%D%0㿘>=b>=b   ) `   *`;`*`) `Ё  D"H H $ 㿘 8`5`3>  `@  @`` >  c  @`a     @   @    @    @ 㿘!``  T&'&! ` !  @ !``$!`   @ !`!`"!` #``#dd"d@@ d0``E Ed0``#`?!0 P #dd@ #(!㾸#> nc> c<' ` `:((>  Ȑ8 $ 8' '$' @ $" `" `" &&@&&c` `8   2#> >  Ȑʔx >   ''@ː`"@&`ް @&h#X㿈 `& | & | 8 < 0 4& T& d& \& `%> '`=!>=> Ec P`  "`Q`h`P $ P |`@& |@20 T |`@2 8 d X T`& X: & X& &  8`??? & ؁ & X#0> @1c "#0> @*c P``" |/耢   '''' |``& | l`` ") 0 |`P& |& &  " 4 @4'耦` 0 @@4'耤2 l |''쀠c |㿘> !,c(5? !   &!P&!@ &!<&!D㿀'>=` >= ``> v!, &!\&!T!\!T''''&!X'> ˌ `> v&`> v&` a &`ǐ`㿐> 'a􀠠K T& D& H |`,`& H& D  & t t@& & t  x@&!(& x!(`"< H! `!   @ t x@!,  D`.@& t   @~ t x@!, D@ H 2& D H`" |@& x`" D> ucl&!(`2> u! & t㿐```> 'a``& 0& 4M& 8 8 0: 0`@8`& < < 4& @2 <> @c0& 8> @c8& 0> @c@ 8 0& 4@@80`@8`> @ҒcH 0 8& <: 0`@8`6 <& < 4 <& @`2 8 L> E`" P@'0``E(&@0``E0````&@0```8 8(`> u`" 8``8 8(`> u|&@%& 0}& 4%$& 0x& 4"!& 0s& 4%& 4o& 0$& 4k& 0$#& 0f& 4` @  ``  㿘> Ja ?6  (@`<` `    l> 8(`Ȃ@`㿘> Ja ?6  (@`<` `    l> 8(`Ȃ@` 㿘 0 4@  㿘> Ja ?6  (@`<`?` `20?4```$`(" " " ā 㿐 pB`><> 8)<`-8/>0`  @" `l(`@`%`@(`0``o(0`` `   `lH(`@`' ߲`㿘 p`` > 8` l@(`@``@2 l㿐Ho%`(@f` ` p@" "Hp@ @"@  'Hp@  0 `c  "&"Hp@0܁ `   *`@`<` ` `(` p`?l㿐>=b>=b` /`<`">=` ` >=b` `   㿘>=b>= b0`$`">=4@>=b`@> J>=b ` `> J> zb>= ` ` 㿘>=b<`  @04`  㿘 p ` ``  0` 4` ў@㿀 `4`0@@!@`` ``$``  ''@``耠@ * &@`` @ * '`@``@B@ܐ@ʆ 㿘`.0`㿐 $``?@ $```04@ @@ ` ` f `@ ް  ? 㿐   `@ %  `04@א@q@ ` e` ?`㿐 `@R `0`4$@@E> (`  `04@@,@ (`@f `ް 㿐 `@  `0`4&@@g@> (`  `04@N@@ (`@f  ް 㿐 `04@)@Ð@ " ` (>  0 4b@ @@ (`@ 㿘 0 & 0  $@"& [ $& 㿘 0`  (*/` `$@J`$`$`0`"0`  $`@"`3``(*$`$`,ހ` @ڀ`(`$` @33$s$` `0``$` @ 8`,`,d``,``($`$[  2-```$ɒ@$`$ L`0F? 2``` $@ $` 7`0` $` 0`0`$$`$)``0㿘 0`F  (@*) `$`"$` `` @@`@<:? X$`$(!`0`0``$```@!@` 4$`  <?`0`"`  $`@"`v``(@*`$`,@` @@Ő`(`$` @ 8`,`,``,``( $`$?`0`0`0㿘 0`2 < 0& 0㿘 0`& 0  $ 0& 0㿘 0`2" `G ( :  $Z @ 0 0` & 0 $  f & $ (: $  V & O & H & $* 0 ( & & $J   ( ѐ `@& & $& (Ȓ 0 ( & 0 $ ( & & $  (`@& (& & $ 0㿘 0` `@ `ԁD 0n 0㿘 `@@@88`@@88`  &  0` l 0``& 0a㿘 0 `" " R@ސ `&  & (@& $& ,`&  0`& 0 0㿐 0`G`2@  & $&  `04@@I@ `    $ #  $ u $ @& $& ,`"@& & & (S 0`FN& 0  0㿘 `  0`"`"  & $& & & (& ,A    0`& 0`&>& 0`&>& 0  0㿐  $`E`> ?@   6@3  `04@(@@ ` b(` ` @?Ԁ  b(Ϭ b( 㿘 0``& 0  ! @ $@ @ @:& (`& ( 0`  & `@` 0` &  0`@` 0`mz` > za > za ``  ` > ~` > a > ~` 㿘 0`Ɓ"`2"">0a$"㿘""&"(`< `㿐" &> Ka "1 > ]`L(( @> ? a``> c    #\   @A  0`@2 ? 0`@`耢 @ (`㿘 8"`@Hoe (@f" ```   *@2 2" {`  &"&"Hp@,2 "|  {J  &"  > q#p&"Hp@㿘`> b# 㿘>  #Z> @S#.`@`<1>  J#㿘 bb  @+  > 8` lL@(`@`?`㿘```>0` @```āA=9`0㿘` :`&` " 0 ` ," <&"`&"@`Z&`02 &` @&`$8` &`(&`,&`&` > &"" ( "`Ӏ ""&" &"㿘 cX@?`( p` ``8 p `  f  p V   W`ײ  㿘4` /.`@`< + Hoe(@ p@  `!$ >  \`<@"`  Hp@f p&`  Hoe4 p(@f p` > c!.  p`Հ "0ѝ㿘 0` ` 4 @ Ho%(@ 2  & `?& Hp@f "   t&  㿘 `@ 0`   ` `2&  t `2& 0` "   >9a  p   `@㿘!>="`" & \b@ "& \& \㿘"`>  樐 "` '*`@`<``"& lb$b?$b@ > 掐 b$`p$b& px>   Pb> @ (㿘">  q "+` 1*`@`<``2@ 0"` 4>=bĀ  #> J " &"> cЄ`&"& pߐ0>  㿘 ` % ,@`< Ho(@"> "a ! "~ Hp@f"  p`8 l@8`?"``Hp@ `?Hp@ $"$"Hp@ p`6? l$"` `,@`< F,@`<  ` `瀤,@`< ` `0԰$"! " p0㿘"Ho(@?"*&"Hp@J f"㿘%> J`` ,   `@㿘ΐ?* @`< ` ` <` "`` `` `` 2<  " Ho (@&"Hp@f&"Hp@㿘%> J`` ,   `@㿘> Ja ?6  (@`<` `> 嵐!0> J?  0`) @`<` `` @ > J? 0`   ) @`<`"  `` &@㿘@& p  (@`<    `) ``` )  `ꀠ  l&@㿘c! # "  0` #V2  `@ & ``?&`#V" 8 #E#L   V"20c^f0  cQ cP1`0`g&8`0``4  ` $`cQ cP ʀ cR"`ED‚K" `0`4@łL2`0`) $ `τ``"``0`4@ cUh0 c]2`0`8@&& `8(`(9 `8`) &`8@&`8`& `8@ &$   `$```.`t  "> '0b@,#``$`$` `"`  > 'b@#``$`$` `"y`  . ȓL !> '"Ѕ(`(`"@N* &`"Ѕ(`(`"@E* &`& `"-&`,  & ``?@&@ v@{  '`i`0` `ð -`4@``?!$` & =08` ` @5$   $@```"&`0`t"`0 ` ` `"`  > `, 㿘> Ja`?0` @1 @Ha(`C `> ` =(`@`<`"9 ` .>  t> yb p$ $ p0``,$ ԀD   t l($ t> 8`@ " ` @`4 @`4 `  `$`  d c $ c$ $ % a $ $ $ N  t㿘#>=b`'>  *>  `,0@4!>= > $"#"$ @$ $  @> J> Hb $  $b> >  aPxo#>  aPi#>  aPc#>  aP]#>  aPW#㿘`   l> 8(`Ȃ@` > ca `(> ]`L> `L`0  @ 0  2 <@  > ސ!>  .`Ε 㿘 p` ` `@ ` $`㿘``" N@`2  @ , @&)   ,  > > >  aPߔ!Y㿐  "o   ` ` v4 v1 㿘` 6 .`@< 0 >=b9 `3XHoe(@p@"9$p$ r"( `04`  { $<㿘"` ``  <` ``   t" \@"@ ؞@㿐 4  s *`)  s  :&`&@`0@A +&` `\#\  @ &`&`$ e $ $ >=b` #\       Q$$ $ uZ  uV 㿀 ` .`@`<  8٠    0 4`蠒 #\#`   0 4`  $` Ja ?6 2  (@`<    > 8 l(`Ȃ@` &3 ?" 0㿐\@ &"> ߈"p&"?&"` , >=b5>=`#\#`    D Z& <>=b`` &> e""@Ր  > \" <& l& p  > T  \`"X& 0& 4`:& 8@@  c " &5> 'bВ#(($, (`"@ * #& @ , & &  t> a  & #!> J",` $",> Jb(> 7> z"XH   $",$> ' > @"@k@t& 0> ߹"H> > >  aP"> > >  aPx"㿐` `  #\@`'> Ha> J !> ca ` > ]`L> `L`0   @ 0 2(``?(`@(`@# 㿐> Ja ?6 < (@`<`6 ` "` ``0 l> 8(`Ȃ@`%` @$`   $ >=b20@``2"'` $`  ""  $Ho%(@ Hp@`  `  ` $``fHo4 t(@f t`a`" tHp@ 㿘 > J p!`!(`DHo%(@ t"  HHp@`2 p `2 p DHp@f t H?0`@`(`@`<` & tHp@& tHp@  H- `0 P0S-    P`: 0FHo%4 t(@f t H& t`> '& tЀ 80`@8`V 0 `p@"0` ` 0` ` `&0㿘 "1> qْ & ]#㿘 `1> T# &  & p & 㿘``  (Ho%(@> cH ! H /&  Hp@f>  !@    @Hp@``0` , * ``&@ր  `Ѐ@  i, &Hp@ #㿘Ho%`A(@f`A`@@" `Hp@. Hp@&7L&7L&7L&7L&7L&7L&7L&7L&7L&7L&7L&7L&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&78&7$&6&6&6&6&6&6&6X&6X&6X&<&<&<&<&<8&=t&=&= &8&=<&=X& J0`?0 * @`" `\` * ?㿘> n`> n``"> n`Ā`> n```㿘> n` > n```㿘  @ 2 2 2   x@ pt` `x `"    (@ " О@ @ " @ " 㿘 \`  `2 &  p t@s  p㿘 & X& Đ  " X" > c  ؀`  X` @x \'0ؒcY2  '䀦2' \0!cZ܀6 \"'㿘.<0`"E l"; l " l@` . @ v@`.=1 ,H-9 l` 1 @1 =` " | \ ۂ(`0``+փ(`> @ G@@ A@`  > 7cL @ &@ `  \ X   l`  \ K  1 =*+@?`? W 1 ='(@?`? F 1 =$%@?`? 5  ϰ  ʰ 1 ?Ô @   㿈'H`8 `1`Ȁ-.`̅.=a  'H n(`0``('(``H`" &`H`耠`"`2&`&`H`` `" ``2&` ?Âb &  > \  a 0} `(`0``o(<0`8 b?c @`'@ ,@}(`0``oa.` `.=0a    ? &  @(`@0`@   0$(`0``o(66 . <0`8->@"*6  0(`0``:(  2̓(`0``8耈"6  `  6 6   `l 6  <5 8!?c@‚8><`@? <#"!>"5 @|  ~"q5q.`@"&`T`&`  $ 6 &  H  ` H`H  ``H (`\ "`  h`H  `H } ـ`H v Ҁ`H o ˀ`H h @Ā`H a `H Z!`H S"`H L ``?,@5 !   <$ &  @@ ܲ@?,@``?& >eӀр298>e L  9 08c6 L   -  L? % 8@^0c"  㿐> n`.> n``> n`Ā`&!> J #> n/> J'<)8+>"$"`|(@`$`|((0o0`@@" @$`|%⌀  > J0`0* `````X` > ch 㿘> n`` `\@ 㿘 |`` \     & \@ & \  `  `> `#X& \ > W#p0㿘`> P# > Jb0? 2 * `X ]@ 㿐 @@o  @"   `@` E  c@"l@? @ xc@c@"  p t` $ c@`Ho%4 l(@f l? c   `2 $ Hp@@"pI @ۂ @ c@2 p@(u( c@ c@c@ c@?c2 l Ђ@a?`߀2ǰ  l$ В( @@m @2 p> Jbh@0c @o@2 p `" `" `"  "  "   && & `" `w&`q& &  & p t` c( @ jz "\k  s > J \bh" <" "  " > JbX   && & & &  ( ̔& **G p t`  c sv > J zbXҐ   } w    @0  ̒  l ` ag$  0@  '@F' "- l0㿘 b}@&@(b|b~@ `v@ X "    @@ @" Xl?" 0  X   @ &   `" 4@ 㿘 Ԙ`& Ԕ Ը`& ԁ> Jb0 ? 2 * > `㿘> Jb0 ?6 .  ؔ`   X`> I#  Ԑ 4`$  Ԃ`$ ސ 㿘> Jb0 ?6 .  X    & & XF ``"  `  @ j@ I  >  #0㿘 > J"0`? 6 @*"0(`   ؀` ``   ``" X@ X`  4& H  & Xr0  \ ՞@㿘 X " "11>   80 @* !" >  $ J `2$  `2  `  3>  ִ`? ` Փ#㿘 `A Ā`+`"" \ l  \ < l`c€`G  \ l`. `2$ z " lj  l` `$  $ $ a &   ĝ㿘!> n ` > n `` ` `$ > > >  ` @A!㿘#> n``!> n$  > $ $ "> > a͔ $`> > >  ` X !㿘` > Jbt&`|&`0 `Z?> n`&`l`> ``l` ` `l&`p  &`t&`&`?&`x@a`Ȁ Z > J`l@"X> J&`"Xbh&`&`&` &`bh&` &` &``> n`H> n`<> Ő `\``> Լ"> Թ Ѐ  @ @ 1>    > Ԧ"p`> n  go $&`l"`l ``ԑ > T p> > >  ` Ք!> > >  ` @Ռ!㿘Ho%4 (@f  Ā`"  \ "  l"` ` Hp@h Hp@  㿘 ``" @9 `2e&  |`"  X> n@2>  X 5> c `1> cHoeH(@ Ԃ` &  `$  8$ 䲐  `2U$  `2< > 'bА* *> @  @> Hp@> ca `A> ]`L> `Ll`0   @ 0  2   x f ~  | `& > 'bА* *> @ ǔ >  !0c `"> ' Ґ > >  ` Ծ":&T&U&U<&U\&T@ ` -(`0``= @(`0`* (`0``o0 <8>@> a(@`20㿘`.`> 6 6 6 65666666666 6666 6 6 6㿘566666   <8@"` ``4@`` (@@ (`(`0``o( (0`@ 2 o@2   =(`0``o ) 0 @?=c @"60< 2`6`  `(`@ <8` @(`0``o @ 2``4@H> Ӄ"(B 㿘@`. @g' . &.  ez &@`  @50@@`0@@0`@0@@0`  p ֔  Ѐ l@2g @` 4` `> _+` @  ` -  <8@ (`*:(`0``o((0`@ o@ ?<@ #<?!8ca aa;=@  +`@@Z(`0``oh(0` "> ݐ" ` > ֐"P  =(`0``o ) 0@@"7@0@2@0@.+`@ :8 ` (`0``o( @@2`4&@**]  +`@ @8? @**0@   +`@  Ά 0`> z"   0ߝ㿘!> J"`> JTb> Jb     .`.` @*@ 0*0``.... . .  @&#@`&/`/` @@ ``(`(`  030`??ň `(`(`  030` $"  =0@8`(( @@ @ `"`0@8`=a `"`@  `"*  㿘 l& X pc& & & & 㿘 `"  |@} b}@"& X@(2b|b~@9 `v@2. l X     @@ @   b}@ X "  @ & `v@ 뀊@"  X l` p?"ې 0ِ Ԑ  `" 4Ɛ@  X` @㿘 l& X p@   > K`ᜃ* `````X` > ch > Ka? 2 * `X @ 㿘 `& Q `& > Ka ? 2 * > `㿘`> A" 㿘> Ka ?6 .  `   X 2 > (" `$  `$  㿘> Ka ?6 . `` X`  l& X` p ``"  ` @H@'  > #0㿘` &`l> K&`pa&`0 1> @.@   > ѐ"1> Α > ː"p1> ȑ 㿘 > K!`? 6 @*!(`   ` ``   ``" X@ X`  4E& H| & X-0 㿘 \@@@ X`` `_& t |@& | @&  @&  @& `` .` x@Ӡ @" `>`0@` @@Ă $  7 ` `  &   Դ ``>`0@` @@ $  7$ ` &  "  @`>`0@` @@ $  7$` &  "  @" t`>`0@` @@f $  7$` &   t/ `>`0@` @@ O>`0@` @@F ?$  (@ @@ 7b$` `  2`  `>`0@` @@! $  7H$ ` `  `<0` @@  $ $72  & x$`7```2s$```2R` |`" `>`0@` @@   | 7 $ ` `  & |  0 @D`>`0@` @@ǂ $  6$` `  & 0  `C`>`0@` @@ $  6$ `6 & .  ` `"A t`>`0@` @@ $  6$ ` `  & * ʐ`1> !"`  &  `  &  `  `  &  > > >  c8!㿘 ``" X@ X 5> c `1> cHoeH(@ ` &  `$  8$ ~  `2<$  `2? > 'bА* *> @ єH C> Hp@> ca `<> ]`L> `L`0   @ 0  2   rl f H `> '  ` > 'bА* *> @ H >  ͋#P0א 㿘`8 p& \ p@/>  c  |- t d@!` `@ 0`` `2`\@ 2 d 0`    d@ ` ʢ ` \` ` @㿘 c@"+ p p$?>  c* d `@ 0``@  d @? & |㿘 ``"6 `\`" X 0``@  d`p h h h"&`p `d& `?& d& h`" d 0@ d`p h&`t h d&`p?& `& d& h1> Α#㿘   ```> Ð#  p&``&`d t&`h p"& p t `d \`& t`0`` @  2 X`0` #  |c   x`2`0  X` `0` `d&```h h`h"& p `d?&`d&`hc`  x  ߐ `h& t`d㿘 p p> `e d `@ 0@$ X d2 `㿘& X 㿘 p p& X> > `0P> d X` `@ 0 d2 X 0` d㿘 X`>   p ``>   ° 㿘  ^Ք    p" t" p  > ֘> K& a& x& 0㿘> Ka? 6 . `X >  ސ 㿘> Ka? 6 . `X >  Ȑ |㿘> Ka ?6 .  X FI& X 㿘'> K@ 1> K!-  & !,  ^j  **(@ @`$􀤠&!_ !> s! > > Ka$p!> K>  i ؁㿘    `` X``    ```z㿘 b@Pa@ b e `v@"O`X@`  |@"`X} c@2`X$`|`X`2`p`\`H`p`p%>  a   d  `@ 0`   d   c@"  c`@ `v@`X"   @@ c@  cb@"`p8C ca@2`X``` &`p߰ ڰ  0@2 d 2 d ɰ  `4@ @B~@2m`X0c`@0Acc@2d`X`p`p  "& 0 @     d`& `X wHo%(@ `9 0` @@" Hp@ `X"q @  f0$`x ғ  +`# `` ` 3 `  & ڽ `2&  `2 Hp@   `}_ 0> Ka ? 2 * > a㿘? 6 J  `` ```"`X`X`  `4쉐$`H$`|   > Ka㿘 > KL@`> Kaa 0    2a&&d&&&H&&&,&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&D& &&@& & &X& &&&,&& & &h& & & & & & & & & & & & & & & & & & & & & &X& & & & & & &|& & &&<&L&l&&&&x&&&&|&|&|&|&|&|&|&|&|&|&|&|&|&`" "`$" `" `" (" $" ," 0" "  0 " L" H" 4 " T" X" \" D㿘7>=Ȕߚ $`Ȱ`    P 2& P & & `ڐ`    P G , @``A> "$ $ * - $ ,    ` @``  $ ဠ 2 $ 22ޔ  㿘 `` `  +   ` ` ?     ` ` ?     `" ? 2   ``2` ? 㿐``3((` > & , @` ((`88@`8"  @8 & (  ( @   `΂&  `&  `"&   `&  @` ,(`88@`8`" @8  & , @`(`88@`8"  $ ,#    `&  `&  ` $`  ( L"   @`n(`88@`8"   ("    `&  `&  ` ` L S     2D & \& H& L& T<& X    @`  (`88@`8  & D&  @`(`88@`8"   ("   `2&  `&  `8 `  L@ "@ ,  @  (88@`8`"  @8& ((88@`<`"  $@8 & , @`(`88@`8"  $ ,#    `‚&  `&  `߂ ` ( L   @` ((`88@`8`" @8  & ( @`l ,(`88@`8"  $ @8 p& ,l  @ T  X \> cК ? 8/8 `(    `@  `؀@  `‣@  ``@ ܈ ``@ Ո ``@ Έ  , $`  ( L"  U  & D X  ? n   T  ` L` ,  `  (# `  `  (#  8  `"  z  `"   0& T& L& H& X  & \}(`0``o *` <0`8 @"?c @@`(`0`` > ah(? 0 "> n(` `"(`0``  > ah(? 0 "o(`0`` > ah(? 0 "v(`0`` (1 > ? ؂@@`1 " 1 <➀> M㄂♀E> ⛂▀:> "◂╀>  P㉀>  a؁"V> J> ✀@❀>  aȁ"1☀>  b"> ق㈂ㅀ ㆀ>  b">  a"> ㇂぀> も⟀>  b">  a">  aЁ">  a"ダ> a㿘``` ,@  (  ` L  & (& , @   㿘`2  `3&  & (` & @  `"&   (` &  & (`!&  `&  ` `  L"@ " 0 ` L   " 0 `" " 0㿘 `"&   , $`& ,&    ( @`& (& , `  (  , H@` "  P D "& , ,& , ("@ ,>=bȀ">`p 㿘``0`9 @ `& @ & @ "%& 4& @`; @` < 8ޔ  & <& @(`@`8 ((Є `82 @ @ `& @ ``[ " 4" @" 8" <" 4㿘``((` > `d  & 4)   , & , , $  @   @8`ܐ  `7` C ( P@  , `& ,& Đ  ( @`1 & ( (` & ( `&  & ,`& (&  & , &  `  L " 0> ؐ"  L D㿘  >=b``&  d V   \{& `> > >  bXķ 㿘"  ``>  `"b` `& &  "*` 4`" " &   ( @`"i D& & @`5K 4`"SM` 2, b`` `֤`2&   ܐ& & 8 2H  (& & & (& & @`р "ڴ  & &  @ ( ,  \  " > "ː `"& Ր"& &  &  @ ( ,  "&  & &       2> c@ 2`` `2`(* @@ #   ?@? @ @@#㿘 `$> <8`E8 X 2@. @,??)@                 2 ?@?ۖ ?   ?@? @㿘 (`2  & `& $@`  П@  (`& (@  (& ("" h (` " h ?< l ((@(@@" h 2``"2` " `#㿘 @6<@8h  <`$88~ Xz  H`%.,   @ ` ` ` ` ` ` ``  @   @` @    (`"   \ 88`Θ 㿘 T $> : X  $ `4$@`@8` + ,    8,` 81   8  @  8) 81ؠ   ?8   㿘 Tܐ Xؐ  7  <$  h`S> h    ! &8 `8+*` 뀡  , `0@` #@#`#`#` #`#`#`#`?` ` @ #@?``@ (@`20@Ϡ@`>  0    (٠㿘 `$ T X A=94    㿘   ` @&   "@@6 & & @"   > I#㿘H` ` `> "  (`  \&   ` & 4`$ߐ & 8& 4  8@4& 8 4ђ "` ?ʒ ? `& 4` @뽐& D 8@`$ 4& @ <: & L& <& $$& & H` 2 & T`$& X`$`(& P @;& \& d W& `> > `& & > > ct& & > > bl$& & > > b<& & Ȁf&  (`c> >  b& ̀b& Āc (}& (Hp@? _ 8  <  @: 8`$<  ?@R&  $& @ꠐ & d@삐@ꙑ*  & ` \  m" 8 $   <  @$@0\  84 < $   \ I"> >  cH& ̀& @` (@ (b& (Hp@   (  ( W& (6#㿘 `@ c   @5     @  #& А ?   @     @ 4ߐ> 5#?> 0 ?  ``> b`" ` > b,> " > " c" Ё> b" > `x" 㿘 `  X  <  ? O`$O l l@P M` P&l`8`( G,> `X(@8`?    (`((@ @@ @80@@@# <  ^ @ (`%@ @ @  h h@ ?  ,(> > cP@88 `S @?"    (`(( @ 8(0 @ ""  -@ (% @-@ @      (`((@ @@ @0@@@# ?є    (`(( @ (0 @ "" ?a@  @ R?@@   @ !! `@u㿘 To Xk  `$0 0 l l1` .`` PS&`8 4`(` 8(>  (`$(@  h hՀ ` (@@`݆ ( Ф㿘 T X  `$3 3 l l4` 1`` P~&`8 7`(`  8( 8( ~Ӓ  (`$0@  h hҀ ` 0@@~`݈  ( ( ~Τ㿘 ` 7 ~~ X~ > < h` `$) > @X(` 8  @ "   ) > c@(> cP@$>(, , ??뀢   @"  ! `@ @ @#@܅8`㿘  $ ~1  X~, $ <` `` > (> `X(  @  @ " cԛ(@@ > (P88???  @" ?@?# ` ` }}}ݐ X}ِ`$@ M,``H >> > > ?Ԉ cP!> ,`X@  (`!,`,  8@`   (@@t` *@"   @:@@ " ֆ > # - >  P @$ `8< m#ԃ>' >@'/ ,`@(`?'*- ''+`''زɀ     @   8@ ` (@ @ ?@`"# 8@ `   @   (@>  @## 6#  `   @#ԃ; ;`/  '?` (`.@- (` (''Ķ@''Р" 'ȲU   ` 8@    (@@`>  $`$@? ` ` 8@ $   (@ ??@@"6@` 8@`  ̂ @ (@@̀},> Ԉ +@@ Ȇ  > `Ԅ  > P ;@@ !@ 8@   @  (@@쀠)` +@@"> `#Ԟ   > cP@;@@ #  *@@+" >  X  ( "> X  (#+@ @(" >  X  +@@)@ @> `X@ (5$@`  ` ` ` `> aL" > c" > b" > a" 㿐 T{Ґ X{ΐ7  `<7 @<`hh `$` // 0` P{&`8`(`    &   `  `  (`$@(@`@2(@ (耤` (`(`@) @@0()?  ʐ 㿘6`6``<<@`kk> n> n ` ./ ./ ./ ( @'@ 㿘+> n`%``%`^> n`"`T`T{'`X{#`` +$( 8`P{%> n`  0``<@ $(``<@ $ `" %``> n(`$ @ `%`  > n $$ `瀌㿘+> n`%``%`> n`"`T``Tzʐ`XzƐ`` 1$( 8`Pz%> n`  0``<@ $(``<@ $ 0``<@ $ `" %``> n(`$ @ ` `%`  > n $$ $ `倌㿘+> n`%``%`> n`"`T`Tzf`Xzb`` 7$( 8"`PzS$> n` `0``<@@$(``<@$ 0``<@$ (``<@$ ` " %``> n(`$ @ ` ` `%`     > n  !#@$」 > n`> Kb   > n` `#`> n`2"@2 `2 `> K?(`(`   :`@  @+`  `  `` ` @ ((㿘Hoo> n`  0-`$ ` &2 ` ` 2` `(2`  2Hp@ Hp@?㿘Hoo> n`     $ ( 2 Hp@㿘H`J?   ` 2 (`0`Hp@> u X㿘H`*? +1` ,@.` `] ( $y 8y  > `x. 2`$ ,``$ 0`` `4` &@(`0`Hp@"`  0@` `$ ("$ 0  $x 8 ݘ `$  ) (   (ǘHp@?Hp@㿘H`  $ (   I > K2 2 b)> n2   b"" ` " 2 % Hp@ Hp@?  I͐ < <u$ $xw (xu  I $ 8 8`8u4@ 0`(`2`(@ @( (`"@? ?"`(`"`(`"`(`"`  "@? "`  "` 0\*@ *@ (`(`> c㿘@*`! @%!  ` tʐ@   `tÐ@ `@`@(@ @t    㿘@,`! @'#  ` t@    `t@ `@`@(@ @ t    > b9   @  `  @8` 4 > ' @ ?> 'a!h!p!d@ `@!d(`@ `@!x@(`!"!x0(  !|@ "|#| !x(` @!x( !x(` ` `   (a|(c|(b|> b$ 㿘@ `! @(` t !` t  `bt㿘@ `! @(` s ` !s `"s㿘cA@<@ B@C@ cE@ ?D@_@@@2? $&  8`"&!|  8` !|  \!0 < "@ 4 "@ 0"` 8"` 8``?("` 㿘> N@da> V!x0>>a@&ad4&ah8&al`?> @ca: > >!p@ca0 @xB&$|> @c֒a @w &!x> @c˒aȔ$& 8> @cŒaؔ#& 0> @ca 8 0& 4v@?v: 2 : v& <& @> !$|& X3& p> 7b`?3> Zݓa㿘> ǒb`?cA@@  cE@?D@ _@@@ "  < " 4 "0"8" "`@`0> b9   @  `  @8` 4 > ' @ ?> 'a!l!x!h@ `@!h(`@ `@> 'a  !t`"( LH` d (d(Hp@ ``(Hp@ ``ˆ@`¨@ˆ@¨@@㿘> ;"P%> '` 0`  L`   @v &!d &!x```e` `!>>> E L`W(`H@S`?F`N@`> "(`> E>>@`?0 &!h4 &!l8&!ph&!t# p$ 0 4> ސ"0> !xb @ @v*& X& p `?3> Z»aP> N@ba`2N@Dz `` L` > &!x   @vxK&`P?"&`P`L`&`L`2rl L㿘`z` ` rY ? `"> '` a􀠠    > b 9   @` @(( @@(@8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@㼘`!p @> !tb *///?(((2( !@ >  @b!t  ̔* (((`a !' 㿘cA@ @  E@L@" ?@@ D@   "&  4& 0 &&&  㿘`L` &`L 0 @u> '& Pa􀠠  > Ec` H`` `?  ?@u&!p0&!d4 &!h8 v&!l!p   s      $/# @& p!> !  @  *@ug @&!t @  *@u^ & XI 4 0> "@`"3> Z?3> Zma㿘`W`  > 'a􀠠`"  q1 ?  E`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@㿐!p !t r#\㿘cA@"4 4 B@7C@ cE@ ?D@ _@@@? !& !tR !p  0 < & & 0!& 8& &!tg㿘> ِ"X`L0` &`L @t > '&`Pa  > Ec` H`` `?0&!d4 &!h8 z&!l!p   ?   $3#>  @b *@tm 4 0& X& p>  ؐВ> Ԓa`?3> Zza㿘`d`  > 'a􀠠`"  p> ?  @`?㿘> b9 @?`% @@? ?rӐ :  > 'a􀠠!h!d`@怢> 'a!d(``@%@ `@%x(%x(@(%t  %x"%p"%t(%p@8@ "%p @ "%t%x( @ "%t@"%p%*`@ h ap @% @ `*`@(as(ar(aq(ap> b 㿘%x " (``   `%x``` `(%x`(%p%t 㿘@,`! @' # , ` nؐ@   `nѐ@ `,@`@(` @n’     㿘@+`! @&"  ` n@    `n@ `@`@(` @ n     㿘 8@`"% X @ %`%x p(%!(h% @& 8&%t`%x @(> vb& 8&%t q(% A(> 㿘 8`ʒ > H> Ha` 㿘cA@"V 4 cL@"$,cE B@YC@"0%?D@" @\@1_@?%`I < (` &`H%`A  @?0܀@ڲ?  &` !p 0%`‚ @ & & 0&%@?` &%`?(`& %`2ʲ !p! &M 0 I 0㿘> "h8?c  $1> !4`"  1> "1> 3@"x> N@^;aJ`2v>>@ 8@ `? @r> 0"0&%| &%&%&%x&%&%<&%&% 2&%  D :`> O" <&!d @&!h D &!l$ϖ# @ D(``?&%&%  @r < 0 4& X> 0 > c%  &%@o&%& 8ϒ % ) @  p!  N& p> Rb􀦠2 3> Zb@ "> "(>>? > 7> d"X3> Z㿘`` ` @> '4@> 'a􀠠" ``?!x?? h!`   !t`@ c !p @ @> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d @ `@!d(` @ `@H`!x`hd{{!x hHp@!| @ ? @@! 㿘 Va|`&Z @@P&Q@4  E `$oΒoʐoƐ$$$$$$ ($ *`3$`$ `$ d@$ 4 `$ d@@$ `$ d$ 4 `$ d@@$@@@    㿘 ga|`d @@`&` D@4 &Z@4  O ` odo`o\`$oX% % % % % %   (%  *`3% `%! `%  d%  `@@%   d$%  `%  d%  `@@%   d$@%  @@ @   㿐 `Ta| @@PP D@ F  n $n Ƞ@ $$$$$$ $ *`?c$$(`@`h$ d$ `$  d$@$n `?($@@@  D @ 㿐 `Ya| @@4 B Ȕ@ $`$`$`$`$`$` $` *`?$`c$a(h$a @"' ( n`$ d$i `$i  d`$nw?$i 4 `@$i(`@@`@ `" $i$i $i $i( 㿘   $ nKa| nG $$$$$$$  ($ *`$aU$ d@$ `$  d$@@$  ` @$@@@ 㿘!x 0`0?c߂` !p! !  㿐!p ! #\㿘cA@3@ B@6C@ cE@ ?D@ _@@@? & ! !x(` 0 < & 4 & 0!& 8& &!㿘> '"h0&ad40&!h8 &!l @n &!p  @n &!t *@nސ &!x@nؐ &!|@nҖ &!`g`2 L> N@ZaL`2e> 'a􀠠2Q>> L> E` @? H`?!t @> `D &$$@l&$<   ;  $O#>  @b  *@n 4 0& X& p> #> `  > `"3> ZÒ?3> Zb@`? L> ` & LL` > "(> 'a> &!> a&!&!> > Pc\&! &!$Ӏ`㿘``V $``  > 'a􀠠 > a0?@@n)  j$?"  ``?> .c " > b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d @ `@!d(` @ `@H`` !p``(Hp@(!p(Hp@㿘!p(`` (``!t`(!p !  㿐!p!t#\ 㿘cA@2@ B@5C@ cE@ ?D@ _@@@? & !t !p(0 < & 4 & 0!& 8& &!t㿘``i 2``?>  \#0 "㿘> l"h3> Kc0 {c0J` >>@0@`? @m$ Q&!p0 &!d4&!h8$x&!l> b̔ &$x@k&$| & !p   s     $#>  @b  *@l 4 0& X& p> "0X> \c4`3?3> Zb@0@`? @lӖ &!p!p `` 20> Z c0 ``p@)   20> N@Xa >>J` > ې"(}>>) )  @@ @ ` (`   `` +`x0> b9   @ ?` @(`8` !> 'a@? !h!d @`@〠@ !!d(` @`@㿘 8@d`e!!t@?yn \!t X!p  p!p? T!p X!!|%?@?' #!!t@?yn \!t  X!p p!p T!p X!!|@?  !!t@?{j! \!t % X!p? p!pc T!p X!!?@? !x !x a!x) )  c !2!x& 8!t@?yn \!t X!p  p!p? T!p X!!|?@? !!t@?yn \!t  X!p p!p? T!p ! X!xc !x  a!x !x  c!2!x& 8㿘 8`R > H> Ha` 㿘cA@;@ cL@"8!cE@?D@@\@_@ <(`& `   `@`0@ނ &&  @&  4& 0 &&&   㿘> N@WKa> O А> @WCc@J`'> }0>>a@&!d4@&!h8&!l`?0! ! @k;"&!p !@k5#&!t $@k/&!x$#  4 0 < & 82 : i& <%> & @`?&!a`  ??8 @?  @k*!&!|  0  @j* &!& 8!|& p& XX2 0 4 > #P> @V͒c`J`> #p3> ZcX ? > 7> ]"X 0> #Hr'> 㿘```?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@H`` !p`0Hp@0Hp@㿘!p` iu !p`.`0!x0!xb1!x 1!p`0㼐> @c<' ``!x! @* `  F> e ` e `e "p0i) p`,`0  0 0 0p`00z#㼐> @c<' ``O!x! @*!p6 h !p`,`0 @ ( @( @(!p`0e` " `  e `d0 > za#cA@*@ B@C@ cE@?D@ _@ @@ " > `  < "> b,  4" 0!"8 " "㿘> 'a  > Ec` H```?00&!d4 &!h8 $&!l  &!d@i9 &!p ( @i3&&!t  @@i-!t?&!x0    $ۖ#>  @b *@i!d 4 0& X& p> >#x> |`(`S?3> Z"c㿘` `  > 'a􀠠` > a?@ @h0dޒ 8@ ` @`@* 2 `*@"@> b9   @  `  @8` 4 > ' @ ?> 'a􀠠!h!d `@!d(` `@㿘$p#Д $pĒ#ŀ`  ?ߴ $pœ#㿘$p#`.@ .`!p@@$p#ɴ`*` (p (q> c(p㿘 c$t! 2?㿘 c$t? $t~!!   㿘`$@Ր ߒ   8`/` `6< `&$x 0d":$x&eb"1$xc $x@&$x> Âb0$t&!> > Ą4`(&!&! > > Ą,bx&!&!$ 0A $t G= 0&$x"$xf@"$xd@$x@&$x&$x@@&$x@&$x@&$x@&$x㿘   ff `$xf`$ d@@ i$t F $t @fr$t,  P$t@ T $t`$ X*@ ; 㿘 `$ fUfQ dxfK`? *t F t @ `t. P `t,  T 4t X-  㿐  Ȗ $x@ (`@`h'` f  ``$f d $t F{ $t{ `$t @u $t,` Tp@e $t$ X(`e 㿐  Ȗ dx@ (`@`h'dt FF dtF `dt @@  @@ `$e d `dt(` T0@ edt 4*  X &~  (`" dt T   dt X*j 㿘  $e  d  $e$x ` f$t F 3$t @ $t P,`@$t T $t` `$ X*8 㿘@*`! @@%`! ( @@` a   ` a   ` a    㿘@,`! @'# ( @@` aʒ@    ` a@ `@ ` a@     㿘cA@"2 4 B@5C@ cE@ ?D@ _@@@? '& !pw 0 < & & 0!& 8& &!p㿘> N@Qa> O' >>a@  1> ##> a  @e` &$p$@el!&$t* `$62&$t  / $#>  @Qc  @ &= a&!d&!h&!l `?  * @e!d 4 0& X& p> ؐ ؐ #惐!p> c6`$>   HÔB3> Zc?3> Zc 1>  㿘> `h捰  > 懒`x`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠!h!d `@!d(` `@$x (@@ $x*`@ @ax`(ay$x@ ) az$x(2$x*`@ @(ax(az(ay> Ɓ` 㿘!t `  ֔!!t !t  !p 0c@2?㿘 :> !p> ǂbĄ&!&!> > ǂaPP&! &!> ǂc&!$ &$ !p !p b!p !p  4 0!po(`@ $!p&$ !p a!p  4 0!po(`@ 㿘 ` cq?cm `ch`$cd d !p3`$$ !p@@$$ o(`@ #@ !p$X o@,`o@!!p@$$ (`@ #@ !p$ؤ ,@o!!p d$$㿘 `$c?c d cOp3`$ p @@ $ ` /o(`#@ 4 `p@ X /o(` p @ $ ` oo(`#@  4 `p@o(` ب / p `$㿐   @  'bƒ ` $b dap?c$d ap ap$d / /(`@  ap$b / /, %@ap `$d㿐   @ǐp?c% p  p#% @@% %`$br d ` o(@$ ` 4pbd@ / o, @%p `% (`" #$  po(`@ p `~%㿘  `$b9 d`  $ b3 `mpa$  hp  bp##$ o(`@  p$ @ o,`@#@p `H$㿘H`!t`&$8` !t a8@OHp@㿘 cE@R ( C@R&cL0Y@UZ@"/?cD@: (c@c_@6cA@? 4 & 0!& 8& &@B@?!x鸓@ې? ( &`:`2ѐ?@7 ͐ `  `  < &e!x  !t`&$ ` 0``2? &@&&   &@& &  @  㿘> ~"`h> [`" $x@`"$x`0&dx$x`l `&!dd &!hh0&!l@b8&!tD  @b<>>&!pa@`? "=!>  @b  *@bw!d!t& X& p 0&$ 4> ` !t  &$ > ƂaD &$$@`Z&$ǒ> ˒a `  2 3> [m`H1>  s ?3> [c`H8  "3> [1> ` 㿘>  > 耢 >>@@`?㿘80 @b &`0*`0 (`01> = 㿘> !`?> b 9   @ $Ѐ``# ?` ?!l8` 42> ' ,@ ?@?C & ?!x8` 4!p +@ ??@C ߄  !!|> 'a􀠠  `@π@ !|?> 'a!d (` `@؄?!p!*`"$ !*`! "$!"$*@ @""$(`!"! !"$!"$*`@ @(a(a(a> Ɂc0 ! `(`"$ !2` `"$*`"$ !"$"$2 ! `(`"$ !2` `"$*`"$ !*"$"$ !!"$!"$㿘! `  !! !  ! 0c@2?㿘 H> !> ʂbd&!&!> > ˂`&! &!> ˂c&!$ &$ ! ! b!? !  4 0!o(`@ $!&$  4 0!o(`@ !&$ ! a!  4 0!o(`@ 㿘 ` _?_ `_`$_| d ! $$ ! @@ $$ o(`@ #@ !$ X o@,`o@ ! @ $$ (`@ #@ !$ ؤ ,@o ! W$$㿘 `$_8?_4 d _.B $  /@@ $ `o(`#@  4 `@ / Xo(`  @ $ ` oo(`#@  4 `@o(` ب /  `$㿐   @ (`@`h' )^ے ` $^֐ d "$!"(((@@@#b##$ /(`@  $^ /, %@ `$㿐 Ȓ  @(`@`h'ሂ "&!"ህ(((@@@#bሂ#& @@% %`$^x d ` o(@$ ` 4ሐ^j@ / o, @%ሰ `t& (`" #$  ሄo(`@ ሰ `^&㿘  `$^? d`  $ ^9 `M Z"$!" h(((@@@#"cc$ o(`@  $ @ o,`@!  `#$㿘H`` ϐ  ?$Ԃ`&$ԃHp@  ѐ$Ԃ&$ԃHp@㿘ŀdbd >  Gb- G> ?a-  H`!? &$ ! &$&$ !&$&$@ > (> [bP  p`` `m` `" @ @~  `"!`` `j`  `2ݢ`!+&$ !!!&$!!8!  @]!2ᄂ`}&$ ]Đ+!> b&$!!  !#ᄒ s&$ !  &$!  s -$耠@3 $Ԃ@&$$Ԑ1 `Hp@ `s2 @`c` ` `    >  #bl-P #=$6 9b$Ԑ `@e&$$>  Ga-<< G>  #bD-6 #㿘$Ԁ`$Ѐ`2$ > c 㿘H`!`&$8` ! a8$Ԁ@*Hp@㾰> nc> <@' ` ` @ S> (#\ Ȑ>  ($ ''$' '@K $`` ҄ @80`@8`ʀ !> [!$ $ $@$ (a$ 8㽒    > ⼐! h& l 6  $& l0n~!㿘 cE@S ( C@f-cL0Y@RZ@"6?cD@; (%c@c_@7cA@?$Ԁ`"a$$ؐ &$&$&$``?(& @@B@ڐ?!!@Ԑ?  &`\`2ʐ?@ Ɛ C` $Ԁ`"9 <$$[2 & `J`2? &@&&  !  !`&$ ` 0`&$$Ԁ`2"$> c  &$ &&!&  & $Ԁ`$$w ۔ ސ$Ԁ`" @  j &&$Ԁ`& a @ & [ 㿘> ~"쀦1>    `0&dԐad $Yp&d4 @\ϔ &a@  @\ɐ`<a&a >>a@&d@ `? # u"X`0`4&d耦d&d$$ &$&$܀ h&$$Ԃ`&$> L @( &!@\D$$& X & p> Đ ! &$ > ʂ`&$&$$ @Z ""m> @b |> cJ < ? > 7> ͐"XO3> [`> @E |ʒ > Βc-  3> [u`# $$`0 &$&$܀ &$ 82$> 㿘> N!`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@` $@ @$@` @@` @$@ @$(@$:`("!# @ @ $ (` @$`(` @$`(` 2  (a(c(b> ρb 㿘 ` @[Ɛ!d?c?c?? ```+ @@ `$ @   2`+` @ @ (0`3`+` @ @ (0``3`چ @@ 8݀$0)؀㼐> @c<' ``! @( `  '> Vǒ ` V `V WW@ @ W0l"㿘@ `! @(` V ` !V `"V㿘cA@"2 4 B@5C@ cE@ ?D@ _@@@? )& !{ 0 < & & 0!& 8& &!㿀J@, @2`(```> O `2`> "J@, @(`>>@#> `?@F c n> # ($'7#''0  @Z &d @Z&d0&ad4&ah8&al &`8&`0&`4Y>&`<&`@>  `@> b  *@Z}&`p&`X #aQ > b ^ > [ahʒ# ;a> ʒb? E > [nahc@E > n#H0㿘(`8`, `(`8`,`22>  cXۗ > /ch@ H`!`h(! hHp@> b9   @ ` 8` @(`8` 4 > ' @ ?> 'a ) )  ahad `@8` 4> ' 造@ > 'a ) )  ahad(` `@`.c! ƠD`$̀`  @$Єa @ ?* (` ظ`  @ƠƠ0 $Є $̈ (@  ?(  ĺD) @㿘 `$XXX @#?  d`0 `W@W$& 4``0  ޢ@㿘 &*d   WӒ $ d  ``0WɐWƐWW`0? @㿘/  0$ȸ+ W&@?* 0@?(@ ĺ&@!?  @@퀡   ĺ&@!㿐 Ȓ @  / @`k'` W`W\ ``$` dWS   㿐 Ȑ @  @,`@`k!' `$W.W* d 4 ` r    (`"     㿘  $` W  ``$  dV`  K  2  㿈  @ ((`@k`k'' VԒ `$Vΐ d l @ ? P&@0@8^V&V( (@@ * @  .   @    @   8@  `" +) ĺ*  @غ%`(8@1  @غ2 ĺ)!  @ظD* ĸD߸   0  ?  쀠` 㿘$Ȁ`> $̀` > !&$Ԅ4> &!a &!> ҂c&!&! `> @Bc " h> ӂ`|&!$ h` 8$> ӂ`&!㿘`>  @C6c !&$Ђ &$Ђ !&$Ѐ` ``(`(`  @8(`&`4&$`>  @Cc "!  (@&$`>  @C c ! @` ``(`(` 8(@4&$ȁ㿘!   ?ς  !|! !\ !  h㿐!| ! ~#\㿘!??c !| @  8" & 8!`` > & 8/`2& 8> ԐQa& 8㿘 8`Ւ > H> Ha` 㿘cA@U@ cL@"#+cE B@TC@"/!?D@ @\@/_@?!`D <  &`F!`> @?0݀@ې? # &`  ! !` 0!`Ă @ & 4 & 0& 8&!`?(`& !`2ΐ ! (`&[ Ð W  㿘> |"h>> a@1> "p > N@B+aJ`r0 &!d4 &!h8 &!l<&!p@&!tD@V'&!x&!|@ `?** @V&! $і#>  @b  *@V 0> &!c@Aw 2 !h @(`&!d&!! 4 0@`  `?> #  Ғ !& XK& p> OaH> Ԃa`&$&$$ @S˖ ` 3> [a> "(0? > 7> Ԑ"XxHۖ3> [ړa㿘> ĒcЀ`?> b9   @ `  @(`8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@1``=`!x `5`!x `!x d dd @ @ @!x ` 2` ` ` > > uc`\ݞ@㿘cA@;@ cL@"8!cE@?D@@\@_@ <(`& ` ˒  `@`0@ނ %&  @&  4& 0 &&&   㿘> N@@a> O" А> @@ݒcJ``?4@ &4&8>>a@ @`?$Ф0@T֐> &!x`@@J`F`g$#$& < & 4& 8St& 0& @>  0 @&!d4!> &!h8!&!l  ( @T @&!p  *@T* &!t !p& X& p> `\"3> [ߒ?3> [a$$π` (> ``@> t> @@L`(> @@F`0d$>  ~$$㿘> `8p  > j`H`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠!h!d `@!d(` `@%x`*`!xt @  t$%x` *`(a{(ay(az(ax> ׁa0 (ay(a{(az(ax> ׁa0 `"!p!p `  㿘!p``  ! 㿘@`?`! @:   `O* .,`` , O       `O ,`` , O      ۠ ` *`  N` ",㿘@`A`! @<   `N֒ 2 `  , NȐ       `N  `  , N      `  *  N   㿘cA@0@ B@3C@ cE@ ?D@ _@@@?& %x)!x  !p 0 < & 4 & 0!& 8& &%x h!x㿘> ~"1> `  > N@>’aJ`> O >>@@ `?> 7`&%xP  @RH&!pD  @R<&!tT &!dX&!h\%&!l> ׂb  &%@P&%   $V#>  @b  *@RT 4 0& X& p>  ؐ> a3> [bD?3> [bD㿘> Ӄ >  { Ȁ > u Ѐ`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d @ `@!d(` @ `@ *cp*ap*bp$t` ` 㿐   dxdp  PÒ ` $ dPP?P?@@\( $(`@`h. ($ '`@ @'` 㿘  ` dx `dpP`$ dPPPP?P}\? @@ `P%n( &`. @&`,` &`@ 㿐 $ `P#\    㿐 `P#\ s 㿈 @@  D `P #\ a  (`" D  dxdp @ `P&(h(`&   ( &  & 㿐 D#\  e 㿐 #\X 㿀  @((`@h`h''$  Oِ* OՐ , G  PdxdpOɐ&8(@@ `P$.($. (`$.$ ? (@&  $   (`   + 쀠`??$  (`   +  `P#\  쀠`$(` @ `P$.(`$. ?($.$ (@$ 㿘$t$cO?` ` > ѐ 㿘$t$  #p$!p"p @ (`(@@$    !`$  `$ 㿘$t`$  ``"?$$ `$  $ `@㿘$@ `$x$p $n$n ?c$n?$n 0 4(` @$ $ @$  c$n&$  "   0      0$|?` $n?c$n$n 0 4(`@$n$n ?$n `P$n$n  0 4(` @$  $  $ $ @> !p`@"p#p+ +@`) > YaE&$㿘$` > H> Ha` 㿘cA@7@ cL@"+8cE@?D@@\@ _@ <&  @& `@`0䀦@ 2& @  4& 0 &&&  㿘0&ad40&ah8 &al $@O &dp.@Oz &dxP.@Ot &d| @On &dt @Oh> N&da@;RJ``T> O >>@$@ `?& 8> @;"c8#& 0> @;c@ 0& 4* & <& @> m >  @b *@O4 $$4($$<$H $L 8\ ("$T, : $<  ?@M$$$@$d@> ڄ|: $༃0`> ڂ@8`$$`> > لdc$$> > ڄ,`$Ѐ $ఐA > 7> ے "X`B ? &$  3> [b㿘> a`?#> '00a􀠠3f##0`@* 2 #> 'a􀠠"8 %"`@ % #"`#`2 # %㿘``ϵ   `  J 8@ @ 㿘> 'a􀠠"#  8 \@##8?@! # `#`8 1!" Mt㿘 > R`ao> |c8j> |be4 1> Qw x`?`?> ~n"0&# &#  @N7 &#`1" > I`` (@D`" (> 'a􀠠#D #D @{֖ ? * >#H 6#@&#$4&#Ā> <&#D@&#H&#L  Da@9˔ 6#@`\8 > .a, " G">݂c>&#&">݂c&#&"&#> > ܄Ăb&# %> '&#> ބ&#``> > ܂c#$&# > > ܔ`܀`I`>#`:  #  % ~   y  D>b&#􀠠"5##  @K&# > .a,Φ  <"5@  "$ 0 % J ] %0ѐ # A T #0Ȃal&#`> ނc8&#I> 'L  "w$ 0u  @{ F? @̀j$ > C!0㿘#?c  #8@ LM#8@?28㿘# b #8@ L6#8@?28㿘#``8@ #(```> ```> 0!́> +!`> 'a􀠠"#`#,`@@㿘#(`  ```> 'a􀠠$#`  > 'a􀠠#`r  > 'a􀠠 #`|  -㿘#8`> [b ځ?`8`  K 2#́  br t@@0@@(0@ th@0h@ t@ (@@(@ t( "`  @  @?@*0@`@20@* " 2"  " ` *` 0`*@  `2 2@ `  *@*@ ݒ`x#h'4 `` #D@ (`` "#D#D@ܔ> X/`<> 'bВ @* Y(`0``Yǐ  > ߁aT 㿘 t d,J?,㿘 t? d4(@J4(@㿘``  `" `$   G 8@ G 8@ 㿐#l l#h$(`0`0`@44"4 ?4  #\,  ,  @,  ., ,  `, , ?, @ , , , ,  k 2> ` >  !Ё  l $(`0`0`@44!4 4 #L @#( J  ` 24 >  !4%4  l#h$(`0`0`@04  , 2#h` #h@ ` >  k" #h @ `#p#l#P@#p#<@13 d !& !,$ !,&    X ? &h+`T@ && `    (@ ct bd  ,`@`ct@ l* #t @(`0`0`@4 4 dh(`@ct  `1 ` &\& `   ) @ h$   bh  ,`@`h$@ l* ($ @(`0`0`@4 4 h  (`@h$p`0dh &x&&t l&&& `% ? b0 + ($ ` 0 h #@' @($( ( (@ a bhbd l#t P#h&H?D&&L! &) 1 1 2 l($#t @(`0`0`@0  l#t#h@ @6 ԃ(`0`0`@1   #h@ ` #H`@0 @ `   2#h @2#h   ?>   H"h#h>  B"#h?>   9"8#h> "㿘Hof (@g  + x 4"0 \Hp@ \c$#\ \A@h Hp@ \`6 \`  xdВ `@ #0b``7$ ``x y ..`"@ @ `F8 `$ ` ].. "@ @ `  b4 Ԓa{   $#XHp@ \ 6 \㿘Ho& (@g > " Ԕ { x6 ' P `+ >   `" " > k# Ԑ`6 3 Hp@Y"㿘  PbhL*@h$@"  `0($0@@ &($0@  &>  >c(㿘 >  4a!@ #&cT> > ߄b<&cD&c@>(> ߄D`$&cL&cH@> a| &cP  &`p@Hh0`p&`t!?'>Br >=  c,`p ] &`l`p#> a  @d0@ `la @2> `pcP@&`h`l>>`&cd&ch@ >> a  8  ?`l&c`a`p&clac( &cp9 T0> G#> > ނbd&c@&cD> > ߂c&cH&cL> @`H0  (H&cP&`p&cT@G&`t4(@`p? * @G"&`h&`lhD a ?4hD(4@4g`pcP`l@c(`p`l|&cp&cd&cl&c`&ch/ "> 0 `D`> > a$$> ?b "$4\$cT> [(b@> א#`"!> `4 8&`4> b(&`0`0 8 > ȣc耢 ` "$ b(&`4&`0`0@Ey 8> m#X> j#`h#p> e#x  D #h/ t(`0``F  bh L x'' @> > [4`8 4    !(+ 0(3 0 *(20 (0(`) 0`1 +`@3`(`*0`2@@ @+` 3`@ @ @>!55  5  $5> [ c4t@0@t`0 H(t d0 `H@  D H&@` D` & @* *h$@`@ ($((`00` @a 0@#L` #\bicSa @    ?'`'` '` '`  ܨ   $ a @: $`Y> $ $$@` W , `#L@% @ @$0@$ `0@f `P&($ P0@U  P& +> n,@h$` !(`(0`0@a @M0 Ä@`#L@@% @ c@@8$  @$ > na )> n a2M ܔp d@ * t(`0``" `\@"B l  ۟( `hp 0@``#L@@@% ([$ ؐ > 4c(!@>!! t > n !($#t @(`0`0`@0 l#t (005  ` #(瀦 `"   ``  `@ڐ ((  `x@2 2 2 2  @ 2   `q 怈 #(5瀦  `" 0 怠@  #(" -!@e>!#)#*#+#,#- 0v#)̀#*ǀ#+€#,#-] #)f#*a#+\#,W#-RC  @  A@ 㿐 \`@c!  p`_>  Xc  t `7 (@"F` $"X%"X(`@@`  ,4 @eA`  @@ (ٯ4 ;((4 (`@@`0`%0`@` @ % (@2(!  p l l6 \`  x X(`@@ `@`(0* 2*s2?(`@@` P0 (`@@` 0 h(`@@` '(`@@`) ) ) (`@@ `0$(`@@ `0(`@@ `0 l(`@@@ ` (000 l(`@@ `#h (001   %5 ҁA4 ;8X( < "S $"X+%"X`u v x X(`@@ `@`(0* 2*r2?(`@@` P0 (`@@` 0 h(`@@` '(`@@`) ) ) (`@@ `0$(`@@ `0(`@@ `0 l(`@@@ ` (000 l(`@@ `#h (001 k  %5 ҁ ` X ` X㿘 xP ԃ(`@@`6 6 (`0` >   ! aa /@ ` 2$cX> `4 ($cX2a 2a 2a"cXaa@`   ` #h@ `&, @0 ` @  P퀌 Y ꀌ C "#h!@L>!#h@ `ޅ,  hDhDhF *+ 2 3 > А XhD, a4hD#h'''''''''''''''''''''t'h'\'P'D'8',' '''''''''''''''''''''''''''''''''''''''''x'l'''`'T'H'<'''''''''''''''''''''0'$'' '''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''|'p'd'X''L'@'''''''''4'Ƹ'$'$'''''Ĩ'Ĩ` @ `?> [ct ? 2  2 *     (@  )   (@  (  \`" " 0"  " " " $" (" " " " ," 㿘@(&@@@0 ((@&@@((`&@.``.`.` ````(`(&`G`>(@&` ``0  `|`(x@&` $6` ` 6` .` ` .`  ( &`` $@( @?`0` .```@>.`  @ @6.`  @`6`  (L*_`>(@&` ``0  `|`(`&` `.` P.` ?ք .` .` > 'a􀠠 >b .`  ``09 `|.` .` .`  .`  .` "6` .` .`.` `(&`o ``0 `|.` Ղ.``.` .`  Ђ6`  Ԃ.` .` .`̂  * > `> t> `> `> b8> b(> b> a> a> a> a> aP> a > `> `> `> `> `> `p> ``> `H> `0> `> `> c> c> c> c> c> c> cx> ch> cP> c@> c(> c> b> b> b> b> bp> bP> b0> b> b> a> a> a> a> a> ap> a`> aH> a0> a> `㿘  `R`#> |c( 0`> `G `"`|`a@ @@@@@@4|Ԑc(2)  `" 1> |ʑ > |ǐ"1> |đ @> @@P> (b` ` ` *> 2|"h|c("  1> > |"x|  `㿘 > [#t`? 6 2@ #t(` > `a|" 㿘 n Ha;" 0a& 0> }="x ؔ ;ܒ  @ ` ` ` ` ` ` ` (@! ``((@#`  h0(` h0( h0)  h(` h =(  h ) @>  `"   h ` `   > |*" h ( @> `>  h`  ; (  ;{ |ѐ#㿘!~` `H@.!~- -  @@@(`@X@D?`@0`@` `(`@`H<@lR  > {ݐ#@!~ ``.!~(a@@ !~`H &X&\ X &  <@$ 80`@8`  $ ($ $ $ ,$ $ $ $ $ 0$ $ $ 0 @  /BYߐ`0 @  耦$> X\ \\ @D?00(`@`lC,!~ &X&\ X &  & > |@#|>#0㿘 hB a!` !`"+ 0=G?  ` `B  4   @Ә 2! ?$ ?  @² .`.` (@`!~` 耠` ( "!~@6"!`8!Ҳ @y !㿘 h .``.` @@(`6P1 !`@(a_!.!` .!0 > {#h P9>  @> ` C @@` @)  h0`( h0`)  h0`( h =(  h ( ! ` .! ʀ0> {#@> ` C @@`㿘`2!0`  ! @UHa_.!.!x P  !`2 h> {J#㿘`!~ h (` @  #y > y   !@.!(a_}.!Ay!`.! @s' Ao!~!~!!!@@@ 2> (>  > y#> y >  y#1 h@ 㿘` ` `"E`?`R``22` `&` @"` ```&` (&0((@& 0.&`!` !.!.!(a_ ˰ `"Ѐ `q ʀ ` ?`@&`! .!`?Ֆ&`!.!```$(`0` ` `( &`$&` ( @&`(` @ Ւ@  @ ؒ@@4?``&` (&0((@& 0``.6`̂@6 `Ҡ?$@ܐ. `@`. !  !.!@㿘 h `@ ` /c  -/ !~!5$``  ``  ` `(z`$ ` [`0R`0 *4 ``"``@, @!.!00` ʪ $` 2`ڦ4 1`0$ @`, H@hF < <` 0 @ 0 @ Vє !~ ``.!~(a@ !~`ߐ ?`@$`!.! ?`@$`!`@ .! 0 d$ 4$ 0`$( $ @( r/a `` `( ?$` $`($`$`~$`- $`$`@%0(@@%`$$`5 `` @ `5 `` `@@- `  8`0@a @- `( % !"!!@.!(a_.!l M  h> x ( ?~ e> w H> x `?0y㿘` ` @`0"!~   m   !~Ha@ .!~, ,  @@(`@@ .@`l  $\ ( ,      0< !~> > `!~!2 ! @ "!~ `  @ "! !~㿈' ) > t`" 8܂``" ց `2u `2q `2m  `2i  6 `a ]( (`2  `2  f `Ho4`Ȃ(@e` #\#`@  ) * *  @@(`. `. !,!`` !~ ``,!~(a@  !~``h`f Hp@@gu`  `%`!`` 0 @gs ``2` 5 "`@gH"Ѱ `2Ͱ @ Հ 2ǰ  `2ð o(` 2 @ Հ < (`2  `3(Y6 4`8 `2 @ Հ 2  `" ?(`>+!~{>'!j !~㿘֒ !~`  耠` i "!~  >>  >`" >>  >`"x   @9"0& &`h> E*`cd@> ~&`|"vE&` ` &`l&`p&`t&`x@fϐ#&` &`  &L&`   , ``+` `@ (a@`@ ` =(``) ` 4`.a~.a.a.a.a.a&`&`#\&` 0#`     O`* SM* `*  (@` > u a.a``!a~```.a~@(a@ a~`#0> uϐ > u̐ a.a``2a~=gaa~```.a~@(a@ a~`=Xa~> u  *` 2`> u!a.a``a~```@.a~(a@, ,  @@(` a~`y#\#`      a.a``qa~`, ,  @@@(` .a~(@! a~`Z`" &`4`> uZ!H> `&`0`0 `" @eܖ 8 ''`'`"#`' OԖ ``'@e" @#I a> Dcd> 'bА(E@`2'` @#4 '<a~#\<ara~<a~`<aa~> uǐ 㿘`` `"   3 ? . @6Ʋ` `  㿘  !"$`(a6b8 $`8> n  ?(`#`@`* > `|@10 6ab > t!p`H`4> @(`6 Е2t!`46 `H6 `0. `,. `86 ҁa6 a6a$`8a @V $`<4`p㿐 `0 7`&`L`"6`6`&`&` ( l`# Ho(@> `Ƣa`ƀ` =` "`ƃHp@`> Ɣ#tP`Ȃ #\#`6`Ɛ    S d!.!``!~ , ,  @@(` .!~(@! !~``Bр`E> t"`#\#`    # !.!``!~ , ,  @@(` .!~(@! !~``".`O> s"  6``ev> :> sؐ! 6`` ;t`ƃHp@#\#`    ΢ { !* @`.!}!~ , ,  @@(` .!~(@! !~`f`Z 6`6`6`6`.`.`Ն ?00~`#\#`     !.!``!~ , ,  @@(` .!~(@! !~`h`"2> s["p :!!~> sQ!z :!~'`B:!~S`:!<!~> s<"He :ܐ!~`:ؐ!!~`#`#\    7 !.!``!~ , ,  @@(` .!~(@! !~`n`c> s"* :!~`:!!~R.`  `И > r"```Ւ4c4a": #\2> : rҐ"`#\#`    ע !.!``!~ , ,  @@(` .!~(@! !~``"`> r#ʂ :A!~`:=!|!~`Ւ4```Ȓ@44 #\#`    #!.!``2!~:!!~ , ,  @@(` .!~(@! !~``:!~`" > rR#H{ ?c c`ԃ(`0`0``Ղ`@`~``~  (`(`0`@ 0 @ "``̀* `~ > r%#h`2  J `1"@ 6 > # : ` 5 3$ 9!~\`9!E!~㿀 > [#t`? 6 4@:#t(``"6 `ƀ` `' @bv" '''`R@bQ"`ƀ`    `. @`  `$`   (@$`$` ` (@$`$` 㿘> [ct`?0` @1 @ct??(`` ` (@@`, @ࠀ?`<  (2     @@;B   p "`Ұ?  "< ɰ?㿘 > [#t` ?0`@3`#t,  { e`g@`f `n@X0`e@ @ e2  r@  `h@5e@  0!   Sb  ƀ`C @Ӆ4`  `, &   ?(c > * b@,  @&  `&  (& Ho$ (@e "0G ؃Hp@  6 Ɲ(> c<' Ho$!_(@e!_!!!~!0" А!@0 Hp@@@`  #\> p#> '''''''7/p#؀> @" p  ?(> p{# $> >  " ?po ? (@$ > pb >  c  `4 `2   @ , @@@`#\02#` 3 pB  `4Ho$4 (@e   `"4``@" 4   ` " 4L` >  p 0 ?  Hp@> 'bА!(@Ē@  > `>  o#0C P㿀> [ Dct`?@0`@0`@6 ct(`` `ƃ(``"S`ȃ0``"$` G`` & 4& 4 0 <d& @& 0Ho$ (@%Hp@e0`K_?Ho>(@` !~` 耠`;   !~`3`& X X& \ @ Hp@ ' @`" '''`@_"`ƃ(``0` & 4e`Z0'''t''''''t't''t't'x'l't't't'`'T'H'<'0'$'' ''''t'''''t't't''t't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't'''$'''''''''''''''''''$''''' '''''''$'' ''''` @ `?> [cĄ ? 2  2 *     (@  )   (@  (  \`" " 0"  " " " $" (" " " " ," 㿘 @0@ (`6@@@6@.``6``6` `G``Ȅ`(`6` `?`)`(`6` ` `2`6`.``.` $6`  (  6` 0``6`.`@͐.` @* @Ţ.` @"`6` $6`  ( 6` 6`.``|6``?(6`  * > `> > `> ``> ``> c> a> a> a> ax> ah> aX> `p> `> a@> ch> ap> `> a > a> `> `> `> a> `> cP> cx> `> `p> ` %*  >  `  @ 0㿘  `O`#> mc( 0`> `G `"`m `a@``@``slc(2)  `" 1> l > l"1> l @> ``P> (b``` *> 2lڐ"hMlՐc("  D1> > lː"xlɑ  `㿘 > [#`? 6 2@ #ă(` > `al" 㿘 n Ha," 0a& 0> md!㿘`  `.u   (```  㿀  + 00@0(߂@0 0 @`0 ` `(`1   h@)  h0`( h0`)  h0`( h?( h.& ?"   h(`` `  > l0" h b@ >  + ( + lߐ!㿘&  `` `& @0@ |`h``0F` "E   @ , & ,  (@  ``  ) @ |, ,  (@ ``  ,, @,  @ # @12   `צ` @ `22 " @ 00 㿘`܀>G`` `(`@` H<@\  >  k#@<9 0`@8` $ $ $ ($ , $ $ $ $ $ $ 0$ $ $ 0 @  }B`0I > l/!㿘`" @3 P`l` a8``@ P㿘`n>  h b@  ?   %  |@ 0  `4`  "`4'  `00@0 ` )0*2޲`4 0  4 00d 0 $ 0( `@ 0 ,<@ZH 0 `X 8 |@`0`@0< 0"@I/ J 0' 2 `@'  jؐ# h㿘` `1`9``2!` `&` @"` `&` 606`.&``"ဥ ` ۀ ``` ?`@&` ?M&``ɀ``$ (`0` ` `( &`$&` ( @&`(` @S ْ@O @2!@.@%?` `&`60``6 `.6 `Ђ@6`֠?$@!.`@`.㿘 h` J `@ @(`>  + -/?``3` ", `@"(@`"#0``V$`  ``^  ` ?`(b`$ ` "`0J`%  ͂ (Ĥ > i" ?  > i H> j" ?`@1$`,`0$ @`, H@Y <` X 0 8 <` @ 0 H ,$`ɤ $` "` ?`@$` ` 0 d$ 4$ 0`$( $ @` `( ?$` $`($`$`$`,$`$`4(@4`$$`4 `` @\`4`` `@V@:,` 80` ,`(@4 @0`4s㿘@ #B`a h @`@a``  $   ?    ?   2@ 㿘 h (``P^ I0 > i"VP+>  {b@ T > i"h D h( h0`( h0`)  h0`( h?( " @؀0> i"` > @ 1 @``@`> @ 1Ӗ @`` \P> i"> i"H㿘`\  ` .  `!Ѐ .@`l$  $ $ $ $ $$ ($ $ $ $ $ ,$ 0e *p"@> $  h"ۀ> b `Ԑ 1~ "  㿈'`L`2F  `2B `> `f`6 Hod4Ȃ(@e #\#`    . . / `"<Hp@@X`( `  *  `쀢   @X ` &9 "@Xz &3ð㿘   >>  >`!h >>  >`!hp   @*0& &`h> E*`cd@> ~&`t"g&`x&`&`l&`p H @XS %?' H @t  @XE H H@X' @`H@`> g" N H&`&`  e &`|  ``|#`@ ` 4`h1` d1`|b1``1``@1` `02``|``h0&`&`&`#\ 0#`     ` 0`` `> gG#0` ``.` > g6 > g3#0> g.#X``2e> > g' Ѐ`V`h`=`&`4> b&`0`0 ژ`" @W 8''耢`'`".`'ܠܐ A ܂``'@Wo" @ `> 5c,> 'bА(7@> f#> fސ#> fې#`2'ܒ` @ 'C`> fɐ#fŐ#p> > g# 㿘`` `"   %|? b@ @ 㿘  O!"$`(a6b8 $`8> n  ?(`#`@`* > c@" 6ab > fx!p`H`4> @(`6 ԕ2fn!`46 `H6 `0. `,. `86 ցa6 a'a$`8a @ $`<4`p㿐 `0 `&`L`"6`6`&`&a&a8a8&a< |(( @@(`&`&` ( l`# Ho@(@> `Ƣ``ƀ` / "`ƃHp@`> Ɣ#f `#\#` 6`ƒ   C W "^ "!i> e! 6`` e> -`ƃHp@> eԐ ( 6`6`֢ 6`6`.`.`ل ?00~&`̒``'&``#`#\     2` ` -O` `>  ` -E`  > e! p> e hE6.`  `Ԓ> e ```ْ&&": 2#\: > em" l "``̀"F`` p "``̀"R ``ؠ `&ѐ,2`&͒`Ȓ?&ǐ#\#`     ` ,` "=`> e) ; > e  @2 ق @  `Ԁ ` ؀" p > e  > e̐ @ `Ԁ` ؂ `@" `ْ&s```Ȓ@&m&i#\#`  !  < ` ,x` 4 ?cc`؃(`0`0``ق`@`~``~:  (`0`@ (` @ "``Ѓ(0`@* `~&> d#h`2   > d#H @ > s!  `  $ a#"㿀 > [#`? 6 4@:#ă(``"6 `ƀ` `' @T" '''` @TВ"`ƀ`    `. @`  `$`   (@$`$` ` (@$`$` 㿘> [c`?0` @1 @cİ??(`` ` (@@`, @ࠀ?`<  (2     @@B   p "`Ұ?  "< ɰ?㿘 > [#` ?0`@3`#ă,  { e`g@`f `n@X0`e@ @ e2  r@  `h@5e@  #!  !E  ƀ`C @Ӆ4`  `, &   ?(c > * ah@  @&  `&  (& Ho$ (@e ""ƒ!Hp@  6 Ɲ㿀> [ Dc`?@0`@0`@6 că(`` `ƃ(``"9`ȃ0``"$` G`` & 4& 4 0 <d& @& 0Ho$ (@傐Hp@e0`>?Ho$$(@=`` 0 ' @S" '''`@Sd"`ƃ(``0` & 4eے㿘Hod4 |(@e |  `"4``@" 4   |` " 4`  > b 0 ? c Hp@> 'bа (3a@%0%000 000 0 00 0㿘% `4 % %   㿘% `$ 㿘!`  `c%!$&&$`3``3``,``3`,`` 3`2`3`3` 83` 3`3` 3``"-  (@   ) ` ( (``3`!&!```3``3`2`3`3` 83` 3`3` 3``2  ̂ (  (@ ` ( (``3`!&!> b!㿘!`  `s%!$&&$`)` `$`<@ $` $` `"*  ̀ (@2<   ) ` ( (``$`!&!` ``$`<@ $` $` `2  ̂ ( 2"  @( ` ( (``$`!&! p>  a!0 ܐ rʔ۔>  a~!P > b?!㿘!!`%0cP `(`0`@? #C d&``@?> aV!p`$㿘&`%؀`2 ܐ 4 #%  4 # 4 4 4 4 4 &4 4  @ $ #$ $ $ #   `$  @㿘!!` 4%؄&! $  ,!`   3> !$a @! @&!$&! ` `K`8`.> \8` 8$ $  @(@ ( > `!@  ,!`&!!`0`֐!!`&!$ $  @(@ (0 > \0`+@4 4 > \0+@ 0`+  ?c0+ ,` , > \0+@ 0`+ 0 0> ai!㿘!!` `%؆&! 4  @"!4 4 4 4 4 4  @(@ ( (`0``&$@&`  > *`!`k2`@  ,!&!!0&$  !$J ! @&!$&! ` `` `  ?c@8`)?&!4 4 4 4 4 4  @(@ (0 `` ``@ ? ?8)? )? ?c@8)? )? @8`)?> `А!㿐` `` ``@0&f(  @"ɖ ( > \6`P`< &``6`>  &`&`Ȃ  f(&`&`Ђ   &`&`&`>w>yc&`d&`&`&`  > ``> &`> &``&```k> `"> > > `&a&a &a &a `"&ea`&a&e؂ &a!@&f y &f t f @@2f &e> &e&fb&eJ ``e Q` `a&f`> _"2on!Z a4 `0@X `0"3`0' > #: @   > `8> &` > &``&`> > ` &a&a`e @ ```> &`> &`b z&``2΂`0 @ R ɂ`0> _"8 <8@4" <@㿘&`+%,0` 2@` #!` `(`0`# &!w> ^"p뀤`> ^"Xפ㿘`` > 'a􀠠. 9 `(`" > b  >b   ?> ``b    (8`?> b  >b" 0&㿘!` > !`> `" $`   @NO $$ $` _X"_V"㿘! `5&(`/! #`!`, & `  !@2> _7#  $`&$`$` o &@NӔ $` $ ``> ^Y#@&> _"> _##2` `@Pc ` * 2 2` #`@Pc ` 0#2` `@Pc ` ?(`#0`@`: (`2` #`@Pc `* 2 ?(c :0㿘4`1> Q^ x> ^ > &calc , `"8&c> N&#b@  6#>  @ cp&!|8   <"  > # &#!  "x  &!.!&!z&! 6#6#6#"$6#6#> # c!> \`d &!( &!.!  8{ &!!!6#6#6#6#!6#D< @ j !2!!2!#> bP#H  &#H@X&#L!  &!`?&!Ȃc_&!!x`4&!x"@@Q!`m`_M! ` ^d"# @@*__> 9#Ȁ 2#!А! b@@ @\> *# 2q!n&#@a > !h 2"> X ? id_"@@__ @ ? _H`  0 1> ]#ؒ# 4 > # "- > #&`?!`  00 @Ɣ &c s, p,  , , @  0㿐#V#? @(0(` 8 ?7@(`0`@`8(`7*+ 23  > _x!@?`@77(``(`` (`0`&@6( ##(`8`(`@?(c08`(@6㿐#V#  7 7*+ 23 > _/!@?`@77(``(`` (`0`&@6(  ##(8(6㿘`h>#e* `"> #e#đ* e> '* $@a􀠠" `$`$`(b` #` @Kށ \ 㿘`$"$``G"h)> '!`"b` ` e#đ* `s> `` $ !"h`H#&@(Pe#đ* $`h4 ` 6  &$& 6  @ //  `$ ' / ' / // `$& &$ 6 ..... .,  @0 g`@6 `` #@L%  2 &`, e > [ `!`"`  &`, f`$@KV  \a 8㿘"p`"!  *  * ^ @!&"d (`X !`F&#Ă``A! J  I&"h@K <&"p!`1! 7  D&"l@Kϔ 7&"t!`! & #`0$! 5@K `4$! >  [@!8!@``!! >  [1  >  [*  >  [#  >  [ ȁ >  [!㿐!!@>!@  !@>! A<&!t &!t㿘``Ғ > `  >  a &88@ # "> # "> !` "> # "> # ">  #Ȁ "(:8(:X(:l(90(90(90(90(90(90(90(:(90(90(90(90(90(:(:(;(;L(;(;(90(90(90(90(<((<((90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(9T(:0(9P(9T(=$(=(=(=(=(<̝㿈@`3`> aH@3`& & 8`83` 4` `   + >    @@̖  : > @Hp*@@$` ($`, $@(` $@ ` `  ɒ .`@,$@ $` .`@ .`@ ( @v@~ @n ,@i@ @a ,@\ 0`@& 0 @Q ,@L@ @D ,@?@ @7 ,@2@|   `-@")"p*@$`  @ ,@@`   A @ @ ,@< E $` !P`:```> Y}#H> Z@#X(`>  4! > Zc 4> Y#(' ?  \&`> Y["``'`0 @ ~h#j!> > Z #h``> Z"> Z"`Q> (`> 0'  '`> > b0 ;0/ -~+h9j'  $ "`> YՐ#x`'`(`  ``@$&` @@ܠ @> ''    `> Y"㿘  ,  , K` 0`j @$ `  $`LA`L6$`T`$`T @Z @ $`X$`P @ "J     `c8@ @@2%$`h$`L`?$`P` @$`T$`X 4> `X`0$`P@ @ @`@$`h$`d$``c%$`\ @$  @&  &  @&  @c$`\@ `T`~$`TY #@x0w >` ,92 "H  `) 0`!$5  "8   <  @ $ D ( H` @@$ `?`(`  s" `(& 0ڀ`, "  s"   @(`  s"   s" 㿘 ` , ``2 @`  ,@`,`  0@& y    $ ( <`D @`H@gt``4 @ "` @G@g`&3`  3`` "`  @G@g`   2"`    @G@g`   2"`$   @G@g`   2@"`(@` @"` & & & r @`4 @"`㿘6`c?c@6.`@67 ..@/     #`#`#`#`?#`?`#`#`#` #`@E & & & ?`& &  㿘6`6g?.@(0.    #`#`#`#`?<#`#`#`#` #`@ & & & & &  㿘?6`.@`0( ` ! ! ! ! ??! ! ! ! ! @ & & & & @&  㿘` >`@       @ư 㿘.&` 2`&`&'" > W@#x?"`&@@@&` & ?&@$쀢?耢?2> ဢ?㿘````` 00@1 (6()   `0& &" &`2 ` `2 `2  &`&`&`&` ``2&` @ C&`&`&`&` ``2 &` 0``  ``  `?㿘`@B(`(")&`c H `@d?c, `&`&`& `?c&& &`` $` 7?&& &@[ `&`&`& `?c @H"@J " ``@2`&& & " `  $` && &6  㿘`@9(`#"&` $< = <@ '`"', `&`?(@&`` 9$` -?&@ >`&`?(@@Ւ"@ג " ``2`& " `  $` &6  㿘`@-(` R` 5@ Y`N>  2` , `?(@@" @ [`` $`  6 Z@m"@o " `` 2`"`$``"`Ul#㿘@``# `" ``c$``4` r@4"@ "```$`` :` 2 㿘 > U2#&j&V&2> &㿘 ,   ,@`j`e`2 `` @$            `  S `@   d @ ` .667 @/ .`@6` F@ . ` c@.667 @ / .` @6`` $ @$ $ $ $ $ $ `Z `@$`.667 @/ .`@6` F@   +`   .667 @/ .`@6` F@   +`       .667 @/ .`@6` F@   +Z @㿘   `     $ (8?"@@@5; @@ /`@7`"; `` @ 7  ``@.@@6" 9  ``  @@ 7   g@`.@G@``6"$7  g@G@` ` ; @ a`/`@A7`@@"(" @l@A^8㿘     `G  c#6c82#.  (  @6 6@ .@.@6 .#@@#####  7  @.6@6.@@.@##### "# c  չ6?" P ` L h d  L c \㿘````r> S#`r````@@= "`"`"`"`"`  `_#` `?(`  `""`0 0  @ ((+2 *3   @ "`"`"`"`"`  @  ᔎ`۞ > Rʐ#  `9 ( @  `9(`F`fɀ` 4@"@` @  > na\ a\㿘> nc@㿘> nc`㿘> nc@㿘> nc@8@ 㿘> 'a􀠠> n`x `t㿘> ncl㿘!> n#` @  #`>  Q#㿘> 'a􀠠 >  Qz > nc @ >  Qf H @㿀> c<' Ζ  " > $#㿘!> n! !8` ,㿘`" 4 > Q,# 4 >  0`> Q! p > c㿘> 'a> n`x `d> Qѐ 㿘1> n!` &!`7 2&!`> Q 㿘> Q 㿘?> Pc> ː Ȁ 5 8> )> Pa> > M`Ȩ      ɒ   ݒݐ˰> Qm 㿘```?㿘  > )a  Lp 㿘o> 'a􀠠2 > n `2#& c` &"Y``@K>  : && &   8 9& > \`Р & ?`> PD!:o> c` *> a`> bW@{  .`.` @ > > P!> \`Р & @> Pؐ > PՐ!8PӐ!p㿘> nc ` |@@y |@0> nc> <@' ` `> >  dO&@&Ґ` @`?@ > #j#㿘#@z#@z%> n 0'> OȐ#@|q0 @yȠc Or"@ .,㿘#> \aP`> na<> 'a􀠠> n> n a<( @( $aP. c> n>=c0'> = &> n@yg > n > Or"0 > n( @(< $  < a c<' >  bh> O@y1@y. ؔ `,       > "#> O"`㿘 6 >  `"P 20%> ' $````(,N @` @"` N `s  Ŕ @`   @ $`> ! %> '`s2@0Ѡp#> 'a`  U P> <@'<'> a ''tЀ 3a`D> a`4> M b "9> > M> Q> b``ئА " 5?"Ð   ( Ё> MO8"8'ԒO2"O0"㾐> c<'  !> bՖ!?C @zp E @yɒ &  ,&  &>  a ? : & (>  ch @?7 4%> ' < &!0*`蔂 ``S" @<` #> PQc pc> > " N  l> `"@%> p .   )pe4  /%> '> \> \`     ) @`4 `(`>  MƐ#0” %> ' > > #Mq&  *  * > > #8Ms > #> Mz \> `Ȣ O !4#P-> '`2a>b!>> > !HMNؒ!H> <M#􀠠b6F `G> nc LH@"#H>> a@> `>= B c0>>`<'@L`> a̦L`` 'ђ  'Ζ 2M> )a!>> !H!H> <M #􀠠 !Dɐ> Obp '!> '!̒ !D>>> M`<'''!' !> M> b8'''  `2'> ` (> O> Pbp> a "j  !D{' ''''] O`/> )> Ma> a> P> Obp/> \`  P\@`&`!v 2 Đ ` 3!D> ap''>  '́  Q 7Ԁ` Hpk '& ̀`3  `> Ҫ``H@>>>  ܒc>> a@Ԃ`%> `<> L) L !DՐ> Obp''''>  &> Lؐ > LՐ#㿘> L  @>>H`< `<> > `XP> `hL`>  $ K ` `aKL`2 > K >>aD  ?(@2``0ؔ@ KА 8> )> '!c<@'  !`0!>=!>" l $!ý !!@!C!@<=Z!`B> !``:>Bc=@`?P ?P(@@ >  #4!>> \`> n ($ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ> ,Ђb8 !> Mʐ  Yn# # sĀ`m`q` pҀ@` ``[ !?P 'pҀ@` ``P``@UĤ@4@,@~Ҁ` ``O`@C?p  ?p`> @!!> M  %# @> # 1(`@~><>< ] cԠ> 'ԔpJȐ6! > '%! > 'c0 > K!h#> K > K > K!0> K"8> K!> K K"8> c<' !>>  <!x/> n`(@ *J`/2',;>> J`@ `/ `" (( J`@ (J`@5?$ aD ` 'aDJ`/" ,@ 2L-> 'L`-`2 -> '#> c4d`P> (> Hb> Eb `G@ ""   h J`, (8``:aD J$ J`"aD`/aD J`"aD`/@"؈  P`ك(`@ `  `  '> a''>=  `` `!> '!`"'> `x '> #$' !``  Ho@H/` /> 'b̒ " @Hp@> ' b > Vjh-> '#>  L`c"c4`c`d`"Wc4`a c4`$c4L`cc4d$c4`s2 c4`$c4@: L@ -> ''''M `(0 -> '` L`-c4   *  #>   y!}`y> P<c> O^bp "P> J8"`f (8``l"M (8``sM `d `t`r㼐 < > Ra;>>aD$`'aD?$$ >  rcaD$0$4$8'aDL@ r;M> pI >> |[ aD$P$X'aD$T> I"M `e( < > MGb#>>aD$$`$aD?$M M > Hڔp 3 aD$0$8`$aDg$4`d `t`r`>b` <``Δ >b> I"xM `dz > M <;>>b0  aD$`'aD$?$L@ > Hh >> \aD$4$8'aD?$0ML@ > Hp@ aD$P$T$X'aD`eJ( < > RԒa!>>!D$`$!D?$$ >  ǒ`!D$0$4$8$!DM `d'( <> ͔ c >>!D$$$!!DJ`,-> ' yJ`,2-> 'r -> '> M <;>>b8U`y> < > Mb0;>>aD$`'aD?> $$ b~ aD$4$0'aD$8> \`LH`1!`8`MM@ > H p>> a |aD$P$X$T'aD> H# > H"ː `8`> MKb;>>aD$`'aD?> $$ b < > M:b;>>aD$`'aD?> $$ c> ǐG̒ ɒ>>ap` >"  ` "> `8     "("8@ "$   >>p> '`  * * 8`>b(b8 b$  ¢>>p> '` + *`* 8`> `> `8  ¢(8@ $ ¢  ¢0*`* ل>>ap >"  ap ¢"(> 8@ "$ ¢㿘%>`"> aa>>`p`@` 0@r, `,@?  ¦c@ @04`>(%, $ ¦  ¦04``?k>>p >"(" 8@  "$   `>>p> '`  * * 8`>b(b8 b$  ¢@>>p> '`  * *`8`>b(b8 b$   *`*  >>!p>> "(a!!p8 "$ ¢@㿘> aa>>`p`%>` @@@q0@($. $,  c @@0`` ?c@ 0 4 f4 4 `?s  ĠF  ĠF ƠF>b(b8 b$>`> nh` > h o@ @"p`,op h ¢㿘% >> "b>>? ah>>(> d al  €@a {  "$    a>b"d ڠ@ >> b>hb 㿘>bhbTb<@pbP@p*> b>>( ah>> lȀ@"!  Ơ F!#  Ơ  F# Ġ@>̂   Xl` pbĘ@@ĸ@@ >" `!"p!"1> Eב > 'a􀠠 <>> @ al>>> ah  $  @ ˆ@`¨@ >> b>hb x>>  al㿘> $؀@> >>? ah(>>> d al!    Ā"   Ā  > :>b! Ơ@>    `1> Eu %> F6 㿘>bhbTb<@p>bP@p:*> b>>( ah>> lƀ@ F  F Ơ@> `1>  XEB 㿘%>hT<@pP@p *> b?>>( ah>> lƀ@ D  >    >bTb\`  ¡ā"   ¡ā  @  Ơ&€@@ > D! >1> D 㿘>bhbTb<@obP@o*> b>>( ah>> lĀ@Ġ@>b< bD`    @ >bTb\    Ā"   Ā   >1> D > ca2 `@  ? 0`@`  ``> ca2 `@  ? 0`@` `?> ca*  **`     (`@`?~ ?㿐ɒ(" D(b H     0h% 0Ť > b|,`" 0`"  "&& &  & 4H@6!4 6!H6!06!,* 6!@*`&!D2 &! 2`: '%%`` @ ```B@m @m%`%`ު`?b6!> '%`%`@@`  @ "``B`@m y@mx%`@%`ݪ` ࠈ ( ࡀ (ࢆ7  gGc&  ! & 6!  6! 0% % ?(b% 0 0`% <% 0@b7㿘 A X> 3`@a&Xȱ(" DE 0" " ?(b" 0 00`" <" 0@; 24H6ab2p  @`b(``B   0h$0Ğ > b|<  @`@C  #Ŗ 耤& ߀k ؀LѠ^ Ԅ ? ̈́ 0  &XaW&&@&`! `! ` &(! a&,a&0a&4a~a<p&8 @  a: @j &<6p 6ra&@a &Da &H6&> &a , `` M $ 4  $ +`0` @ 4 @`,   , 4   (` 0` `0` ` gG#ꀠb#뀠```856` ``-`.`.``" `1` `2( `?`gGc뀠26 Ȉ - ؀ - 5  6p<6  @ C " ``: ``2(   ( (  02(  ( ``Ȁ @`@2`> a`, `@  $ 4  $+`0` @ 4 @`,   , 4 aӚ @`㿈 / 0 @@ >4 `"'`M`H(`?  Ec傌 &`'4 `?`;R `*` ڀ`H쀢`R @l'而` 4 @<(&@`"4 4 `` `H(`?۔  Ӄ4 (`@ ` (`@`', 8`'(`@`'`H(`@  0'>b  㿀> c<@' `  @ @ 2? 6 *) @%&'''/''7 ` ' `'  `Ȁ> А! ǀ? c `"  @ =& 2 @ *  ?. ? + ??%  $(,048<?@ ?܀    ?   ?  ?  ?  2 @? "  2m *2?c $(*  `? c  `"@  ="@ 3  @`+  @.`?`+`?%  $(,048< @`?܀``  ``  ` ` `` `" 3 `@`" `2o  ?# 3 @(`0`@0+  3 ? @0`@?c`""`0`0`2`0""`0㿘@`0`0@2`0`"@`0 &`0 >  @i!0㿘 @(`>>!@ 㿘> c#P  8`> N" b'Ӑ 1> c#  8`3> & ah'ɑ 㿐!>''"@ !`?p! > > P3 ?e!p!@> > !?]> @ "0㿘   > > "8?Obp> > n!p @`  > nl``  l !!p> n al> ?"㿈r{> 󀢠t`*&` &``'k` H`> nt8@` > nax. @`  > ?͐"  > '> 'b .  >"a @8`> 'a􀠠> '. > c##@Hp@b . >"ah @8`?).@   #`(R> #\#d?#0(R@΂ #`>  ?z"?w" 㿘H` 8`  > '& 8`  </ Hp@ 'a  9  H  G /,$ <$$ $ $ @H`> nt8@`> nax,`@` ,`> ?#h,`>>!@Hp@  Ǥ  Ĥ 㿈> '> 'b `. >>"a @8`)?. '(R''H`)> n!t 8@` Hp@L@  2L!t (@(%!t. > nx Hp@>"ah @Ň8`x> 'b H`#> nat8@` . Hp@ > cc@>>a@> 'a. >"a @8`?).@? #`(R> #\#d>s#>"ah @8`(R@  ' 2 @ q8''. > nax @  N@ 2Nat (@@$atHp@  ǂ㿘Ho8`@>aH. p@`(((((((((((((((((((((((> n a㿘> M> 㿘> >#㿘> M= (㿘> = 㿘 > n!`2 ?x!! `%)> !@8@@ @ @.> 'a􀠠( @`%>B@ !&@ !)> !8@ @ @@!!?ض> = 8ڃ(`> = H㿘> b@> Bcش.q> = `㿘`   G> = x >`p 㿘``? "..  ϋ 0 > "" " " a" $" " " (" ,\ @㿐`  > `?b   k  $$ #`#\@ *?  ; \' ' ''    㿘H`>`0``> 'aL` M$` Hp@b̝㿈>`0``"<> `4>  a``````#\>   (@! <:> a0`(@ 0 <  $ ( ,#\ 4#` 8#d 8<$#h 8 2`1> <!h< > 㿘N@`  > "1> 1> < !`t1> <!<ǐ!;!㿈> ;!> ;!耤 > > b4@4@ 0 <  $ ( ,#\ 4#` 8#d 8;#h 8 2㿘> lb?(2 ((> \ aT`> a ,@)>>!@,,*$@@!Ć$@> c> c c㿘> 'aP;> lb> cc'> c䀢bb ?> "H2;b> \(`(`T @b>  ;v"xb(( @@`8> ;h"@e@J/> `> ;[">>>B Qx`N,8)> n@- `  > > D> ;;"`@  - @!b! >B@#`4 `@D( 8 @@8!> 4`; "! `` ` .`1> ; p-'> cj> + 1> :"1> :"1> :"1> :"1> :"1> :"x-@$ @ !P@` 黒 @@<)#@#`#`#`#`0#`H؀ !<`&!<??b&!&!<>`0`aP`$ H'a<@ (@@23a4  (@'X'T'\'D'H P'` 'd'h 'l 0'p@ ú@$  D X a@$ H$ $ $ a8@$a<0'<'Ht+<0ܐ  a@㿘`   !    ->=`( 0;> cccЀ cЀ`8 > F`ذ> 'a 㿘!Lh!P$ !L @f, 3 ? /  2!T ?`$!T  @%>@%n *&!T } P $@a$=c$`$`$`,$` 4`$`$`$`H&$`$ $㿀#> 'a`[>>a>>B#!> !@>! @ @2?Ha?L` 0'X> 'b> > c9" >>!a > *@#92`> Bcؒ '#\ rr a> c% c?>> a?>>#\ aȔ>  #  $q >>  a  > *@#P9z2`> 6 b?>> aބ0> :.#(㿘> 'bȀ" > 7 "XC2#> > 9P#Fc>  c4> c؀`!>?zH`!"> 7> 790#@B`> #> 9&#> `0 '>  ؀(> i09#p0> 9#  > n! s ( @! d( ! -*!(!b! *!(x(((h(h(h(h(h(h(h(h((x ? 2    (`   ? -㿘? 6  !> n> `""`` ! "`> /%> >Bbȶ- ->>5> '/@'>> 8!> n"`"=$" @ ` (@ @``Ԁ`@ gԒ`԰`а j`˰`` &`` ?Gc@@>BcP@{>B@8` `?(`k ǔ`` @u o`>> , @  `  `@ @ @@ @`?H@@>B@͠ ˠ `n @ @c`!>>!Ђ Q$> B> co I$!> 8 ` &@`K&`> 8  ʹ % dch@@``@  8 6 &`  8 w *`"" " 㿘`>`0at at  & Hp@> >  88oh㿘 H@& @` >"@0t` t@`@> >  P8K㿘 H@& @` >"@0t` t @`@> >  P8'x> 'a` ?  㿘> nc 2   @ @  @   㿘c  ?   &Y,㿐c@>=#> n> nc''0@"280 c@1@| c0& @P@o  "_  ]Y Vk O   H/` / @Hp@ 2İ #p H/` /@Hp@ `   H/` /@Hp@> n b& H/` /H/` /@Hp@@`F 4& ab1>=c0.> nH/` /5Hp@ X$bB&   'H/` / @Hp@L&)) ) p) \) H) 4) (㿘> bԄ?@?? 2`(( @2` a 2` `㿘 0 `>B#z>>a>>"a"@>>c>Bcx  8     㿐> ''D`'H` DH@'H D @?>B cPD>B? chH@>B'?c> '#?7>>1> c;>)> n/>>3> +`= Ĕ@`#4aԠ  #a?#(4`(`(`! ` 4``+` 0؄(؄ @a„@@¤@@@H> '` @`Ȁ@@(> 'H㿘+> 'a` , 0Ho>(@g> U ! 8`!&& a`=` @@ >>> ab, 8 ,#@2@* $@ %( ( @  ?  °`??  ް  ¨`?/!>Hp@Ԃ@@A `C >,` a`@   ,&04!"؟@! (,`8``x"⠀  >bП "Ġ@`Hp@bП{>>??   㿘> a@@ 3>Bc@$  `" >> `  2`(`(`   2`a2` ` > ' a> b?*@ o2  (@">>b :```88>>ah @> 'a`` >Ġ@>> 2c 㿘>>> 'c( `  >>>>a* `> b:㽀7> ' Ϧ  Ĩ@@"c'9> ->>!`*'?'`''  >>b (`@ >> D)> l$0"!> l!   "" D!> l @'!   "" jD @2'`!  ;>B/> lcx` ?`  ?! K 2@ `5@/>>+ ->>+> l`2E @` !†'! *?b" ?D ! `2" İ@`@> lb"−" D "Ġ@4"@`Ĩ@`ဤ@㿘 06` (( @(6`>>a"! @`*` @Q ¬@Ȇ@ @@  > a``@?)(@@&   > 'a6` |6` `@> 'a  İ@`>` `> (Ȁ@ Ĩ@`>` `?>`  ¬@㿘.> >>b  .@`% >Bc>C@ `0(Ho&(@g`+"@ Ġ@<``">  Ġ@`"@ @~@Hp@ `% Hp@bğނ 㿘 >>BcU>B#> '>>aa`T" @@Ho@(@@a6`6`3`? *(8`** ! @ @` @ aHp@a`' @@퀦@ @`  *(`Ѡ@g@#> 'cHa` "@0"@㿘QHo4 D(@g D$!> '!`( @@ @%> # ¬@@ğ@  ! `!`2"Ġ@Ā` @@Hp@"@ڰ @"@Hp@㿈>>b @  $8'@ "@ " D8'D` #\#` ?͚?㿘Ho4 (@g `="@ 8" ->8``7 y@` `"Ġ@ğ Ġ@` `%@ 9 `& | ` `$ " $  2 "@Hp@> 2 > 1 㿘Hof4`(@g``o @``` `` 2 (( @i2 ??`?)>>-3> '/@5>@" `6@8``Ĥ@"<'` ` 2 (( @C2 `?) "`"@`"  `¬@@Ղğ@Ђ¬@a􀠠2  ư@`<` `> („@€@ƨ@`<` `?<` '`  @@Hp@Hp@ > 1r 㿘 L` p @2  㿘i @ L`$ L㿘 L` Z @ 㿘T @ L`$ L㿈Ho4 (@ g `x ‹@ q' ` 2 (( @ 2 ?7>>(/ 8@+> 'E@`h[?`­@>ğ@'쀤 m@ऀ a4 `|4 ` @` ` `$` "@` $` @`+ ``Z> `` 2 (( @ R2 `?(Ia2 `|2 `@@ @`2` Ĩ@@Hp@ (`?(@` ­@a2 İ@`: `> (  < `& Ĩ@`: `?: 0!> 0! > 0!@㿘`G> '&a􀠠&! Č@%>` "@П ¬@>$@ > ¬@>$@ "%>؟@ ""@П@ "Ġ@` Ơ@>$@ > 08!`㿘!ƀ@>`"/̃(€D` 2> >a> 0!p0"> 0!(`c >B+'?)?Ƅ`"=`*/ `> 0"p`"Ӄ(   @ ̃(  @`@*@ @ *@) ) +  @ x@  @2@2 >  Ƅ` (`@Ȃ `" ?*``"/ > /"@`+ x4`$4 ! @`b"՞  (`@ĀD`"%> * `" > /">`"́@ @ `@) ) +  @ x@  @2Ғ`/!` @㿘0ƀ@`#Ā` $Ġ@`0€@``€@``€@``(`@/(`@?(.?(.> /A"㿘 "Ġ@"` @ $Ġ@`!!2  ?Р@ $Ġ@`㿘!>"` 8*`8"'>  `M >>6?((@¤<4?(@¤@/>bğ ¤ Ĥ@,"㿘 8&> >>4@a<?,@@¤>  ¤㿘 @ (`>> %W", L>>c ` ` `  &$$ `?$ (`$ >> `  & & `?&(`@& 倉 >> l@c @ c " `2͢  `#c &   3 > .#㿘 @ `6(>>c `  2!  >> l@.c @*c >> `"!>> $ؐ", %&"" @ " (`" >> (`  & & & & `#c &  !>>> .+# 㿘 `x@M>>c  ``$  A> `; `@2@`@2@$ @>> #", ``" >>l@K `2 0E@B `>2  `$ &   $ > -ؐ#P @>>c  ``$  @& ` ```@ && & & >>#K",  `  `$  & & > -#@㿘 `{@O>>c ` ``$`  C> `= `@2@`@2@$` @>> #", ``" >>l@M `" 0G@D `@2``$` 5$  $` > -U#P @>>c ```$` @& ` ```@ && & & >>"Ȑ",  ` ``$` $ $ > -)#@㿘Ho&#> '(@g#> 'a` `/> ` `)> Hp@  a "a`"`"  $ `"> k $> n"w" & (& $,#`,#㿘  `"  "㿘V> a>Bcp.@@ (2 Ho&4 (@g *`*` @ `"5>  >> 2 `" >>b@.> ' 䈀@`I  ¨@@c@l(@¦@ 䨀@Hp@+#Hp@a 2 `|2 `@-(@!Hp@0@?@¨@> '􀠠) ڨ@`: $`?(Ā@( @@`"Hp@ @@`"> +^#0ڰ@`: ݄`>bğ㿘Ho&4 (@g  L"@ 1 > c;>`"*& ``; ", " Ġ@ Ơ@` `2@ `"@  @2bă<  ?`@|@`2`& "@Hp@+@@   `< Hp@ 㿘 L`  @ 㿘 @ L`$ L㿘 L`  @2  㿘z @ L`$ L㿐>>#\",    > #ښ`(> 'a􀠠$$  !> c> n#" #\> #ʚ`0> n#\"> !`@! # 㿘> 'a􀠠  >C>`+ $ې 2  + #  !ѐ 2   @ !Ȑ 2  $  &!&!㿐> 'b7> &`> 'b8@>> ؀>Ca >B`# ? xѐ>>* ">>#!Ě?* ">B cx !>  0@#!> 'a`f`B>>''>ƀ> /> n?((@ `l%㨀``4>B >> b>B> 8`t D>B> 8 \>>> :a >>> Q >>> 5b >B> 8H >>> 7c >B> Q0 >>> Ib( $>B> E> :a l>>> < p>>> Jbt >B> K H>>9>B a܄#   ?-> c%>> >?>BcD%'$ k!+`#@ ?`?0??>B(`(` $"dme> a`>> bb>> bb  `>B pp'#">>'>$. @@ (@ & ! ;>B D'c>>? a>> a>B$Ԅ`` $ $@!Ԇ@4$@> n> 'c>? > `> `?>B>>a؀  >@`@>Bd-- k?c @@ 0`)> ? 5 @ ` $ &@ @`@&@>Bp&`>B &`c`>>&` ` 0``#`"06`&`6`? 0`? @6`(`0W>>a`(``4 #`4 `,    #`>>`  /> n;>B'>c8 >  41 >>@ >Bx㨂``$ @ > a` 1 4@  ш>b >B>B(`4"4 > `, >>a,@> a  `@"@  ?> ' c ت@8 ư` 8   ƨ`   `" >Bd) )  @ @@>>0` `  >> ,"@ ,">B>Ԁ`2>>> 'b ! @8Ь@    ; ``(    ?ư@` @ ƨ@`@  aԐ @  ƨ@@> '> a` >> @a (@> a;c€@ @+c€@   @  >>䀣;c €@    >>>@`}>B!>  >B> =cd D>B> = \>>> Bb >>> O< >>> 4` >B> =4 >>> =b >B> Op >>> Dax $>B> C> C,` l>>> 5 >>> Ma >B> K H>>$ a9>B #  ` $ (/> n%!>?# k;+>> cDk5+n!($$ @ ? @?>> ->Ԃ(@%, '#$k > Ԡ5>>,&(㨄$(?@RѐђF% #>>$# <$bj$3>>&a j(('>B$㌒ j$> nbc> >B! $ (#>B,;>B$cL$ 8'cx@ % >B ak*` @0``x # *`  `+ ㌄@ 0``x*!a ``>Bc`$z#>> aa `>>? a>> a>>B$Ԅ`  $!Ԇ@4$>? >B㨤> > 'a>B 3`(`(` > '> 3``3` `|3` `#@ 0`;`(@ 8cL@ ( @**@ @: x >B`) 4@ "4!>"`7(>C> 2`0T  #@    )   r) φ#`     #`   #`   #`   #`    #`cL%:"0ǝ㿘 "   < i < " +++$` $` $`> '``$`$` $`0 > nh" k$`$`$$`(  x #> ax   $`0㿘%> n 8``8-> n/> nD+> n!>"`;1> ! ` >b4(  0Ơ`5(``x pƠ@`bx!!> n>bğ" "  pƠ@`> nx@> npƠ@`> n x"!>>!#>B% ﺐc! $c%%b㿘%> n 8`''> n!>"`"""> a4@(``` 0Ơ@`xa> n pƠ@`> n x>>a>B$~#$㿘Hof4> (@g> >b.@ '> '`, ƈ@@ Ĩ@@`>Ą Hp@¤.Ĥ>b `" @@Hp@"@ Ġ@>B2# `׆ 0 Ġ` z . `z"@Hp@㿘 @Ho&#>(@g#>`0` Hp@@`b؟@> '` Ĩ@@0"Ġ@00㿐h>Bc>C@?`0$@"Ā@'Hofp(@>>c +> /> '-<9>V6``?6`[ `) (8`^*) )   `";+` ``"4`" Ġ@$> a`&8@@@$$  pĠ@`@x@a@ŀ6` ` ?@a(`$(뀉2 "ğ@ Hp@"Ġ@`) (`@g>>> % P㿐`⑰ @`2 Ho'`D`"Ā@' `L`H` 2 - -  @ `"> 2 ?-``>>b,9>` 2 - -  @ `"> 2 ?-``~.`@ "`Ġ@"ğ 0Ġ@`@4  l9  `z`4$`4`0>Bc@+@`-`- @ aĠ@`-`@x@@> n"&@ `, @` "Ġ@``$x@1 "> n$"䀤2 `'`D'`L'`@"Ġ@Hp@(@g\`D Hp@> $L $J p> $G 㿐 Hp@ Ĩ@@ ˆ@'Hom(@/>>%> c -> '9>>+)6``?6`A` `) (8`w*) )   `"+` `" "(6` @`= `¯@@@0@̀@ $`& $ (>Ă`& (¦@`) (`ö@`|6` `@@ @g¯@@2 Ȱ@`>` `> @(@€@ Ȩ@`>` `?>` > # P㿘#> 'a`L@ @@Ho&@(@g@>B)>Bca2`2`0`? *(8`**  @ @` #H Hp@a` @@ @` #H@瀤 *(`Ԡ@"@0"@㿀>>b 2b     @?$$  $   @& $ `>>$ c `>B @&` ,p! , 4`! 4` .. @ .0$ 4 4 >>b b `>Bc@>     @$?$  $  >B cp&  ` (`(`   (`'# @@@` ` >M`¬@@  >bȑ* *`2 2`> 'a`  (`(8`@>>a??-> +# ) $,@@@c'ђ?* *  @>*@@`(("ނL> ` L$@` >>a`4`  ((`8`@"İ@`"0 K  @? $ @@$ `.$ `  ` &`. @ .0$ 4 4   0`0! 0)"  (`(8`@ƨ@` ((`>>c `4`0 `4E `0 4> 'a` İ@`j '`   ((`ƨ@` Ĩ@`[ ߏ ¬@@> '> " > !!`> ! > !!0!!㿘 0@?` 6`** @L6``?*F`>>@  †@@@??@Ho&$!(@>>"> 'a􀠠 ®@`>>> a¦@@Hp@ ¶@`>>g>>f"> 'a􀠠 0 㿐> 'a􀠠X @@ Ĩ@@ K  4;c>*b@)> %'9> ?'* *  (`(`@@`@ (  Ц@""Ģ !@ &ې > !N! Ц@2"ğ@! @@ "@ Ġ@ H>B>*c@)</>%> k `A4 [?!* *  (`(`@@`@)     0 `|@"IJ հ ? 0 `|@2ğ@"@  ?>  !> 'a􀠠>>( 0ƀ@`>`>B> cL"@2@> Gcd 㿘>b * 㿘֔ >b2> a֐  㿐>Bcd.` .` @@w> 'a􀠠m-(8`@>>a>*b@+> )#' `"a@@ @2 ~?* *  @@`((< L` L`aD  - @?-$$  d>>b(>Bc10"K >> @>>?c $$ 4! 4$$$  , `! ,-(`@> 'a􀠠+ İ@` & "$ >> @>>?c $$ 0! 0$$$  , `! ,>> b Ĩ@`d >B ct> !㿐`e @`5Ho݂(@ D` ‰@' L ۪ H` 2 ,,  `2 a@`߄;>>.``b/> 'J@`} `­@>ğր˃:`B@  @  0 `|0 `"`4$`4>>","' L` 2 ,,  `2 a@``.`bM4 @т`|4 ΂`>Bc@E>@``6b°`@ "`&@ `,  "$`4`4`,"$`,`0@"$`0`4­@􀠠2  ư@`< `> (ƨ@`< `?< ¨`@@ƒ "&@b, `­@Ĵ``>Be# q, Ĭ`킀g" D ' L' D' @ ƨ@@Hp@Hp@> ِ"> ֐!`> ѐ"(㿐 .. @@ @/   ~  Ĩ@@%> &0@`>`@ +H,@(D,@ 22a>c|ϐ ?"* *  @>*@@`((@< L` LHo&<(@ΔHp@ ¦@ 4& 4@,`> 'a 3/ .8`>>>a  /`¨@ IJ`/`2` - Ī`킀gÒğ@>bȐ ~.ѐ㿐 ..  `/    `> `"   >"`> b&0u E+> ;<a@>6` `@ @2#4  c>| ?* *  @>*@@`((@ < L` L樂` pĠ@` | 4& 4a@ȃ6` *-`./ a @Ġ@` / @x@!> n4"% `- ` "Ġ@` $.xE " %""Ȑ@  ğ@4 > }"`{"x㿐 ..  `6=> /  ,`5>> `   Ĩ@@/> &0@`>`@ @ W- @(S- `@7 `@>{i @?(* *  @>*@@`((@ L<`` LHof(@gbHp@ ¤> '4 `|4 `%@ 4& 4@- -!> '!./ 8``d>>°` "%; `,  "$!`  ,"& , 0@"& 0>bȐ p> 'a6` |6` `@>*@@c/> -@  "! $ 4& 4@- ; "% `, 2 "$¨`z?އ* *  (`(`@@`@"$Hof(@gHp@$/ .l  ¨@> '􀠠 @`>`  `?/> ` (@`>` `ğ@/"`> ,"x㿐 .. @@ @_/  `Y "Ġ@%> &0@`S>` ȟ@D>*'<b@/>@(<, 6` ` `22" 7  24z%?(* *  @@`((@? L` L pĠ@` x 4& 4@8, `@ @̑7 㿐: 6`(`(` Ho&4(@g`K"`S> n6``?,[6` `@6 ,` ``-` 8`& 8  7` 잔/@`" Ġ@ p `@@x@ 4& 4Hp@  ?c<"?2  4& 4 "]  ق"$, $> n ʐ"䀢 2\$Hp@ > n "䀢  $-`  `,  x ,뫠2  |6` `yV?* * !>*b@ ((@ߔ` " 4>bğ 4Hp@h 8 `& 8  x h $@2  |A t& 8㿐=c@{ 6`(`(` 6`aHof((@6` @ - ? `,  7` є/@p Ġ`x@ 4& 4Hp@ g6` @ 2  ?*<"2  4& 4x?* * !>*b@ ((@F " 4 "Ơ@>ğ@ 4Hp@6ϖ 0> R"㿐> `b`?(@?0x}? * * >*!b@ ((@",`x +`>B`#@@N@㿐x.`?<(7>  a>Bc @ (`.>C04@("@ 6@  22>  2  " `$ "@`$ a4@x ?Ƈ* * >*!b@ ((@̀ "㿐? 6`) )  @'L@Ho/> '(@g/> '`4,0#@0@8`@W &$0 "5a@`@ 5>>K`` Ĩ@@ƅ>`@ 6 D` `. 8`$8 @ @  `N Ĩ@@@6` `|6` ` @4`$4Hp@ & $,`(5 `@ 6 `c@ @Z?4$4 Ĩ@@􀠠B ư@`= `> (@ 5 `|@ڢ  Ĩ@@􀠠3 ư@`= `> b* "  fHp@ >>aؒ "(   $@.  `5>>t- ƨ@`= `?ƨ@`= ϐ`?̃= w,?* * !>*b@ ((@`"424>bğ4Hp@LЖ8`$8 $8 ǒ" %- 5>>0`㿐 6`,, 6``?- @Ho4 (@g +>>b" @` `,  @ ڔ@b @"@ 4`& 4Hp@ c@ @@W@1? 4& 4>B#p 4  >`- > 'a  Ķ@`, >>ƨ@@ Į@`>>> a?@  0vI,@?* * !>*b@ ((@R@2 4  ƨ@@>ğ@ 4Hp@6 0㿐(`(`@>  a! @6@ ?>B(@ #@ @> au6@? * * >*!b@ ((ۘ@㿐>>b>``` (` @&>  a`?4(@ @>Bc,Ȗ  > w"@@a`u4?ؘ * * >*!b@ ((ʘ@њ ր @? ? ` P` `P !L`㿘!T`" *!>"@!ذ ֝ $"!T!ΰ !. &!T㿘!P``@@` շ P@aP<,! 㿘!T  >b!ա > d`!ՙ ^!T㿘!P PՍ  㿘!P 0( 4  8` , ,`@?`B  㿘G!L `㿘!L` &$`  `  @ 8 @?  4$` ?㿐>  `@`$ ] | p> '> # > bp> \`%>0``Y> $aP *aL *&  > u "' "' h> dc> > # bp'  Ȇ0t怦 >  "'   { 2;'&^&] @M > > # bpc . > da$@bbȀ"&&<&&X *'  $ > #А'   20 . > Y ?}? `> `"?H#'&&   >b@(&> U '&&   0   0@> !aT$aTb0ђ  @ ِ`> $ ('&&   Ș0> >  bpĐ# b. '   Ƕ0   ǯ0> d c`, ~`,> ncj 0  H ˔ @ "XÅ X` @ r`?q$   {0i ݀ > Ȑ# Ѐ y TY 0PaTP *>=`"'`C'>─@ `ԆaTԬ!L$│`$!L@1&   ;0)   40"`4a> 2#P'H` (!aDaHr$aH  0 !> d` !$aT (ʐ#> ǐ#Ő#p> ` @>@`0`!L> 'ac@̪`0!0$!P3Xƃ4 6`e,Ѓ(( @@ `8"`4 ,`"U `4'' ,"z :&!0`.!0`,``@&`0&`&`&@ą `8"@ ,`k@>b(&@`0`44 &`4,K&`0$@?``(`@`FĢ , U 0``R @`H \*Г,ѕ   `8"!0 ,`2!0U !0А(`5z @> 2bĀb `4`84] @`(&@&`&`#@Z^`4>  0>  8>  P> ݐ h㿐> a>`0`  +q l`` @`ߐ>b(&` `@  k `#`  @`"'L`` _ H`>  > PƘ >  `4 `?6``.``B @ @"B$PZ> 'bȀ2L=c(7 > Bcؒ?o 2L`b @@`0> d@ @ d€@```2`#€@` > ob&&2L$P  ?; x@ 2`b`  T0\Y`0xH`>  x> PG>   㿐> a>`0`  ">>b"%>`` @`2V!L @ 'B  @>b('@ @ @ @.$!P  єB &Ҁ`E` V!L>' b.> 'bȀ=c( > Bcؒ> !L H`>  > P">  '`'`> b>  x@ 2`>w `2w`H`>  > P> S  8"aG6&!\ &(6!P P~!L!T` ;'>b<!o('"aH'#d#h#l '  #\#` З쀢 "#\#`#d#l#h  Є!\ `& T!(k!T㿘!T  #>b@ *EX$b㿘>`0`!LHaL> bL> |" !T 9>b< * Ր!&aT!Tk!% P@&aP d2  & 0&  `& 4& P$ @& H 8 >'a$ $$ $ & &aTH$`Œ * 㿘 0#>  Hb>B@8#$ H> BcؒH L>& L& H` @ < @ > c 㿐 0H/>  , H` & L`> B؂@8$@ @G& H`,>B+>>c1>!>>!' @ @@a@ > "`! @ @@ >  㿘> > 'b.`'.uHoo>>a̒9 > Hp@>`@!0y0۝㿀 > d#`-> !#  8@@@@@H` Q>>#à@ (`#` #\#d ?0Hp@ 6 <@, '>>#> '+>Bc`@  @'@ / a('y @'>`"@a#  @ (`#` #\#d ^0@@0> Z!0> Bc؄  > Xb@ 㿘> a`@.@3><c`6@   㿘> a . 5 ><c> B&@cؗ6 ?  4 > B&@cؗ6 ,  ` *  > e>H`!|@㿘7? > 7cH4 > d(a@> !P> b"> ~!` P#>C`p`H ``P!> e!x `$!xВ  !x$!x`H ` P 㿘> eax> c4@> Ր!?㿘`=> c ( * L   . J  㿐(``?c`?>C`B= <c= 89> > b> Ȫb> > XЮ`  `"$ `  4 ??  < 8ؔ')p)p)p)p)p)l)l)p4)o)o)l)l)l)l)l)l)l)o)o)o)ol)l)l)o0)o)l)l)l)l)l)l)l)n)l)l)l)n)l)l)n)l)n)l)l)l)l)l)l)l)l)l)l)n)n)l)l)l)np)nX)l)n@)n$)n)m)p4)o)m)m)m)oP㿈 j @> ecT``0~0~7c0p 0`` @  `"j> 0` `8`W @2 2 >  #(  (`8` `, j L``,>  #??,(`,@-`,@4 4 `'4 `@?',4`@4' ) - ?/``?Ђ``E(`>  ̐#L`2%> >   Ð Ё0`?`4  >   #ȁ> Z$>  #>  #pۦ !X ˃) >   ">  > > b  `@ @(`8`a`p`"` y` s` o`4> ` h#(>  c# > ec@@>  [#>  U#8>hLF >hL? |>  A#v>  ;#p>  5#j>  /#d> ea@>  '#\>  "#W>  #R>  #M>  #H> eb@>  #@> eb@>  #8>hL 1>  #+> -`  #%> eb@>  #> eb@>  #>  ڐ#x> ea@>  ѐ#XL`82>  ʐ#h> e (`>  #HL`724> ђ `  >  #>  #ߦ > e(`>  #զ> ea@>  #ͦ> ec @>  #Ħ㿘?΂a&.`.` ( @@(` А 2 @7ɐ $&`, `2 @7 `&&   `*  @*@Ho(@f(`h`(Hp@> \bp"  `  `?㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ(㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ( > jbԐ 2 (` * *  @@`< Hoe4 (@ f (`hPf "!Hp@  ` `@`(`m`(`lHp@  `l`m@?``@2` 2`  @?``@@ `?(`@Hp@  ` `@` (m` (lHp@  @ऀ2  `@ (`(m2``(lHp@  㿈> j sb`(0(`@ (( @   `$   {Hoe4`((@f`(  =b`(`" `$(v(r`$`(|(x` (` @?@`"2a?b;`2(``@@?`"(  ( ` N(?((`` @@?` ` (` ((!Hp@  ɄDŽ> ^`l"  ` `?> jb 2 (` * * " < 㿘  > 'bЅ. . "@59* 㿘  > 'bے@5-#耢 @5(#㿐& & Ho%`(@f`;a@(`h`"ۖ@(|@(x@ ( @` H(@` (@ (!>  @(`h@(@` (Hp@ &> ! 0㿘& & Ho%`(@f`0> @(`h@ (r@` (@ (!>  ٔ@(`h@(@` (@`?(Hp@ &!Һ 0 " X@ " Q@㿐> jb `6 (` ..''@ `4`@ a  < D$ <` $ <* * A    l ``d``"`<`Y``D``2`<>`G`<`C`H`$#`H% `(f`<`H`$`<! > 6Hp@ ``2`"``<`W$  `<``Hoe4(@f@ <``%Hp@``!f e "`<0א* * م  <`$ <} l <$ <$`@&` @@ݞ@㿘 & `:> ^> ^cЪ  4, `&8 , , @מ @ט l ` P , `, @`4&4&`0> c1> !> 1> c!> &`0 1> cx!㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ( &@ޘ  (`(` `]@@ y@C (zx@ߐ `@ &u א k@"38"l`j@9\@2ʐ  Đ  `$`@@ {@2 `D`$`D @ m@2 D  @  <  `D`$`D  / & )  㿘 & `<> b> ]b\    &P ` d` 0,`@4&4@ " 3%&8" " &< $ &L $8` 0@`۠ @$0> `c> c1> !&`0>  c㿘> `p``p` Kt @ 2  㿘 0`c   (`4g   t@R0 ) ) @`0  `"`" b(   ) `  [   (( @` ` ," `"  ( !  (```v ؁  (( @`` `b$" `" $)`b)  @ 2" `  $    `" | 0``(`(`  `m @?`@ # `#  +`` ` x@0 ) ) @`0 `C  (`c  ! `! ~   (`c?(c ! " ,`(`c?(c ! @`! ,! (`(`c`(`c ,C` B ( ( `H!  `_$ ` 㿘> jb 6 (`@ . .  0`@, `@`@, Ho%)(@@(h@o&Hp@ c`$   &&  &f& & &  㿘> j pbԈ?1 (`0@Hoe4 t(@f ta Hp@33 H` U H , ,   ` P  \ t, `, & t Hp@ p> jbԈ?1 (`0@Ho%4 t(@f t` a`(`(`  D` DHp@ " t㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ(Ho4 (@f   t`   (`(` " @ Hp@ 6h> c<@' > aЖ '> `p8``  ( ` > @I# 2`@I 2`@> NbJ `  > '"`> &# 8&``,&`0`4 &`4 `&`t`&`x` &`|`? $- @`0@ ``$@$(@ `?(`0@ @@#(( ( @@(`8`2 : @/!, ~``" ``4`2`?(`K $ ` @Ǧ`4`   8+`@@ `4`    > \Wbp  > ^Q`l> a&``|&``?x` > e!aT&`> !@ >  J(8-`-@Ю@b  J(8-`-@Ю@ U `㿘> jb` ?06 (b) @"0 . . @`4Ho(@ ``Hp@ f  & Hp@$?& & ڐ & &  Ho%4(@f(`h`?( (Hp@ 㿘> j"` ?00`F@"ԃ) @@ `0< (`(` ` t` F$ pdd ' Ho(@`$> # b  !@  t`b/i$ t " Hp@ t}$ t Hp@ l> 8(`@b3i$ t c $ $ c$ ` `` $ ` `` @@$ ` `% @$ % $ $ $ `$`$$` Ho4(@f`(`h`?(-  (?-?(` 2 t``  t`v$ tfq`m$ t㿘   0> 8> `Ƞ> 8b   ;@/  0 <`t` 2B T 0-0) `# P <`"`H` <$ f` `? Hoe4 (@ f  (dC\ "" Hp@  ` `* 0   @(d` (`((Hp@  J 0h(@?`a@2`@ 2` `Hp@  ``* 0  @(d`@ऀ (((Hp@  `"* 0  * 0 @(d` (`((0   @(d`㿘> jcL 6 (` . .  @@(`@`4> 8 l`ȅ(㿘> jcL 6 (` . .  @@(`@`4> 8 l`ȅ( > jcL 2 (` * *  @@(`@`4㿘  Az0``/ / &@(`@`L( x(`D"`@`H@" `@  (h&@&@(`@ `L 2```'``  (h&@&@(`@ `L 㿘  A0``.`.`# @(`@ %`L  `H@"`@" ) hzhx) D  @`H@`@2``&` ( "# @(`@ `L 㿘  (A0``..&@(`@ `  T &@(`@``  (&)((` ߂` `#@ )( 3 & ?(h{ &({@(`@``` ``&@(`@`T`4 P@` T  P `(h{ `(h{T`$P )({ ?(h{ ` ' `   A`@0(( @@(`@``  ``"@ (  (h㿘.`@,J. 2  `?c .0 .> gc Ā`?    @@  @ " "`0> 􀠠c> >hb!> > c>hb!>  "`0> c>hb!㿐  ' @  " w```ђ  @  "  v``  @   u`` V @` e @㿘> jcL 6 (` . .  @@(`@ 4> 8 l`ȅ( 8 &8 `]@ 4@ y@H (zx@  X &U ܐ k@"88'l`j@9\@2ϐ L ɐ  `$ X@"% `{@2  ` <`$ `༐ (d`(0@m@2        <`  &    㿘 & `.> i> kcx &D `@4.d  @ (d*" " &4&<&8$ H &@ $$ 0> `c> c1> i!&`0>  c㿘``CB  > C< p`?㿘 ``0> 8> `ȸ `-@/   4 4`t` 2 H  4$ H` 2`2 `l(`@` H L  D$ H@ @H` ` $ `Hp@Ho4 (@f (hd (Hp@ `@$ \ `l(`@`2  P`0 "`0 P`P`HQh @ `t `l($`t@`0㿘> j scL0(`(( @@(`@`8Ho%4 t(@f ta Hp@+ H` HNr $`T P$`P t`& t`<(hd`(Hp@ p> jcL?1 0(`@Ho%4 t(@f t`a`(( @@(`@ `` ``Hp@ " t㿘> jcL 6 (` . .  @@(`@ 4> 8 l`ȅ( 8Ho4 (@f  t`    4 `(hd`?(Hp@ .㿐4`1>  `1>   8  А0&` &`> `&``>  ` p&`%&``  &`&`k&`(@`ab ? `2[> ?, `@``k@?(p`?(q``(a`?(b`?(c`(@`(hA`(B`(hC``` #\> !  > f?`  > g9c> gc`h?&`h`&`l> h``0?&`0W&`4 > iaP&`&%b&`| ?㿐> j scL`(0(` ,,%@(` `8  `$   Ho%4`((@f`( 4  b`< (hd` @?@`"2ab`2 (h ab  B `2>  B. ` @@?`"( ab  D `2l>  D.   ( ab  H `2T>  H.   (   (  (h   (  (  G(  @( (`(`" `$ (9 (:`$`"   (1 (2 ah  ``2>  .` %(@@(`@ `\Hp@      H  D w Bca㿘> j#L` ?00`M@> j$`G#L) $@A0 `<,,%@(`@`4 t` F$ pdϒ ' Ho%(@`$> % aH  !@  t`b'$ t " Hp@ t}$ t Hp@ l> 8(`@b+$ t c$ c $ $ `X``2c$ `X`` @@$ `X`% @$ % $ $ $ `@$`L$`HHo%4`<(@f`<`(hd`ab % ``2'> %@(`?@,``< (dP&O` P(X2 t\`  t`h$ tfc`_$ t ڂ% @ ( @ ( 㿘 0`I x "6 @ @#` ``,`(  8@`& 8( @( @#` R  @``( 0& 0 `  `(㿐 @'􀈠 `!o`   @   @`'` `>  %!h @㿘8  0 &`@Ȑ`@<@ (" > >  !_> !Z!V㿘> >ޒa`?㿘> jc ?6 . `4`H_$`8 ?$`0 2 ``$8$ 2`4 `0@&`$`0㿘> jc ?6 .  0` d d d 4| , <㿘 > j#`? 6 @(`#  N <`  Đ$ & 4& 0. <  㿘`>  # 㿘 4#> Ma H & @ ? @%& < 4a < ` `8$`4 @   @   @ `  @" `4 @@ ` <@Ԑ 0 1> |2#`P> Na> &!x> a> >a  > !  0 &`D  ܐ< &`H  ֐H &`L  АT &`P  ʐ` &`T  Đl &`X  x &`\   &``   &`d   &`h   &`l   &`p  &`ta4 " '> =a "48'?> ^b`D&`0&`4* @` `0`D(@`8 d &>  Р!D8  ' '> n ,x` ''㿘>  =f! O@  0 d`(> k,`,@`` > k,` ,@``@  㿘> k,` ,@``p ` ` `> k,`,@ ? 0`@`  ` ` ``"܁   `܀` `  ܐ ` > k,`,@ ? 0`@`  `2 `ܐ  ܐ  ܂  <؀2  @2  ?"  ؀` `""  > k,`,@  R` "`<> k`@"`8ؐ "` ؁ 㿘 ܆` > n؆`   ?c@?( *`n@ 㿘a bt" 0 0 `   ( ( 㿘> > bP> > b     0 (    0 ` (  ;  tV |`R x`7"  & t& x `"ؚ  0@"(@ 0  ͚  Ț `&   "P  |`   . & |  |`l t΂  | "  2  I       `& (`& |& x 3   t& & x& |@ (`& | 0(d  & & @?@ & x & |& T ȃ O բ  0. (E _㿘 x`  x`H` t`& t`  & x`$& `& & &  |` & x ` Hp@`$`;, Hp@h > k ,`> <@' R ,@ N  @" @@ @ Y> a@ a@@  -  p`# ..?& p".  .װ E;ϰ  0 ($ ǰ Ű   /̂ ''̐X`? . z /̂ 'ܒ'I(.ʔ 耠`.? .. 0(@ $  0 (@ $ (.e?.h > k ,`> <'   ,@  ?''/ > R h>``!> /Р#<'  >//ς  ''//ΐ > 0!> k,`,@ `(@ࡂ@@ (`(ࡔ@ *> qc?h>  pc<' @ ! `! !?/̂ //΄  '' t` a-"  g$  > ? t//͂  /'܀'0  g  a "ɐ! > k,`,@   @ p`@* @h> c<'  $ /̂ //''J̀` .  > . Ɏ!0> k,`,@   @ > rbh h> c<'  # /̂ //''̀` &  > & X!Hh > k ,`> <@' ? ,@ ;?c @ 76`//͂  /''ߒ$ d.6  0//̄  /ΐ''ΰ @ >  d@ " @ 6   !Xh!> #<'   /̂ ''(`@& p > !hh> c<@'   /̂ ''(`R J>    O> r    "* pf   @ `5 @>  p`8>  #X ` p @ `@ %> > cH> `> c>  # ϐ " y ǹ @ Ր"s!h!> #<'  C ϔ //-/΂  '' > R!㿘 > 5>  ו㿘> 8#p`?㿘4`1> Q x`1> #x8  V0& 0> ">>& t!H> 8`c   & t . c  ( > p 0 `> p`& 8 8?& < ) > sQa| p`A > j> cب> > bX> > `Ю @.@+ P94@ @@6```"6``2@  ` >  В  :   p`@  0 D(& xTޒ 0 # # # # #   #  # #@  > " @"*@"" " ?(0 (0> `a> c㿘> v& $& (c4& ,  㿘 , "& ( & ,& (& $㿘 > `0! H` p (@ " pHp@>0a$ p  h  h 4 aa"p 0 (@ @`" >  ,`~1> )c ,>hb! 0> u`(㿘> v"Ȱ `l> z( > "㿘 ,`4`@"0 !?  @u,@ 0 ?  0`  0  0@"  0h#0  ?"   d(`0``@=@  " `0 )0 0`1> .`6"@㿀> bx' h''''> u ̓ &&   ?(`0`h@?߂@@1  (0 `  0?   @s& 47 & 4 4  0#> MaӐ@,  4  > "a x?@ &`4> va&`0?`W`0> ~" > "> u&`p! y> k`x &`h/ - -  @ `p@``,& 0 &4 & &   -&,`@`` ` &@&0& &[ ` Ԭ<㿘> 6'"`?㿐H` | (`0``'` 0 (`0``'` 0 @, , ` @``t  2@Hp@    `#*`@` @ # # \#@ @ 㿘>  pbH` p "? (@,@& pHp@(( @`t ` 4`݂` 0 =$ 4@s 0ՃHp@  0ɒ `Ƅ 0'$ 4 @6 0㿘 $@ (H` a0Hp@㿘 d`ceZ"@d# 1в@C"@  @X"@ & d  &@N"@& d  &%Z㿐!,Җ( (``" @  +`@(`0@    8(8`@(a0 @@  (?0``@(8`݈@ 0""" ""  0 `#`*`@`4 @ # # \# #@ @  0# <# #  > `a> c㿐> 'b{@vb@> 'bȀ '  >  Ő㿘 , "& (<& ,& (& $㿘> x& $& (cJ& ,  㿘 > ` ! H` < (@ " 0a$ <㿘> x" `8> w( > ^"㿀 & $& (& ,& !&   > bx' 4''''> w | E&   (``0@  ( 0  @ ??c(`0@   `??c(`0@ ?`  c(` 0@  (`` (`0```&   `@&  ?(c08`(@㿘> ?c # > k`& <& 4> w#v $`L$`@ ,  `@ \?(c08`(܂@  @(  @@(`0`0  ($0> wb# ?@(`0``@(8``@@8`(`@0  ($0> wb#㿘   `(& 02"   8(8`~b80$"   8(8`yg0  (`y`  @@0@   @(W  ?c@1"  ?c !@(`0``" ` `?"   @(`  !@(`0``@(8`@`瀈` & I (`0` @Ӡ ; ? ?& &  @ A +`` 0@  &  ?(`0``@(8`@@ @`8(` ?@(`0``@(8`@`@`(`8|@`& & ?(c08`(@?`(@8`@㿘H`?> c0  - `,  (`6` (`0`@#,`` `5`+``0@  ")  ,  ` @` &`+` ` 0@ ̂Hp@ (0(`8Ȃ 逤(8`Ɉ@(0``@(8`ֈ@㿘H`?c  /-+`,`` (`B``(`0`,` ` `(`0@ (`   (2 2 $2 "2 !2 2 `` 2 Hp@`(0(`8 0# < # #@㿘0`&`4&`8&`0 &`4&`8&`&`&`X&`0&`&`@&``K4`1> s#` `̅, ,  @`8  " , ,  " , 0 6 / *@ `p&`p  > z&ab&a?`a> ~B"> z&`܂`&``ؖ?> 4#01> ~- 0 `&`&`\&`  1> "#㿘> 1#`? 0 D@@  2`  8(@@ 0 D@(@ 㿘` @  @`!X` `` (``@  㿘 `0`4  > aX`"7 ``"3  ` "/    P, L @ $ L8$ P   N M  L  L P " |   }$ P $ L㿘 `0(`4㿘!X  0$ " T`"  `"  R "  T@ X `E  ?G  2 T 6  ?8 㿘 (`D>  ``0`0 & `!X" 0``" D @* @`(!d2` 0 4`  H  ,0@4 !d` #!d& `!d`#!d `00`4Ð#㿘 ``> & (츐 㿐 (`>  d`` d ``/ `` aX"`0``" D" @* @`@ (H2``0`4@ ,     d`` d 04 H#\   D 2k   (aX@?@`  ` AC T`2}  (` `?(` q m  aX`" ```8  Oa N]  MY  LU  P L @ O  ``#:& `  `00`4  `0,`4e `,0@ & , @ & 0& @& D& H ``0`4| #㿘 `h` > > b0> aX  !@` `C$A`A> !P?c(`!R@#`2=> >  8!P(`2` > !R@> aX> 2` @!R?c@"> .>  X> ."0`2> > " > @ې h ג ѐ 0!P͐! ɐ! > @> Ð h> b> >  xaX !@ ` ` `> ꦐ 00꣒ `㿘> ꛐ &`0&`4 &ah&a`&al㿘!X  `"   $ "   2 㿘!X !>  `   ` $`"  "$ $ $[  2 㿈 0&!X`, 4@ $ 00@ 4@ V!T`2 > ka/!X"/ d $ ( T X2 !X 7 > }> {aԨ 8!P!R'77'Ĺ$ $ @ 2!P`?@4!X |۔  ?" `"" " "  " !\  !X&!\ > 깐 㿘`"!X`!X  ` $ " E  2   `"   $ "   2  㿘`-``?㿘 aX`\  T` 2 \\  @&  2 \a``"Z> `0`$`4 w ?y & T& X a`@2a``D> Hoe4 `0(@f `0a``$`4  0 4`  > |$!`& X& THp@`0`$`4Ho4& X(@f& X& THp@ !㿘 !Xd` T` 2 \\  @&  3@ !``n> Hoec(@$T$X$\ 0 4` > |$!`Hp@ a` ޒ   ג   ِ$!``=> Hoe4  0(@f  0!``$ 4  0 4` Ho4$T(@f$T$X$\Hp@ f l!(j!X****p*\*H*4* * ***** *************t*`*`**T `"!   @(`   @*@(`  0(  0@(`  0(  @` *@@㿘`"   ``!|`` "  ` ` &` ```ha " a  |  2 `h a `h a a$&`&`l&@ `ڐ `  2   <2  `@ `l  d ` $ `l `  `l  `}@, *$ `l  `  `l  `@g@, *$ `> a۔ \&`d ``l  d "! &`l z &`l@?"`l`&@ `l ``l `l `h`la$ `l`h` $`l `' $  `U `h` $`h `   $`  ?` `@ 6 `h (``h,@ $ 0%`# `h` ` * 4a `h`ِ `Ӡ * 4a` Ȓ``d` @ `?@I `@ \ z  [`d8 \%`X`l`X` `l `%@&`d` z  `@ 5  ` @   "#4@`"  `   ` } 2  ΀`` \&`d2 2) # @ `]@` %` `%` @ `` %`  d%` %`(%` %`$` @t `:@` ~?%``@%`@ ``%``a%` (@5`4` @P q@0 `@ ``%`80``0 2`8`h`0`8` "+% <Bp `@ `@ `ݒ@ `ג@ `, ,` , % < `h`0 ")% @  /  `@ `@ `@ `@ `, ,` , % @`")% D`؀`'`{ `@ `@ `@ `}@ `, ,` , % D`8@y  @ `c@` q %`b%`  `d%` `h%`  %`T `@E` 2 0v`=@ ` @` @ Ȧ@ *``  %``%` @ ``%` ``%`" ``%`  %`i `h`>0 xX &`l@?"`l`&@ `l ``l `l `h`la$ `l`h` $`l [`l `@ ``%` ` 0% m`  `@˦ %  N ) @2   `@ %  `% ` o ` ܀`0 `@ `@  * %  `@ `@ `@ `@ `, ,` * %  `u@ `@n  * %  `c@ `]@ `W@ `@P `, ,` * ~%  `@@ `@9  * 5`4`/@ `)@ `#@ *  `, M, `@ `@ ` @ *  `, , `@ `@ `@ *  `, K,  %`8 `@ `ܒ@ * * %`< `В@ `@ɠ  * * %`DU%`@ `@ F*  `@ *  `@ ܑ*  %`8 `@ `@  %`@* %`D* &%`< `@ `@ * *  `|@ `@u * *  `k@ `@d * * > 䤐!㿐> ' !֒ 8`" <J> <ʐ!> Ɛ"> >  c(X,`a@`" 1> ` 㴐` 1> 㭐 > PR"(㦒aX> > > c> 0> 㕐X`` (`> ㍐#P > ㈐c``> 5> `89> @7> }#`4z#` `2N``8`2f> `T`> lX``2> `2> `2> `2> `2> ` 2> `@2> `2> a2> b2> d2> h> E `X`"@<``> `"> > 2#`4/#` `"`8`> '#` `   `@` @ `8`"`T>   `8`  < @` D`@`8@ `T`>  HX```>  ```~`> ݐ p``z`> ֐ ``v`> ϐ ``r` > Ȑ `` n`@>  ``@j`> ⺐ ``fa> Ⳑ `abb> ⬐ `b^d> ⥐ `dZh> ➐ `hU> ☐!▐ `X`2T2Tb1> > `<⃐!> #`4> > u#8 > p#( > k# > f# > a" > \" > W" > R" > M" > H" > C#` > >" > 9"p 5,`@a@/``4~1> k'!` `2[> > !V> > !Q> 㽐 0 4'H'L$@ ȴ#\ ̐  $@ ̰ '' '''      *@c 'LH@ ̒`' @`2&#\a #\  .`$@̓2`'̀ `? '=  ' @`߬ #\    ȟ@Ą `'''   '  ̐` '̐` C2 ̐` I2 ̐` S2  @`'   @6 / @~(~, * ~, #\$@̂ 2`''   $@  #\$@̂  |' ' M̐` ?`'LH@ 2 `1'̒`-'̃(`> `D@ 8̀̐`̠`|̠ * `7s̢`n̠`iW/@c' (` `@@` '  O@ ' @> !̐'@ Ւ  ̐.` * @`'  `; ''̐`@  `? ̐` @̰`/ ̠`@̢`@ `, ,`*  @ `'B H  ``?ސ̬`ِ̠`Ԑ̢`ϐ `, ,`*  & > ??!0 @   @ > ?-!`(''''''''''''''''''''''''''6!T 8''? a a a a a & 80a `0a!X> a$a,?`0㿘> ?bX>  b  5> k!X a4`@W!P@2`!R`2`LJ2``\!X"&!X "  Xt7  2 Xt0  2&!X&!\ `Z d r}    d $ $  \  rp ` \$X X @$ $ !\  @&!\`@!P2`!@ "`#d` 2`!D "`#[` 2`n ,a@`  2 > > a#( ` > Y !X \ r$  `N \$ X X @$dD!X,@a@> >#(4> ̓, > l aЖ@ 2 `  @+```  +` @@ 㿘a @ 㿘`"  `  `@, `|@@  (` 㿘```"  0  `@6 # 0`"#)##& 0 ## >8  `& 0&/ 㿘"l ##` 0@4## 0 @4㿘# #` R%b 5 =   㿐&c ِ > 8`>  `"> |#ebRc` 04`   > cc&cX&c\`   Bc "c> V @c> P Xz(`0`Q8`  .c d  &c`>8c&`0J`O> .!p $#` hl> c>  2 ` 04`    >  #~ #v8 (`  > גbP    |c>  > > ޢ h$`  ` `  `@*2$$``` #$ #$p$,`  04@ " $,  > ݤ  ` 04##\  > $ܢ ($܇0@(`$, 0 @4$,` 0@4  s $,p`7 $,`  04@ - $,  `0`4 #\ #܆  ( $,` 0 @4$,` 0@4> 2 >  !+ $,㿘```"   `@"6 $0`"$,]$,$,&$0Ͱ $,$,  >є&$0] `F Ȑ $0`6 $,㿘$( W; "$,$$` 0@4$,$( 0 @4$,$ 0 @4㿘> b$?,<`" $ `" $ "  $ " $    $)"?@2"?2 @2 $ " $  u 2 $ @2ڰ $  㿐&d,`  > > a0X> d a @` " m X ">  ``" a X 2 > Z"?&d( `  `  04`  "dB Xd&d&c@&cD`&d=F >  &c   Td( "> #!d,` 0@4?&d(#d,   7d$ 2> d>   X> ?  b  V W`"9 @ "* `  `$ V W!"`@"y!`` `" !`"  ! "  "J  ݢ`$ 2ת ` 2Ҫ  `acD (@cD `Psd`>d, `>sd,!&d0J`pV d,d$` 0@4d,d(` 0@40iۉ!d,h  `@ `"  `Z v W `$"``2`> _!d, 2d,>b>&c>b&c&c>>c4&c&c> &d&c `p2d>>b&c&c>>`t4&c&c> / >`܄&c&c>>a&c&c>>a&cn&c@㿘Ho&4(@g`"> b`  2! 6c& `@(&Hp@㿘`3``  ``" d`  ` & # ` ͢`$  > `ؘ&   >  o@ `@6  ``& -㿘`-!  &`  04 @   00@4僐 㿘#  ` n&@w " > `#``0`4@  @ @ > N"h`@   p @ 2O> ``@@> ;"` @@@b&@! &@ @ &@ഄ&@ &@Ă @&@ @?΂`d0@@ @ ?@?̂`h0@ `>ǖܘڠ &@ :@J> `X> c> "> .9`    @  `0`4`@ ! `  @'@&@  04` `@ > ϐ" 㿘> aD$t "  ` 2  "   `"  # 怤 ?c "2 "2@  @  `  >فb 㿘 `   JL O   JF I d 㿘0!  &@4@" 8" &`4` 1> 8 $ &`1> N!Ȅ  &@>b&@ `?@ > ~?"> `|  &@> `&@ > גa &@  &@&`b㿘> !耠`? @ @  * *@     *@ 2@ @ 2@ : :    : * @   @   @㿘  &@ `" ` ` `` * *@     *@ 2@ @ 2@ 2     2 * @ 㿐  &@``?`  `㿘?c@6 6` )$ $ $@$`ܐ`2 * @4 , @@@- @5 @@4  @,  `㿘 IA 0)  @ $@ & &$@@@`    @ $@֤ Ӓ&` ` `88 `   @  ( 0@ @0  *`(@ 2P > lb`@B  ?    ?0674 4`6`77777777`<.`"$.`0`@, * 0`@* @,* 0` @ ?@* @* 4 @* @4 *  'ĠĄ ` ?`  @(`' (`ڂ@0+`'ȉ0c'Ԅȅ(`'Ȁ` ĒOȐJ+`0'`ć0(`'@?''c''̬ @(`4`ԃ(`0`, @Ԧ@!, ,0` ĦԠĀ  ж@i$$4@@4 #@ (4` @0`5Ā И @@00`? 5ڂ1К``''Ѐ  #ȀĒ   @*`ȃ(@0 @0 *`5@(`(@?(`(@Ӄ6Ȁ (`0` ' '"@ @b   @   @> cp 㿐  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* J " ?* /> lh=%/> ∬%/> lt @`E < @   7A2Y    @2 $ a$ 4@  , ,2 @$ $ +> 'a`-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $  h %8+> 'a`+?P `-`0+-?P%/> lh@̀/> l%x/> ∬%/>=(D=(  ,%P %`8+> 'a`+?P `-`0+-?P%  ,% P %`8+> 'a`+?P `-`0+-?P%/> lx@̀'D'H'L'P'T'X@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  levelchannelphytargetlunslotoffsetconsolemuxvectdrivecontrollersocketfunctionirqpfpflogpfsyncpflowencnmeamstsendrunvndksymssystracebpfilterbridgecarpgifgreloopmpeppppppoepppxslsppptrunktunvethervlanbiohotplugwsmuxOpenBSD5.2GENERIC#88 @(#)OpenBSD 5.2 (GENERIC) #88: Thu Aug 2 18:11:37 MDT 2012 OpenBSD 5.2 (GENERIC) #88: Thu Aug 2 18:11:37 MDT 2012 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC Nonparticipating?????Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncRe-InitNVRAM 0x%08x%08x 0x%08x%08x exchg_cnt %d maxframelen %dNVRAM execthr %d loopid %d fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM 0x%08x%08x 0x%08x%08x maxalloc %d maxframelen %dexecthrottle %d fwoptions 0x%x hardloop %d tov %dxfwoptions 0x%x zfw options 0x%xinvalid NVRAM header (%x %x %x)invalid NVRAM checksuminvalid NVRAM header%x %x %xversion %d NVRAM not understoodUsing Node WWN 0x%08x%08xbad WWNN- using defaultUsing Port WWN 0x%08x%08xbad WWPN- using defaultDMA error for command on %d.%d.%dtransport error for %d.%d.%dbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%ddata reassembly error for target %dtarget %d sent ABTSmarkednot marked%d.%d.%d data underrun (%d) for command 0x%xunavailablelogoutport %s for target %dport changed for target %df/w resource unavailable for target %dcommand for target %d overlapped task managementUnknown Completion Status 0x%xUnknown Command 0x%xno parameters for 0x%xIN mbox %d = 0x%04xOUT mbox %d = 0x%04xopcode %xHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USEREGISTERS BUSYerror 0x%xTIMEOUTMailbox Command '%s' failed (%s)skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xisp_plogi_old: portid 0x%06x already logged in as %uisp_plogi_old: handle %u in use for port id 0x%02xXXXXisp_plogi_old: error 0x%x in PLOGI to port 0x%06xisp_plogi_old: all IDs used for fabric loginisp_plogi_old: error 0x%x on port login of 0x%06x@0x%0xInitiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Cannot setup DMA2100220023002312232224221240101601216012801080LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode CapableDMA Failed to Stop on ResetFailed to come out of resetchip reset timed outreset didn't clearMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)load 0x%x words of code at load address 0x%xF/W Risc Ram Load FailedF/W download failed at word %dskipping f/w downloadf/w didn't *really* startresidentloadedboard type %s rev 0x%x, %s firmware rev %d.%d.%dFirmware Attributes = 0x%x2K Logins SupportedLast F/W revision was %d.%d.%d%d max I/O command limit setSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiationtransport error for %d.%d.%d: %scommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freeInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport busy for target %dCommand for fast post handle 0x%x not foundIgnored Continuation ResponseMarker Responseunstable type in response queueUnhandled Response Type 0x%xAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneline %d: markportdbLIP destroyed %d active commandsPoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)LS_RJT sentQFULL sentUnknown Async Code 0x%xfast post completion of %umailbox cmd (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyisp_intr: hard optr=%x, soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xResponse Queue EntryRequest Queue Entrycontinuation segmentinternal queues fullbad header flagbad request packetbad request handle %d (type 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)%d.%d.%d FCP RESPONSE: 0x%xasked for %ld got raw resid %ld settled for %ldRequest Queue Entry bounced backBounced RequestUnhandled Response TypeAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)XS_TGT(xs)=%d- hdlidx value %dRequest Queue Overflowout of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldFC scratch area busy (line %d)!IOCB responseCT Passthrough returned 0x%xRegister FC4 Type rejectedRegister FC4 Type acceptedRegister FC4 Type: 0x%xscanning fabric (GID_FT) via CTct IOCBCT HDR + payload after putCT responsescanning fabric (GID_FT) via SNSno loop topology to scanFC scan loop 0..%dgiving up on synchronizing the port databasebad pdb (%1d%1d%1d) @ handle 0x%x[%d] not probational/zombie (0x%x)Loop Port 0x%02x@0x%x Pending ValidLoop Port 0x%02x@0x%x changedout of portdb entriesLoop Port 0x%02x@0x%x is New EntryFC Link Test EntryFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08xisp_fclink_test: not at FW_READY stateisp_fclink_test: register fc4 type failed4Gb link speed/s2Gb link speed/sFC Link Test CompleteIOCB LOGXIOCB LOGX responsestatus 0x%x on port login IOCBPLOGX failed- no linkPLOGX failed- no IOCB bufferPLOGX failed- no Exchange Control BlockPLOGX(0x%x) of Port 0x%06x failed: reason 0x%x (last LOGIN state 0x%x)PLOGX failed- no fabricPLOGX failed- f/w not readyPLOGX failed- not logged in (last LOGIN state 0x%x)PLOGX failed: LS_RJT = 0x%xPLOGX failed- no PCB allocatedPLOGX failed: invalid parameter at offset 0x%xportid 0x%x already logged in with N-port handle 0x%xN-port handle 0x%x already used for portid 0x%xPLOGX failed- no handle allocatedPLOGX failed- no FLOGI_ACCstatus %x from %xPLOGI 0x%06x failednew device 0x%06x@0x%x disappearednew device 0x%06x@0x%x changed (0x%06x@0x%0x)FC Scan FabricFC Scan Fabric Done (no fabric)Fabric Nameserver rejected GID_FT (Reason=0x%x Expl=0x%x)fabric too big for scratch area: increase ISP2100_SCRLENgot %d ports back from name serverremoving duplicate PortID 0x%x entry from listskipping null PortID at idx %dskip ourselves @ PortID 0x%06xChecking Fabric Port 0x%06xFabric Port 0x%06x considered deadchanged WWN after reloginFabric Port 0x%06x changedFabric Port 0x%06x Now Pending ValidPortID 0x%06x already at %d handle %d state %dport database too small to login PortID 0x%06x- increase MAX_FC_TARGFabric Port 0x%06x is New EntryPortID 0x%x 0x%08x%08x/0x%08x%08x %ld already at idx %d, state 0x%xZombie Fabric Port 0x%06x Now ChangedZombie Fabric Port 0x%06x Now Pending ValidFC Scan Fabric Doneisp_pdb_sync: bad loopstate %disp_pdb_sync: isp_scan_loop failedisp_pdb_sync: isp_scan_fabric failedSynchronizing PDBsportdb idx %d already validisp_scan_loop: state %d for idx %dUnknown Control Opcode 0x%xRESET BUS NOT IMPLEMENTEDdriver initiated bus reset of bus %dRESET DEV NOT IMPLEMENTEDTarget %d on Bus %d Reset Succeededcannot find handle for command to abortABORT CMD NOT IMPLEMENTEDbad frame length (%d) from NVRAM- using %dbad execution throttle of %d- using 16bad value %x in fwopt2 timer fieldSetting ICB Node 0x%08x%08x Port 0x%08x%08xSetting ICB Port 0x%08x%08xNo valid WWNs to useisp_fibre_init_2400: fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xisp_fibre_init_2400: rqst %04x%04x%04x%04x rsp %04x%04x%04x%04xisp_fibre_init_2400INIT F/W from %04x%04x%04x%04xbad maximum allocation (%d)- using 16isp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xINIT F/W from %p (%08x%08x)isp_fibre_initisp_reinit cannot reset cardisp_reinit cannot restart cardNO-OPLOAD RAMEXEC FIRMWAREDUMP RAMWRITE RAM WORDREAD RAM WORDMAILBOX REG TESTVERIFY CHECKSUMABOUT FIRMWAREWRITE RAM WORD EXTENDEDREAD RAM WORD EXTENDEDCHECK FIRMWAREINIT REQUEST QUEUEINIT RESULT QUEUEEXECUTE IOCBWAKE UPSTOP FIRMWAREABORTABORT DEVICEABORT TARGETBUS RESETSTOP QUEUESTART QUEUESINGLE STEP QUEUEABORT QUEUEGET DEV QUEUE STATUSGET FIRMWARE STATUSGET LOOP IDGET RETRY COUNTGET FIRMWARE OPTIONSGET PORT QUEUE PARAMSSET RETRY COUNTSET FIRMWARE OPTIONSSET PORT QUEUE PARAMSLOOP PORT BYPASSLOOP PORT ENABLEGET RESOURCE COUNTREQUEST NON PARTICIPATING MODEGET PORT DATABASE ENHANCEDEXECUTE IOCB A64DRIVER HEARTBEATGET/SET DATA RATEINIT FIRMWAREINIT LIPGET FC-AL POSITION MAPGET PORT DATABASECLEAR ACATARGET RESETCLEAR TASK SETABORT TASK SETGET FW STATEGET PORT NAMEGET LINK STATUSINIT LIP RESETSEND SNSFABRIC LOGINSEND CHANGE REQUESTFABRIC LOGOUTINIT LIP LOGINLOGIN LOOP PORTGET PORT/NODE NAME LISTSET VENDOR IDINITIALIZE IP MAILBOXGet ID ListSEND LFALun RESETGET INIT SCSI IDGET SELECT TIMEOUTGET TAG AGE LIMITGET CLOCK RATEGET ACT NEG STATEGET ASYNC DATA SETUP TIMEGET PCI PARAMSGET TARGET PARAMSGET DEV QUEUE PARAMSGET RESET DELAY PARAMSSET INIT SCSI IDSET SELECT TIMEOUTSET TAG AGE LIMITSET CLOCK RATESET ACT NEG STATESET ASYNC DATA SETUP TIMESET PCI CONTROL PARAMSSET TARGET PARAMSSET DEV QUEUE PARAMSSET RESET DELAY PARAMSRETURN BIOS BLOCK ADDRWRITE FOUR RAM WORDSEXEC BIOS IOCBSET SYSTEM PARAMETERGET SYSTEM PARAMETERGET SCAM CONFIGURATIONSET SCAM CONFIGURATIONSET FIRMWARE FEATURESGET FIRMWARE FEATURESLOAD RAM A64DUMP RAM A64INITIALIZE REQUEST QUEUE A64INITIALIZE RESPONSE QUEUE A64ENABLE TARGET MODEGET TARGET MODE STATESET DATA OVERRUN RECOVERY MODEGET DATA OVERRUN RECOVERY MODESET HOST DATAGET NOST DATAPrivate LoopFL PortN-Port to N-PortF PortF Port (no FLOGI_ACC response)????isp_read_nvramisp_mboxcmdisp_parse_statusisp_intrisp_startisp_register_fc4_type_24xxisp_register_fc4_typeisp_gid_ft_ct_passthruisp_gid_ft_snsisp_getpdbisp_scan_loopisp_fclink_testisp_plogxisp_scan_fabricisp_fibre_init_2400isp_fibre_init%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%xNVRAM%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedO/!OOOO?????OOOO?*H*P*`*p******P*p*****0*H*X*`*p*x********* *0*@*X*p********8*P*h********** *0*@*P*`*p**********H*P*`*p********0*H*X*`*p*x*********(*@*0*X*p********(*p*@*X*h********0*@*X*p********8*0*H*`***bad underrun for %d.%d (count %d, resid %d, status %s)HBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %d%d.%d.%d: FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%xPortDB[%d] changed: current =(0x%x@0x%06x 0x%08x%08x 0x%08x%08x) database=(0x%x@0x%06x 0x%08x%08x 0x%08x%08x)HBA PortID 0x%06x N-Port Handle %d, Connection Topology '%s'HBA WWNN 0x%08x%08x HBA WWPN 0x%08x%08x*****bus %d is in %s ModeDownloaded RISC Code Checksum Failure%s: ispmbx_sleepInterruptingPolled%s Mailbox Command (0x%x) Timeout (%uus)target %d has departedtarget %d has arrived, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing EnabledBus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPout of target idsarrived atarrivedchanged atchangedstayed atstayedgone zombie atdepartedPort Database ChangedName Server Database ChangedOther Change NotifyInternal Firmware Error on bus %d @ RISC Address 0x%xfinished command on borrowed timerestarting blocked queuerestarted command for %d.%dblocked cmd again%s for %d.%dCMD_RQLATERrequeued %d commandswatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%disp(none)TargetTarget/Initiatorisp_wdog*p*x-z*PortID 0x%06x handle 0x%x role %s %s tgt %u WWNN 0x%08x%08x WWPN 0x%08x%08xPortID 0x%06x handle 0x%x role %s %s WWNN 0x%08x%08x WWPN 0x%08x%08x UNK TGT INITINI%3d---%d: hdl 0x%x %s al%d tgt %s %s 0x%06x =>%s 0x%06x; WWNN 0x%08x%08x WWPN 0x%08x%08x%s:%s %02x0x%08x:%s%s index %d=> isp_fc_runstate: linktest failedisp_fc_runstate: f/w not readyisp_fc_runstate: scan loop failsisp_fc_runstate: scan fabric failsisp_fc_runstate: pdb_sync failsisp_fc_runstate: f/w not ready againNIL PROBDEADCHGDNEW PVLDZOMBVLD isp_print_bytesisp_print_qentry***** *(*0*8[wrfifo(%d): %02xregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] %s: resetting SCSI bus [flushfifo] %s: unknown revision code, assuming ESP100 ncr53c9x_rdfifo: bad flagcont [rdfifo %s (%d):ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d [NCR_INIT(%d) %d] ncr53c9x_ecbDMA activetimed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled out of memory %s: unknown variant %d, devices not attached : %s, %dMHz [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_scsi_cmd] [0x%x, %d]->%d espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HME %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! %s: media_status on unknown chipset 0x%x /(unknown/impossible media)/autoselect default %s%s (default %s) ep_get: packet does not fit in MCLBYTES address %s, wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? %s: device timeout epstart: no header mbufutpauireservedbnc100-TX100-FXmii100-T4*# *%** $*(& *0'@@*8&*@(#%$&'&(epgetwi_do_hostdecryptwi_do_hostencryptwi_attach** *8*X*p***** * *  *8 *8 *8*8*P*P*P*`*`*`*`*********P*P *P!*"*#*$*%*&*'*%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: init failed %s: wi_mgmt_xmit: xmit failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiiocwiscan%s: wi_cmd failed with %d %s: tx buffer allocation failed %s: mgmt. buffer allocation failed wiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_deauth_req: unknown station: %s wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_assoc_reqwihap_ioctl 7n%s: overflow %s: receive buffer error %s: dropping chained buffer missing buffer, no_td = %d, last_td = %d %s: controller failed to initialize %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled am7990_config: weird memory size %lu: address %s %s: %d receive buffers, %d transmit buffers ne2000_detectne2000_attach: where did the card go? : setup failed ne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: remote transmit DMA failed to complete  @ @ Xh%s: mii_write timeout %s: mii_read timeout %s: status=%b INTMETXEMPTYTXDONERXDONERXNOBUFRX_TAG_ERRPCSTXMACRXMACMACCONTROLMIFBERRgem: invalid Receive Descriptor ring size %d %s: cannot disable tx dma %s: cannot reset transmitter %s: cannot disable rx dma %s: cannot reset receiver %s: cannot reset device %s: can't load rx DMA map %d, error = %d gem_add_rxbuf %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create rx DMA map %d, error = %d %s: unable to create tx DMA map %d, error = %d , address %s gem%s: board self-diagnostics failed! %s: unsupported chip revision: %x %s: bios thinks we're in a 64 bit slot, but we aren't%s: unknown hwrev ti_jfree: can't find softc pointer!ti_jfree: asked to free buffer that we don't manage!ti_jfree: buffer already free!ti_jfree: buffer not in use!ti_iff%s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: no memory for jumbo buffer queue %s: can't create recv map %s: overwritten!!!%s: couldn't get mbufnot enough mbufs for rx ring%s: unknown link state code %d %s: invalid command %s: unknown command %s: bad config data %s: unknown event: %d tigon1%s: can't load firmware: unknown hardware rev tigon2%s: firmware revision mismatch; want %d.%d.%d, got %d.%d.%d %s: initialization failure %s: watchdog timeout -- resetting %s: failed to send write command, status: %x %s: failed to send address, status: %x %s: failed to send read command, status: %x %s: chip initialization failed %s: failed to read station address %s: jumbo buffer allocation failed titi_handle_events%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interruptcomprm%s: %d silo overflow%s, %d ibuf overflow%s comcomstart|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" micspkrhpmonitorsourcemuteinputsoutputsmulawslinearulinearalawvscsiccbdiagnostic ../../../../dev/vscsi.csc->sc_state == VSCSI_S_RUNNINGvscsiref%s: POLL && NOSLEEP for 0x%02x vscsipollvscsiiocvscsiinvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d unknown optional metadata type%s: unable to start background operation %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s ../../../../dev/softraid.clink->target < SR_MAX_LD && link->lun == 0sc->sc_dis[sd->sd_target] == sdsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_wu_put got active wuvolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwdfailed to allocate boot volume%s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: save metadata failed %s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_sync%s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: sr_scsi_cmd got active wu%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuild_threadsr_check_io_collisionsr_raid_startwuRAID 0 requires two or more chunksRAID 0sr_raid0_rw%s: %s: too many ccbs queued %s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue %s: sr_raid1_recreate_wucould not requeue ioinvalid volume stateRAID 1 requires two or more chunksRAID 1%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld sr_raid1_rw%s: is offline, can't read %s: sr_raid1_rw%.2x %c%s: %s: invalid volume state transition %d -> %dRAID 4RAID 5%s: %s: %s: invalid chunk state transition %d -> %dio error: disk %x sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer sr_crypto_rw2%s: sr_crypto_rw2%s: sr_crypto_finish_iocannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskKEYDISKunable to allocate work unitsunable to allocate CCBsincorrect key or passphraseCRYPTO requires exactly one chunkCRYPTOsr_crypto_wu_get: out of wus../../../../dev/softraid_crypto.ccrd%s: i/o error on block %lld sr_crypto_intr: no wusr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlsr_crypto_finish_ioold_state = %d, %d = %d, invalid new_stateRAID 6sr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s CONCAT requires two or more chunksCONCATsr_concat_rw/dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf_change_appf_change_a6pf_change_icmppf_rtlabel_matchpf_calc_msspf_routablepf_get_wscalepf_modulate_sackpf_get_msspf_tcp_isspf_send_tcppf_src_connlimitpf_insert_src_nodepf_test_state_icmppf_testpf_route6pf_routepf_free_statepf_unlink_statepf_state_insertinvalid address type: %d FUW%u.%u.%u.%u:%u[%u]IPv4IPv6TCPUDPICMPICMPv6 in wire: (%d) stack: (%d) - [lo=%u high=%u win=%u modulator=%u wscale=%u %u:%u @%dOUTINpf: state key linking mismatch! dir=%s, if=%s, stored af=%u, a0: , a1: , proto=%u, found af=%u, a0: pf: IPv6 short opt typeIPv6 short optIPv6 long optIPv6 multiple jumboIPv6 bad jumbo plenIPv6 short jumboIPv6 short jumbolenIPv6 multiple fragmentIPv6 fragmented jumboIPv6 short fragmentIPv6 multiple rthdrIPv6 short rthdrIPv6 rthdr0IPv6 short exthdrIPv6 missing jumbopf_setup_pdesc called with illegal af %u../../../../net/pf.cstate->timeout != PFTM_UNLINKEDstate->timeout < PFTM_MAXpf_test_via: kif == NULL, @%d via %spf_step_into_anchor: stack overflow cur->timeout == PFTM_UNLINKEDpftmpf: pf_src_connlimit: blocking address , %u states killedpf: loose state match: fwdrev seq=%u (%u) ack=%u len=%u ackskew=%d pkts=%llu:%llu dir=%s,%s pf: BAD state: pf: State failure on: %c %c %c %c | %c %c s->key[idx] == NULLpf: %s key attach failed on %s: wire, existing: stackpf: state insert failed: id: %016llx creatorid: %08xpf: src_tree insert failed: pf: key search, if=%s: pdpd->srcpd->dstpf: state reuse pf: key setup: dropping packet with ip/ipv6 options in pf_test_rule()pf_normalize_tcp_stateful failed on first pktpf: icmp type %d in wrong direction (%d): ICMP error message too short (ip)ICMP error message too short (ip6)ICMP error message too short (tcp)pf: BAD ICMP %d:%d -> state: seq=%u pf: OK ICMP %d:%d ICMP error message too short (udp)ICMP error message too short (icmp)ICMP error message too short (icmp6)pf_test: kif == NULL, if_xname %snon-M_PKTHDR is passed to pf_testdropping IPv6 packet with ICMPv4 payloaddropping IPv4 packet with ICMPv6 payloaddropping packet with ip/ipv6 options in pf_test()pf_route6: invalid parameterspf_route6: m0->m_len < sizeof(struct ip6_hdr)pf_route6: pf_map_addr() failed.pf_route: invalid parameterspf_route: m0->m_len < sizeof(struct ip)pf_route: pf_map_addr() failed.pf_normalize_msspf_normalize_tcp_statefulpf_normalize_tcp_initpf_reassemble6pf_reassemblepf_normalize_tcp_stateful../../../../net/pf_norm.c!TAILQ_EMPTY(&frag->fr_queue)missing fragment at %d, next %d, total %d%d < %d?off == totalsrc->scrub || dst->scrubpf: %s: multiple TS??pf: src idled out of PAWS pf: dst idled out of PAWS Timestamp failed %c%c%c%c tsval: %u tsecr: %u +ticks: %u idle: %lus %lums src->tsval: %u tsecr: %u dst->tsval: %u tsecr: %u tsval0: %upf: did not receive expected RFC1323 timestamppf: broken RFC1323 stack did not timestamp data packet. Disabled PAWS security.src->scrub == NULLtrying to free > %d frentsexpiring %d(%p)pf_refragment6: short mbuf chainrefragment error %dpffrentpffragpfstscrbad fragment: len 0bad fragment: mff and len %dbad fragment: max packet %dreass frag %d @ %d-%dreass frag %#08x @ %d-%dprev != NULL || after != NULLnew frag overlappedfrag head overlap %dfrag tail overlap %dold frag overlappedflush overlapping fragmentsfrent != NULLpf_reassemble6: short mbuf chaindrop: too big: %dcomplete: %p(%d)bad fragment: IP_DF../pf_anchor_copyout: '%s' '%s'/*pf_anchor_remove: broken refcountpf_find_or_create_ruleset: RB_INSERT1 '%s' '%s' collides with '%s' '%s'pf_find_or_create_ruleset: RB_INSERT2 '%s' '%s' collides with '%s' '%s'pf_anchor_setup: .. beyond rootpf_anchor_setup: rulesetpf_setup_pfsync_matchingpf: startedpf: stoppedaltq: startedaltq: stoppedpfpurgepfpurge threadpfruleplpfsrctrplpfsnitemplpfstateplpfstatekeyplpfstateitemplpfruleitemplpfaltqplpfcnslkpfr_mark_addrs: IPv4 walktree failed.pfr_mark_addrs: IPv6 walktree failed.pfr_enqueue_addrs: IPv4 walktree failed.pfr_enqueue_addrs: IPv6 walktree failed.pfr_update_stats: assertion failed._pfpfr_get_astats: corruption detected (%d)pfr_get_addrs: corruption detected (%d)pfr_get_tables: corruption detected (%d).pfr_unroute_kentry: delete failed. pfr_detach_table: refcount = %d.pfr_clr_addrs: corruption detected (%d).pfr_insert_kentries: cannot route entry (code=%d).unknown pfrke_type %dpfr_states_decrease: states-- when states <= 0pfrktablepfrke_plainpfrke_routepfrke_costpfrkcounterspfr_get_tstats: corruption detected (%d).pfr_pool_getpfr_clr_tstatspfr_reset_feedbackpfr_unroute_kentrypfr_set_tflagspfr_del_tablespfr_attach_tablepfr_add_tablespfr_route_kentrypfr_lookup_addrpfr_kentry_byaddrpfr_commit_ktablepfr_ina_definepfr_clr_astatspfr_tst_addrspfr_set_addrspfr_del_addrspfr_add_addrspfr_walktreeFound "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" osfp no match against %xosfp matched %s %s %s %x==%xfingerprint 0x%x didn't match%adding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %xpfosfpenpfosfpfingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d)pf_osfp_fingerprint_hdrpf_osfp_fingerprintpfi_kif_getpfi_update_statuspfi_dynaddr_setuppfi_address_add: address buffer full (%d/%d)pfi_address_add: no memory to grow buffer (%d/%d)pfi_table_update: cannot set %d new addresses into table %s: %dpfi_kif_unref: rules refcount <= 0pfi_kif_unref: state refcount <= 0pfi_kif_unref with unknown typepfi_kif_ref with unknown typepfi_dynaddr_updatepfiaddrplpfi_kif_get for pfi_all failedpfi_kif_get failedpfi_attach_ifnet: cannot allocate '%s' address hookself:network:broadcast:peer:0/%dpf: pf_unlink_state: unable to optain addresspf: pf_unlink_state: selected address . Failed to decrease count! decreased state count to %u pf: pf_map_addr: src tracking (%u) maps to pf: pf_map_addr: weighted RR failurepf: pf_map_addr: selected address . Failed to increase count! with state count %llu with weight %uinetinet6natrdrpf: af-to %s %s, pf_get_transaddr_af: no nat pool for source addresspf: af-to NAT proxy port allocation (%u-%u) failedpf: af-to %s %s done, prefixlen %d, pf: NAT proxy port allocation (%u-%u) failedpf_postprocess_addrpf_map_addrpf_get_sportpf_get_transaddr_afpf_get_transaddrpflog_packetpflog_bpfcopypflogattach: no mbufpflog_bpfcopy got no mbufno second mbufpflog%d../../../../net/if_pfsync.cst->sync_state != PFSYNC_S_NONEpfsync: cancelling bulk updatereceived bulk update startpfsync link state uppfsync bulk donepfsync initreceived valid bulk update endreceived invalid bulk update end: bad timestamppfsync_deferred: unable to find deferred statereceived bulk update requestst->sync_state == PFSYNC_S_NONEpfsync_delete_state: unexpected sync state %dpfsync_update_state_req: nonexistant instancepfsync_update_state_req: unexpected sync state %dpfsync_update_state: unexpected sync state %dpfsync bulk startrequesting bulk updatepfsync link state downpfsync_insert: PFSYNC_ACT_TDB_UPD: invalid valuepfsync_state_import: invalid creator id: %08xpfsync_state_import: unknown interface: %spfsync_input: PFSYNC5_ACT_INS: invalid valuepfsync%dpfsync destroypfsync bulk failfailed to receive bulk updatepfsync_input: PFSYNC_ACT_UPD_C: invalid valuepfsync_input: PFSYNC_ACT_UPD: invalid valuepfsync_clear_statespfsyncioctlpfsync_clear_statespfsync_delete_statepfsync_update_statepfsync_deferredpfsync_undeferpfsync_deferpfsync_insert_statepflow_pack_flow_ipfixexport_pflow_ifpflow%d%s: insufficient message buffers %s: %s bioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachhtplevhotplug: event lost, queue full %s (%x) state=%d, session=0x%x output -> %s, len=%d pppoe_send_padi in state %d%s: failed to send PADI, error=%d pppoe%d%s: timeout %s: could not establish connection %s: failed to transmit PADI, error=%d %s: failed to send PADR, error=%d %s: disconnecting ../../../../net/if_pppoe.cm->m_flags & M_PKTHDRpppoe: packet too short: %d pppoe: could not get PPPoE header pppoe: unknown version/type packet: 0x%x pppoe: packet content does not fit: data available = %d, packet size = %u %s: parse error %s: tag 0x%x len 0x%x is too long pppoe: alien host unique tag, no session found %s: host unique tag found, but it belongs to a connection in state %d %s: wrong interface, not accepting host unique TAG ACCOOKIE ERRORTAG RELAYSID ERRORTAG MAX_PAYLOAD ERRORSERVICE NAME ERRORAC SYSTEM ERRORpppoe: received PADO but could not find request for it %s: received unexpected PADO %s: No valid PPP-Max-Payload tag received in PADO %s: session 0x%x connected %s: session 0x%x terminated, received PADT %s: unknown code (0x%04x) session = 0x%04x pppoe (data): dropping too short packet: %d bytes pppoe (data): could not get PPPoE header pppoe (data): unknown version/type packet: 0x%x GENERIC ERROR%s: %s: TAG HUNIQUE ERRORpppoe_outputpppoe_timeoutpppoeintrinit_machclkaltq_add: no cpu clockaltq assertion "%s" failed: file "%s", line %d altq assertionoldtbr_set: no cpu clock available! invalid weight value %d for red! use %d cbq_add_queue: no parent class! cbq_add_class: borrow class != parent altq: packet for %s does not have pkthdr rmc_root_overlimit_rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_init: root class not allocated altq_hfsc_dequeue:Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsnfsreqsnfsnodesbcstatsbreaksbufextentsmallocnfsreqnfsnodeobjectpagepanicpoolregistersuvmexpwatchessynccrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnexttraceshowboothelphangmandmesgdb_fncalldb_command.strtab[ %s symbol table has bad start address %p ] bad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*lodb_print_cmddb_examineSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%sdb_show_regs [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] db_printsymAfter %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. db_write_cmdau_get_muteau_get_gainau_get_portaudiogetinfoau_set_portau_set_gainau_set_mutewskbd_set_mixervolumeaudio_silence_copyoutau_portofaudioattachaudiosetinfoaud_qmiaudiooplaudioprint: unknown type %dmpu%s at %saudio_attach_mi: NULL audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer selectauddetaudiodetach: %s didn't detach aud_draud_qwraud_wraud_qrdaud_hraud_rdaudpquiaudrquiaudio_open: 0 precision aud_qioinputdacmasterlinecdcnopen: recursive/etc/firmware/%sncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: reselect, no REQ ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? %s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d DATA_OUTDATA_INCOMMANDSTATUSUNSPEC1UNSPEC2MSG_OUTMSG_IN+#+#+#+#+#+#+#+$%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbufdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%d%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d dp8390_init ##$  !"#$%&'()*+,-./02468:<>AEIMS[g****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80( jkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP%s: %u: policy %d %s: %u: %p(%lu) %s: free %d %s: allocating %d -> %lu %s: new, ents %d %s: %d -> pid %d %s: %d: code %d -> policy %d %s: %p: pid %d -> pid %d systrmsg%s: Trying to detach from %d strprocplstrpolplsystrrd../../../../dev/systrace.cstrp->proc == psystrace: pid %u killed on syscall %d systrace_fork%s: attach to %u: %d systrace_msg_policyfreesystrace_msg_childsystrace_newpolicysystrace_detachsystrace_iosystrace_getcwdsystrace_policysystrace_answersystracef_ioctlvndioctl: null vpWARNING: no memory for vnode disks vnd%d%s: sloppy %s from proc %d (%s): blkno %lld bcount %ld vndioctlvndencryptextract_entropyarc4_initrandomread;n vAMaX ֣d° xcd9660_reclaim: pushing activecd9660_inactive: pushing active..RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_device     x  x8 4 8tag VT_ISOFS, isofs vnode cd9660_strategy: specudf_disklabelspoof*UDF Virtual Partition*UDF Sparable Partition*UDF Metadata PartitionCannot read sector %d Invalid file entry! unodeUnrecognized file type (%d) found a vnode alias udftrpludfndpludfdsplCan't read sector %d of VDS Cannot read sector %d for Metadata File Entry Invalid Metadata File FE @ sector %d! (tag.id %d) FSD does not lie within the partition! Cannot read sector %d of FSD Couldn't find the fsd Invalid root file entry! udf_find_partmaps D  Ɯ ( h  Cannot deal with strategy4096 yet! Unknown strategy type %d SFile offset out of bounds (%d > %d) LFile offset out of bounds (%d > %d) Unsupported allocation descriptor %d warning: udf_readlblks returned error %d udf: invalid FID fragment udf: invalid FID tag VT_UDF, hash id %u udf_transname(): name too long udf_transname(): Unicode translation failed udf_allocv: failed to allocate new vnode hash entry is NULL, up->u_ino = %dInvalid FID tag (%d) uiomove returned %d udf_lookup: Invalid tag udf_readdir%s@%dOpenBSDcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldexec: a VTEXT vnode has writecount != 0coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_file#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dexec_process_vmcmds: RELATIVE no basevmcmdset_extend: not necessary../../../../kern/exec_subr.cocnt > 0/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerfork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2012 OpenBSD. All rights reserved. http://www.OpenBSD.org Accounting resumed Accounting suspended acctacct_threadacct_processbqquiesbqqueuebqdestbufq_init: type %i unknownbufq init failbqinit < <@ < ;8 ;p ; kn_status & KN_QUEUED(kn->kn_status & KN_QUEUED) == 0kqreadreltimespeckqueueplknotepl r rexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i../../../../kern/kern_exit.cTAILQ_EMPTY(&pr->ps_threads)init died (signal %d, exit %d)thrdeathcpu_exit returnedwaitprocessppwaittforkunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d ../../../../kern/kern_ktrace.cnewvp != NULLnewcred != NULLktrace write failed, errno %d, tracing stopped ktremulktrstartktrstructktrcswktrpsigktrnameiktrsysretktrsyscallktrgenio lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendinglockmgr: process context requiredlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: release of unlocked lock!lockmgr: draining against myselflockmgr: unknown locktype request %dlkmlookupDDB symbols added: %ld bytes lkmopn%15s %5s %6s %7s %6s %9s %8s %8s TypeInUseMemUseHighUseLimitRequestsType LimKern Lim%15s %5ld %6ldK %7ldK %6ldK %9ld %8d %8d malloc - bogus type../../../../kern/kern_malloc.cflags & (M_WAITOK | M_NOWAIT)malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_map???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple frees%d,%s,freedevbufdebugpcbroutetblfragtblifaddrsooptssysctlioctlopsiovNFS reqNFS mountnamecacheUFS quotaUFS mountshmVM mapsemdirhashACPIVM pmapfile descsubprocVFS clusterMFS nodeExport HostNFS srvsockNFS daemonip_moptionsin_multiether_multimrtISOFS mountISOFS nodeMSDOSFS mountMSDOSFS fatMSDOSFS nodettysexecmiscfs mountpfkey dataxform_datapagedepnewblkindirdepVM swapUVM amapUVM aobjUSBUSB deviceUSB HCmemdesccrypto dataIPsec credspacket tagsemuldataip6_optionsNDPtempNTFS mountNTFS nodeNTFS fnodeNTFS dirNTFS hashNTFS attrNTFS dataNTFS decompNTFS vrunkqueuebluetoothbwmeterUDF mountUDF file entryUDF file idBluetooth HIDAGP MemoryDRMsysctlklk??%s: lock held%s: lock not shared%s: lock not held%s: lock not held by this processrw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%x $$todo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenmawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s STRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITSSTEPSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession but not curprocchgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlesleepstopzombiedeadonproc+P*m+P+P+P+P +P(plimitplrlimit../../../../kern/kern_sched.c(self->ci_schedstate.spc_schedflags & SPCF_SHOULDHALT) == 0idle%dfork idlep->p_wchan == NULLp->p_stat == SRUNcpu_switchto returnedci == curcpu()curproc == spc->spc_idleprocsched_chooseprocremrunqueuesetrunqueuesched_idlestunrsensor_task_unregister: unexpected state %dsensordev../../../../kern/kern_sig.cpr->ps_single == ppausesingle_thread_mode = %dsuspendsigactionusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.corepostsigpostsig actionProcess (pid %d) got signal %d issignal psignal signal numbersigaplsigwaiterror != 0p->p_sigwait != 0coredump_tradcoredumphashinit: bad cntureadc: zero residureadc: non-positive iovcntuiomove: modeuiomove: proc%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlksysctl_diskinitkern_sysctlwakeup: p_stat is %dsleep_finish !SONPROCtsleep: no identtsleep: not SONPROCabstimespecthrsleepsleep_finishabstimevalnanosleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds %9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func timeout_add: not initializedtimeout_add: to_ticks (%d) < 0boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %s../../../../kern/sched_bsd.cp->p_stat != SONPROCp->p_cpu == curcpu()phzsetrunnablepreempt: cpu_preempt not yet implementedresetprioritysetrunnablemi_switchupdatepriconfig_activate_children: device %s failed %d failing resume cannot be handled resume %s config_pending_decr: config_pending == 0config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureautoconfconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: %s attached at %s config_detach: detached device (%s) has children%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe ../../../../kern/subr_autoconf.ccd->cd_devs != NULLdev->dv_unit < cd->cd_ndevscd->cd_devs[dev->dv_unit] == NULL%s at rootroot device %s not configured not configured unsupported config_detach/dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]disk_unbusy: %s: dk_busy < 0 ../../../../kern/subr_disk.cpart >= 0 && part < MAXPARTITIONSdisk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)dkopendisklabels not read: (default %sexitswap device (default %s%s)root device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not foundroot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%cdisk_mapfindblkmajordk_mountrootdisk_attach_callbacksetroot%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: extent `%s', start 0x%lx, size 0x%lx %s: extent `%s', region not within extent%s: overflow%s: start 0x%lx, end 0x%lx %s: region not found%s: extent `%s', size 0x%lx %s: bad size%s: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusive%s: extent `%s' (0x%lx - 0x%lx) %s: region lies outside extent%s: can't allocate region descriptor %s: name == NULL%s: extent `%s', start 0x%lx, end 0x%lx %s: end < start%s: fixed extent, bad storagesize 0x%lx%s: storage provided for non-fixedextentpl%s: already registered%s: NULL result pointer%s: extent `%s', ex_start 0x%lx, ex_end 0x%lx %s: substart 0x%lx, subend 0x%lx %s: bad subregion%s: bad alignment%s: extent `%s', size 0x%lx, boundary 0x%lx %s: bad boundary%s: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx %s: overflow after alignmentextent_print1extent_freeextent_alloc_subregionextent_alloc_regionextent_destroyextent_createextent_registerklog page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s NameSizeFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s Allocator%-10s %18p %18p inf %*u %*lu %*d %*s %*lu ../../../../kern/subr_pool.c((((vaddr_t)pi) + ioff) & (align - 1)) == 0pool_put of NULLpool %s: putting with none out pool_do_putph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpool_do_put: %s: page header missingpr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentph->ph_nmissing == 0pool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)flags & (PR_WAITOK | PR_NOWAIT)pool_get: PR_ZERO when ctor setpool_do_get: %s: crossed hard limitpool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpooldb_show_all_poolspool_do_putdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad basepanic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d%s: table is full kprintflogpri*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at root ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s%3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot %3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindlistquittimezoneverboseassertwaitok: non-zero mutex count: %dassertwaitokfdsetreltimevalpollpipeplpipelkpipeclpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewr../../../../kern/sys_process.c(p->p_flag & P_SYSTEM) == 0ptrace: impossibleSysV message longer than MSGMAXmsg NULLfreeing message queue with active referencesmsgwaitmsgqrmsysvmsgplsemexit - semid not allocatedsemexit - semnum out of rangesemwaitsemop - can't undo undossemaplsemuplshmplshmseg free count inconsistentttwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ttyunblockttypendttnreadttyfree: tty_count < 0ttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d ttrstrtptydevnameptcwriteptcread/dev/XtyXXpqrstuvwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZptmattach: Can't find pty slave in cdevswptarrlkGPSGPS simulatedGPS estimatedGPS autonomousGPS differentialGPS invalidGPS unknownGPRMCnmea%dLatitudeLongitudeMSTSmsts%dEndRunendrun%dputc: required clalloc b_to_q: required clalloc mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_AUTH_AHM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRm_zero: M_READONLYm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_clget: request for %u byte clusterm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLm_copym0 overrunmbuf prepend length too bigmbinit: the largest cluster size != MAXMCLBYTESmbplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm_defrag: no packet hdr or not a chainWARNING: mclpools limit reached; increase kern.maxclustersm == NULL in m_pulldown()unix../../../../kern/uipc_socket.cso->so_splicelen < so->so_splicemaxso->so_rcv.sb_mb == so->so_rcv.sb_lastrecordsockplreceive 1m == so->so_rcv.sb_mbreceive 1areceive 3so->so_rcv.sb_mb == msoaccept: !NOFDREFnetclssoclose: NOFDREFsomovesounsplicesoabortsofreesbcreatecontrol: message too large %d sbdropsbappendcontrolsoqinsque../../../../kern/uipc_socket2.c(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsemi-panic: sbcompresssb->sb_mb == sb->sb_lastrecordnetlcknetiosbappendaddrsonewconnsockaddrnetconacceptnetcon2unp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tail../../../../kern/vfs_bio.c!(bp->b_flags & B_ASYNC)biowaitTrying to undirty buffer on freelist!Trying to dirty buffer on freelist!bufplbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybiodone alreadyneedbufferbuf_get: dup lblk vp %p bp %pgetblkbp->b_lblkno == blkno + 1bp->b_vp == vpClean buffer on BQ_DIRTYbiodonebuf_undirtybuf_dirtybuf_putbremfree../../../../kern/vfs_biomem.cbp->b_data == NULLuobj != NULLpg != NULLpg->wire_count == 1(bp->b_flags & B_BUSY) == 0bp->b_data != NULLbuf_needvabufinit: can't reserve VM for bufferssize == round_page(size)bp->b_pobj == NULLbuf_page_offset > 0bp->b_flags & B_BUSY(bp->b_data != NULL) || (bp->b_flags & B_NOTMAPPED)buf_mapnchplcache_revlookup: found entry for .cache_revlookup: found entry for ..wtf? leak?cache_lookupcluster_wbuild: size %ld != filesize %ldvop_generic_revokevop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotleaf should be emptyrelookup: symlink found.namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsflags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p, %pall vnodes: %p, %p, vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASEDNOTMAPPED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: vfs_register called with vfc_refcount > 0 bgetvp: not freevdrop: zero holdcntbrelvp: NULLvref used where vget requiredvref on a VNON vnodevinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s) Use count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockfree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed vflushbuf: not dirtyvflushbufvflushbuf: dirtyVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNNPFSNTFSUDFvprintreassignbufbuf_replacevnodebrelvpbgetvpvwakeupvwaitforio+++++++++syncer vnode fsync failedmounted on: %s sched_sync: fsync failedsyncermount: lost mountunmount: dangling vnodesys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mountvn_lockgetcwd: oops, forgot to null lvpgetcwd: oops, went back too farspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_fsync: not dirtyspec_fsyncspec_fsync: dirtychkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode fifo_badop called, fifo with %ld readers and %ld writerstag VT_NONfifo_write modefifo_read modefiforfifowdos2unixtime(): month value out of range (%ld)   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_reclaim(): pushing activedetrunc(): can't truncate root directory, clust %ld, offset %ld msdosfs_inactive(): pushing activedeextend: file too largedenodedeget(): pcbmap returned %d fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs_lookupmsdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAaU#D 4| 4$ 4msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirtag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_create: no namemsdosfs_mkdir: no namemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctlif_upif_downif_start on %s ifa_update_broadaddr does not support dynamic lengthif_attach_common: mallocegresstoo many interfacesifaddritempl%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d  ;n C&vkkMGP&"/+Ka5 d1͆< 8O     d;n &0vAkkQMaXPq< D֣ad°Ԡ x0123456789abcdefopenedillegalinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentnetworkestablishterminateauthenticate%s: pap peer TO %s: ipcp_open(): no IP interface %s: phase %s %d.%d.%d.%dpapchaplcpipcpifidcompressionaddressaddressesproto-compaddr-compmruasync-mapauth-protoqual-protomagicchallengeresponsenakecho-replydiscard-reqconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-req\x%x-%02x%s: ipv6cp rej opts:%s: ipcp nak opts: [wantaddr %s] [agree] %s: ipcp rej opts: %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: %s output <%s id=0x%x len=%d%s: ipcp parse opts: [invalid] [rej] send conf-rej %s: ipcp parse opt values: %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack %s: lcp parse opts: [invalid chap len] [not configured] %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] max_failure (%d) exceeded, send conf-rej send conf-ack %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: pap tld %s: chap tld %s: %s %s->%s %s: %s close(%s) %s: %s open(%s) %s: ipv6cp_open(): no IPv6 interface %s: %s down(%s) %s: %s up(%s) %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: invalid proto-rej length unknown%s: %s: RXJ%c (%s) for proto 0x%x (%s/%s) %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: loopback %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s TO(%s) rst_counter = %d %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=Failed...Welcome!%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: lcp nak opts: magic glitch %s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success%s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d %s: chap unknown input(%s) <0x%x id=0x%xh len=%d%s: ipv6cp nak opts: [suggestaddr %s] [random] [agree]%s: ipv6cp parse opts: [invalid] [rej]%s: ipv6cp parse opt values: %s [%s] send %s send %s suggest %s %s: workq_add_task failed, cannot clear addresses %s: workq_add_task failed, cannot set addresses %s: up %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%x 0x%x 0x%x 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%x %s: Up event(incoming call) %s: LCP keepalive timeout %s: pap TO(%s) rst_counter = %d reconfirmedtlu%s: chap %s, next re-challenge in %d seconds re-challenging suppressed %s: chap TO(%s) rst_counter = %d %s: no memory for transmit header %s: sppp_clear_ip_addrs: in_ifinit failed, error=%d %s: sppp_set_ip_addrs: in_ifinit failed, error=%d %s: Down event (carrier loss), taking interface down.%s: Down event (carrier loss) %s: input packet is too small, %d bytes %s: Failed to align packet! %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow ipv6cpsppp_get_ip6_addrssppp_suggest_ip6_addrsppp_set_ip6_addrsppp_ipv6cp_scrsppp_ipcp_scrsppp_ipv6cp_opensppp_lcp_scrsppp_chap_inputsppp_ipv6cp_RCN_naksppp_ipv6cp_RCRsppp_clear_ip_addrssppp_set_ip_addrs++T+++!+Rg%#|4,;MX9!+'&%h#d4 $M@hL W+'&$#L3F(D #+! W0Vtl#+!!YhX(H9lo%dlooutput: no header mbuflo_altqstart: can't handle af%d loifmedia_match: multiple match for 0x%x/0x%x, selected instance %d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedslstartslinput%s: af%d not supported sl%d: can't allocate buffer if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full mbuf packet without packet header!%s output: %s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x pppdumpmpppioctlpppintr0123456789abcdefppp_requeuepppdealloccan't establish softnet handler%s input: %s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! pppdumpbpppwritepppasyncstart0123456789abcdefiiiiiiiiiiiiiiii#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary 1.2.3z_incomp%d: inflateIncomp returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_compress: deflate returned %d (%s) tunreadtunopentunstartbridge_rtfindbridge_ipsecbridge_brlconfbridge_ioctlbridge_broadcastbridge_input(): no HDRbstp still activenot implementednot a bstp memberbstp_notify_rtagevlan_ether_purgemultivlan_ether_resetmultivlan_ioctl%s: initialized with non-standard mtu %u (parent %s) svlanvlanattach: hashinit../../../../net/pipex.cmppe->old_session_keys != NULLpipex_sockaddr_compar_addr: unknown address familypipex_sockaddr_hash_key: unknown address familyPPPoEPPTPL2TPUnknownpipex: ppp=%d iface=%s protocol=%s id=%d pipex: (m0) != NULLntohs(l2tp->flagsver) & PIPEX_L2TP_FLAG_SEQUENCEhlen <= MHLENip packet discarded by ingress filter (src %s)rn != NULLPIPEX is ready.rn_inithead0() failed on pipex_init()m0->m_pkthdr.len >= hlen + ppphlen + 1(flags & PIPEX_L2TP_FLAG_TYPE) == 0Received bad data packet: out of sequence: seq=%u(%u-) ack=%u(%u-%u)m0->m_pkthdr.len >= PIPEX_IPGRE_HDRLENout of sequencereceived packet caused window overflow. seq=%u(%u-%u)may lost %d packets.ack for unknown sequenceReceived bad data packet: %s: seq=%u(%u-%u) ack=%u(%u-%u)m0->m_pkthdr.len >= (sizeof(struct ether_header) + sizeof(pppoe))session->protocol == PIPEX_PROTO_PPPOEReceived unexpected MPPE packet.(no ecrypt)Workaround the out-of-sequence PPP framing problem: %d => %d%d packets loss.pipex_session_logGetNewKeyFromSHAmppe_key_changepipex_l2tp_userland_lookup_session_ipv4pipex_l2tp_lookup_sessionpipex_pptp_userland_lookup_session_ipv4pipex_l2tp_userland_lookup_session_ipv6pipex_pptp_userland_lookup_session_ipv6pipex_ppp_outputpipex_lookup_by_ip_addressrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rtflushclone: called with a non-cloning routertflushclone: no rnh_walktreeifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtentplroute_init rtable_addrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtrequest1rtinitrtredirectsysctl_dumpentryroute_outputroute_outputsl_compress_tcpgre_send_keepalivegre_ioctl%s: port %s at index %d %s: capabilities 0x%08x %s: ioctl %lu failed on %s: %d %s: failed to remove multicast address on all ports %s: using proto %u trunk_hashmbuftrunk_ether_cmdmultitrunk_ether_purgemultitrunk_ioctltrunk_media_changetrunk_enqueue4 ../../../../net/trunklacp.clp->lp_timer[i] >= 0la->la_pending > 0la->la_refcnt > 0la->la_refcnt > la->la_nports!LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)la->la_refcnt == 0lsc->lsc_active_aggregator != lai == p->pm_count(lp->lp_state & LACP_STATE_DISTRIBUTING) != 0TAILQ_EMPTY(&lsc->lsc_aggregators)lsc->lsc_active_aggregator == NULLbest_la == NULL || best_la->la_nports > 0best_la == NULL || !TAILQ_EMPTY(&best_la->la_ports)!TAILQ_EMPTY(&la->la_ports)la->la_refcnt >= la->la_nports%s: unknown statelp->lp_mux_state == LACP_MUX_DETACHED || la != NULLla->la_pending > 0 || !LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)%s: ADDMULTI failed on %s lacp_port_create<„hlacp_set_muxlacp_sm_muxlacp_port_creatempe%d%s: trying to send packet on wrong domain. if %d vs. mbuf %d vether%dpppx_ifs modified while lock was heldpppx: unable to set addresses for %s, error=%d pppxifpppxreadpppxdevspppxifspppx_add_session la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][, ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) revarparptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpintrarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arp_rtrequest: bad gateway value arp_rtrequest: malloc failed revarprequestarprequestin_arpinputin_delmultiin_addmultiin_ifinitin_controlin_lifaddr_ioctlin_ifinitin_controlinvalid argument to in_lifaddr_ioctlin6_pcblookup_listen: laddr= lport=%d in6_pcbhashlookup: faddr= fport=%d laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d IPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportin_pcbnotifyallin_pcbdetachinternetdivert_packetdivert_usrreqicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenicmp_mtudisc_timeouticmp_reflect}E#(Dip_savecontrolin_iawithaddrin_ouraddroKgpqrstuvwxyzsave_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %xforward: src %x dst %x ttl %x redirect (%d) to %x ipqeplipqplip_initaeshmac-sha1deflateipintr no HDRphyint_send on vif %ld err %d unschedule_bw_meter: bw_meter entry not foundbw_upcalls_send: cannot allocate mbuf bw_upcalls_send: ip_mrouter socket queue full wrong if: ifp %p vifi %d vififp %p ip_mforward: ip_mrouter socket queue full ip_mrouter_done ip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_init rmtaddrmaskadd_vif #%d, lcladdr %x, %s %x, thresh %x del_vif %d, numvifs %d add_mfc update o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x del_mfc origin %x mcastgrp %x expire_upcalls: expiring (%x %x) ip_mforward: src %x, dst %x, ifp %p ip_mforward: received source-routed packet from %x ip_mforward: no rte s %x g %x bw_upcalls_sendreset_vifip_mrouter_setip_setmoptionsip_outputmalformed IPv4 option passed to ip_optcopyip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %drip_attachrip_detachrip_usrreqsyn_cache_respondtcp_dooptionstcp_inputtcp_pulloutofbandtcp_sack_optionsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanupm_pulldown malfunctiontcp_input: TCPS_LISTENtcp_output REXMTtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_outputtcp_signaturetcp_set_iss_tsmtcp6_mtudisc_callbacktcp_ctlinputtcp_respondtcp_respondtcp_respondtcpcbpltcpqeplsackhlpltcp_inittcp_timer_rexmtx$Όttcp_identtcp_usrrequdp6_ctlinputudp_inputIPv6 inpcb to udp_outputudp_usrreqipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) (unknown address family)no tdb hash table tdb cnt bucket cnt +%d%s %d IPv4 Simple EncapsulationIPsec AHIPsec ESPIPcompTCP MD5 Signature Option, RFC 2385gettdbbysrcdstipsec policyipsec acquireipsp_spd_inpipsp_spd_lookupipe4_input(): should never be called ipip_input: should never reach hereetherip_output: no space for align fixupetherip_getgifudpencap_ctlinputipsec_common_ctlinputipsec_common_input_cbipsec_common_inputipcomp6_input: l went zero or negativeesp6_input: l went zero or negativeah6_input: l went zero or negativeesp_input_cbesp_initah_input_cbah_massage_headersah_initcarp_ether_purgemulticarp_join_multicast6carp_setroutecarp_vhids_ioctlcarp_hmac_generatecarp_send_adcarp_hmac_verifycarp_hmac_prepare_ctxcarp_ioctl+P+X+`carp: carp_update_lsmask: %xstate transition (vhid %d): %s -> %sstate transition: %s -> %sip_output failed: %d> snderrors< snderrorsip6_output failed: %d> snd6errors< snd6errors%s: master_down event in INIT state %s demoted group %s by %d to %d (%s)carpdevdetachinvalid version %d != %dincorrect hashreplay or network loop detectedpacket received on non-carp interface: %sreceived ttl %d != %d on %spacket size %u too smallchecksum failed, on %spacket too short %d on %schecksum failed on %sINITBACKUPMASTERipcomp_initQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXj ggʧ;l٫Ak[~!yB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj ggw1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy~ ,ntfߦ3yjXDݝD1sZ*"8cˬ$:iz IH8@HL_H %AN@$AU erQ略%ח 9Myjch@ VZ qVN)cf-Ĭwq 7*W5"aBt[h!!S<ȭ(=\8ә N $/OOivǕtU圢¦-'jBce fU)Usu2Ǒh RGU< D𪇬6:t&+tId-~۱Ih &B„cg7PGf6nz7}0c߶)A&fVdTЍXHTU0I[.Zjn":f+͞h>Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) >@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptocryptopcryptodesccrydevcryptof_ioctlcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!swcr_combinedswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptDES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZSHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Final H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fmplsintr no HDRmplsmpls_raw_usrreqbind failed krpc_call: sosend: %d RPC timeout for server %s (0x%x) prog %u rpc denied, error=%d rpc denied, status=%d ;Process killed due to text file modification nfs_doio: type %x unexpectednfs_bufqnfsvinvalnfs_read modenfsbioreadnfsbioread: type %x unexpectednfs_write modenfs_write procnfs_boot: bootparam_getfile: bad reply nfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot: no suitable interfacenfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%dreverse arp not answered by rarpd(8) or dhcpd(8)nfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_getfhnfs_boot_initxid 0x%x flags 0x%x rexmit %i procnum %i proc %p mreq %p mrep %p md %p nfsmount %p vnode %p timer %i rtt %i size %llu flag %i vnode %p accstamp %i pushedlo %llu pushedhi %llu pushlo %llu pushhi %llu commitflags %i nfs_reclaim: pushing activeNULL v_data (no nfsnode set up?) in vnode %pnfs_inactive: pushing activenfs_commitlk../../../../nfs/nfs_node.cnp2 == NULLnfshshlknfs_ngetnfskqpollnfskqdetnfskqpwnfskqlks0ps0qnfsrv_pathconfnfsrv_fsinfonfsrv_statfsnfsrv3_accessnfsrv_commitnfsrv_readdirnfsrv_getattrnfsrv_readdirplusnfsrv_rmdirnfsrv_mkdirnfsrv_lookupnfsrv_symlinknfsrv_linknfsrv_renamenfsrv_removenfsrv_mknodnfsrv_createnfsrv_setattrnfsrv_writenfsrv_readlinknfsrv_readnfsrv_read iovnfsd wakeupnfs getstreamnfs server %s: %s nfs_realign_fixup: no memory to pad tonfs rcvunlocknfs sndunlocknfsrcvlknfsndlcknfsconnfscon sotypenfsreconshort receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilnot respondingis alive againnfsretrynfsrcnfsrv cachebuild > MLENnfs S too bignfsnodeplnfsreqpl../../../../nfs/nfs_subs.cauth_type == RPCAUTH_UNIX111111111121N1j111111101<1F1P ?BEFnfsdnfsionfsidlnfsd initndscplbad nfs svc reply, siz = %infs_args: retrying connect nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_mountroot: rootroot on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap nfs_mountnfs_mountroot(ytag VT_NFS, fileid %ld fsid 0x%lxnfs physio/asyncbwrite: buffer is not busy???nfsfsyncnfs_fsync: not dirtynfs_fsyncnfs: sillyrename dir .nfs%08X%08Xnfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs_rename: no namenfs_remove: no namenfs_remove: bad v_usecountnfs: writerpc iovcnt > 1open eacces vtyp=%d nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 ../../../../nfs/nfs_vnops.ccnp->cn_proc == curprocstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapbsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,ffs2_reallocblks: unallocated block 1ffs2_reallocblks: non-logical clusterffs2_reallocblks: non-physical cluster %dffs2_reallocblk: start == endffs2_reallocblks: unallocated block 2ffs2_reallocblks: alloc mismatchffs2_reallocblks: unallocated block 3dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialffs2_balloc: block too bigffs2_balloc: ufs_bmaparray returned indirect blockffs2_balloc: unwind failedffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_update: bad link cntDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlap?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@Pߜx4ј ffsinodino1pldino2plinodeupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2ffs_mountroot: can't setup bdevvp's ffsffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_read: modeffs_read: short symlinkffs_read: type %dffs_fsync: not dirtyffs_fsyncffs_fsync: dirty%s%s(%p) state %b %sATTACHEDUNDONECOMPLETEDEPCOMPLETEMKDIR_PARENTMKDIR_BODYRMDIRDIRCHG GOINGAWAY IOSTARTED SPACECOUNTED NEWBLOCKUFS1FMTONWORKLISTmount %p ino %u lbn %lld fs %p ino %u nlinkdelta %u dino %p %s bp %p savsz %lld fs %p newblk %lld state %d bmsafemap %p buf %p lbn %lld newlbk %lld oldblk %lld newsize %ld olsize %ld %s bp %p inodedep %p freefrag %p savedata %p savebp %p off %d newblk %lld oldblk %lld freefrag %p %s indirdep %p buf %p vnode %p mp %p blkno %lld fsize %ld ino %u previno %u devvp %p mp %p oldsz %lld newsz %lld %s chkcnt %d uid %d mode %x oldino %u vnode %p mp %p off %d ino %u da_un %p diradd %p bp %p mp %p ino %u dm_un %p pagedep %p deps: %s: got error %d while accessing filesystem softdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O errorinitiate_write_filepage: already started %s: dir inum %u != new %uinitiate_write_filepageadd_to_worklist: already on listdrain_outputsdsdtyclear_remove: vgetclear_remove: fsyncinitiate_write_inodeblock_ufs2: already startedinitiate_write_inodeblock_ufs2: I/O underwaysoftdep_write_inodeblock: lbn order%s: direct pointer #%lld mismatch %lld != %lldsoftdep_write_inodeblock%s: indirect pointer #%lld mismatch %lld != %lldsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep2softdep_write_inodeblock: lost dep3initiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/O%s: direct pointer #%lld mismatch %d != %d%s: indirect pointer #%lld mismatch %d != %dsoftdep_write_inodeblock: lost dep1newfreefrag: frag sizeindir_trunc: lost indirdepindir_trunc: dangling deppagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplnewdirblkplsema_release: not heldsoftdep_setup_blkmapdep: found blocksoftdep_move_dependencies: need merge codesoftdep_check_for_rollback: Unexpected type %ssoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirtyhandle_allocindir_partdone: dangling dependencysoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %shandle_workitem_freefilehandle_written_mkdir: bad typehandle_workitem_freeblocks: block count handle_workitem_freeblkscheck_inode_unwritten: busy inodehandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncate%s_process_worklist: Unknown type %ssoftdeprequest_cleanup: unknown typesoftupdateclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2flush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedsoftdep_sync_metadata: Unknown type %ssoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_change_linkcnt: bad deltasoftdep_setup_inomapdep: found inodesoftdep_free: unknown type %dsoftflushfree_diradd: unfound refhandle_written_filepage: not startedhandle_written_filepage: attachednewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %u should be %ufree_allocdirect: extra newdirblkhandle_allocdirect_partdone: dangling dephandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%lld mismatch %d != %lldhandle_written_inodeblockdirect pointer%s: %s #%lld allocated as %dindirect pointer%s: %s #%lld mismatch %lld != %lld%s: %s #%lld allocated as %lldhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedepdisk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %sallocdirect_merge: old %lld != new %lld || lbn %lld >= %dallocdirect_merge: extra newdirblksoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedsoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entrysoftdep_setup_directory_add: lost inodedepsoftdep_setup_directory_add: lost entrydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: lost pagedepdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %ssoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busysetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_allocindir_page: Bonk art in the headbmsafemapallocdirectallocindirfreefragdiraddmkdirdirremworklist_printdrain_outputgetdirtybufflush_pagedep_depsflush_inodedep_depssoftdep_fsync_mountdevmerge_inode_listshandle_written_filepagehandle_written_mkdirdiradd_inode_writtenhandle_written_inodeblockhandle_allocindir_partdonehandle_allocdirect_partdonefree_diraddfree_allocindircheck_inode_unwrittenfree_newdirblkfree_allocdirectallocdirect_mergebmsafemap_lookupinodedep_lookuppagedep_lookupsoftdep_freequeue_processmfs_mount: dup devmfsidltߜ$x4ј mfs_badop calledmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devmfs_close: dirty buffers ufs_getlbns: Invalid indirect block %lld specifiedufs_getlbns: indirect block %lld not foundufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cache../../../../ufs/ufs/ufs_dirhash.c(dh->dh_hused >= 0)(block < dh->dh_nblk && block < dh->dh_dirblks)((((&ufsdirhash_list)->tqh_first) == ((void *)0)))(dh->dh_hash != ((void *)0))(offset == dh->dh_dirblks * (1 << 9))(offset < dh->dh_dirblks * (1 << 9))(dh->dh_hused < dh->dh_hlen)ufsdirhash_findslot: '%.*s' not found(oldoff < dh->dh_dirblks * (1 << 9) && newoff < dh->dh_dirblks * (1 << 9))ufsdirhash_checkblock: bad offsetufsdirhash_checkblock: bad dirufsdirhash_checkblock: bad dir endufsdirhash_checkblock: bad free countufsdirhash_checkblock: bad first-freeufsdirhash_checkblock: missing first-free entry(offset <= dh->dh_dirblks * (1 << 9))ufsdirhash_dirtrunc: blocks in useufsdirhash_dirtrunc: first free corrupt(dirblock < dh->dh_nblk && dh->dh_blkfree[dirblock] >= (((slotneeded) + ((4) - 1)) / (4)))ufsdirhash_findfree: free mismatch(dh->dh_onlist)ufsdirhash_lookup: bad offset in hash array((((ip)->i_ump->um_fstype == 1) ? (ip)->dinode_u.ffs1_din->di_size : (ip)->dinode_u.ffs2_din->di_size) >= (1 << 9))ufs_reclaim: pushing activeufs_inactive: pushing activecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smalldqsync: dquotdqsync: filedqsyncfree dquot isn'tsetusesetquotaquotaoff: mount point not busyquotaon: mount point not busyufs_quota_free_blocks2: vnode is not lockedchkiqchkdqchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquot %s: write failed, %s inode limit reached %s: warning, %s %s inode quota exceeded %s: write failed, %s %s inode quota exceeded for too long %s: write failed, %s disk limit reached disk quota exceededdisk quota exceeded for too longgroupundefined+RX,,ufs_makeinodeufs_mkdirufs_linkufs_renameufs_makeinode: no nametag VT_UFS, ino %u, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_readdir: lost in spaceufs_mkdir: no nameufs_link: no nameufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaufs_strategy: specifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s blkfree: freeing free blockmode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloc: missing credentialext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_balloc: ufs_getlbns returned indirect blockext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cacheext2fs_indirtrunc: bad buffer sizeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_inactive: pushing activecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smalldirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2ext2fs_readdirext2fs_direnter%s: modeext2fs_write%s: nonsync dir write%s: typeext2fs_read%s: short symlink%s: type %d start %lld, end %lld overlap start %lld, end %lld Ext2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplH |P0xext2fs_reclaim: pushing activeext2fs_makeinode: no nameext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p interting %p, colliding with %p%s: duplicate insertion: state %p inserting entry %p which collides with %p../../../../uvm/uvm_addr.cp->entry == NULLuaddr == (struct uvm_addr_state*)&uaddr_kbootstrapuaddr_hint_pool.pr_size == sizeof(*ua_hint)offset < align || (align == 0 && offset == 0)(align & (align - 1)) == 0(offset & PAGE_MASK) == 0minaddr < maxaddruaddr_pivot_newpivot: cannot grant random pivot in area less than 2 pages (size = 0x%lx)align >= PAGE_SIZE && (align & (align - 1)) == 0*entry_out != NULLuvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxentry_out != NULL && addr_out != NULLdirection == -1 || direction == 1(hint & PAGE_MASK) == 0 && (high & PAGE_MASK) == 0 && (low & PAGE_MASK) == 0 && (before_gap & PAGE_MASK) == 0 && (after_gap & PAGE_MASK) == 0high + sz > highuaddruaddrhintuaddrbestfituaddrpivotuaddrrnd(map->flags & VM_MAP_ISVMSPACE) != 0uaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrk ,0x ,@ ,P ,` | ,x   l|,< ,uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insert../../../../uvm/uvm_amap.c(((entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0((offset) & (PAGE_SIZE - 1)) == 0amap_unadd: offset out of rangeamap_unadd: nothing thereamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpage((sz) & (PAGE_SIZE - 1)) == 0((padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0amap->am_ref == 0amap_wipeout: corrupt amapLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference count((entry->end - entry->start) & (PAGE_SIZE - 1)) == 0((addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(entry)->end + (entry)->fspace > (startva)(entry)->start < (endva)anon_pagein: uvmfault_anonget -> %d../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anonpluaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object../../../../uvm/uvm_aobj.cslot == 0uao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuao_getpageuao_getudv_fault../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_attach../../../../uvm/uvm_fault.cp != NULL && &p->p_vmspace->vm_map == map(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startnext != NULL && next->start <= entry->endanonget1anonget2flt_noram1result != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)fltamapcopyuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2../../../../uvm/uvm_glue.crvva == sva + szuvm_init: page size not set../../../../uvm/uvm_io.ckm_free: unmanaged page 0x%lx ../../../../uvm/uvm_km.csz == round_page(sz)kp->kp_object!kv->kv_singlepagekp->kp_object == NULLsz == PAGE_SIZEgetpagekm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvm_map_pmap(map) == pmap_kernel()vallocwaitkm_alloc1wuobj->pgops == &aobj_pagerkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernel!(flags & UVM_KMF_VALLOC) || !(flags & UVM_KMF_ZERO)TAILQ_EMPTY(&pgl)1 01 1111 8'../../../../uvm/uvm_map.c*start_ptr == uvm_map_entrybyaddr(atree, addr)*end_ptr == uvm_map_entrybyaddr(atree, addr + sz - 1)map->flags & VM_MAP_ISVMSPACE(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)pg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_pageable_wire: stale mapmap->flags & VM_MAP_PAGEABLEuvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries sel_min: 0x%lx, but should be at least 0x%lx sel_max: 0x%lx, but should be at most 0x%lx sel_min: 0x%lx, not aligned to 0x%lx sel_max: 0x%lx, not aligned to 0x%lx sel_min: 0x%lx, aligned to 0x%lx, expected 0x%lx sel_max: 0x%lx, aligned to 0x%lx, expected 0x%lx uvm_map_sel_limits(sz = %lu, guardpg = %c, align = 0x%lx, pmap_align = 0x%lx, pmap_off = 0x%lx, bias = %d, FREE_START(sel) = 0x%lx, FREE_END(sel) = 0x%lx)uvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)(entry->etype & UVM_ET_FREEMAPPED) != 0 || uaddr == NULLuvm_map_uaddr_e(map, entry) == uaddr(entry->etype & UVM_ET_FREEMAPPED) == 0entry == NULL || (entry->etype & UVM_ET_FREEMAPPED) == 0uvm_map_vmspace_update: vmspace %p invalid bounds: b=0x%lx-0x%lx s=0x%lx-0x%lx(map->flags & VM_MAP_ISVMSPACE) == 0(min & (vaddr_t)PAGE_MASK) == 0(max & (vaddr_t)PAGE_MASK) == 0 || (max & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASKvmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapuvm_map_splitentry: split address 0x%lx not on page boundary!orig->start < split && VMMAP_FREE_END(orig) > splitentry->start < addr && VMMAP_FREE_END(entry) > addr(entry)->end + (entry)->fspace > (start)(entry)->start < (end)last != first(first)->end + (first)->fspace > (start)(last)->start < (end)(iter)->end + (iter)->fspace > (start)(iter)->start < (end)RB_EMPTY(&map->addr)which != NULL(void*)map <= (void*)(which) && (void*)(which) < (void*)(map + 1)fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free map(start & (vaddr_t)PAGE_MASK) == 0(end & (vaddr_t)PAGE_MASK) == 0 || (end & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASK(start & (vaddr_t)PAGE_MASK) == 0 && (end & (vaddr_t)PAGE_MASK) == 0(sz & (vaddr_t)PAGE_MASK) == 0uobj == NULL && (flags & UVM_FLAG_FIXED) && (flags & (UVM_FLAG_OVERLAY | UVM_FLAG_COPYONW)) == 0(*addr & PAGE_MASK) == 0(map->flags & VM_MAP_ISVMSPACE) == VM_MAP_ISVMSPACE || uvm_maxkaddr >= *addr + szUVM_OBJ_IS_KERN_OBJECT(uobj)uvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3uvm_unmap_removeuvm_mapent_freeuvm_mapent_allocuvm_map\../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)../../../../uvm/uvm_object.c!(pg->pg_flags & PG_RELEASED)pgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0dupe == NULL(pg->pg_flags & PG_DEV) == 0pg->pg_flags & PG_TABLEDsaved_loan_count == 0uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of two(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)uvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initpg->wire_count == 0obj == NULL || anon == NULLoff == trunc_page(off)pg != NULL && TAILQ_NEXT(pg, pageq) == NULLsize 0 uvm_pagerealloc../../../../uvm/uvm_pager.cpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)pseg->start == 0pseg->use == 0pagersegsize <= MAXBSIZEpppp->pg_flags & PG_BUSYnpages <= MAXPHYS >> PAGE_SHIFTswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0uvm_aio_aiodoneuvm_aio_aiodoneuvm_aio_biodonepagedaemon: deadlock detected! ../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0anon->an_swslot != 0uvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLpgdaemonuvmpd_scan_inactivepmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d ../../../../uvm/uvm_pmemrange.cpg_prev != NULL && pg_next != NULLpg_i->pg_flags & PQ_FREEstart == 0 || atop(VM_PAGE_TO_PHYS(found)) + found->fpgsz > start!TAILQ_EMPTY(pgl)pmr != NULL && pg != NULLsz >= 1nw != NULLpmr->high > pagenouvm_pmr_split: lost one pmr drain->nsegs == 0prev == NULL || atop(VM_PAGE_TO_PHYS(prev)) < pagenobefore > 0after > 0sz >= high - lowcount > 0 && (start == 0 || end == 0 || start < end) && align >= 1 && powerof2(align) && maxseg > 0 && (boundary == 0 || powerof2(boundary)) && (boundary == 0 || maxseg * boundary >= count) && TAILQ_EMPTY(result)flags & UVM_PLA_FAILOKpmemrange allocation error: allocated %ld pages in %d segments, but request was %ld pages in %d segmentsatop(VM_PAGE_TO_PHYS(&pg[i])) == atop(VM_PAGE_TO_PHYS(pg)) + iFlags: 0x%x, will panic now. (pg[i].pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg[i].pg_flags)pmr != NULL(pg->pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg->pg_flags)Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p ../../../../uvm/uvm_swap.cuvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswap_off: swapdev not in listswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapmount: no device swapmount: no device 2 /dev/%s%d%cblkdev0x%xminirootswapctl: miniroot copy failedswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndvnx->vx_pending == 0flags & PGO_SYNCIOswstrategy: vnode type 0x%xswplksys_swapctluvm_swap_ioswap_decrypt: key not initializeduvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_attachuvnsyncuvn_getpageuvn_get../../../../uvm/uvm_vnode.cuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_flushgif_output: recursively called too many times NULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin_gif_outputin6_gif_outputHuh? Thought in6_pcbnotify() never got called with mapped! in6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_update_ifain6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_ifawithscope: output interface is not specified in6_savemkludge: no kludge spaceCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctldivert6_packetdivert6_usrreq%s: didn't unlink in6ifaddr from list in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datain6_selectsrcinternet6%s:%d: ip6q lock not held ../../../../netinet6/frag6.cip6q lock check%s:%d: ip6q already locked ip6q_lockfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_reflecticmp6_notify_erroricmp6_rip6_inputni6_inputicmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d icmp6_notify_error: in6_embedscope failed ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_pullexthdr: invalid nxt=%d ip6_input: packet to an unready address %s->%s ip6_initip6_nexthdrip6_savecontrolip6_inputcannot forward from %s to %s nxt %d received on %s ip6_forward: tag of length %d (should be %dcannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forwardadd_m6fc: %s o %s g %s p %x dbx %p register_mifip6_mforward: ip6_mrouter socket queue full del_m6fcdel_m6ifregister_sendip6_mdqadd_m6ifip6_mrouter_doneip6_mforwardip6_setpktopt: impossible case ip6_getpcbopt: unexpected optionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputscope error in prefix list (%s) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_lookupnd6_rtrequestnd6_freend6_ioctlnd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_outputnd6_ns_inputnd6_na_inputin6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p dr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) in6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrreqrip6_attachrip6_detachrip6_usrrequdp6_outputPF_KEYpfkeyv2_policypfkeyv2_send @@@@@(@(   aesctr3desdesblowfishcast128lzshmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512pfkeyv2_parsemessagegetflags: %x CLGET: returning %x ttcompatK%  `   X,nK22Kn,X `%K w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far back     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length check     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs##h#h #h# ## # # #need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version-)-)(/-)8-)H-)X-)h-)-)/   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`_bus_dmamem_mmap: not implemented_bus_dmamap_load_uio: not implementediommu_dmamem_unmapiommu_dmamem_map: nsegs = %diommu_dmamem_map: size botchwarning: %ld of DVMA space lost iommu_dmamap_load_raw: size botchcache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB iommu addr %p vec 0x%xvmebus: no rangesrangesvme: PROM ranges too large: %d: version 0x%x vmevmesvmelvmelattach: can't allocate intrhandvmesattach: can't allocate intrhandobioobio: PROM ranges too large: %deepromcould not find %s amongst obio devices zsvmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqvme: spurious interruptvme: spurious interrupt counterinterrupt-6-7/-7auxiliary-ioauxioauxio2Tadpoleno aux registerauxregWARNING: preposterous time in file system WARNING: bad date in battery clocklostgainedWARNING: clock %s %d days -- CHECK AND RESET THE DATE! oldclk statintroclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz delay calibration delay constant %d [TOO SMALL?] delay constant %d%s oclock: calibration failing; clamped at %d counter-timermk48t02model: %s (eeprom) mk48t08oclockclockpowerleds߿version 0x%xpsr-implementationpsr-versionimplementationversionclock-frequencymmu-npmgmmu-nctx[viking: turn on PCR_TC][viking: PCR_TC is off]physical %s%dK instruction (%d b/l)%s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)throughback%dK byte write-%s, %d bytes/line, %cw flush%s%dK external (%d b/l)vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typeUnknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dcache chip bug - trap page uncachedmidsun4csun4esun4m%s @ %s MHz, %s FPU: %s%s, %s; %scache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache sun4cpuMB86900/1A or L64801L64811CY7C601W8601/8701 or MB86903MB86904MB86907CY7C601/604CY7C601/605 (v.b)CY7C601/605 (v.c)CY7C601/605 (v.f)CY7C611RT620/625TMS390Z50 v0 or TMS390Z55TMS390Z50 v1TMS390S10TI_MS2TI_4_3TI_4_4MB86910 or WTL1164/5MB86911 or WTL1164/5L64802 or ACT8847WTL3170/2on-chipL64804L64812 or ACT8847L64814TMS390C602ART602 or WTL3171B5010 or B5110/20 or B5210cpu_attachmemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorstore buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. HyperSPARC async cache memory failure at phys 0x%x%x %ssync mem err: ser=%b sva=0x%x WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemregattachmemory-errormemreg channel %dzs_set_speedstdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. slavezsattach: expected 1 interrupt, got %d pri %d, softpri %d mousebroken zs interrupt schemepwr-on-auxio2keyboard/displayttyattybttycttydconsinitfdc%s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d drive %dfdcresult: overrun fdcresult: timeout %s: read-only medium %s: no medium? hard errorcontroller statusfdcintr: block %d != blkno %lld timeoutsoft errorstray interruptfdcstart: not idle fdstrategy: controller inactive : %s %d cyl, %d head, %d sec : density unknown pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c SUNW,fdtwofdc: ierror status: state %d fdc: spurious interrupt: state %d %s: timeout but no I/O pending: statu %d, istatus=%d 1.44MB720KB360KB/x1.2MB/NECslave-only%s: dma card found in non-dma sbus slot %d: not supported relative sbus addressing not supported"%s" at %s class %s slot %d offset 0x%x: %s MHz burst-sizessbussbus: PROM ranges too large: %dvm-I%s: reset: invalid keyboard type 0x%02x sunkbd_input;X?@ABC8jgFˋ )v7SrGHIJ !"#$%&'(+KLMRɒE*,-./0123456OPQ:s9tN '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_-J `-LT-OO-Nj V-V `-LM-Pj-R L-SP-Tb-Xb-Z O-WV  -W-[|-JN-PHL-O O-VZ-MC-Q~,-[i-R J-TBK-UvU-YdU-Z O-X  -W-[       %s: input overrun zsms#p###T#(zs_shutdown: not enabled?zstty%s: %d silo overflow%s, %d ibuf flood%s flags 0x%x input output: console%szstty_attachzsopen: failed to set baudrate : failed to set modes : no keyboard , flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%xzskbdzskbd_rxsoftOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmediamii_phy_setmedia: MASTER on wrong media!A  !@@@@: %s, rev. %d nsphyDP83840 10/100 PHY$6$38$5-bnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHY$9$8X$+-b-c-c(: Generic ten-bit interface, rev. %d gentbi$=$cookie != NULL in scsi_xs_syncxs->done != NULL in scsi_xs_syncsyncxsscsi_link_shutdown: scsi_xshandler on linkscsi_link_shutdown: scsi_xshandler on poolpendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredParameters ChangedMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated Device-k-k-k-k-k-k-k-k-l-l-l(-l8-lH-lX-lh-l-l-l-l-l-m-m0-mH-m`-m-m-m-n-p-n0-nH-nh-n-n-n-n-o-o -o@-oX-op-o-o-p-p@-pp-p-p-q -q8 -qh -q -q -r(-r`-r-r-r-s -sX-s-s-s-t-tH-t-t-t-u-u(-uP-ux-u -u -u -u -v -v( -v@ -vX -v` -v -v -v -w -wH -wx -w -w -w -x -x0 -xX -x -x -x -x -y -y( -yP -yp -y -y -y -z -z@ -zh -z -z-z-z-{-{8-{P-{x-{-{-|-|8-|P-|h-|-|-|-|-}-}( -}@ -}P -}h -} -}-}-~ -~@-~`-~-~-~--0-X-x------@-`------@-h-----H-x--- -@-p---- -@-h------@-`-------0-H -h - - - - -8 -H -x - - - - -H!-x!-!-!-"-$-8$-P$-8$-8$-h$-$-$-$-%-&-&-0&-H&-`&-&-&-&-&-& -8& -h& -& -& -&-&-0&-`&-&-'-k'-'-'- '-@'-`'-x'-(-(-(- (-@)-p)-)-)-)-)-)-@)-`*-x*-*-*-*-*-*-*-(*-`* -x* -* -* -* -*-(*-@*-x*-*-+- ,-X,-p,-,-,-,-,-(,-H,-`, -, -, -, ---.-8/-X/-/-0-0-0- 0-P0-p0-0-0-0-0 -@0 -h0-0-0-0-1-1-1-(2-X2-3-4-5-5-5-5-05-X6-7-8-8-8-8-9-8:-X:-p:-:-:-;-;-0;-`;-;-;-;-;-;- ; -8; -P; -p; -; -;-;-;-;-0;-H;-h;-;-;-;-;-;-;-0=-P>-x>->->->-?-(?-X?-p?-?-?-?-?-?-8? -X? -h? -? -? -?-?-?-?-?-@?-X?-x@-A-B-C-D-Dq-0E-PF-pG-G-G-G-G-G-PG-pG-H-I-J-K- K-8K-hK-K-K-K-K-L-N-P-0P-HP-hQ-Q-R-S-S-S- S-@S-xS-S-S-S-T-U-@U-XU-pU-U-U-U-U- U-0U -hU -U -W-X-Y- Z-8Z-`Z-Z-[-[-[-[-\-(\-@\-X]-x]-]-]-]-@]-x]-]-]- ]-X]-]-]-]-(]-`]-]-] -]!-@]"-x]#-]$-]%- ]&-X]'-](-])-]*-8]+-p],-]0-]1-(]2-h]3-]4-]5-]6-H]7-]8-]9-]:-0];-h]<-]@-]A-]B-P]C-]D-]E-]F-(]G-`]H-]I-]J-]K- ]L-P]P-]Q-]R-]S-0]T-h]U-]V-]W-]X-8]Y-h]Z-][-]\-]`-8]a-p]b-]c-]d-]e-P]f-]g-]h-]i- ]j-X]k-]l-]-^-0^-H^-p^-^-^-^-^-8^-`^ -^ -^A-^B-^C- ^E-@^G-``-a-a-a-b-c-c-(d-Pd-pe-f-f-f-f-g-Hg-`g-g-g-g-g-g-8g-Xg -pg -g -h-i-i-i-8j-Pk-pk-k-l-m-n-o-0o-po-¨o-o-o-Pq-Èr-ør-r-r- r-Xr-Ĉr-İr-s-s-Šs-s-s-8s-`s-ŀs-Řs-s-t-t-t-(t-Xt-xt-ƨt-t-t-t -8t -`t -Ljt -Ǩt -t-t-t-@t!-Xt0-Ȁt@-Ȩta-tb-tc-(td-Ptn-ɀto-ɰtq-ty-XS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial._~ offline../../../../scsi/scsiconf.cSLIST_EMPTY(&sb->sc_link): %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibus_printlink-----/-0-@/-X-h---/--/--/--/--//-/--/--/- -(/-0-8-H-P-X/--`/-h-x-----------/-- /-0-8/-@-H/-X-`/-p-`/-x-/--/-p-/-p-/--/--/--/- ////////////-//NEC CD-ROM DRIVE:260SPECTRA90000200///sd_read_cap_16sdgetdisklabel//////////////////%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thinsdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook %s: bad residual %d out of %d %s: block wrong size, %d blocks residual %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d TANDBERG TDC 3600 TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TEAC MT-2ST/N50 5150ES SCSI FA1501 A-8-0-H-P-`/-P-x/--/--/--/--/-- /-8-H/-8-X/-8-h/--/-----/E-8-*--////ukFan%dPSU%ddoorlockalarm%s: unable to read enclosure configuration %s: unable to register update task %s: unable to register ioctl with bio SAF-TEsafteses_attach%s: error in sensor data FanPSUDell%s: unable to register ioctl ses%s: error: csr=%b INTERRDR1DR2IENSLVERRRST WRITE ENDMAENCNTTCDSBL_CSR_DRNDSBL_SCSI_DRNTWOCYCLEFASTERTCIDISENNXTDMAONALOADEDNALOADED%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PEND%s: intr: addr %p, csr %b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA addressledmacable-selectiontpe: rev esc1+fasunknown (0x%x)espdmadma: %dK memory lebuffer%s: reset failed. %s: PROM ranges too large: %d #channels: no channels : invalid number of channels: %d : %dK memory %d channel%sqec%s: invalid tcvr type %s: bmcr reset failed %s: bmcr unisolate failed %s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid packet size %d; dropping unexpected%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: resetting %s:%s qstat=%b RXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BEboard-versionchannel# pri %d: rev %x address %s %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... : no interrupt found on parent mace-versionqe: no interrupt : only %d register sets local-mac-address: can't map registers SUNW,vge%s: mii_read failed %s: mii_write failed %s: link status changed %s: reset rx failed %s: reset tx failed %s: stop failed %s: burst size unknown %s: setting rxreg->cfg failed. %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP: expected 5 registers, got %d hm-rev pri %d: address %s rev %d qfeSUNW,hmeSUNW,qfehme pri %dinitiator-idSUNW,fas: expected 2 register spaces, found %d : could not allocate dma softc : can't map DMA registers : can't map SCSI core registers espattach: no dma foundptscIIaudioamd%%@%+>IV"k}3 3 D %s: trigger_input: already running %s: trigger_input: bad addr: %p cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %p %s: error interrupt %s: attempt to free rogue pointer slinear_leslinear_beulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration %s: timeout waiting for reset : expected 1 register set, got %d pri %d SUNW,CS4231audiocs' char-height >body >user %lx ! ' char-width >body >user %lx !stdout @ is my-self addr char-height %lx ! addr char-width %lx !stdout @ is my-self addr window-top %lx ! addr window-left %lx !screen-#rowsscreen-#columnsstddepthwidthheightlinebytesfb_get_console_metrics%s: couldn't allocate copy buffer wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsmoused_sleepwswaitwswait2wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device../../../../dev/wscons/wsdisplay.c!wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplay_forceclose: bad screenscrdata->nscreens > 0%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %dwsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %swsdisplay   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wsevent_fini: already invoked wsevent_init: already initialized wsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %swskbdread: evp == NULL %s: can't attach mux (error=%d) wskbd_input: evar->q=NULL %s: event queue overflow ../../../../dev/wscons/wskbd.cwskbd_console_initted!wskbd_console_inittedcannot load keymapwskbd_console_device == NULL: console keyboard%s: attach error=%d wskbd_console_device == scwskdetwskbd_detach: %s didn't detach wskbdABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %swsmouseread: evp == NULL attach error=%dwsmouse_input: evar->q=NULL ../../../../dev/wscons/wsmouse.cev->value >= 0wsmdetwsmouse_detach: %s didn't detach wsmousewsmux_set_display: bad child parent %p wsmux_displayioctl: bad child %p wsmux_detach_sc: %s has no parent wsmux_attach_sc: busy wsmuxclose: bad child=%p wsmuxopen: dev already in use wsmux_do_open: bad child=%p wsmux_mux_open: busy wsmux_mux_open: no parent wsmuxpoll: not open wsmuxread: not open wsmux_getmux: no memory for mux %d wsmux: attach out of memory wsmux_do_ioctl: bad child %p sun&~&\&&&(&........ .(.0.8.@.H.P.X.`.h.p.x...wsemul_sun_output_lowchars: ESC in kernel output ignored ../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %drasops_mapchar: no font selectedrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font 888????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? wsfont_unlock: font not locked@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d PFU,agaagtenp4%s, %dx%d bwtwo: p4, %dx%dcgeight: p4cgfour pri %d: expected %x bytes of control registers, got %x expected %d registers, got %d expected 1 interrupt, got %d %dMB, rev %d.%dcgfourteen%dx%d, rev %d SUNW,cgsixcgsixcgRDIcgthreedev_id (%s)%s: %dx%ducoderev, microcode rev. %scgtwelvecgtwo_putcmapcgtwo_getcmap: %dx%d cgtwo %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d %s: unexpected engine id %04x SMSI,mgxmgx: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d p9000pninek: id 0x%x, revision 0x%x bt445btchamstdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx ! addr fontbytes %lx !p9100_romfontp9100pnozzp9100_pick_romfont"%###Sqn|uqn/C"c ]"pqrs   $(,0rfx_putcmap %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %dRasterFLEXRasterFLEX-TVrfxstip-ropblit-widthstipple-aligntcx-8-bit%dx%dx%d SUNW,tcxtcx'W 'Trevision, revision %sfreqcodehresvresPGI,tvtwoPGI,tvthreetvtwo %s: expected %d registers, got %dVIGRA,vs11vs10vs11vs12vigra%s: zx_cross_wait: timed out SUNW,leozxbusmaster-regvalif_le: Lance buffer crosses 16MB boundary%s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port %s: configure command failed %s: individual address setup command failed %s: TDR command failed %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: reset %s: abort commands timed out %s: disable commands timed out %s: receive descriptors out of sync at %d ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s ie%s: tbuf overflow ietint: command still busy! %s: multicast address setup command failed %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready multibus/vmeonboard3e/vmeACFAIL assertedUnknown errorSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test number%c: %s %d/%d/%d: [still trying, new error=%s] [recovered in %d tries]%s%c: crash dump not supported (yet) xddummystrat%s: off-line: %s xdc_resetxdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_start%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE %s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEADxdnfreexdsubwaitxdcmd nfreexdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) xdattach drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! xd%s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout xdcxdc_tickDOUBLE ERRORInterrupt pendingBusy conflictHard ECC errorIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulSector count zeroSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headxydummystratxyc_resetxyc_startbuf null buf%s: DOUBLE ERROR! xyc_remove_iorq: controller DEADxyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_cmd%s: stole control iopb %s: can't alloc IOPB mem in 64K xyc malloc: doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled]%s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xyattach drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s xyxycsi_dma_start: bad pa=0x%lx%s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d %s: DMA timeout (while polling) sw: DMA error, csr=0x%x, reset sw: short transfer si_dma_stop: excess transfersi: DMA error, csr=0x%x, reset si_attach: impossible bus type 0x%xsi: dma handle malloc failedsi_intr: DMA conflict si_intr: DMA bus error siswsi_dma_free: no DMA handlesi_dma_free: free while in progresssi_dma_alloc: already have DMA handlesi_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO scsi-initiator-idQLGC,ispPTI,ispptispPTI,ptispSUNW,qlcQLGC,qla%s: no mem for sdparam table ISR 0x%x SEMA 0x%x%s: kdma handle not already allocated%s: kdma handle already allocated%s: Request Queue Overflow++ %s: cannot allocate request queue %s: can't mapin request queue %s: cannot allocate result queue %s: can't mapin result queue %s: cannot allocate FC scratch area %s: can't mapin FC scratch area SUNW,isp(0X()`()(44(2 (1X.ExA'W COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.37 Customer No. 15 Product No. 00 $   qp \ pISpP p p?p 10 y8xc/   @B bxx xxO 85 xxx i8@h< !xh(hh hhhh#hh' i:  h hhhj-  i;  h? h2h7 h @hhdpx xdx1xGx62 ppxxxxx4xMx22xxxxp  p  z zp@xxVxU 8h!Ux'xx 8o!e@C 8j!!! `xOx> 8o 8i! @S @xx| a`@^|ppppp 8yn.. HW2 &cl{z 8yetrq @xsrq @p a` P @|qxp@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I] ApO Ik Awpp qWpp@kp   B J &Sxp @kHk&Sxp &Sxqp! rxp%ppxprstprstҠ@xr@xx @xzz{~|vxxxxxxprstprst֠@܀x@xx @xz{|xxxxxx 8Y! rx 8A! x 8B! x a8@a bx 8E! x 8F! x 8G! x 8H! xyz xqā:jh@#kx$k xwxX kj 'x xHF a; `<F<xN   xS{zyx xwxX ijk xqġxxqġ 8A"~!xxq  "@pxxآ~ 8B"!~xxd2K a8@a bp`p`x a8@ap`xq  (@  2@  < a8@`~a#xx6xqġ 8G"!~xxqġ 8H"~!xxqrȡע!yx "z xxqā: rh~&@@@"" j @)@/@@@@@<xx@xx@r̂@rh@r a8@a(@Y2@_<@edHoxiPHoxiCHoqqrxj hhk qxwxX jk phph'x 85" p xqrs̡xxwxX jj 'xwxX jj h@xI 'xwxX jj h@xI 'xw A I Q xe 'jxwrswrsxh@'x x |  @x xww A! I Q xe a8@`g`xxI |wwwwƧ a8@``gxxI  A! I Q xeph>8< |xl 9 A! I QxX h i 8U?8?U ih0@@hK hH@pxyhK hH@px px y8x a8@```xxhh hF |xxx0qqyJ|tsrtsr y8 @x5@x@x>x` x 8h  # " $   , .%0~x1eeff``xI |p@xqpyxqq!hx ii -h p@x!p@pxqrs!!y/F[]_p@qrsxBp@pppwqx 1a&$0$"F3H 1aHx:x:x:UUwxX h0  'xwxX j4 'xw~ rȂxX l0j2 8''$xw~ rxX l4j6 8'$xy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppqp q p|p @pp pqrs 0x ppp  p 2q 2,Sp|xPe@=,xR c|~ y8xP b,xR| ]zR r@U/  xL | ;|xX)h**h.h i 8O! h@ ``h~ x ~he@`hxxx+'hhx+'ii |e@`` x>!x|`  @h(`h,`|~ q8@p@ʠ8- pB|~ q8@ 8r@!H!Ӂ!tB|xX hxe@/x,x`e@/` `,( 8O @/h` `hhxdx `d,h%`x`` xx+'hh | 9 A! I Q xe8:?8?: |h\ a`\xx]|@cxyeuw}uuuuuuuuxx0 x x xx0 x  8," x  xx0  xp a` @|,`, cxdxfxhyj@,xyn| ~ a8h- k`d`f`haj@-xanx+A |x@ ~`e@x `x>|xle@ xdxf,xnxj |xMytprТ"x@MxhM @xMx5@Mz|{x@! x$ @x@Dx>xxM xxxx xMxx`yN|VeVVVV 9xx``x`xx|x@lxVx`x`@x@xxxx|xxVxx|x@xVxg  `@  @ 9  @xxX- h+h/hh - h pxĂ@ xx>|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x1eeff``gxX h@4 x x xxx` ;`"jh HJ@J 9xx, he@RaiVi!``hhxx h@@v@h x~~i0!h2i4i: xI xx|`` x xe@`x`xxx|ypxt xvpx@xh @|h )xle@x@~xą(x@ @| {yrpԢ"# |H | | q p?pr?? q@ x z{ `$@ @x@1xx? xxxx x?xxyx <xp֠ q | 8h ~ y 8@!b 8!bx0bbxD|~ # q8@ y 0^ +#@|x##S3xox xx pxpxpbxxxCxSx pG8pC | " x|  px" |  px¢! |  pxӡ" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@e a\xm@S a[ ~xm@? `p=x2xe[ q8@p``q` pxDxa q8@``q` pxD xg   |,@ `` ``x`xn| 8A"  ;"@ !!"|~h䠌 @堄`:p q@塌q~aap  @! x x pppp~aa!p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@|0"x礜P"xy'!"Q"w$''((()bM7 'f7x  |pp?p0@Kp3 p\pyV^l^xx Fx&jpx9x/px~xxx x`xx[ x& ppp38px9x/qx~xxyxx`xx[ x& ppp38px9x/qx~xxyx qyx x`xx[ x& ppp38px9xx/9p hxox/,Phxn A xAx/9xp\ hox/,P`` hx 1 Ax0K x, t@@28 0qD*H) 8!de?!#qFpp?x9v@8qD&x.qF%h%Xu>,P`<p2~ / p"x"hhhh#x-ڠ-y"#"###--#--$$---$x禄@# x:xx9h@#hx/xii#3h#;h#+h@#xXx9@#;xXx9`@#@##Ix#c~Znxtzyx#V?k!hk"h@@#k~Znp#xx1x3exgx9x4jilk"@#""!|{##@~Znxgx9xg"#x3vx9x3x9xjx9xXx9xx$ i@#ši ~pH ````` x#@#i ~pH ````` ,H @#x/ x,X@#x`(x~X~Z#xUx9xix9~X$xXx9xjx9x-x- y@$xx$-#| @$%H$%x$'x#$z$'x$ $#@$=H$=x$#@$hh~X 0~Z`` ~pH `` ,H @$ax/ x-=x$p ~pH `` ,H @#x/ x,X@#x`(x~Z$xUx9xix9zx$#@$H$x$-x-x-x-xx@$xzx-y$-+-,آ$xx-xix9$xx. xix9P$x#y$$%%@$x p:py$$$$''L&$$x禄$x1M@%xh@%W%`` x*@%Wx+x1Mx%>(%Wx1M`` x+4`@%>`@%4@%4`x%>h(hx%`0@%.`` h@AhhpT ~ `h` `h-%T``xA~x&hh'o@%%%t`@%txzh.j*:"%x%" @%h%x&xA@%@Aih@%p8hix+ x+%`` h%x+x%pT `h`xxAH%x"y%%%%%xp@%x-xixjx9xxy@%x-xjx9hh&x-x& @&xx. xix9x/x0&&y||`&&h/h+x&&5hH5&5x1M| @&_xЀ&Cx4xx4y@@&Mh/h+x&2hH5@&Gp8&Yyzi.j*x&2@@&ih/h+x&2hH5@&cp8&uyzxЀ&|?i.j*!&x&2x4|@&`` hj(i,j:i>h+h/h3 hh py&&&&&&&&&xh&x+x&pT,P `h`*` !8W$@& x&-" k|wx.x/`@& ~ \ h  !\  x!j@&~ ![~  x!j@& p&x&8&xAx+ x+h'xox4J~!G@'x'/ ~h:`` x/kh@'9i ih@'@h !8Wh "j8ip2"y)-)))-xp)x+x1Mp4` x)p@)p \ hp>p2"y))))))xx. xix9p)x+x1Mp4` x)p@)pzx| i\--qV h@)h@* hx)p \ hp>p2~ / p*x)jhhh#n~Zh @*mx.x*mp*$x+x1Mp4` x*)p@*pzx|yy[--qV h@*Hh@*ahx*;p \ hp>p2~ / p*Yx*Rjhhh#n~Zh @*mx-~Xx*m~: `pJ`pN`pR`@*klih*{{||ަ~Zx3vx*h!#$@*{{||h~Zx3x/ j@* i ~Zy-p>: Hx9` @*̀`"`` p`&|x1Mhhh@hpy****+****xx+ x+xxAppy*********y pxAhx'h+ ``|x+'`@++x``` |x+4`@+&`|~~ 8.!@+1 |~~ 8/!@+> |~~ 80! |~~ 8/! |~~~ 8.! 8/#  80|x/hx+x/hx+x/hx+wx/q[-- h+xAhr@+hx+h hpx+ h+x+x+hh xxA-}~ii@, i@+H+@+ 1++x.@+x,x+x.O ~)```x, ii~X~Z+xUx9xix9 ~)```x, ~X,xXx9xjx9 ~pH `a@,KbH,@, &,$"0bp(,4,: x,: ,:  ",?"(x.S++x.@,Kx,x,Ox.Ox,xXxZ xix9 ~)``,r@,l,la | 2 x,bp(,, x, ,  cH,@, xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |-zii@-i-x-cx,ȩ x/ x,X@-x`(x~X~Z- xUx9xix9~X-xXx9xjx9-%@-/qH! -/ x.Ax-cx,xXxZxix9 ~~)``  -S-Qax-` xxxzhh | ~pH `@-k @`xxx`x`` |~p@-x-x-֦ @-x@@-x@-{?-@--@-Ҡx4xx4yx-֦@@-x-?-Ҧ~Zyz -Ƣyyzzx4xgx2x9xgx9xjx9x. xix9x-xix9h#x.i ih@-hxix9 x.  x. x.  x.  x. xx~Z|~?;;: y@./x```88y@@.?x```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 8F (@.} !.  x. !/  d$@. #p.x.|~ 8F"2H.@. !.   2x.(@. !.  x. !/  d"@.H.̄ #p.x.|d.xpx x전@.$. !x.$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| ;|yzxЀ/%?|~ y 8@ !y/5/g/?/?/?/?/?/=/=xxKxH/AxKxH/Hh@hxX@xZx0/g/gh /exx/gx | ~h:` /a@/`/`~ii  @/! x/ x/ ````~ii!` ` ` |xjx9xix9xXx9xUx9xx9xx9xx9xx9xx9xx9pxFx9~x0/xx x전!@/xx |xx |x0@00 x|xx x전!@00x~xx |p@0. ~-`/hx-x,h hxX?hh/h+xKx!̠ @!x전@!!x- ~h: ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I1Mprr p@1_x1dp |p1q1qx2.x1ip @1p1p1p@11ipx1@1x31@1ix1p |d$@1,p 91'hh 0h)!@18'1pu@1 91x1| ~ " y8 qp pp q p pp Ix | I1p2pqp1䡄0@101p2p 2q 21x2hppp2 pqH2xp I|~~~~ "qx2. |r!qp 2p 2p y2H2R2b2p2b222p2xp2[ Ix2_x32[x|p2ix2mx32ix|px1x/+h@2}h|xxx2rqp (x@2xx2x2',X`c ""c!$@22 +`x2+`1=,holkpx1|8'2`@2 ` 91Q@2p| Q|P9'2 91`d2-`|~ ~ " h `hklW1~ h@@2~ yxX@@33pp3p@3x$3!x3^,X'``~p`p !3N@3N3Nppvpx`p`pb $pb#pvp+`x2x3`x33^ |~ ~ " pp3lp |~ ~ "  I3vpp3~ h@@3h$@3 P 91-`x33 |~~~ ~ " ~ h@@3 I3h$U@3-p.` 91'hh "hH3ՊQ3x8'3pu `@3 91x3" i $"i#3x q x3 |p@4'!p!p!p!p~ yxX@@44vpx2|~~ ~ " I4 q4*h$@4:x1dx4:q42x2.x4pq44x2.p4p4p I |~~~~ ~ "  I4J 1p h&ppp@4hSpp4j Ip |~~ ~ "  I4yh `hklW1~pp4,X'``p`pppvp 1 4qp 4 H4x2pklp Ip | 4Ѣ4̀|~ @44H444x4#4~2 |~2x45c `x x"5[x$x" 84!5  ~?x/ `d5 i8@h@58@58h0 @58!@58 @6@ a;  `<@5N`>5N`@5N~xIp5Tx5> @5[ x5>x5xx5fx5x7 |x<x>5wx@x>xH@5wxJ5wxI|x4x65x8x6 xD5 xF[ @ e@5` @5`"@5`,@x5|x(x*5x,x*x05 x2;#@5ˢ "@5À 5# xI| i8@h@5h<@6@goxXh 6= 8+!@5`#x6=h!``?````` BgoxXh@6hhh h6xh`/`+,hx i8@gh xD A! I Q0xe 85"j>86" 8+  8, i8@h | 8O!d ix`hX?``H``/`+h0@@6|hK hH@6ip6ix6`hK hH@6vp6vx6m p6|x6xhh hF 8h xLxJ | y8x6x6x6x6x6 83 84 x3xGxK|  8F"<@6 {*{.| 0 8F"2@6 9"<@6 '{6{:|  8F"<@6  "2@6  {>{B| / 8F"2@6 9q"<@6 &&{"{&|  8F"<@6 ~ 81# 82# | 81! 7U 82! 81 83!7  ;"#@7U"@7@@7@@7@@7@ 7U #  !~ xI|np COPYRIGHT 2001 QLOGIC CORPORATION ISP2200 Firmware Version 02.02.06 $    ɫ Y+xx# ( Q*p ) 1 9 !h Ϡ 1A4ubvfw^tjtn qd   !A4qd4  A8Ќ   !A 4  A  2    K? |  . \z R5 fu $ h bs #H $\ 0 x#x Px#@x P @*pp*ppX >I .A \ S f  & p  YP Y yx(x* Xpp( a  yx'z(/z* X gC X g X gC J gC 0 p  C yxD J gC X gC   xx@xB s > r<„r>  ! {  - QI YX K(@pp El Q z ´z`ps pМ(p Kppr Yx  (O !pSpWpw yRxЬ•r YH  -ppp yx'x(x* *  } o YH a (Oa. ppp yx'x(x*  } o YH a (Oa. Y   Y  ~ ,psptpvp& pp0 * opЬМ@Є0  ! !Ќpؠ +m opД   + opܠppФд  Q S ЬV   N`8h^(^  ! !q   @   @ppqt @    @p0p2pp  '' > y YP Yx(x*    }  } o o.F& y 4! ({  Jy@yBy$Ѵx'@ќx'6VyTѬK YX Y(  p Y     XX Y@  JxCxC x М8 Y8x$Ь*px$ YЬ p  ''xPxRx/ FS gSxPxRx/ YX Y(  p Y     X  J xPxR Y xCxC !x `x МX Yx$Ь YF !!N!x'H  gx$h    p g` 4!   ({ Y@d( Ypx'x$ YЬX p(  ''H 4 x'Hx(x*xPxR^> X.N*p a c`` `  p !pSpSp[pspw a` `` ````` a``` ````` a`QL`OG` IC` (  pH 1 9 ! )衆    X  (U 8 M    a,#b,"b    a,#b, a, a"b   a ,#b,"b,#b, a, a"b  i8 7  Nx`( P"  yxЄy.x*x&9x:x#x P&VF  @  "@  $@  &@  (@N^. y . .. pppfirmwareC8groupB protocolsdpasswdtmpspwd.db servicesCasswd.orig pwd.db fstab8 resolv.conf( hosts8 ... ... . .. installboot . ..misc Fkeymaps . ..termcapwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  PPL < @ PLuSdP  PLP@@<@T UPhpPhhAPM0P.KQP.KQzAPMPMPM |k"CPM#BPM#BPM#B 0 dAPMTsP-P- `iAPMTsPM hPM h  APMTsP2wP2w  mPS'PS(mpPS(mpt^)PTPTHq0PTHq0#PS3(wPPS5PS6#spPX`hPKAPS3PS6#sPS6#sxP1PS3PS6#sPS6#sy~EPTPTPTNP%XP%XP%X/tmp/fstab.shadowЅP*$`P*$`P*$`/tmp/resolv.conf.shadow$ P.KQP.KQP.KQ/tmp/hosts(  cP2wP@P@دh35*6]mE+͚9k.fdV6~oB'@DrيWS%L '_ϨIB+I"}>z:+#!`q 34bDq23JvM-z}_x!1qmY2J9-b |ڎQDݔ.~\t6bBFbgAm75POhR[j[%C,\#6!qi_80I)Yfu+RD-~W!!R8)?y)\hq"- iw Bȫۃ38N`r6B+NGQ_Jrq.C >R#b3<rP'86D*IIe&ܫҌ5 u\*~:[_  m0)yOw0SW>g<0@+b.hcoa^UM[ZS7 ']W f߂>,{Q"[}8IHɏD^ytfɻ #1i` {wDcpz7#{WJmfƙbyųCL6f.)38 e(fYxbڰnUƟ0B/ cն1'neΗy3onDѶ.%lNi>Yyb(D@qE^s07 ? j F3C]lXiN${d e5`Xh]1!jL3j UMA|?P'\pA۩{pJ(NXPs`^~|~lNaRt~ݔ:P ZPj3;37sTkHPܺ잁xN ^߫1"t,AŏHEжCT|b4 "lV/.PQi\ -LFT6u44;-EXl\/ ,tJL>u>6f7nEh!M\Fo6 1qej b:d+RcZڜp1B(;-J9zryk/? ;PE6<zAy3U  SОY-^ 1tM|IxgLfr;> Fp,\, Qi+2eP#$8FAnB(:b[WǪYֆ&O(Iq$|IvLUPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  n}n`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  n}n`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3Mroot:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kI=\E[247z:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:\ :kh=\E[214z:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:\ :nd=\E[C:rs=\E[s:..sa=\E[0%?%p1%p3%|%t;7%;m:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:up=\E[A: base_vapmap_map4sun4_mmu3lrcookiescookiepmap_extract4pmap_extract_srmmupmap_map_srmmuobmemopen_countnetif_prompv_putcharsun4_idprom.2981promdev_inusestringbuf.3093rootnode.3053dtabfilestore.3171promvecstore.3326saveechobootstore.3178getphysmemrelseekLstdLmul_shortwayLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9block_mapbuf_read_fileufs_close_internalread_inoderecvrpcebuf.2161sputcharsbuf_endsbufsbuf_lenrarpsendrarprecvbuf.3292numberetherbuf.3130paniced.2161get_bytecheck_headergetLongsstoppos.2277arpsendarprecvsyncsearchupdatewindowmake_crc_tablefirst.2646crc_table_emptycrc_tablegf2_matrix_timesgf2_matrix_squareputcharprom_getpropdvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopycd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenelf32_execrpc_fromaddrrpc_portstrerrorcompatprom_findrootrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirbstartrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openprom_getidpromerrno.mulocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsprom_makememarrip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660fdloadfilepromvecxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvprom_interpretnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbendbootfilecrc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysprom_nextsiblingstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpprom_findnodecd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.rempmap_extractrpc_pmap_nummmu_initxdr_inaddr_decodeobp_recvprom_getproplendvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumprom0_xmitadler32_combinekdoprntexit_divufs_writestartfile_system_nfsbceaprom_getpropstring__moddi3arpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulprom_firstchild__data_startinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freepmap_mapcloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefreex @   y$/ zX z y&/ zp y&/|(   @          @x   @     i  a ,V&! `.^ qq`q. !00@pd(" "# 8ЌHpd(pg  H tt& qphpp, h-p. kh.n q& p`pp, h-p. kh.n & qp, j-p.pp.8hh I  qp  qppp qpp& "pp qp" pp( y. qp( yprpqp֡ p hqx&h$x2h(x6h,x:h0x>hph phЄ p)p&q @@!prx"x xA.&6FVp x&q @@!p"Sx"x 3px^N>.6FV  Sx & xApppp .^N>6FV ) x& * S +  Sx & xpppp &.^N> q yyx p#l6d5 (6FVp x@p S4p^N>p px0x2x4x6 p p lp  Pp x0x2x4x6 p p lp hx0h&x4h*x8h.xp ]_ l  > H ( p l  > & " y0 q"pp.p.xx.i4,FhLм h`h.h\h*hXȡphLм Xh`h.h\h*hh "c h2hX@hLЬ hh "c h2h.h*hXhLЬ h.h*hX"c! i2-ih&hLhNh i|iiihLЬ h3"`-ihXh&hLhNh h.h*i|iii   袀 lhL   8ޢ  hh &F6& ".>Npq " # $ I .qp  8 .r "`&&6 "N>.$`a!hjbk^  h @pp qHpH  ЌhF N$``  @   МHx` ` xhxhxpp `aH H hpp qpP  Ќ`F N$``  (  МP  ЌPx``xhxhxpa H .&6FV q"p p y0p x ` 2   x@ &VxxЬxx pp^. ]  Y8f 1 ZEnX `% 8"  TV .! ^^N>.p q !p `!!$I .qp ( (O 8!`` h-Xh(Xh,@hL(hhhP0xhxhxh$ Ph `h0 @`4  -X   ` t д hh "@ p >'0hP((h)pTTpphpTpYYppp`YxhRkljpml ٜP(hon 0hRkljphkj mlkjmlon h4@ "% {"z&}2|6:~>srut"w&v*yqqh(h*h,h. -` "%(hhh "%(hh`hHh0h  "%!h  p `` hp  'phh i|iiih+h/hPhR W & "+hh `yxx XpxМ pѼќ}x }     xpѼg&6| }$~04xhxh  @x(x p k(j,$hn%hrk*j.>.no"%( ";hPhR*h&,h(h2hh HhL0p ` H p p V} ռ g^ h+h/hh i|yiyxhzjќ`Pp hLhNx phh p `` V .! ^p ` H  xhxhxyA   ?xxxx xxxpp ` H  8pєxМ8xМ   աH   xhzj xpѼlh4)ќ&6| }$~04xhxh  @x(x p  k(j, ";(h`4М(hh  hhє 5*h&,h(h2hh k*j.>.V}  g^ h+h/hh i|yiyxМ | x$xh|l xut w$v(p(p!x0Px48x8 x< xxpp Phh 0p ` H  xpp `` hhh l(k, .p q wp!  w!l- uh uh hhP!k,u!j(uhPhRhlx"phpx&phx2ph x6p"h ``4Мhh0 ֬hhx:p&h x>p*ox:x>p&p*o!uk,u!j(hPhRh0 i` М`x"phn` x&phr`x2p`x6p"x:x>p&p*`x"phn`x&phr`x2p`x6p"`x:p&` x>p*hxhxx  <"  x Ф ٠ & "p`p q@ ( (p.p.. Y `  8  f 1 ZEn  ( (p q!0 `` ``` I .qp @ (O! ]  `% 8" ( ( ]  q"p q!0 `` ``` I .q P 8   ` ,  YH !# `! ! A h  H8  !p qx i  0 I H& H +  )   0 I x 2 6 !    ps$t p(p(t&p7q.p/p7s&t" `% 8"& ] y   @ `  p p `   X x0y(y Ѥ ` .x dxЬ   !   ! q yp8xx x0x4x8x<x y0xЬ  yx>x:x6x2x"x0xЬ  o qIp֢ liLi4;;;;oN= hLд  h`h.hh\h*hh|h hhiXh48hLд  h`h.hh\h*hh|h hhhh "c h2iXPHhLд  hh "c h2iXh.h*hLд iXh.h*-hh4"c h2i&hLhN y x qIp r \p hxh hhlxh @ yx yx+hh$ Ph `h0 @`4iyqh xppppi,h i(hX6Fkl "N> Πx& y Y 9.ΠvfVF6&  ~p r:pr  }  }>'0hP(h) ` E E ` ` Y ` E ` J J ` ` ` Q JhRkljpml ٜ((hon kj mlkjmlon h48 "%  {"z&}2|6:~>ypph(h*h,h.p ppp "%.>N^n~ &   @xpp `` h 'hPhR` ab `Ȣ`hj`hfp ` W  P @ ~  } o.!& $ y qI+hh `yx p! !U!pќp  !  !xєHhPhRhLhN&6k(j,x hnx$hrx0hx4h"k*j.>. ";hPhR*h&,h(h2p!&xx yzx6  x м>yyxxʢx.xphpєhx ќ  &6k(j, ";(h`4М(hh  hh!! . qIp y  ! є  ! h 3   @  ! ! !  @x  pxxЬ @xp& qI y p@p `` h 'XhPhRh z hz   @xpp ` W @ ~  }.hjhLhN, '   @xp ih3h?@(p`hh ``4"c E Q PPA(, `- `h`4"s E !%)!'"X"T"b"X"_"\"b"_"Z"Z"b"Z"`"`"b"`k.l*hXU #-``4"c0 `\"``(E@#`e # (hٜ(h"h  h"h #PQ #@ @`e #0Q #@(X`e #`4"c( @+hhPhRX" +hlnkrٜhi$"i # h h`i$"i# h h+hlk"hPhR,h(h2*h&(  #(#)#,#/#4#7#<#A            & & y q i $> $. yx '\x ᐀ @ x/#d ᐀x; .& &xФ $+######## b|x b` b| b8A(1!.& y0  p 3    d W @0j Yx     Z X J_ $.h6FV q" ^N>( y2. qq( ! ! Y С I p! @   yyx '\y8 & q r p(p  . x7x/x/x/x/x7 x0м$Nx7x7 & ( a q`$`&`S0 '`P`R a2a6 '`a``K`C`/`/```  `+/. 2  1 & (&a$,*$$$$$$$$ i  i i i xh i yH iY( i i )..a$`(Мќ& Yxp`$x Y YH`' `C  X Y`$       X&Ѭ`$p0p( [R&  H    Z& [&Ѭ & Y`' &6 Yp     X>.>. YFdL8 adJ`C`CtΤp4Єx`p<ЄHp>6$  > >pTq0ь S"q2`b@ %bH%p4Ќ@  Ѭ%!6s  > >q0q2 S" Ѥ   h  - '  ѬH  +pV   N KK%^N  }  } {6  |w>`  (ќb(b*  # `'  Y@  X gє &b Ҵ &{ g z2`' #}px2P i@abx`x``C `Chhab n% ox pp7/`  i@h@ hh a`(8`* z%& #e ' &Ҽ & g```' i@h@ hh a`D`F`<Π@  g 8aaaa6  |w> #e O ќ '#p4Ь`V`'`/ & `&`/aP`R f& `` М0^aR`' (k&^aR`'`(`*  }  } {6  |w>`   Z  `' a&&& qqpơ(  >  > r 6 ' { a (  +>..& a'o"` '|"`.@@@ HX@ (!0 d8- -  i@   hRhV'& i@ ! hS( hV'. a`0`2V& i@i0" " h'h.^ S PФ@F . N& y@xH  # # h 0"Lx ! " 8  Y .x & (& p ..  h p L(   V y xTЌ(r^ a`0`H```P``` ``(``/`/`/@`/``*`````R```J`2`6  ' q!@ p! )^)b)f)l)r)x)~)))))))))****************))))))))))))))))****************))))))))))))))******************))))))))))))))))****************))))))))))))))))** $* $* #* #* $ #* $ #* #p* #p* $ #p* $ #p* # #p* # #p* $ # #p* $ # #p*  (:* (: $ (: # (: $ #` (: #p( (: $ #p (: # #p (: $ # #p@    &F ! Q*r  ҜH҄8Ҽ* *** Y p*Ҕ p*   ' Nq`  +@( ,3 +38sp>*- =? A~p (H  p'VpĄ N  Nqxą`rҌ`Ԅ N( ,p ,X ,3 +3p( ,@^*p^qN.p ~ Nq8 ,3ppv,h W hB -` `  N  N!& pp.  ~v,h W hB 8-`h~@h + `  N  N!& pp.  ~&  Nq 1p.v,h -` `  N  N!&  +p܀p.  ~&  Nq,h p-`c`b   " .f6& k k9 $!0( ~   N  P KK+܆ .>n6&b"pr& ) kv 9 j, ~.` Pbc KKbc.>`( P qpp qpܠ p ``6&V!x  S PФ@F - N &~ , ,࢈5! H   !`  R ) kv 9 j&!`b`( b., ~!` P.,W^.>F& S HФ8" ' ) .N&6r S"Ҭ! ' ,ӄ 8 h>.& &6!& ) *. >.5 eX aa + N. 5 ~}|{܀zـրՀԀӀҀyx̀̀ˀʀɀǀwvÀutsrqponmlkjihgfedcba|`zy_vutsrqn^ml]k\j[igZfYeXcW\VZUYVUTTSSRRQQPNOMLKNJMIGLFEC<:96K54J3I2H1.G-F,E+D*C)B'&%A#@?>=<;:9876543210/.-,+*)('&%$#"!   qpppp:p>p3p7p a`.@.@ q+xxЄ@*`x i/%. qp.I.J.S.d.R.R+xxЄ+x a`( /p h*`pp hh4*`+xp*`x @aB!?/a.//+/3/7/?/E/I/U/X/b/e////h//w//00$0M000111101Q1Z11/1/////11////////1/////11//////22r22/37KAs/////////b/e7M/7ZB BgB/C.CXCwC///7^899.999:2:A:P:S:v:;8;E>>>?////@@8@A\q< !@ =& / xЄ. |"y&z*{.x @p P. !@  !@ !@ !@ !@.% {(z,x$y0=x#x$.% {(z,x$y0=y$x(! /y$!/ Sy$z({,/x$ `   x;/}8|<@}8|< a ,`   //" iRx$y0/( /(hJiBx,hRx(hVhZh^ \/ iRx$y4/( /(hNiFx,hbx(hfhjhn R/.% /%y${(z,  A = /%  =p/h4 8 /% /%qp (p = /% ab$c(d,e0@ =p/h4 /%p hh8h: Mm(pp0 S&  S ! .=ax$`/ x#@x'ISx+P x/ !x2?x6 ab a`<x: !x>x P @ q '/%y$ N/(~8?@/(|(}, PmҌ P PF a& `H`m0h<h@P.  /% 0 W. /%/  S&   R.//% = /( Ok /% Py /%//% = /( P /% y$ P /%x(/(  gO/&  P )dP$% N P( b%  P xx$p  gO)././%./( = /( O Pm//% = /( O Pm//% = /( PH /% M P Pm/ = /( Ok /%b  P a kv 9 j  ~ Pm/ = /( Pm"/V ihi  h   ~ i5-u0pLqpYh1n#^/}@ / !x  iib//%aP-"cpbtgל 1׬ 1hפ 1@ Y 1 1~:>/a@bD #/& a4 c8./ = /(bDc8/a@bDx$`B{(cF iRhx, i- j/& x$`6x,`:./x8x(% /(x,- /( N bDc8dFe:  = /(x( /(x, /(bDaFc8`:/  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/(  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/( h0 /%/ as& `Єxab*``hx:`x>` r cH./! /% Y /%& bH`hH ' El././(  p aR` r  hr& x$3*333:3'3'3'3'3'./( !  4p   48(. !@ / 3 !  8  z 4 { , H P X 6 6T>' -` qI y ih$д@ } x> | x:  6 6 5K 6( 5 5  5; yx$Д0xx y@ 40x yx'x2x 4x$м x'&|x$Ь0X 44M 4PH z& {% 4@  398 " 3 3 1)% 4Mx$м()4M`3 0 x$ЬH "  0  @`' u `&,` @-hh3 x$Фh'  a `  4"@h' t h& y a x' r ` s `xx3e a`'aax$ (`P`R`/`,`.`K`C`C)*++./. !@ /4 ` d   0    "  I  & y  y2y6 'xP 0xR  xRx,x. F4 `4xPxR  x,x.xKxCxC 4xPxR axTЌx'HxPxRxC@  @ x' xC x'Hx$Ь q" y0  `p@Qм8pxx px z& {% дPЬHФX yxЄ@     q  p ! qnpcqfqpkps pwpxpzpppppp~pp6pp'p2p 6( 4!(p$м p' q" y0 ih$д hh8x:  6  6p q" y0y 5x&ќ5p5555ѼPPp xx y$xx"y&   5' x yp8x@ `0  `` %b2pxp`$ `&`a0@(x2@(x6@(x"@(x&@zpp`)8` `  `2 qI y yx-`&p6P6;6Gpќ  6` 6Hpx0  6 a  ` a  ``` t  8 v $ w  =h3 o&-h !8 '>h -h =h3 ph'-h v  r w p a y  ` @ r p ` s p`xxʠ`:`> q p&t2s6p:p> ! q"pAp pp@St0s4-` =` p-p`Π u  8 x $ y  =-`h3 o&-h !8 '>h  6-h =-``3 p`',` x  r y p r p s p 0 x$Ьx  !`' "  0  /&  @ @./}8|</ = /% Y K0 z,{(|<}8 =p7r h /(hЬФ /(Д aa8b aЌ aaa ! hЄXj(/(-! aZ0h(/(`Rh /(A/(/(h  /(h /(hHi@ /( /(hLiD /( /(h = /% z,{(|<}88 =p7 - in-Sp t ЬXx$  2?0 - iR-ShaB`F \ R` R`8h`* #  h p 6k (>hij k$`abc"lHh0i4j8k<`a bc  @ hi kpӄ 5  bhx`ht ` ```8z iR j0p @  (O !! a`/@`/ Y( @ '`Ƞ` 8 Yx X gC X g   X@ J_(` 8/  X p L 0 0` /% iRx0hBx4hFh 0 -z,{(|<}8= 'ˁ/% Yx     Z X  K0 J_//% Y/%ap?  @z,{(|<}8&  =p..p? i @ CeP-! !j ! N`8 8#$  -  j @  J9; = /( = /% S дPx$~ `Ќ`h7h8h:  /%pp9 = /( +,-S    J   J- +z,{(|<}8=/% = /( P//%x(/( = /( P /%  Py$z(/q` )~ adP$%) N8"  gO/% = /( Ok /% P//% = /( Ok /% Py/a/ = /(  /%֬ y$фh x>hx:kja/x$д`/%bPP @ z,{(|<}8=/% = /(`/% = /%h7h8h: P /%pp:h0 /% z,{(|<}8= 'x$/% Y K0x(/(y$8/(! '&& a`` Yx     Z X  }  } {6  |w> a  `J`C`C - J gy$ Y z( :../y$ Nq,/(/ /%`Ь0М /% = /%y$z,{(|<}8 =p;e  N0` !@ /֭ ijk lmnh  ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ!1qȠs h0h2@(h h8h:࠾/(  <"  <"H  <0P <0  <" =hh8h:h7hShO h[ i~hjklmihh7h8h:h#h h l /%pp< /%h / /%  D L) ( <$  D L T \+ * ) (  /%`Ь0М /%y$!@`Ь /(/(z,{(`p@`tN /( /( =,h@X-` QF@$`@'&0@  @ /-p",p -` .X =+pP  /%h7h;-`h3h8،h:&  +.`  N  N!   /%pp<h0p `8 b/% h8/ QF/֠. 5 Ь0& q50 !  q.0!p$(X ho'n&$`-`؄h`8 @( @$hn8 5 Ь @ p=0 @ H 0 Nqcb/% = /%h7h8h:x$ /( /( - + /%pp=h0 /%/y$`Ь /(/(&  T5"e` KK 5 Ь`././% hp -pp0ph `-`p y$ N0~(?@f~$ N(@fq(!hi  qq 1 1 afa`b&c*d.e2, Cpp/& y  h>%xЄ@z"{&|*x @ qq8p0 `xp0 a,p2p6q:"bcd . qp8p& >| yxЄp4 `,x"`x&`x*x @p8p:0p3p7H p6.& S   > ./%& `0`2 Yx     Z X J_./x$ (a a//(/%`/% S Ь/% = /(` x( / = /%h7h3h8h: 1 /%pp>h0 /%/  /%$z,{(|<}8 = /% 1p#p/p&  N?d`0?d S Ь( QFלהׄX 4 S <0הH 4 S <0!הج S  4 S <"& Sה  5 Ь@׌ p~Pה (P?  q /p/qp p"w* a`fp$`b&c*d.e2, Cpp?p,pqp$ w( 1 ab$c(d,e0? q / )~y$z({,|8 /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( aabc d/ S  r мahz$cy&//( /( `l /(y&bj/  /%|(}$~8, = /% p#p/p& 5,d`0`X` `  *H q /p/qp p" a`cp$`d&e*f.g2, Cpp@p,hqp$  ad$e(f,g0@Sq //%`ЬМ /% = /%y$z,{(|<}8 =p@֭ h(pHq0r/(h i$ ' Nqq"fen = =h7h8h:h#h h /%pp@/%q  ,h  /%-ph *  J jk lm a`no(pq@ /( =r/(T /(``*b&c*d.e2, CppABp hh  *  J * ab$c(d,e0=/%y, ! = /( Ok /%&  P./x$ЌЄ 9 = /( = /%`(x$Ќ ``0 S д 9x$~ 9ˠ 9ˠ 9`Ќ9h7h8h:  /%ppA = /(9 1!  /%   /% S Ь /%`ФЬ9h7h3h8h: 1 /%ppAh0 /% = /(A /%` /% S Ь /% = /(` /% =  /%h7h3h8h:y((iRy,iVH/(hShWh>   /%ppB^h0  /%/ /%` /% = /(` /% =  /% z,{(|<}8 =pB֭h@h(h/(h7h3h8h: =/( e  /%ppBh0  /%/ /%` /%~$ N/(P` /% = /%h7h8h: h   /%ppCh /%hh6h hz,{(|<}8= = /%y$/( z,{(|<}8 =pCJ *   S/ = /%y$/( S z,{(|<}8=x$/(&   aaB./ Y     Z X 8 a`0`2 J_& ay$aRaN`W`K x8`jx<`fx(`bx,`^ a `````7./& a q`DФЄ EFhЌ Dg@Д D8Мa.a(ќa* bLP`H0bJ`C`Cxq4Ѥ`b@bB(  J`@@`B`Cp{ppp pp J gV t ЌpSp| J gC`@ `B `DЌhDObBp`@`BbB0bBpp^p# DsDEEp  # ᐀ @ y {"xx xx8xxxx#x'x+x/ y {x   S y {x  S` ` JFp`C`Cpp% E-` дE+q E E&  " #D`C```Cpp  J g ii08h4 ih   " #0Ehp ᐀ @  S`C`C`@`B` д`  p ᐀`V`u z) 0p# EyEEEEFF9FjFFFGG1GGGgGzGGGGH"HSHHHII:ISIT a` a`````Cp  J gp`C` д yz0x4z8(pp J gCp G J_p`C J gC J  E` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gC yz0xx4`z8(ppp) J_p  J  40 K(Ppx8 IUp '  &S ` JF Elp J gC@ yz0x4 `z8(ppp xz8(pppp Gg J_p " @ C  A J   K(  pT " BS` JFp J gCh yz08x4 p ) J_p  J  @S ` JFp J gC yz0Xx4@p Jp) J_pp```C`C  J g7p J gCp K(qp pt '~8  I ᐀ @  t S` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gCp yz0@x4 Hz8(pp`z8(pppz88 t Фpp) J_ ᐀ @  S40 p K(Ppx8 IUp '  &S ` JF Elp J gCh yz08x4 p) J_p J  40 9' @S K('(%  *pT#$""'& @S ` JFp J gC yz0Xx4@p Jp) J_p ᐀ @  t S` JF )S%,  A( S   ( HIjI؂` ? ? Iء   ! #$@I# !&%I#()X 9":'IuR-)-uve2e6% '`e # p{&( S ( ! !   ! ! !#8', :qR-$-uve2e6% '`ep{ qp y q@ z2p@ pp& q# sx@&  JxBzB..&  p. ᐀`V`u z)  J g&&  }  } {6  |w>  J a`` a` a`C`C - J g7..& q z2 q@p@ pp Y Y   (O !   X0  '' J_. @ 3 J ᐀ @  S ᐀ @  S a 1 8  `JF S ФX *   ! *  +N J_pp  М&  !.V 5 KE^6V6F iR``` ``-#c #@  #@`>`B`N`R`V`Z`^`b`f`j`n`r`v`z`~````````a`m ``m `ޠ`Jh`:h `Fh`BN>^>& iDnH?@LBLG  L*5!e L`L`  P`  QpiL NH MiL  OiLx@ O( O( Mp`P 0- h`R(-`R`Nh j?.   (  5 Ь``мHa K )  ( ! ь hф @ )a ` H ) ) .& hD L5!e`,p .`-`` `  ` (@ 5 ЬX`м@a )  ( ! ь Pф ( ) ). , &  yiDMh N`phdoP 5 ЬMQ`мMQhdo Mih!@xЬjpklxp`xtN"#@"# =,p0 @@.` QF@$`@'&0@  @hfijjn 0P 8 @   .` -``h8،h:&  +.  N  N!  . ( ! ь 8ф  ) ) iDnH?@ࡈ5!e`hL  O10!hL O P ( @a ) H ) ) & `P 8- h`R.-`R`Nh & `Lp qph`Lh-`N.-`R`Nh p`L pph-p.& `Lm0h`R`N.`Lm0h`R`Nh`  - `-`` && b"`b…„b..& b"`b`Ьh S Ф@ b(b .& b"`bx`Ф` S Ь8 b.&5"e -` , `` KK.& &֡5"m -``m `m  ޠ..05!e V6F` ``` YX`~ i0 5 Ь- i ah bh`h` h`ލi- i@ h ih ih`^h`ba8 `:h`f ! S ! S ih`ji anh`rh`v`~ ii an Y С I p! @  aN>^& q.h qphph.& `mi@jH !(O} & j -`h  Ohn. & ` !hh` Ph hh  `.&  Q. M PH P.& `miP@jTp !(O & jV -`hS  OhWnb Nࠅ. &  j?. & `L h`p hHX0h<h@ -h h p }j`LbN"aR. ` h hHX0h<h@ -h h pj`b"a P  Q QF  QF i QF  QF  QF & `mhh7kJhG `  R P``.` !pph !0P٠& `m( -`hh  P. & `m0` .` !ppP` !(Q$&  ` hhThV  `.`Ф Yqqќ ~5 }Hxxx yRxФV   Nh```Qn^ Q  8 yRxФ0  Q g Q gC Q   ! S Ф0  Q g qpspw *V   N0`Fb' ) ```` ) kv 9 j  ~NQ^` ```  }x&& b5" bb.. 5"8  R+ g R+ gC 5"  qppppppp pKpOp[ p_@p q}ppp p]p p@p7 q5qqp S P S МqR r  s! RnRRRRRnRnRnRRnRnRnRnRnRnRnp6FV v S^N>(pp" 0pp! ppp"  p! ppppp qhL0p(p*(j`r6kds:hhp>pvhlpBpzhLp.hDp2 p ?!rnsrp(p*pV&h8SUh  qp,!hi j-p.pp qpSe 2ScS q5ri4SsiHhD@ "ScS:SSSc q 2ScpЄq"h q}pppp . C qp UBpUBh< q q VUBpUBh< h@ q q VUB& T qpЄq"h8 @i"h @p.p  (p V ࠎppmX V@p VpPpPp0p Vep VV q5qp q! r&V: r*V: r.V: r:V: r>0p"^V q5qؠp q! r& r*V\ r: r>   Bp"^p,q00p4pnp8prHpl@pn ppprq2p p& V  ! @ p .  p .pmp& pp-pp.   ## 0## `s,q0# -p& pVpS& ! . _p) 3 `'WWKWcWWWX WcWVWV ihhp( i-p Z`(`*p( i-p`(`*6FV q" ^N> ihhp( i-p [R`(`*p( i-p`(`*6FV q" ^N>ha$ Xx`8Pp  Xx(ppha$h@`` ` Y $.Vh hW}H hh0W Z^x^p(Xp@p(p p`` ` Y $.ha$X0Xp(@p(ppha$88 pp Xa$ Xx (8p p Xxha$`P(@p(pp! Xa$P(@p(ppha$xP(Xp@p(p p& a i@ q  Y  Ѵ!`'`$Xh    (`(`* YP Y8  '' Y Xx  ''p p"p%p!.& X g.& d X g. z2 q X$&6& z2 a i@ q `(`*  }  } { g6  |w>`   `'   ''.>.  @    ` Мh`hV -X `X^ a i@ q  XXXXYp"@p!(p# p$`C`h  '&  }  } {6  |w>.p`+(`+ V& `$Ь .^Yhhi0hYK Z.^ Y`Dh`P `R Z`R(h Z& X g.   V YHh0   a i@ q    p`h  'h`C`C`'`+/   r 0 r 00 r 0 r 0   Фp '6 ( +>  q . r`P``` ``(`/`/`/@`/`*`````h  'hhh`R`PV&6 a i@ q` 8  !Z  !`(`*`'h `$Zl `Zl  }  } {  |wh    h   $.`   '`h `' `$ 8Z `Z `(`*phh>.^V&6 a q i@`  h[h`h  ' ihh`(`*`' ip jp&p Z `Z[J i@ `' `$  [ `[  }  } {  |wh     $.h i@`phh   '`>.^V&6 a q`   }  } {  |w i@h    [  Ѵ`! X~ i@ $.h` ihh`(`*`' ip jp'p [ `[[`' `$ Ƞ[ f qp& X gC X g. i@`phh   '`  !>.^V&6F a qq0ь` S"q2 p0Ќ \Xq0q2 S" Ѥ0  V  ~ Np'     h\#^ѬH  +pV   N KK\O^   }  } {6  |w>`   XN>.^ qpppp+pOpSp_ pc@pppp qhH0p(p*(jPr6kTs:hXp>pzh\pBp~hHp.h@p2 ?!rrsvp(p*pp+x qpCp \\\\\]*]+]]]^](]]]]]]^^^^^^p \](](])])x0y0 x0y0p0 q,  -pZpc@ pW& ! p. _  -pZ  -ppc p ]2]5]C]\]\ \&ppX a  \H&p apX hppZhhh4:.. ^ qp ]i]i]i]k]npp^^^ ^_^^^^^^ _`$`m`^^^<^ ^^^`a^^<^^^^^a^^^^^^^^^^P^^^^^^^^^b^^^^^^ep h p ]]]]] \&ppX a  \H&p apX hppZhhh4;..^^ _^^ ^^ ^ ^^ _^ ^ ^ ^ ^ ^^ _^^^ ^^^^ ph8h:&  R.ph8h:&  R.ph8h:&  R.ph8h:&  R.h4  p_Ipp-pppK_Ih4 ^ p_hpp-pppK_hh4^p 1! h8h:hS L& h79hJiR R. ( hL pa.-pp $ ShXp^.j^.8hi __ pp ^ p-p"p `,h6p "q  q q" Cpppp h p h^.p hphh- hiq^p hph(hih4 a.__  vfonh `!' p xpxpxpx~ ( x`e0n~ 1! h8h:hS K S&   R. ( 1! hXh8h:hS LN& hJiR R. (  xph- hiqppp0p hppHpiDhH  xiD NfnP OnF  "$Ą$N N Q_hLЄ &  R.& p S Ф asaфxhXP`Є `8`` h` `hXx`hXH` hXb.a.a.a.a& p S Ф as`ЄbcЌ0lHpiX ! (! iX !0h!Ph``bc .a.a.a& p ascӌ c c .a.a& phLЬH as``HhXh\e 1  h``'iLѤiPa& A iX @&  h.hLH as`Ќ `` .a.aiT. @- (*0  !ࡆ p)0iD Nx``Xh\e `$  ` as`ЄЌa& b b.a.hSahSah4 ^x 0 pQ@pp-pppKa.& > 1! a ! єahH p a  aqp a a asa0hSh-pXqhLa.` h. hhi!hhLa..hSaф iD N`qhShShShhSPhS58 r hH p`\qpp мX 9pa9pa9hS(hS).hS* .` ` 2. >X @ (  hThV&  R. p,q00p4prp8pvXpp@pr0ptpvy2q2 h 6&pjDbd҄pjL5"e`,  bhDbCbHbKbQ  ` DH iP [iP D hW&  R..>hW hW phW XhW @hW ( "  = =p =`Ѽ>`pXh\@ G z҄ ^ V6F 0= >(v8p c 0x(x( c7N>^ ! o ऄpH cp դxVF  $. `% 8"N^Hh ? 0x(x(N>^90ph ? 0x(x(V f^ @  Ќx  H&6 H% > >.h` .  S .  S pd Hi C 9  e hj dq #d#p f dq$a p0Pp4d  d0  ddp4d  d"dp0hФ(hqirphv yyx  'y2y6 'iRp< q@p qpp4d dWXp4dhh 0dW@p4d dW  dW! dWR@p4d dWP@p4d dW@p4d $dW$ -ȠS * XSȠa " !!$ > d< #p` ?@x E  ""  ' NqfeXhpht``FPhp8hth ha`q a      (!0 d ~襖   5#Ӭ8 ! q50 ! ~ q.($#ho!k F$x X pd͂" eeeeeeeeqѼq !``Hh\0q$a F Ƥ eiqѼei ""  'ei Nqfe`bHbb 0a`q a q0a" D  a`q a ``` jh o   I >   a`q a q0a"```A j" oqѼxp `P8h\ E  -hq0 eeeeeeqѼp q ' Nqhfeb a `q a   Xa `q a  qѼ@0q$a  qѼ@A0q$a  p `X@   1i 1I 1) 1 p fF ""  ' Nqhfe,N`  -`&hh7l: /.Snf`>`` jh o n N qppappvpppp&p+zIp2p7zp;p?pBpGCpJp[g    :pn qg2 `p ppap& p@ ( qBpD a`4:rlPpn C  > & p$ p p"hp# q&p(p(p0 p,p.`p/ q2( zp4p8p:p<p>pL hpHpJHpK qN qPqNpXp pt Xpppr8ps qvpxpp 8p qp.pgXgYgq qp qrp  qppp q`aq NX`@`0&  o.pqp `& ``a` hhTphV  a . q  pp qp'p#    qq2p/    qqrp &pTpV a`Xph`2pd`.p``*p\`&, C. f qqvrzps  qpxpvpz ass `hT P as`Π8   ahLд8м  h0 t!Є8 B  C 0 B `H A a  C   ` hiRh`iLX asbҌ bb R`mv 9 h~V as``^hЌ8h h  h̀V ( h(#h2 ^2 & ( y. ih i- j`'xii;ii i;iii  g ob J gCx((x* JV  Jxx'x+ @ g<  @" xb`x+x$e   9 x$e x ix('0x* z% a qpЌP a q J_  8  b`x+x$e   U9 x$ xm hhy$!` i<  i>hTzyyxx' oa(igx ig n% jh oiU`'b`Ģxy<0 I    9 y< yDu0yFy<! 8````xHxJ& `, a` `"`H!a.aa i`hh h",hho`hX`V`[,hhZ i `V`Z,hh& `, a` `"`H!a .aa `, a`40!a6a:a6 vfV6&&. qv8&`&x k`( k  ` k p<6  |wp3p?pCpGpK> )p86f v:p46@,6/p6p7f f,~&x` '` h`h7kJhG6v   R~>  j,x` `j 6 o>..>^n~`X6v  ~>` jjf 1& yx8eh` `x<6  |wx3x?xCxGxK> 'x` h`h7kJhG R  ~:~6.n` `` & A lX.& y  l mW.f& qv&`&x l.`( l) ` l)p$8 ih g z2h ~p'6 i@k hh ih$Єh'> ` c p6f vp6@,6/ppf f,~&x`` h '`@h7kJhG6   R>   }k,x` `k.n`X6  >`(` `x` P& 5 e lf qfTpvp0ppv`X}~V/hZ`W`[`` M lv$覀  ihH g z2h ~p'6 i@k hh ih$Єh'>`<`>&` H&`` c lXh7kJhG   R }ln.f 1xe m7` `x$@ ih g z2h ~x'6 i@k hh ih$Єh'>(` c ,0` h 'h`h7kJhG R   }l~~n` X`(` `` `fxe m`T`W`[`` M m~$覀  ihH g z2h ~x'6 i@k hh ih$Єh'>`<`>&` H&`` c mi8h7kJhG R }mim\xxnf``LmhHp qp$5H  ``!n yx8&`` c  z2x ~p'6 y@{ xx yx$Єx' ~> M`<`>&` h7kJhG  R } qpn7n:nPninn7n5n5 p$eHp p"` Pr`pp'rr ` ` M``p p" `T@rpp'rr p$ep ` }`  r`Hrr 0p` }`  r`rr`` ` M`` }pe8`Trrrp'p$e@ }` Pr` ~p'rr ih0nnnn h@ha.b  c>,xq 5 ЬѼPq q@ (-, aa ussh/k&h+xxx@> h e8hh&h+ o ih0  Ѽ`h8}h3h>hGhK& $. 0. x.hCxx @j:xh3h? `h:h6 !f 1 ZEnX` p ptuptup p n% oV6F` a!xy 5"ҬѼPy y@ (-/ ,x aa@p3N>^q3q~qrhrrrrrrrrsHrsisqrsqspppppppppppp{={R{u{rprrpqrhprprprq,pppppppppp{%p !3N>^ppppppppp    sx h $  h< hP hT ` zx hh ijҬм   s  xh h h h h h ` zVF   s x x ` zN^VF   t!   4  S  S 3 q `L zN^  ` z   s R iRhЄPh(  '!(  S  S 5 Ь8x( 8   @   ` z   s  5 Ь8x( 8   @    S` z   sx `  Rx( ~0 b ´b  x( ~r* 5 Ф 3 3 3 ' 33 333 Y7? 3  S  S  r  r 3  r%h 5 Ф@  ` '` S  S  S  rH  rN S  rY r_`t z   s     yRyѬ Ѥ ` z   s Pq   s !  ` z   t!  ` z   t!   *` z   t! q   t!  x(  x ` z   t!   x hhi0i@ !X @ ( p yRyѬ Ѥ t! ф ` z   t!    ` z   t! q9   t!   *` z ᐀ @   t!  ` z& ᐀ @x( ~ " "   ""Т0 " 5 ЬҼȢ( " H5-lh" h i-h-֢5-lh" h "" )  z" / .& ᐀ @  " i-h- )    & ᐀ @x(  5"Ҭ~֠5-lh# h h@h( ( i-h-֠5-lh# h ""   z" z"/ . z" z"x .`  a!xy 5"ҬѼPy y@ (-/ ,x aattttttt F  ` zNF   u( x x `  zNF   ub   ` zN& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h "" s& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq,xx@ S y!`a 5"ҬѼPa a@ (-, aa@uvv~x:uuuuuuu}j}z}}uuu}Y VF   v5y!hiHy"!"""iL @ф  Ѭ HѴ  "0jn| 6! S>  "&` ᐀` `      N^ ᐀ @z# "x(  5#Ӭм֠5-lh h i-h-֠5-lh h ! ! ) " / V6F  x hh` h\ h h|  `  zN>^& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F   wx h"""""x0xC+N>^w wwwwwww  6iLPkx#hh hd >wá kx#hh hd "ht "h|  wh|htV #wB^"""  ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" a> z    (( """ " """" p " "" %"""""`2 z (""""""` z """"" "x$ ""`  z 6{x"> " >h& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F6x;>N>^xTxTxVxTxTxTxxxT yy   iRhм0h,  ?"""` z    & ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h "" ! z" z"/ .VF6 a qqTx hh (v֬0м ijtT ijspttx y{ 衅`bbfcjdn`s )`whh`z`/`x`x pp`p`p `p`hl```` v `Ġ X g>N^pЬռ8`bbfcjdn8`bbf`kdn`s `whh`z`/`x`x pp`p`p `p`hl```Hj j b v `Ġ X g>N^x ppL y 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p``p\`p`p|`hl```Hj j b syi 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p`p`p `p`hl```Hj j b syiz# " ihC ᐀`V`u g` ` aa```a& a i@ Y  f 1 ZEn gh ai@P1hh aa(Xa*a$΁ g z)pa$@  g  .   aa(a* g J_ 8& g qq< a i@ Y6  |w>qqp6f vp6@,6/ppf f,~&x`` h '   }},x` `}Ԡ.n~`Ψ f&& qv8&`&x ~`~ɇ('~H`~Ʌ` p<6  |wp3p?pCpGpK>p86f v:p46@,6/p6p7f f,~&x`` h '  ~v,x` `~v..n`Χ q  ppf&& q,v8&`&x"p86f v:p46@,6/p6p7f ,~&x` ,x` `..nf& qv &`&x `( p$ ih  z2h ~p'6 i@k hh ih$Єh'>p 6f vp6@,6/p p f f,~&x` X ,   ~  ` h 'h`h7kJhG R    }8,x` `8.n`0 6V6F9 "* Ƞ8 !""SN>^>   t!  ` S  xx  z   t!   x x x( ` z  yy! ` ᐀`u z) gV66 ᐀ @x$ hrrrrqsqr pr pr .S`5j8p0`7>>^  `6a a*pphpJpO& q uHpL ``H p\ a `)uJ p\0uN.pO  quHpL ``H p\ a `)uJ p\(uNpO Ƞ Ȭ    `` ```````"`& a`H`J&  o. `:U*Ep( n% oG ^f` n8~ 8888888888 f` nSSSSSSSȏȁS i iS f` nn㊞܁nnnx{nnnn f` n  `a` hhO@h|h hhhhhT b, ' j&  o.GÁÁŁށÁÁÁÁ  n o`a!hhO h\hZhth~hxhhh na!h ' hK R  o n +a!h ' hK) R  oG! ` hhLhN => , ^a!hhKhS R  .` S 34 34(".#&< '0` ppp7 6s00` hhh`0 hhh7k2 > * ` S *`  S`  pp7  p0@p8 p<! `  J '@` ppp4pp7  .` SX` hV6&    .>^V6&   .>^Pp8h p.&6! ( kv 9 j`e P, ~>. N   o    n% +  ,`(  框~( 5 !  `2X q y /%`! P" 砲@ vwz}tttttttttttttttttttttttttttttttttttttttttttttttt        p N! n%`  ` o N! n%`6 ]#  @c> o  n%   o q y /% n%  o8 n%`  ` o& ЄЄ & '` pp49H 0 @ p8xp`!`=Hp7p3. .tp pp7p#f&hhޠ  fC  uf3 0f( Nf) ehf .0f f" Vf= pfD PS(1  م? !H@ => , ^.tp pp7  qpt p` h  N! , x   N! ,`` jh hЄh  N iRhФ  NN !"t` hj~  WG M` h( hh`8 hhh7h3  N! ,  q5.М qqr 8` ppмqr` hh8xh49X  @ @  N!`` jhh\  Y 5"    yx 'x 5"     N!  N yyy2y6 ' yyv!  'yR Nq,`  N!``` jh  N!    NN , & qpp(` >` h OZ  P` hhޠ  N!`up49H  @ 0pp7p3 ,   . !"X  N!`` jh  !"8  N!   J~ ?,f   <x  N  N!`` jh ! `` hh@phB` X ! &  J i-h` hh~8 i- jx  N  N!`` jh` h 'j4 !4  ! h p  N! (``K .֢9`` h 'Hh49h8 P` hh@@hB` `h~8 q K +` JX  N!`` jh   iX  N!`` jh X   N!`` jh  !8 !*!d N6` h q5. r ` 5! S ФX *   ! *  + q *V  ,^ Mhh q y. i jxp. i jxx2x6  ( "  ' Yp i qh rhphp hp @  N! , >&6V (# q.p   H   ^>. qppp `8p$ФЬvVF&& )%, !$$ a qrHph Bgh%P$8` LH 0  ` h '`h7kJhG R  ά p\9..N^~ 0 " #0#  `    h( , 8 n%  o @ՉՉՉՉՉՉՉՉՉՉՉ׉׉׉׉ՉՉՉ `a j"&  o.(`@o' n% +a!h 'hh7hK)hGiLiN R   o `@(F8E G   Є& (& i ..` MKKKKKKKKKKhhhhKKKh  n%a!h 'hh7hKhGhPhR R   o n%  o  n%` o`!  n%  `` o@Y  qa!hv =  skbsk^(( hKhKhLЬpij!Hppibj^8hKhKh7nF@  s(s,kVp  6#  G>q$iZp!` q# G h8 iZ h-x   7hKh7nFhLЬ0hi  Rb"hj<j> ` y|{~ }` xxLЬ8`!0"(X$y| #z&%|{~ }, ' j o`a => , ^@ 7  pxbpx^ 7  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x ~` y|{~ }` x|{~ }, ' z` n oa!hiL @iHh8hLhP V!# r^hRhN!h   7h7iD(hK`hK8hKhK R   |w` n o n +a!h 'Ph7hK)hG R   ohK8hK ibh^@򍟍 v qa!xv~FLNb"hj<j>   pxbpx^ @  ~F (  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x 0  qrs ~ => , ^`a!hiL v IiHh8  hLhP!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi hHxJh`xbh\x^ V!# ^hRhN !h t!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi h`xbh\x^hLxN   7Xh7iD(hKHhK iDiFhKXhKhLЬ0hi  R  n% n 'a!hh7 ! ьфaiJ) hG R  o ohK hK p@  & ^.ԎҎҎҎҎҎ ` a j"&  o.``  r'   n%  o  n%  o(` ' n% +` h 'Ph7hGhK) R   o  ࡆ n%` h ' `h7hGhKhPhRSQQQQQ^  n%  ``  o n%  `` o  zzzz|z  ' ` hhL h7hPд(hKhRHмhK hK hG R ` h 'h7hPд(hRhKHмhK hK hG R  ` h '@h7hK(hG RH0' 0 n%  oVf ) !0 i#  G xm  (h7h;- |=(&Y< <-x (/}6(/}6n^Xh}0h R/h  RV !# N^& `.}}xkxmxxkx 6  2``>` h 'h49(hKhS(  S  R ڠ `  ϐސ̐x}}xxxxxxx ` h ' `` ` j" o L 8 qp$ { { x6 qp<8  |w>P ~>( x` z ( z    n% o ` ' `,`  68Xjw6 jj6666t ` ppPpR qp$ {`` `  ` j" o` ` hhPhR`` ` j" o`` hhPhR  L`   ` hhޠ   aᑮᑮᑬ `P8 K ]`  z! ~" z= ~P` hhޠ +  a N 5 Ќ Y     Z X` h 5 Ьhмh@hB``` (-``P``( ~p 5! q K   +&  ,.   N!`` jh o  ,a 8` hh@ $hB` jh o    +&  ,```.`    ``  j" o  ' + 'h` hh7hKhGhPhR R,h Ph` -` -````` jh o `     ~ a!hhK R X@   &b.6& a qsHph`H   ά p\ P.>5! ( aa +V&  ^fe ` K .^ V& b ^P`e `%` P kv 9 j, ~ф( ڠ0 L .^ F ,x~,xx ! /` M NF ,xx~,xx !/` N NF ,x~,xx !   /` (/` R Nv&  PH ( PX %$ S R$ mb A 9& k j/&H a< lX o.~&  f a `-`  . &  f a `-` ! . &  f a `-` = . &  a `-`  . &  f a `-` D . &b"hj<j>.`p``  Q`f 1S&4(f&`nH On`@(`mHh498h8&  a `-` + ( . ءx !"tH M``) jh   (  N!衆 !"` h OZ p` hhޠ8  N! H   hH hPhR& q uHpL ``H p\ a `)uJ p\0uN.pO  &6   2 h  "   qqr d h  " R>.  (   qpp`$m &  xa `-` 3 . qp` hj<`,x pppjP`ptjT@b("  ,7 H   pTjT H &  a `-` C . qp`,x pppj0ptj  + H   pTj  x &hLЬxij!Ph`h\ ibj^.6c#hhJiR@c#` h8  QFjfijjf9#hkkrc#``hn R`>iDp! (hi  of` n(>(((((`(((((( f` nC͗CCCCCCCYYC f` n^Ğ@^Ǡez^^^^^  !@u| gb(;󗪗S  QP 5 ( @` `+ `p Q6&b"pr& ) kv 9 j, ~.` P.>f&` NΦ&4x a  `p` p (  xa`  -a j`p`p  -f&hn  N7pn@( nP&b("  ,7. OZ` p` p +`p  -f&hnަ P&b("  ,7.` p Q@ 5   Qf&48&  NN.P7 a { `pFd($$'F +N S! ѤX ) ` hhhN`p  NV&6    >.^h7 a a`` p Q@ 5   Qf&47 a 8  `pFd($$'F +N S! ѤX ) ` hhhN` @7 Pa`` p -  a`` jh`` jh `   - a` ` jh -`#` jh  - a& ", "` "``"p ",  "!``&` "`%h`p`$ !``%` jh.  NV&6    >.^ `1p  Y&6 YX     X Y>. - aa `+p`,p  - aa  `.p`/p& QX Q  qpp yrprx梄rtpvxp S Ф  Ь( * . t &  h -P8`E` jh +`` jhff&hn7pXn(nIh h bh$`* `hi h$ '0!  ,7 ih(`` ih@h` 0 @'    NN n%  oxzxxxzܜ  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  n%  `` o  N yRxЬ  N` @ yxx` ``@`( >  8 yxx  N! n%``` jh oa!`  gOf&hnަ7P8    > f&hnަ7p H 0   NN n%  o&#####%###  n%  oa!hiф@ N!  N ,f&hhޠ  ;( km yRxЬ`}xx  N  N!``` jh o ""  ' N  h`` KK``  J8`` jh `  n%  o@ݜݜݜݜߜݜݜݜݜݜݜݜݜݜݜݜݜݜ VF&a qtD 9 0   h  `-h7 hh;lZ,h^`h` xxq0iJhFhOhShW6 R 0  0  [ D  isj҄ h -x`  xЌxx`hh7h;`h,hJ` xxq0ihFy(iy,iy0iy4ihS=rDhO@@hOhO  ! i i~ R.N^  Є  N```A j" o ( i- ihla a``C j" o@```A j" o   I > ````A j" o` ``p`@ S @ G`A  Є& (& i ..`pġ'  `@  NPPtNNNNNNNNNNNNNNN  n% o6`m`` мx  ``  ``> n% o ' ` h   `!  n%` д8` C ` o n% h  o n% A@ڞܞڞڞڞڞڞݞڞڞڞڞڞڞڞڞڞڞ `a => , ^@%%   n o` hhLPh A`` h h 6 n o` h  `(  ```>P`B  n% o'`B   NN n%  o@yyyyyyy{yyyyyyyyyy 6F => , ^N>` hhj xhL A0`` h ! ќ``! h@  jjhf@ ԟ֟ԟԟԟԟԟԟԟԟԟԟԟԟԟ `a j"&  o.`a j"&  o.`a, '&  j o. ^& 6֡@#>.1La ` hhL`a j" o` hhLh@`a j" o``  ` hhL  h`a, ' j o ^ n%aX!h 6 ) >  o naX!h 6 ) >  o ` a j"&  o.&  qr$br  `@`r$`` j" o o.``  '0 P  NN n%  o  n%  o   H0' 0 n%  o6  1``>&6 ,@ }Xv,8 ~g~(```@`  ` L` h ' ``  `>.6V yy8x< ' Nx.& ) * kv 9 j~v 9 ~ P&bb ,. KKfe^> !!t ii i  `` ppp`ii iii ixii```p`X` @` (``-&6Vb"hkxH0-` N      8Fj' S! Ѥ8 ) hh ) kv 9 j, ~  NNN^>. ih`&6V yy0x4 ' N   @   ^>.&6V ""  ' N   @   ^>.vfVF&& '@ )%, !$$ a qvHphP(M M! D B Dg h h%$ R` x`  LH 0  ` h '(h7kJhG   R   ..N^n~P(   hP Rȁ  0 -X`8 0  8 ,   D,!p  `Fp( $',  N6  2>  NV&6    >.^vf&& '@ a y 7 qvHph7(( y Bx$`g@(@`` `@`  ` L` h ' F N   ..n~ vV A ), b } 9 ~g ^~&FVvV, !(  6 N,V A% ) } 9 ~g ^>g^~^N.vVb A ) H } 9 ~g,  ^~&FVvV,  6 Np, A(( } 9 ~g >^~^N.8Ќ00hh}8hkR R/h kR RF6 a8 qtHph!h`H`0`$$@   @>N  h7 h^&    " .hJiVlFhO  hRhhh:hZ RgX@ ( ` pp(` ¡'x n%6` h  > o p   n%`  o     ` pp&6V (" #46؃#4"6 `  P `  ^>. q K *` pphPhRvfVF&& )%, !$$ a qvHphxg%$ B R`  L  ,    X..N^n~& q@դp4p6մp0p2լx%H0 qJ.& q@դp4p6մp0p2լx%H0 qJ.& qB!.. r p. r q@  qD i& q@pDpF. @ @2fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2WARNING: opennode not valid on sun4! %s WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d %saddr 0x%xPROM boot failedno PROM root devicePROM sync commandhierarchicalsearch_prom: null nodemakememarrmakememarr: hope version %d PROM is like version 2 makememarr: cannot find "memory" nodeavailablemakememarr: cannot get propertymakememarr: no memory found' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !sd-targetsWARNING: %s map is bogus, using default config_attach: device name too longfindzs: unknown zs device %dfindzs: no obio nodefindzs: cannot find zs%d%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored %s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector SUN-4/%d seriesobio missingfboptionsno options in OPENPROMcould not find %s in OPENPROM bootpath: /%s%x/%s@%x,%x:%cpagesize %x l!/obio/interruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/counterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiesx%cc%c%cbootpath_fake: unknown system type %dcpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!PROM root device type = %s (need CPU)mainbusmainbus not configuredraidSUNW,sxeccmemctlvirtual-memoryaliasesopenprompackagesinterrupt-enablep2busgetpropintromgetcursoraddrgetdevunitrompropbootstrapcpu_configure-6//@/H/X/h/`/p//ˀ-B-6-9-7//ː//˨-B-6-9-7//h/ː/`/p//ˀ/X-68-60/pproperty lengthcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent in4_cksumih_remove: intrhand %p (fn %p arg %p) not found from %pprofAsync registers (mid %d): afsr=%b; afva=0x%x%x NMI: system interrupts: %b VME0VME1VME2VME3VME4VME5VME6SBUS0 SBUS1 SBUS2 SBUS3 SBUS4 SBUS5SBUS6KSEASCTVI5MIFVMIME MAnmistray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to unremovable fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsoftintr_establish: level %d interrupt tied to unremovable fast vectorintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x_bus_dmamap_load_raw: not implemented_bus_dmamap_load_mbuf: not implementedmapiodevmapdev: zero size_bus_dmamem_unmapbus_dmamem_free: nsegs = %dcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:device bad device not ready area improper i/o error succeeded real mem = %u (%uMB) dvmamapunable to allocate extent for dvmaavail mem = %lu (%luMB) WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting mmrwmmrw: out of space in kernel_mapmutex %p not held in %smutex %p held in %smtx_leavemtx_enter_trymtx_enterpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%lxpv_syncflags: no segmentspv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLctx_freemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_reservemon4m: unknown pagetable entry typeVA2PA: Asked to translate unmapped VA %ppv_link4m: allocation failedpv_link_4_4c: allocation failedpv_unlink0pv_unlinkpmap_release: segment list not emptypmap_release: releasing kernelpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pv_syncflags4m: no pte pmap: %p, va: 0x%x pvplL1 pagetableL2/L3 pagetablepmap_protect: last segmentpmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no pteskvm_uncache: table entry not ptekvm_uncache !pg_vme_free: no segments in pmappmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_rmu: no segmentspmap_rmu: no pagespmap_enk4m: can't enter va 0x%lx below VM_MIN_KERNEL_ADDRESSpmap_enter4m: can't fail, but didpmap_enter4_4c: can't fail, but didtrap type 0x%x: pc=0x%x npc=0x%x psr=%b %s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_FIXALIGN T_INTOF syscallsyscall cpcb/ppcbsyscall trapframesyscall nargstext fault: pc=0x%x sfsr=%b sfva=0x%x kernel faultdata fault: pc=0x%x sfva=0x%x sfsr=%b text fault: pc=0x%x ser=%b data fault: pc=0x%x addr=0x%x ser=%b asttext faultillegal instructionprivileged instructionfp disabledwindow overflowwindow underflowalignment faultfp exceptiondata faulttag overflowwatchpointlevel 1 intlevel 2 intlevel 3 intlevel 4 intlevel 5 intlevel 6 intlevel 7 intlevel 8 intlevel 9 intlevel 10 intlevel 11 intlevel 12 intlevel 13 intlevel 14 intlevel 15 intv8 r-reg errorv8 text errorv8 cp disabledv8 unimp flushv8 cp exceptionv8 data errorv8 idiv by zerov8 store errorv8 data access MMU missv8 insn access MMU missbreakpointzero divideflush windowsclean windowsrange checkfix aligninteger overflowsvr4 syscall4.4 syscallkgdb execsvr4 getccsvr4 setccsvr4 getpsrsvr4 setpsrsvr4 gethrtimesvr4 gethrvtimesvr4 gethrestimetrapcpu_fork: curprocvunmapbufvmapbufvmapbuf: null page framedvma_mapout: extent_free failed dvma_mapin: null page framekernel: %s trapFaulted in DDB; continuing... kernel: keyboard interrupt pcnpcwimg0g1g2g3g4g5g6g7o0o1o2o3o4o5o6o7l0l1l2l3l4l5l6l7i0i1i2i3i4i5i6i7prom%s(0x%x, 0x%x) at nop ,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s][%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN)undefined spfptpctnpctstatettticktbapstatepilcwpcansavecanrestorecleanwinotherwinwstatefqccrasifprsasrfcc0fcc1fcc2fcc3iccxccn_readsone_readn_writesone_writeilltrapsethiCdbaa,mbnbnebgbgeblbgubleubccbcsbposbnegbvcbvsap,ubrzap,1lbrlexbrlzbrnzbrgzbrgezfbaap,mfbnfbufbgfbugfblfbulfblgfbnefbefbuefbgefbugefblefbulefbo12d1idaddcctaddccwr12Y1iYandcctsubcc12P1iPorcctaddcctv12W1iWxorxorcctsubcctv12T1iTsubsubccmulsccFPop1andnandnccsll1Ddsllx1EdFPop2ornornccsrlsrlximpdep1xornxornccsrasraximpdep2addcaddcccYdjmplqdmulxUNDEFINEDPdreturnumulumulccWd12F0FtntnetgtletgetgutleutcctcstpostnegtvctvssmulsmulccTdflushsubcsubcccmova0jdmovnmovnemovemovgmovlemovgemovlmovgumovleumovccmovcsmovposmovnegmovvcmovvsojdmovumovugmovulmovlgmovuemovugemovulemovosaveudivxsdivxrestoreudivudivccpopc2ddoneretrysdivsdivccmovrz1jdmovrlezmovrlzmovrnzmovrgzmovrgezlda7d8dldfldfa7e8eldubldubap5q5ldxp6q6lduhlduhaldqldqalddlddadpdqstad7d8e7e8stbstba5p5qstx6p6qsthsthastqstqastdaldswldswaldsbldsbaldshldshaldxacasas2dt2dldstubldstubaprefetchprqrprefetcha7r8rstwacasxaswapafmovs4efmovdfmovqfnegsfnegdfnegqfabssfabsdfabsqfsqrtsfsqrtdfsqrtqfadds34efadddfaddqfsubsfsubdfsubqfmulsfmuldfmulqfdivsfdivdfdivqfsmuldfdmulqfstoxfdtoxfqtoxfxtosfxtodfxtoqfitosfdtosfqtosfitodfstodfqtodfitoqfstoqfdtoqfstoifdtoifqtoimbpp_recvmbpp_sendmbppdelay: %d port%s : %d tty%s magma_prom %s (unsupported) pri %d softpri %d:mttydcd%s%x: fifo overflow %s%x: ring buffer overflow magmamttymbppMAGMA_SpMAGMA,4_SpMagma 4 SpMAGMA,8_SpMagma 8 SpMAGMA,_8HS_SpMagma Fast 8 SpMAGMA,_8SP_422Magma 8 Sp - 422MAGMA,12_SpMagma 12 SpMAGMA,16_SpMagma 16 SpMAGMA,16_Sp_2MAGMA,16HS_SpMagma Fast 16 SpMAGMA,21_SpMagma LC 2+1 SpMAGMA,21HS_SpMagma 2+1 SpMAGMA,41_SpMagma 4+1 SpMAGMA,82_SpMagma 8+2 SpMAGMA,P1_SpMagma P1 SpMAGMA,P2_SpMagma P2 SpMAGMA 2+1HS SpMagma 2+1HS Spmagma_attach/p///p//@`/p// @`/p// @`/p//  @`/p/(/8/p/H/8 @`/p/X/h @`/p///p//@`/p//@`/p///p///p/ /0@/@//P@SUNW,spif%s-%x: ring overflow : expected 2 interrupts, got %d : expected %d registers, got %d revlevveroscCCR: timeout : rev %x chiprev %x osc %sMHz stcpri %d ppcpri %d softpri %d sttycdspifsttysbpp%s: draining still active (0x%08x) : Zebra : DMA2 : Unknown type SUNW,bppbppchild-presentfalse: no devices SUNW,xboxwrite0-keyxbox%s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected return value (0x%02x) %s: command %x failed %s: (op=0x%02x): unexpected data (0x%02x) in state %d %s: SHUTDOWN REQUEST! %s: LOW POWER WARNING! restoredremoved%s: main power %s attacheddetached%s: external vga %s uctrl: expected 1 register, got %d Tadpole_S3000XTmain power availableinternal battery attachedexternal battery attachedexternal VGA attachedexternal keyboard attachedexternal mouse attachedlid downinternal battery chargingexternal battery charginginternal battery dischargingexternal battery dischargingtctrlapmioctltadpole_powerdowntctrl_lcdtctrl_tfttctrl_brightnesstctrl_belltadpole_belltctrl_read_ext_statustctrl_read_event_statustctrl_set_glyphcouldn't establish interrupt socket %d%s: spurious interrupt on slot %d isr %x %s: unable to create event kthread%s: slot %d still busy after 3 seconds, status 0x%x pcmcia: expected %d memory ranges, got %d : %d slots ts102tslot_eventtslotstp4020_delay%s: unable to create event threadstp4020_ev: rev %x stp4020[%d]: spurious interrupt? stp: expect 2 interrupt SBus levels; got %d and %d: attach: cannot map registers SUNW,pcmciapcmcia_function_enable: function not initializedpcmcia_function_init: function is enabled"(manufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachdisestablishing last function, but card has no ihchanging ih ipl, but card has no ihcard has intr handler, but no function doesfunctions have ih, but the card does notpcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: can't alloc memory to read attributes %s: can't map memory to read attributes %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-151<1511 =1<1=11 (11`(1|1P1<1U1<11<11<10(000P11`: function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, %s%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't allocate I/O space : can't map NIC I/O space : can't map ASIC I/O space : can't match ethernet vendor code : no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926EthernetAdapterSeiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetV1.0LNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10080Hz0X0` 0h0p000000000@00@00000@30 000(000Pl080 0PH00 0h0p000000`0000 *00 *0HT00 GC000000 00000HT0@0@0P@0`0 *0 0p0x`CGCZ)IeI000ZIZIIIIII0I0PI000I000IE000]IE000PIE000 IE000@I I0 0 00@"00 0-/0 0 (0 0 @0 0 X0 0 p0 0 0 0 0 0  ")A0 0 u EE0 0 0 -X@&o@o @o @  @& 3BIE0@IE0HTIE000@IE000IE000 I@#(0wipwr: can't alloc i/o space port 0x%lx/%lu%s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMVw0 00 0000 00(0 080H0X0hPttt3V0 0x0hV00X0h8V000V00000hV00 0s080H0(0hoo PM0x0k&h= = s qPs&! qh00l C00 0 08apwr-on-auxio: can't map modem registers modem0}sun4c compatiblecr .( OpenBSD/sparc: this kernel does not support the sun4d) cr0}d'(^ <<d d@ +8*X0*X8*X@*XH*XP*XX*X`*Xh*Xp*Xx*X*X*X*X*X                          vTUVWa_Y\]^XgZ[`jicehSbfGHIJKFEDwxyzLMNO#$%:;<#$|} !:;=>?@A(2&=?0t0È000000^0000^1p1p00^1100110011001100110011001$18001$18001$180011001L1`001L1`001L1`00110011001100110011001 x1 001 x1 001 x1 001 1 001 1 001 1 001 1 001 1 001 1 001 1 0 01!1!001!1!001"1"001"1"001"1"001"1"00-_1#0 0v1#D1#X0 0v1#1#|0 0v1#1#0 01#1$0 01$1$00 01$D1$X0 01$l1$0 01$1$0 01$1$0 01$1$0 01% 1% 0 01%41%H00`1%`1%t001%1%001%1%001%1&001&1&,001&@1&T001&h1&|001&1&0(01&1&001&1&001&1&001&1&001&1&001&1&001'1'001'D1'000'1'l1'X00'1'0x001'0001'1'001'0P001'0P001'0P00'1'0P001'0P00'-1(H00-1(H00-1(H001)1)001)1)000(1*D1*000m1-1-000p1i(1i<001ix1i001ix1i001ix1i001ix1i001i1i001j1j,001jh1j|001jh1j|001j1j001j1j001j1j001k1k001k1k001k1k0t0r1l 1l4001lp1l001l1l001l1l001m1m00.+1m001n1n0001nl1n001n1n001n0(00 u1n0(00u1n0(001n0(001n0(00u1n0(00u1n0(001o 1o 001o 1o 0\0r1o 1o 0 0r1o 1o 00r1o 1o 0P0r1o81oL0D0v1o81oL080v1o81oL0,0v1o81oL00v1o`1ot0 0z1o1o00r1o1o00r1o1o0 01o1o0h0r1p1p001pP080011001100110011$00181L001`1t001100110011,001P1d0011001(10010001$0@00180001L000*X*X*X*X*X-*X*X*X*X*Y*Y*Y*Y(*Y0*Y8*Y@*YH*YP*YX*Y`*Yh*Yp*Yx*Y*Y*Y*Y*Y*Y*Y=PCD~HH Vp 9ZRPL`qD`,XD&l|HIG1vFED-|u @@5w@H0 **h********** *0*# *%* $,*@ <HCDG4,LFt-,THIS is A memory TEST pattern*X**%edq*8o$fHjeer@(8*$t,`54''5''5L5X5  @ @*00*Xh`/h ,  NlT+d .p-x   l   @Td+44  PT p Ah Ah*XACX*Xz|~*Y`5 +h T+p l+x s+ &t+ &+ %+al+a8/ 0+ $+ + &P+ %$+ ', '+ &+F &+ %X+ %4+ %+ %+ !+ % + $+ Z+ $+P %|+ oH+( "p+0 "\+8 "H+@ "4+H " +P " +`+h 5p+p :* :+x 3- m, q+z q+ ,, ,+ + o+ p+ \`+ \`+ ],* ],+ \+ \* \+ / ", T+p l+0+0`+ '+ A+ !D+ /$ . + .` , , -xx55P09 +0 l+0 l+0 l+0| l-=0 l+0L l086`2@ | \ p +  | $*`*X*`+*`++*X++*h+*h+*`+*h+*h*H*H*H*0++*8*@+-Pa :h # G G( # # F66 \ \ \ \ER CE ST |SL RR hCE ST |NM 8CL 0PL 0RE |@RR hCE ST |PX hTF PN RR hCE ST |  H  4 h 4 < vt \ j 4 H u 4 4 4 4 4 4   lp vt D u l  0 p0 < vtƜ00 00 u0000 008   8   <  p D ,0d4 0dnative(K0 (<  native(K0 x(< Z4+9+:+: m `  |   p  vt0 mh  ye  c\ P m (0 ! l  y$ }<x  o prfpe@ sD m 8 m i m   X W  N  ( 9 O m  4Uu o 0QiH m m m m m m m m m m@   m m  `  "@ T 8 H m m m m m j m b \ m]` / ~p @ m 1@ m m( 8s m m m m Q m m m m , )q m    _cH m  ]@ m m R x~t8Zsn< m  m m m m m m tV m m m m m m m m m m m m m m)J m m m m m m mTS( m m m m m m # " 4 m m m m m m mo [4 t + .X$ X mXg^, d ml  m P P P P P P P P P P m 28 m m mP! D E mK, m ռ  m m m m m x m m m m m m m m m L m   `l $  m m m m m m,{ m mTR\   m m m m m m m m T d   m  p VT E` 7qd \q z1 I %   x h  v< $ ynPmXlrdbq@v Z wylo] ut tmlx H   r r r z qp u y q q  r  qP | rt0ڠ0ڠ0ڠ0ڐ0<0ڰ 0+D+D+D+E+E+E+E +E(+E0+E8+EH+F+EP+EX++Eh+Ex+E+E+E+E+E+E+E,+E++E+E+E+F+F+F +F0+F@+FP+F`+Fh+Fx+F+F+F+F+F+F+F*m+F+F,p+G+G+G+G +G0+G@+GH+GX+G`+Gh+Gx+G+G+G+G+G+G+G+G+G+H+H+H(+H8+HH+HX+H`+Hp+Hx+H+H+H+H+H+H 0  O O P(0P0X0`d+T +T0B@+Vh/+[+[00 ] X0 n4 m  +u(-(*s/H+u0*+u80+u@,+uH+Zx+^0*װ+uP/+++uX,q-=,`+u`*װ+++uh*+ux+ip-`+// L  L l d 4  DhHxt4`tDttyclsttyopnttybgttyinttyoutvutt`Dd~yPeL`c    P  bDd~yPeL`c    P  b  ~D ~tbƄTP¸c    P  bŬ~yPL`cҐ$~yPL`cT~yPPL`c +z0x $0@+8000000#d!|!!p+0`00X, X, @Wd6lP0,wffs,mfs,ext2fs+0cd9660+msdos,hnfs+3\udf 2lockf@` ++++++++++++++++++++ +(+0+8+@  <LPN<L4 <xthlp D <$l44 < < <4 <$4,T44 <4$0p <0 <Ɯ00d00Ĕ0000008˜Lô. .. ---HF*+\/10@ Cd( . 0((<((*G<J(4L.H73.@`,-St)\)* )*@ n[p0h00^^3333+pLp#$%&'()*+;,-.;/;0;1B@2T 3T 4T 56T 7T cdeB@B@LK@O[T@n6%Ql7Jpp@@@@ j j j@*Yp0x00*YXH,$D$<D0X`00X`0<\*YH*Y(Rlb*Y(+( 00| ]c!|Yph!pZ+h20H0|*X$*Y@|$*Y|*YP|*Y+(+888, 0D`80T|hX0ln<,01-+.0-+.(0 $-+.J0ab-+.W0) $-.0b-.01-+..9t;.03-g+.l@02-gl+.l0l`-+.k0/-+  X07-+. 0p(-+.ـ00-+. 0|,+p~0{01-+.4+x00 dd00dX00000<8Q @X,0000000000p00t0x0|0000000006|(@AAA==(A*E@ dd%(i @@@@@@@@@@00T8T8D0x0X0000$0P0X0T00+JJJKKD+p,+4+|+DhLT0$0X000\0`*Y0X,EX p,Yt,ZT0dt,Z8TD H,Z ,Z( x0,Z@$l,ZH$D,ZP$,Z` @ ,Zh +|,Zp X@0`>,Z `@c<,Z `@?<bl,Z @x|,Z00,Z@@ 4,Z4%%\$$#h,Z4%%\$$#h,Z$4%%\$$#h ,[X0`> ,[`c< ,[ X0`>,[(`c<,[0Z,[8Z0(49X099X099X!,\(400  0000,b@,b @@     F'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''x( p 0l´Ԝ0`~PyPxHp0$k| $\ 8xDj|$4SHqHlp$k|jlp0p@0$k|Ɯ0000(000000\,u,u,u,vaHl̨2t2P28H\@%$D+ 6%B$5`03\2z48XDh##->p##l#p#$(D((((<(###$(D((((<(# ##|(@0((## #(X((D((X((## ##(0((D((X((`(##(###((40( ####(x((D((X((`(p##(0x((D((X((`(##d##(0((D((X((`(#->x1`->1`->1`->x1->1->1 ->1->x1->1->1->1t ->1t ->1t-?1t-? 1t-?(1(-?(1(-?81-?X1-?h1-?x1D-?1-?1+1((D*MD\*P\*U*S -?-?-?-?-?-?-?-?-?-?-@-@-@(-@@-?-?-? -?0##-BޭޭK %%%%Fh P##-6#p##@##@#H#t### װ1!`-D-E-E-E-E#<#H#T#`#x#P-E0$TP @-H *PP-H *P(-I5tM-I##T+7@##(-I#T#ܨ#-\-]-_#####\#-`#8#$#h#l-a@$$d$$ $$$ t$$7x$7$&p$$@-b$;$;,$&p$$@-b$;$>$&p$$@-c$Cl$C$&p$$@-c$G@$Gh$&p$$@-c$Il$I$&p$$@-dh$L$M$&p$$@-d$M$O$&p$$@-eP$S$T$&p$$@-eh<$l$d$,$L-8$$$T$$+h$($ +---KP%%%$$*P% %"%!% p+4%(%*%* -p%64%4%4-(%7%C%B-x%Vx%R<- x%Q%R<-H%X%W`-8\%`%]--%w|%s-%%((P%h%S%% %% -%%P$%H%\%%%%% %(%D%p%%%%%% %(%D-x%0%%%\%%t[[dP[]8]@%%__(%P_X`Da_Pam7930xaudioamd%%% %$%L% %X%%%$%%%X%%%|%%8%(-0SUNW,CS4231aonboard1.%x&'&%%t%. &0&NX&Q|&1d2d&3&3p&H&A&@++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy. x&^&b&j&^&_&`&`&r&qT&u&m&mt. @Boldface.iso1 1.Gallant 1<1cp&1d!1.1.Dwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp1d1d1d1d1d1d1d1d1e 1e1e01f021f8)1fpa1f1g1g 1go1h1h  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&&ɀ&&.&&$&&Ќ|&4&ќ.&8&x&%٤x&&,.&P&&8%٤t&܌&(.&`&<&&&&,.&&&&\&&.'(&`&&4&t&.'81+$A'* + + &$&''T.''''|' '.''' ' H|''.(x' '$' '% '".(4'%'%`.) '70'%'5'<':,.)p9100_romfontE!c'AL'='='D'B\.+x'R'F'E.+'X'W0'W|'\T'Y.,X'a0'\']'d 'b@.,'n'dl'e('rp'o.-'sD'tP.0.0.0+*p'~'./'Μ'<.*=.symtab.strtab.shstrtab.text.rodata.data.bss@*,!*X0*Hž)0//11sZx1s41u4L` 3@*X001 HXH-<H>pI E8TDj g4u 'D10\HP,'."8 XH '(\!82)f;L R)L_&j 0lv&3#1<dp$Lp {, 6#ip1&NL:)J(G%8S(a$rp(^4#h1$00 T (d(F %1-aX6s(E|R0a#ܨ`p Լ~Y!d00ި&41&|1h)l, 4] %6 @F0LM]@d)|z(p041\8΀d1##<%(0 pTX{T8.PTB#OCD] /(na~;PD tT(T01@ L'Q0*>THtP'%$&1!>0UP`7k1Ht zH<"g(0< JdT8 $d0$( x:CJ:\e|y6xH6Ȑ. $880< Ȭ ((Č $X&Mx\ n4#88 (h:$;pFؘVtm#dD} HH <)Dq@$4&  H  pD8 80 %u` 8 I%ؐ Y0 j|@ s$,d 8( 0 dh4 5  6 $` P 60  6ǘ 0  H|  &l| *!d 7 Q r  ^$Y<@ l& z&4 9D  | | (( - C )L $l h `  H ,0 ;'H4 H, ` !4d y${ 0$ Pl $֨  \ x T  0   1*0 &(4 &p, :pH UXlH g"L l( p !ՠh 6? wt  H, X 4H <\ $ (P &| ' 08 ?t F$0 Ul  dl8 m( z'h| &  ~4 Ŭl ( 1 $ t    0  &$8ô|!78B(`$P#D[*U`1(Lr"l8|$$ED6p<\%`|6|&>pH <")&7!HTT6x^ .<dkDwL1qT6@ p6 t b,<M<*Jpd 6g m+ 44&jC8T0`0q!τo`(H d81 "|,4DDX' $)p-pH65>((`K([((V6nX} ,$ rX h*?$x&{40ވ `g*04|B0@KJ|Y tDc <`wD BDpL%TL%@ %ed $# N0`+[:DKxT0Xb j8w'\~l0 T8`p5ڬ'%8$$nAh#. %|$A4Q0 Z1k(j +wYhx`564#  tLp86t\1) LX20|4> ,J"lZ (h4r d 470< *!% , *(P!?d4y D0JpUc&t| $ 8 $oh<)lH0|o@<(#40|A Tt<g$r 8} D L\ '$Y*>(|P@D  )# 80 <Td J'(Y (@8jX{6  t1!$860tD'|L40l`l<.H () V0,7 |4HR%+b7n1% xg\&thH |'H e" "|,X)0< ,KX8 cK,mxz%#$Hst(  &38"&#d#H  T \ &0h*#6 R| J/Q1i<Z%٤8j'DspL \( x)&%*(6h  {00 &"828АHZHk0ݨDx8 !| <( XH!$( <\$h(h!` 050xBlKw` pk /{l8@ t(0$d4 !@ 6? =4"|06(>$$HmDLQ Xh] f8pq!pI ]8&l,0o-V  `_X0# pl1Ɯ<P@TM8Y0he ^\m$`\H|61&,(Wl,|\D$(`$=$8" td Ќ (4 3D @ ?D N` a' i#w t |6_ _p 7D  0dP <$ t(  ; 8`!&!#!&ˬ!5T !B)|!Z%xX!h@l!y0ݠ! \!\!&ohx!&~!&T4!8'$!t " c" Et\")|"81l"A#tH"M8"["k6"w%H"1"6`|" 8<"84"#8""6D"$"tx#ِ\## 6`#/ #< 4#PD#_#o (X#|8## j##O8#1# L#z#0# d8# #h|#Q$ ̘x$0$, $;)H $O HP$Y%k`$`$$m(X$w0$8$ϔ4$1 $#L$ $P$8$7%64P%#(%1)l%*6X%3 dp%D0%N$a%_1%o0% #08%'T%0%0`% #hP%08%%c%1 p%g&6`&kD&$#p&6&L &V &b1&&i%a$D&v$&I&#x&&H&&0T&( &X0& ,H&f&l' ( ' '&1'00$'=6π'H(( 'U(P'a8'n8'zF' \'$'-S'#ft'w,'('' \( &,4(6D ("8à x(*C(3(B0(V#(d#Vl(u/(6X( (($*<( x(M (() )4d)Ԍ),1t)9T)C#JT)W8P0)`6h$)l0L)w&8,)0p) c,X))(tH) 4)#T$)1l)&AdH)6D)* l*H*(0<*51#l*?ʈ*Gl*Rh`4*f@p*1* \|H*0* ¼*ؤ0*.* `* x* x* ]X4*sX+ + +% x+4 Ɛ+; @ +G'+S1+]8 l+o)6+zw(t+d$++-x+)++`+1n+%5> 0x>#B>.'\>9\X>Ll>]>p F8>y>0 >1$l>%>$<> 8>1(> T4\>0>@H>?T? &<??.?@?R6?\'Dh?h%R<<?r(`(\?{8P?p? ,?0xL?0? F4X?1?6@5̀@"d<@-L@C,<@[#@b G@@pπ@yPT@4@#@P@CH@Wt @'_\@0`@L@ !@HALPA#gA! A10ACk@AN D`A]!?8dAl1Az DA%[AeA?lA0A&KhA1tA>0PA`A1$0A% BB V<B#$B2 B:"8BD#hBS 5<Be By%xBdBDBHDhB0HB#bdB(LB1otB0TB'P@ BTBC 0hCHlC'C2tC: CF tCN#C]lCz)|@C!8(C$ CC PC8C%ltC$CHD 0XD^D" % D4D@H8DSiDh0DswXTD} H LD1!D$tD8 D,D6 D D%PD8D60D#|DE 'dE$0E! E/#}pE9 3DTECEV0EcEl!Ew $EoDE,hE#k|\EE1tHE E"E"XEe PE FF#%F2,F:FK$FT lFf0@Fq#gXF}*lF F p`F%)lF1 FF u4F%LF#(XG1 \G!6\G-xGAGN|GV,dGi@H!%\H5xH@ `HWX0HncDHyDH8,H0HHlH5H H`|H"%0H |I 1o`I)DI&$i4I9(xIJHIUIZ8If)Iw6(IhI%|I\pIl,ITIdILI1n(J8TJ 'HJ7!̰J!'J0)JA%]JKOJ]iJg7Jr(XJ0J{XJ0J#hJ"`TJJ tJ "J J xDKZXK PK'rp$K(0K7KAtKJx0KZ Kg 4(Kv8 KhdK0K KK KUK۠KK \ L'@L0L6xL2TL;= tLE /DLX),LcLm <Lv0L$ LL5LL]xL#@L:Ll|L"|dLcP8M7HM"M1%HM$ o,M6 M>ؼME0MV@Me)F0Mx&S0M|M`Me`M qLM8M)(M QlMHlM<M&sN 0NkN'6N1 0N>r$NLJ4NS(NedNpm$@NzlN6pN`lN(TNtN N&\N)DN\NpNnP|O O0O!xO>hODx`OWȨOm\OL`O!g DO,O((O1 OaOPO-d O$Pa|P*Z P#XP!)l\P38P9#`PE(|PV<|Pj Pt60P dP(P2XPpP P0|tPNTPxP5P6$PpQ6x(Q"',xQ0@Q=OQEqX0QV4lQ^ dQp,Q{(Q|QQ0QQ1#DQQ'(Q0`QdR ppR)R. ^(@R<tTRM*YARRR`1$Ri1p0RwـR%|R0R5̈́R9R1R|R1)RR@DR1`\S US6?4S ]PS-b S(8@S90S@!ESRSa0Sw lS1S:8S`SC8S S4SS0SilLST0İT%PT01 T;(TB0TX%Tp?"T TcHT1o TPT 8XT&-,HTT5TT0U l0UU"0U2$d<U9#L`UDR\UP%U] { Ui28UtTUU`LUUҤU08UHUdPU-8xV _8V$tV!*DV1$VEhVO) VY0Va dVo0tV{0HV5 LV9PVmdV l(VPV1# V(͌VV1$V*PV8W M W84W!'+<W40 WC tWV0xWa6Wk+W0xW#\W2t W8pWBdWr W$38TWlWD W $W=``X p|XhX X4XC'  XO&_(X`Xs00X4DHX'$ X%(X1# X#xX)(xXѐX)x$X+X HY'Y p8Y! xY-18Y6Y@(d8YLY]4Yi!HY{DYTY1PY phY |Y*Y YdYY!<lZ!UZ8Z! BpZ(1Z460Z? gZOZ[ Zed(Zq*0tZ~e Z IZ08ZZ@ZڐZDZ6Z&[1\[H [1-[("[-\[: h@[I![a8[p [| |[ &@[ K[5[ %4$[%8[0 [ ,[[6H\St\ Q$\'%`\"#x\*0\0"(\@ \M1'l\Sd\a(\lҸ$\ !D\8\D|\ad\ Mh\6@\%h\h]0$]]2T]>0]JL]U]Z x]c6d]qPP])H]$]5l]%]8@ ]]w]*>$]&܌x^6`^^%0^58^Gd^d^s$p^z. ^`^(^&^0^ o`^^h^p^I^ w0_)e,_ H_,_< @T_G&t`_T H_j$_ypd_%yP_h_ӈ__T0d_P_&rh_l` `Nl`&H`*&`<1* `K04`V&`b`o`v(40` xP`$tX`1m<`#}88`D` 8`%,``0|a.a\a(0a:"=`aJ aSa^ x|aj8haqda0a0a0aAa PDau0aB\a`(a$|b8 b5b#| Tb#!X`b3 Tb9#bD!FPbRbbRlbv0bPbbhdb#P b`b6h,b8c \c'X0cDdc(1xc4!"THcG $ c[x0Pcbcqcw Ztc c dc',(cptc /$tcw(c Xhc$8d Pd$)Pd4ZT0dC!ưDdP <d\]Hdi8d-Pd d`d Tdd,d6e<e$e%e65heG'f0eSs0Tebhepe}6`e!KTLe0ڠeWe1&e1%e<el8e&Րe7(e f%~f $dfxf+(f80fF*?HfP!f_8fh(@f"Xfh\f$\f7f0f'sDlf@f1#Xf)`g,g$P g! g3PLgJagZ,8gtgHghg%FXg!t`g <$g1"g)|g&g!7Lh1&@h 1 h xh+8h;1%\hIH4hS0ɬThZ`Dhjhy&8h \h$h%(h1$h%P$h)dP,h%Bh &h F \i8i+i# ü|i8 QiG iV%Ǥ4ib68is$ili ndi$ pii0i,i \`Li8iLHj ptxj% jtj1 C`j@ )X|jH-Q~j[jfjxjjxj$t`Tj)@Hj8jDj0j1 kDk1ok$<k& , k+8P8k480k?kJ `kdT,k|k7k Dk1k1%`kgkk8 k kX@k)s `k&l 8ll21olC6όlJxl[8hll!lzTl zl$l6DlDlDll LPl(sdl :lhm<m#6`m.'@m:!8mC!mO m[(<pme!my4m&mm ,xm %4mm mxlm\mTn1n"#dn6 h0lnJtnU<ni$,nz8nStdnۤn ,Dn1n Ln 8n6n <\n*, o $o( <ho2άo?_PoPRldoXЄoi-ot)0o)|$oto%o!8oo6<oΰHo0p'lp"p,p.1k0'p<&^pJ%<pR$tpZ6pf lpt p8|p"ϜpOpp#p6dp LpSp'ȘTp% qlq ̰8q1`qA$L(qL0LqZ2qe8qs6\hqqpL Lqqq8q pq" q0Hq8 rFr !r(r!vr4JtrBXrKdr^rftrr80rrִ rW0r|r ;(rXs `s*Ps8s(ns6@sA#|<sM sT'sc1sl0H(s*& 0s8 s`seds Ts#(,s s spTs0h t ut#Ht!\(t/ht: 0tN1tX,h4tcŸ,tst,tTt#|t =pt6Hxt}Tt1p$t f$ty$0t%@Pu u du$u-puC<4uL1duluw;u~(u1 u8 uumu -`uܼu6Du.(v0$vYtv 0ޠv, v; @0vFjtDvS48v\Yvu)Yv&Mv v8v%Q@v 4vv0,v,v1w(ww" .`Lw7DwE1kwPtwXwf =4wp  lwv1'w}|w'<$w&-tw0`$w6Xww8w(8w k<wLw Hx xE\x+P(x9&DdxG]$xT&xxf+:(xp'\x{%x @ xΌxLxZh xTx!$xxTxyy $,y T y$ 8y21y;)_yE8yO<yec yr0Xy} y vPy0py0y0DyVy'?y#KLz0z#8lz1z+@z6)0z@,LzH zV hXz`'zl& z(z`z<z Mlz1n0z@zlz0z( {p,{{%yph{61{<'t{F{Z${i6={x${2p{ <{{ @t{ L{ L{0{%| `T|6ǐ|# q@|)8P|2#H|D"|Q\|b$P|t8|P|!(X| v,|#L|4t|#|'kx|}6|} 1o} Y|}1p}!gT}0'F}9 }F %$}Z!H}d t}l F}~ T}|,}L}d}5H}1p} } l}k~+~1 0~? M~J ~V ~b~p$ $~{L~~"~&z~d~~!,p~ ~6aH~0`04D|6BKHdQ$gy6(\$d$\ 0 @H& 8\P5h!d\H- x@H\\L[<`j1ks H{d1!` 1L@45Xj#Ic,hh)"lVd hp2&0>8K'LWTtb5m5t1tLs 9XM`'yd~ P$(01  EDT:,)0:8C6h0MY!(Dfh@r& Lx0(6\.+U4Ldl8(1 'e $T  #1\1PJcAtpt` VT~P1 ´ |0Xxi0 $08(1 :@0B \R)<\er7|6t|,1&h$ `KP k<alx1! Vl/(;)dTMh\c e60q1*(#8(6FIT@ 5dX)6` *M1j&%\T6 T,G|VwrH*<(ѠT1,\ jH,8w0 9d*01|,C(V `leMDn8 0 hv( sD'*dH#HP  0hUp'&X|5lKOP,Ym y% TxH Xxy@0 N(8} `-@  6\" 61 T=HRKD^ h d45lP`(#XP-_T ((d#Y$(38D0B P`a#ixo80|0ݰ|4A0d1&~0߀8,Gx4p0 1%Id0(24(A \K0^% f8s{&<0@$1' ,5\%64\(](h8s8d6YX64!04,< 1@L%`b1mi%<q1| L LfX8 6x3($` GT)X0$sx@0L,4a8j)`tv(i(0T +xh8\T|&43d!4 #& .76 5 XC glW >lc) o({iL |(t( 6ϐa|h6',4(`l:K-4b6j5`z&߸8@h1j(0 (t xD #&,- T8DԜS$]@d~)q (0L$O0<$ 3d)@| %5DRːbtq&rxh~X vT(!ph66h80È0 .&XDA1(Va)j#Lrt~$x'D8%T0d$ =$d'%`L%` D t8 p (01 ]`;%XCS 8,g%<|$MD$A0# Xx0X ~4*%d 00t-6T 66|B D$P]1|k~1ش('r00P`4,4#l #$@3p4=8'PlA!N8hY0De0o6i8w4\p$$x| Mh<1 $pH 1#/{h=' K$lW$kyPv<$@"1H` [45$&rX)al0l,SHt 6G ٨),$r TA#TJW#$b0k1p |05T xh*&PpP):`8%GT`0)$.|;6 S1i^&lpf HT8$0tm<P'O%@( m`1x,'(<p?@XTjH\0e dXoo06 {8&$+\4H(@h6(8x$<%80P?L)]DPjx}W X$Ӱ880' p|l1T 1 6e'z`'%d01 FS%lD[dv^,'JbL]`t$ (000Ĥ `1$$0.=0|O G,,\xn %\8} $#gt DD$d@#\1t 0,,Q%(X"%r<)%+ 7H`tR5D \p1<d'0()   0 Dp1x T)P(#-L<51%;1%A8@hJ$0U1^m}t~6)gXtblH06| Oh5(e  \)L(!Xh7 lLxXU6?8^1Pe!V q06x*I@("5`4(1'T16e"\ \1$C*Ul_0o _h8}0j10d < '{88\   D-1iP(=PhE Q(Pc%\x<lTE0 !@$X1l0  66 .x&tL6)fB%|(Xb@i*'xXz%0("=";,$X0(1 G4  1#1&2&ќ>&aP0KRW  c'Hj5q zPx qp@ D1x8 Xl"ll'!4D88 <8J$W $b&$0q8`~1 x"|0ڰ6?< ;$7`1#!%4(7ՀB6,J%(X8en|y g(T1d1 @*+0`P4$6E<8|+ n4D;00EaPR|@e llt J *I|# 6Dx d+ 7L4"  Hv1~=0N$Y6Hoz /8l4H6h,P0&D-Uv\H*I0 8'dx#150A)J X|$X 6 0j#lv1'AL64(b#$P$dTxH4 'rhl4ŬHO,`^,<gt8xD+' 90P v< P( u$,HD7X# (|1*X4-`F1`N',^-Ydq!`d|<4 @d>418)&<x&0@6`6D h&p#(P ," :h<1 v,H %$Zlmu(<8u L( t=,x$8L&ch8% =42lC!XM#XtZ8b$Hp-Z $5$%s iLl%\8"tk\\#Id 0)!7 (M[lptH8&%|0"|D$L.`P  ,h1#"0 $*$T7 nE,TO1[͘Hlp x p5h  x0  88 bx( ~H4 x(x04FDM!`X)\hi)r$D:N@%qp |1|6H\T[, H$tdC!P h|]%Hitv0|"ڔDVx5(@)<$0%%d60\ec%s ( E`.87xK#yHWiu\q D%G8(^tHÔ(<|( \0q@H40"1T/0ސ6 J „V8cn8 *8P#$ r6$6$g $r4 @"P5FERt Y-f8 fe|#6lq4t 0v, 6d t8 ''l4 \FP@W(Ts,u~0`6xb0ĸ%[TP `p ,{Lˈ7hM@*r5yL>1%4I8Z d4a Xh <v',X;@P p* (4+0ll P i@$ >#|I#{S$d08v 4&0t) '=8T \ x Xtd,'%7#GPO D^ xf5s% $  41'1##Hd L8T-PH) (0'M|7 D@@d_1oe6LXP'>|0HC@D&NXPm1pP  '8 5D$@ 4Jp|Y"Pa Jn18\ p8%`D0`l(4\ < KpL*Jt2);"XGlV0`(dp(q"H@p[,D0$8@ 0L6\  p&3X#1 t3 T8D^lR%P^6hk)4|d$  `p<08%h&`$, $t D8"~L$0@1i(RDc1l'\TDw0P0<  x0850d~t ' , *hDtX(eH)1 ,$6 $K0S$g%it(P4=h8h1lp'a0#L1!@ 16HX %h$.$\C"7(0T-^ctu(`HǨ15$Gh2!L|L  #?, !H ?) x3B)H|0QXh]!t1\6 ` x`6l< # #(T0 !$:l#7A)K)"0Y(`^w<k`P'B\̨X X|), #P(#( y,+   J(#pK0V(HXfx0 8| 8L'8<Ǭ ( x 0!<,H4DSQ`\Hj~ tŒ6I•",Ÿ8¯ (¸)0 +=)p8 N ')Hx7I,B}P %h|Z dh%w0Ì0$ßbé ò Wü5X'J1#^t`8 <4${ P-;xHްZ1j,d0wP\ătP$ďĢ%GĭX@Ļ,uX$  "@h%  DD1'%n,3" 4TD)O ]j@j 0p(88 ō6mPŗ xh@š 2|Ŭ0|Ŵ&`H Ռ$  $ 0Pb,))541p,B&O@^0ޔ lNP|ƈz|Hƛ#0Ƥ DƱ(,ƺјHL)q8$d0s,0"&Q|d/lx9 jPM%`^Ljk(|($njǘ_Xǣ$Ǵ" ('|Hd$$t8<%g $.L%0#$6P<AoM& T^ ( j(w6DȂ lȏȘ00ȣj8TȺ  \5(%a0X T ~|'-8hD6P_ XtɁZɏLɟ(0ɶ1  @@o$)ـ$DX@%&X\5[B,0O6Ȁ]6>XiPʆ |4ʑ6Dʚ=T@ʫ h<ʱ0\(rdK@1(0x'd0$%6,088@ GS \dDl1t <<ˇl˓,t˩˸[Tl ,$$,!<(s 1('#N|>0Mbr"\~ԐD̋8 ̕0T̝]`̧^x̶zx td%l|@#d< Ԥp |`878C%(Sp^(o$7{xX͇&'͝"O4ͬ&24|͸X(J11k(Lp|t 5X1ARLZ( h@`x4΂ \Ύ `Σθ4  m  4 4'ڜd zT4' ^ld> \tJ6?\Q(l1tw,Ϗ)Pϥ ϳ0d }Tx ,(^1oL@p@<#d$6$<?0\K-T =4a/m0}6LPЇ (PЍ Л У8 дX%!R(0p1(l<l$ `9(GP'xdY\f 4w0~8lяN@џlѩDѰ(&P#!xh0 < 1($Ll0( >1 L0] f9$8҈.Xҕ$dx0Ҥҿ1h4dx@ $8 $5(4?&Gh,Q0[0PfttuDӅ<ӗ<dө |ӴӺ$D "ph-`p0-67((>%LN6|W&ɀblTq|(8Ԉ  ԓ3@ԣ `ԯ(׌XP)d8$| sd1'&8`7@J%YX%8p(g V y 8Մ.`Ց0՚0|մhջtHx&xpx4 ) %L%0ݘ-0<81Ghe,4pSz&PևSH֑0d$֘1 (ֱØH*?H([8#@l6,  ($, 4<xH0<WtTe'q1\~T׈0XחxTמ$Lת$Tp׶0D0  h @d8 $l xD%*06%X@ALj S>T@a#dk uz1m(؈ ]ؘ ا=ذ! ؽ0 lPq  D  `al4)P)x ; vtxK1 XXf.t6Hف@ @ُ+40ٝ0`٤#%0ٱ%wX0X)!  X) .x7#hh?#n H]ph"@TpHx6}4Lڍ0ڙ0ް$ڥ ڴ#T8 @0ڀ Y XӘ4*"LX` lu u6 |~D0ۅcې5۞5۪e8xۺ0 #1#6P < x$׼l'$5D(D6O)`c p6x#T܅ܒ#&Pܙidܨܱ0 Op&|6)'k`0C(,<Լ`K Z@X'Rx4a0tr6{CXPݐ3ݠ'(Hݯ%ݽ  4l% 6L%( 3$\ >lP dX0h6?`0qLHz$dށދ %ޛ<ޱ8޺&^X1o1 l8`1p4! < #(/6i<6\=G4F1TU0`&n y}4߆#ݤXߒCߛ߬%z|x߳8$t00(, 4lT!46?(=@X|Nxp P}08*Jh& 81lt'],6ϔP6iPa 0d( 'L850?nQ}Xe1u?PX&qT1 0#bD v8 ,H  9%@H)dU$Il(` #@n0~8D8%\$M[)װ@D<4D0=hpEv T `8u0,L~4d 0\0Ly0  uP,l-6496@D DXQ b&s&\([ p  TD06F " l9 #x`|1$I<4 6)6$4D((L%blt88}0H'd `1`8(E,*7,$yl$]\p1@%(=,D`DR1&T[&k(L z)hL&$,11p Z48 v@,TaH&x,&?%G0R$8Xhb8lz68>DXFt8 0\)Tl~$$3 pCU&4xf-Ry'' 0!ld0݄-Mh#0M@0%I-[|<&T,.)9&\`IP(RфXg$lt"Lx0  l`0 X)H dl 1>L'&458>K rdV c1$l ːtv0tb|\)l708*+GD/':,;(0E8,L<DYi (wH@`0 X&`8tX0D' 88 D |%6/$@1PI88R o`fdr y`~8 bD&$VD0(t w %p6b   # \ ,5$E$btR8D`Hp'5$(1 l0 |d D\<%81"  h#ۄ)(=Q0L<f7u%}`8(h`5p%a*Jh06e41L4 @s(%w<6 *PD @L wH\0dHp'Et{%H($Ψ<8c,3Dȴ8 2ld0D$"3 tJ|h+ p<5kxF7P D]l!6|`| %r8nd8H $@t%"t#(`)yD)H|2q <xR[bƄj XuK,_L"tHx)@t1HtP T0ހ6f1a#P)X 8'`Q8\V,m|" װ'=`'% @' \Ԩ X$ xX1(ڄ$?, I GY1p, y'0p 0 Lh0$1&8 1i(;T %X$1 Z\@(DJ&]0j z6@% ,$(,$VlڬQ0(&a \0,*X,'),8 #DT!"8($@ 5 HdL0Z Hli:t}$U, H\dh(Y4\#\6b "P< Zp4٬0 4d3 @0G$0$W"ll\z%!c  D@8` jI\6L V\<4 & `-o :DF*>HP$bT}#&4&p"d\1"R01$4d/H@0 tX00H& d? JPY(bxlp?x&$hTl zhH \"H'Tx$( ;p,%DX; I Ulp&u~\)h00 s'h4X 0 %W$<#Hl6E$&87DGrxR `axlzl6h P | # ){ f*0ݴ)`,@ W 46((0@2)z<'Q`PE$XTDXi b8z)#`18^48L7!Dlul " T0 /ǘ=HOLd1-k#hx~%0|)1DL L$  \0! P2%4<@qHNY$H<b6mTl5,~` b41L$gl,$`] 70t4 T08t4#@"E $ 6 P,$8\C&LR$P @Zt4hTlt >$ 1|@} X86D-d, r@)$= X@(`$H'¨p7lh|LQxZ'0k|~$$0:X)$58X*Ih h$ \x$;2<hF Z!T`8i``v ,p j t"Th6`0@,8< RP1 *43 ,:'y\CNt4Z)t`g t8s04xP 8`hpR(}0lf,(*#|2v @h P1m(`0hj<|*H@U 0d(t-40!8l_((6b. @(((4|JhS d n8, 8&$0xh ׸@8\@1<$ 8V($&87'l@B(ÈtL1S P(D_ t\8k)ޤlyP0 0&`#pX-P(Xxݤ 5t H(6f5(p=-OOahZ0]d%4vDd l%HX AlX8H<'4 5,@&[ #@0QZ` |o+\|50+P1|)@ *X0$0 H 0 r# -1<0O(YX,hAX| np8 @"d('p`h 0(!01DA&M\#<f5Xt41% 8l% X#| XH$(4 x p  !z@ 21i ;t K  U T p$RD p <T 'PX yLD &1L h E %ר % "l #1  55߈ E, M @ Y14 d v8 7 P ((  Vl X4 0 *? %Vx )Ә< $;( 0 30T A d O X| [ $ d&d   1j( +d, 6fD uX 0D # "G,D =\4 tH H,    " 4X 7B D T  p  y,( 4 p )> %L4 $P y,T l *% :  F<T NH@ e"@ r. ,  XT q 1 D4 + 0( 5 $Cl( !ɬ( #,"4|  6 `8I8THc uDq)$~0T\<05 o054"d*<|4tFD nP%L8;.px=',E1 <PZ4_ grnx#00040l#jt0HP'h($d480 &4 ?|d!%$/7h9"t?e<<P%X6Xg)u0D(^,H0d 0H ؤPtx6|0< x()L&l$d5%-L9G PT)/<a6l it 400$ dXZ )"8h6ged|6h 64)r&t'# 3PD Q( (h| h-  8~ 8Ő8$hP1p$X -  T -"8 <1  E  Ni Yx gtP p t z l ( d$t 0  #@ t h 6! !0!(!# >4$!4) <!B6p!X  $!gT!}x@! x(!0! $!&nt!) !8!e!:!"0"(DX"A"1!Q|"<נ`"Gt"S|"_8"tt"6f"")L"'|"d"ۤ" _"o`"4#;p#% CTP#2>\#>&L#N" #RRH#b8<#i_8#u1##$Hh#)&(L#Ȑ4##G<# %$#w($1,$$$$Sx$,#l$:-R$L0p($h~$sD$y&b8$0ެ$0|$D$ wPh$ $$f4$$%?d%0%8%&<$%5tD%@ ɜ%J" %[ y\%j%t%'"$%!ȔX%T%(P`%%I% 8<%,%%0&&H& &/&@"&M<|&c"H&j&W&|`H&Ѱ&  &8&''\&*S &10X& &0t' |'E\''1'1%h'Al'P 7'[ `'m0'z W8'0' `'!E'`D'8'5'ʌd'(70(Yd( "T<(5d(E;,(N){([8(t0( D(0t((h(d( H(6\(U()(8) l,) 40)H)21 L)BDP)Q|)d6@)l )#|d) )-)))^h) )`) @)|)Dp*h*6 *Ul*/ *Ent@*PN*f0*s0$*#!p*$*z,0*X*'X$8*1L*"*)0* up+5+1*D+"$DDl+01$+91+Fl +Sm+_+`d+m'X\8+|H+ <+*'+*<+)x8+%l<+#x+#z+ 6+6d,,t,# Mx(,+4,4(,<,FF,S ,j6,t0,0P,,h, |, !,,8,( ,l, ) -1jh--(zT-/4P-A-XT-c,p<-o-| <0-@--0Ĵ-q-'0|-&-(. ..d.+(L.494|.C.O%L.d%\.n x..8X.8.'P.$6x.([P$.)=<.p$.1`.$/H/ 8|/'0/,0\/< ;\/D/Q)VDL/d(H/l$pt/y 4/t/)sl4/%e<//;P/64/)-/#< / 5X/*P0 0X0v0,0$ h0/ Q05)H 0> (@0IIx|0Ql0c0x0s +0 0Z0 (0\0%D0 34000x 00Ġ00<1 41 /<1%l4101CT\1X1e81yg4l1 d1Z1ބ1( d1m1ix1$10`2 $DD2#T,2*!t24#OH2Fl(2S02b02l2y402l2|2 D2 ],P22Ȭ2԰2 p3)p303(\ 3<03D)I4`3W 3cL$3m 3z3,43Kp3'e(033#31!3083A360X@>>1p>& $>:)L>I6Ȉ>V `>b$>rgD>&L>6 >6p>&^<>#xl>>܈T>d>`l? T?8P?'?2(?@8?Iͼ?U ?c?om0?x6DŽ? |,(?Y H??X(@?1n?'I ?8?8H?|(@>@1nl@)$@&$U\@3q@<1n@Ep@V  @`d@v@@-WV@@ h@5x@ `@)@n@1)@#Gt@ DA%pA <A xA;AFA]Aot`A} i$A1(HAft<AhA j@A)A(H,A-NjA#p4B BpB+<B7jBB6DBL*YBS8B_6HXBg+By 8BBXpB!dHB %XB7PB8lBB$B8C`CC!1x8C1$ ,C?CK(d(C_(Cp8CCpC CBC1C6̀CC) DC%sC(PC8DpD$lD"6(D,8 D9xDM|,DZ5XDl`D-eX DDDD&~,D&I DfD ATD1%D)(EDE"PE7e|8EE/E\ Y$Eg&bEvh4E"\EEXExE XEEE9 DE E1\F1F% wDF4 &4FG a8F^1)Fi'pFs$<F$&\F 4hFdPF4F\F1jF%F\G`G ,G$ "@G2 +G7#$0GF9 HGQ-d8 GayHGn!Gy XG)HhG)GӼXG|GTG @|G HHG&G|H%H$4H90HL XHUu4Hh[,H{%`HH!(HlH0HdH $H&HH6XTI IL\I%1I/#HI61!I? ADIJ@PIU1-I_,IpX@I|0dI (ILI($I$I ;4I%I&I 'IlI)0I&|J$$J$UTJ"J+ /4J;LJKXJQ `4JbJn!@xJ J J (J!J6[HJjJ\,JPJ6hK h$K.|K" @H|K-)b@K>\xKI6f KW0|Kg KzӤKpXK L8K%$KtKDK(K*@HK5PLL, L b(L(1L0(XL9LF(LO#TL]E8LgLu1#(L~L8LL#u4L mDL LVLhM %dM t0 M0M' '<DM3IM>(,MGLMM xMV0MftMxM8 M٠0MRxMd,M (M+M-M yM&)dMl$Nx4NyN,"tN40xN@ XNO N[ 0NmTN @NN<N(NNP|N#mPN(NxtO$O%,O9 LO. pO<6BpOBŸOWD Ob`HOp)$O|8|OԤOXOdO`(xOh,O%POz\O`|PPPstP$58P/TP?TdPP|PV0]P]$PdFDPk0d(P$JHdP$ @PP\PP,PP0PQ0Q \DQ, t Q9QHHQTdQ[ ռQmXQu1Q XQ 9hQQ# Q QQ)QlQdRR |R,6lR7*HR@`pRO)0pR_&dXRoR*JpR(ʼLR WR(0<R <R+R " R&S$lS $TSS"S2ut S@$LSMS`"7X`So HSw%S, S ^LS'PS u|,S8 S~<S6bS!S~S5(S1'0TPT4,T1lT%0pT.\XT>1@TO'gT\%X<To 0T Q TlT'$TZ T*T6ET8TT&KD$U 1<Up4U )<U&%ahU8UG$~UX X0Uf) pUw0xU&UU pU 4U&0UXtU'oU#tU0hUj`U+4V DV&RXV3VF(XVY $Vy m4V*.V(V6VhV%tV z HVTWPTWmW. _lW;1!WB `WS<`Wc ,Wn0@ W~'lpW NDTWW'<WtWrTW\W <W v 4X6X QXdX28XBXN,X]lPXn0X{( (X8 XHX pX;08X1X'YhX#UX!tXxY a`YDY+ r,Y<XYQ CYVh|Yk#Yt8YY)rp<YDxY Y ˬYXY Y$YYZ,TZ!' pZ.(4dZ<$r`HZI$$@ZZ-TBZmZ|l<Z pZ#HZ<Zv,Z G(\Z(`Z">\xZ!aHZ[P([$@[0[: J[E ;88[['DL[e%$([w d[0`[$5t[#$[@[,v[1L$[ d/[8H[)[x\T\&x\!8\6'\D\Rx8\j~h\x6Lj\"|x\ O8\1-\4\)0\' \#4 \\6]0]3$]"]- ]:(8]C4d]S x]bt]yt8`] ֨0]DT]%(]tP]Šd],]9 P]# ^6^ L^ 4^)-X^<8^D#<^Pc^] 4L^n#$^y#X^h^ l^D^ \^)K8l^9 T^&a^ ^6X^ @^^L^#X_t_%<_)%_@0_Mod__1o_e1'_pm_d_[ _T _00_0_$_$_B`_(QHD_&zt0` %9`^$`5`@(``Xi`gd`r'^ P`}0` R $` ` T`BT`0`(?`0X` `&T$a a&a$$lxa/ aC. aP6a]%Pat"O<taua |a8aO@aa(ۨaݸ a axa!4b "\b%txb? DbMbc0(birbs b0h b(b&Ќb&xb8@bb( b)8bXHc5,c1c&@`8c5+cV4c`(,cj)ބ cxc$c¸c FpcU(Pc)(Tc cOc)|c1 d &$dRd&*(d78dCdO K0dYdb}<dn#d}0d_hdzp|d"(LdLd<dVpd*Hd0dtee le%`\e:"Xe@a84eU'4ef Leu6,e|)x$e /P|e1$eeLe ye)hfeXf(8f!pf-g\,f>6fL'@|fX)gXfmxf' HDff&`f&(dfxhf8%8fDg$gdg&l|g5{<gI $gU%\gg :@gv0g-c g͠g Pgp0g ;pg]gKPHg Dg+g|h$dh,h*Th@8hR Lh`8hw%h$#hUlh68h Th6ph$h'dh^hCDhiPii)8!`i91l4i@&DiPiZpie0iu8ii(i9ii(hi"<iר0i`,i!di xj&ެHj-8\j<6ljB-)(jK7jVjfT`jw'j!Xjx|jjjXj jelj8k kXk-0Pk8 TkA \kVpkgtkx8k k1Lk1 kk$kkR`kƐDktl %l%pHl 6,l0)G \l?& l\6$lh)\lztllB$l 6lxll#&d$l $lPm"$m m9Xm3*,mJ8mV :ma .4mp*hm~$m"m\mfpm "<m)Hm%km gm u`4m "<n\nn$Xn!8n+ @n=n\$Tnj9 pns n| 4Xn$V$n5n9 \n@4nhndn^8n%0,oho0|o%'Lo8$oB8loW\Lo]poiouTo"$oo $o $hTo"t o$&0,oo!p o5o wp u0p'b@p"1Lp40pB0PpK\<p`K\pj0pt9 `p{p0Tp8p*pH4p0p "p8qq)(@q"Lq0) $q<$,\qJ<q\ !44qh .Dxqyz\\q&Aq!Ilq0\q5|q'p ,qLq\q4DqȬxr `r|rMPr(dr:rDrO-b xr_`rrהr xDDr0r'rOr 8r6Drr%J4r + rPr0s#s$"y$ls9 oXpsN;xsU%Lsk,syPps <0sLss%O<s\s0<sststt't $t0(t1)J t=|tQtc,`t~Lt.t6tt5t) t&@t$&t* 4t%\@u_8uu$0<u,͠u=8uF8uV8uo&uz,w4u @uhxu(Pu Du8ut8u'|u5u08uv3pv tv. <@vD&`vQ"0 v_8 vk(pvt'g,8v$D,v8v)y\Dv"v5Hv)sDv$Lv#v!Pv0vw)w$B(Dw 6,0w00w<'eXwH*>@wQ-Xdw]1#<wn8w{=w$w$gPtwPHw 4Lw pw$eLwx t<x 'x x%W`|x& Xx<6i@xJ1l xQȐPxn)q x0x)@x$pDx!1dx5xx ^`lx'Kx6x xxy<yPy&my((\ y0$_Ly>1yI )(yW)\yh%yu"yy %`y%ttyCy%7yϐy&0y!tz N<z@z#6z0*S z6#wzA |zO(z\1zldzxzd0z OHz0z rz']\z zdz7Pzd,{ {1*h {8 S`{?8{S{lJL{u$bl{X4X{ `{8{({&${T{ DP|X| ] L|& |4$D|=1|KCd|a|l|!Hh| E| j|! P||)\T|gt|0t}}*;h}#o}-*U}2$}?0d}K!Ld}XYh0}e&`\}t }}H0}\}6,} }0}d}60}6F}0}X4}~8~8H~ ~- |,4~<'l~H #8~U~d~tq0~ެL~ x~Ә<~ 5H~,~1kX(~~ L8%x%8H3 FA @4I*<PY8 m+|Pl\,|Dp!@@6<90@ D8!Q0t XCXS'(L^ 8o||`,[<0P&4T,h &AD o"1t*-V=p[&|q"d m11(\$$VL<5pH@$ #-c 0$xF |VTadryL$,4%0pD5, i0D,P sH 4`-(Hd9(PElS'W0^fjz"*Xct|t˜h *1L% Y,"  6E$/2%d; pG tTh`Lo;h| F@!pt!5%,(^6 % 6d5.D84W {\0s~2P$*&\Դp6E$0X=8X }d%),:TED,T) `,`p(P!L"8X< f6D -&h&HH< p80&3p(@+xN5@b1'Xh'gd8u X #G\0fHH$ d&T& 8W|4pP()C58GmP L]ql8$y X H]1$)"6@ܘg&,, x+,5 P\=J!V1Te%Ht$ |\J(cP0 $H`8xBhh '~H$'r0,7d9 -GpV.Pc0 s!PD' $p$  Dp &P$0 m 6b8  1tL$`zt -@8DC)@<_vmp K| 1.D<pܬX)*t&I06[L#p"X# H/ 6XI(<[0ll hue@06Ø%*MX |x (G`%P$ME`t405 PB1 H0Of u  WT#L#00„@Lh/$/<@ +N,Yd6`k6iDr rd{ I<0'0L  \0x  tP%P(3\,<1qPDWpHV.,`_)dq %!x0N<D19 d8DNtP 0-J1QxC0 Q18^1 k"<d|"l ^h8P%0X&%Xx@&0/o|pCS (`Tp bzd`%(\8,X .| OpL ` T xX(0:TE9xS w(<k <Xze8<<D<)u1 00 1 "! | $)#< 6À0l|<+ 9 ڈD( S#qb&H0m$ Dv'1,PH6E((,`H$|%i "D 3|l t%hP,03)e <]I] xXk8|`, # $0(6E,"' D'@#\0# 0X$'v8rBqdK&](q$h0)\l`$Q +0xK 6ʜp0P "H(0$4>`N)<i)z$$$2 8"B#(50`1nɜh| ;-0<$?{M1l(] XhhUPpt|$8yP l@HD1p #]t "(T-d 68 !X K&H]<hT{1#@X Hh1ix),#|t6p6H| &10` $X.0dG ,Y% cxLo9 hyL4 yD1& r'dl81j|( @%dTʨh%Ԝ 820\Byde1 q0~$G@(|00,8P,D(8&185  D&\6!@HW<i64r =d8T\8 (PD ,D58Ґ@ h1k#h(XP;0(X,`'xrz}1TD%bR%! & 1  05 LH@3? "hLGPH8Z1%t`&z h&\ (<lT*-$kT' T0 8@, 4T@&$K$CW#l(e`o0ބyb%#e.Lx'xD1 ']0h&8d,4l8#kB9 lQ3\t] R @g)P(t1wi00ed1k)x8. (٘D([404xIPT0 !6$*: C)JpP0]N<s pt0%- (Ҙ||p&,%XPP,P$0 &B(8P \6E0h֨@u (=h8Xgd%8,u|$:D %x,0 ?$H,<K&D\Lo 45(( HX06@(|01)@)r`% t8 %X0Dw`O1mV)L`1i%$ s<%$8 Dt$ rt,L"6f0& GT:8I $44Z d4k'5x d ,&($ptj 64(61t7l( xApx)DL;6f@KP4c rDt(~(4x Xl lxPT9 (\0\X 9l8&X0(L@'/T#`0\#4j6ty oHa6d3H0p dL^hIh6E4)8l$8L@%dNa'Ghj&U,}  Mx|[@h1l(E%$Hl5#\F 4T5|]*JpcDu-X ސ6[X` r8 4 x( H&Y@|.8,5#P?L1Z(X8e8 pn uxTt4 <(`1D)٤6$#'lGcU0^0cDq*Y{,ć\0Ĕ$LĦ# ĸ@!_}PL &mt<$!x02%;8xF6D$L$bTwxŅ3ŔtŢ Ų(]<0H4D&}, <,X%$8)5*G < Y%gpz|tƃ8ƐHƜ1"ƢhƮ8 `Ƹ |pVPp7,"<ּK`%^ pgs0\ǃr,Ǚ'\ǫ\ǽP `41 P T$ ,8D 00H;HM( Tf6m'x&Ȋ$Ȕȥ0Pȳ1kȾ T{<<$tx6\ <t {0,7G{`\p! TɈ" Hɗ -<ɧcHɲ)\ɽ(t(@1*tt8 Č.>((dK@Q8 ]Jj z6ʆ%ʔ)ʣ% XʵjTHd<$ \\#  $ '(&$<96bB,`Hj [|r-˄˕L˟ `˯8<˷6nj1|1#8(DL1$ؼ1`3 HA 8L1\Vcr<z X̆$$̙ ̢$̴ `̾#80l nH  H հp\$8/h: LB !4T`#m!p$z ͎0@ͦ<ͳ 4\&^ g@ ", ,l((0-7 n L&Yb''0{!#Ό<Οkά0X ζ0L0`gl@ c&}<28x0-ߜ\9 GU1^k|iS(t6<%(@ϊѰ`ϖϨcϷ(`<#x$T#H u zL`$'`25C1pKY0tl0Ā{=lЍiН)$XЩв (T/ 75ּ1'$L4D# $+. ,LA,LK*@@tT6_Ln$x$ ,ш{ѕ npѩ (ѷ$S( 6 lx\ 3<@8$U@'$EL4 G,|T%$\$pho~ҋZҙ&D\Ҥ#ү¼ҹ6ly#hT -JXx|To"^,<; yHP ƜlY]l6<x dPӂ1!Ӊ$ӕXӥmT\Ӯ0ӹ ),8X1lH(&\"0 (>TUݸa @n1!8x%Cԃ1ԍ6,ԘslԯԵ,X$!ATd4H'` nxd4'R> 8\L+wVa<k1u0LՄ8ՑX՚ Dhէ0կ"dվ $p 1t {8 & 8p(2pd;WdJ!4S1`7r )$4zmllֆ0H֗$֥6Pֽ֮Hrx Z|XX'?(Owlat6\~z׌#8ט0 ש |׹*C 8X$H w%4l T+9$&p0H&?tV#XHak*ADt1j},؈0أ0ض \l,,1L % 1(0H1-@E0lT8 d]6D@d4r'~1ّfT٥tٵl5)X"!P1n) ,900$D ,R3 pf"tm6bwfڊ$\ږ'Qڠgdڽ6c#b$0TD0 d0x$2 h>hX fi 7Tv*=ۆۖlۤ \Pۭ(h*JL)e D`% &$<5PHV^ 80m&P\y%p ܈ m$ܗ%Pܡ&dX,ܯDܹ|B6f8[(Nl00ޤ',0)H>6iLHˌ\\i  {`h݈D ݞhݧ1ݯ&ȸݺs   8 x8+04 6 @ _X0h? xH8HVɤd$do\އm@ޔޠ#T ޭ 4(޸ 9 '$ \)l | wd<4@1M8V `6ho yH߄0Hߎ%0ߙ`0ߪ߳1#|߼1#)0)0#\ hx׼%U4:8DO<Z6mXgqd pv@PV 0@-(u (&,X| d  |\08 h' n01 bh0?#(`Kl`,_ v,$l6hw4#L P0 $( L(0%x@!HX %!8.61`\[)h|n"16N,10`6|8\ (, <5" xd,(AO^g o d8 (%p7@,0l ,l%G`(Dll+'5)PDSWD|a8 j6s(Xp4([t$P~dt)<&1X51( (46dl' 3TC1p8Q"HX-Tj <($uD88!$hPl8pd GX %x80#0(:0@E hV04b6rĀ0iH9 "@1ID0$X)4 ]H %`0>I(U1 l$`$o%8v$} #0 t!( 7L<% %L6ǔ|8m-8Ā`MpLV˴Xb0o%(|{ y0$%j8 9\#\D0 \<$8(`."l9Kt_"txT &/  $ltY\t ET1) bp4# Sl5J|DZ0hl z200UH%8k|1$'4T6`r8,H48&(81A1I1Q ~ta&n1$w'yl%G(( !c0F1@454mL!1*'4<F3LV'^ |k v8H,H| "<0x| <@+3\4,1o'H4@p Z$$ebr)H0x ,%h0&n$  8 L%Y/ PdI#`$X 9pd'pD0z >XPqH<0l@x)|0`GX x@0((8l5!@N#\7 eMt'n`4| 8<$a,1$$%pxdL86@T%<@$>11H p- }x=$ی<H#~xQ#t\<_ Qv5( X;6xP&{P n8x%4x7&* "-X|1(8TB1-QZ8Xa0$r6E8z18 x80060P 4'tL0`p+ z\:%zD8I#hU0Te+HDnhdx ư Q P\%PHH0h$\H%(7!#|* *`<րO)T<` l@q$a6P 10%w|$b #ft8"@z<8 h$6p" ,.!9*P<SH_(l&s8Xv,5׈&3  $$L6Ð MP($a0 &B|.P:2\I4W(gz1'(<-l|6d ph0H 0}#h (#p 8t 8tAH(B'(&d#xl! hd,(870G1j@(\f!$u iH~ H#!Lb@k|6!(= Ԥ&89"lHH~b li)d|ds%nz17 .@&`xW`|n-Tp` D(lX &P,:">I1U[(c4Hj1t0Ü\!&H!@P0x#/Tx $  j0)82d;6ElS9 `g#pn$Dy0P0t hx0 X$;,!h"L hpp5X( U0 <8 E%9lU$ _ krHv1~'G x$pX6e0 9l ØPJ<|zp"X  GX'L|x%$`7 XDF6T9a6(q p`$(L8"%z% 5H 1" f,4 0@O|CdD/ DB8P1d8hn6m`(TPHt%:&*9 <D)0' eP% NX4 E%Q'tP\Z$7x(e s |`J40(1)xl< 40Ȍ(53( HAxKxTD]8tf|6H\ "*L'n,0|.6`2\,\ 6<%Z H" , }@;1nD(K WZ0c&2hs%"PH0xD1 `/h ^$D'd!,)ht80 >hTx`0q, }$Up,# ?`$(?`$(!`P @`/?!̒``  2!OÞ@㿐a8X/O` (8` (/8`@ ? O㿐a/` @ T@㿘  㿘at㿐1!` @ !`pX!`p㿘@`؁`@ `  ˆ@( 㿘a`㿘a̐@㿘a@㿘#`@`2 `` 4 "$`@ & 4$`@㿘a̐ @  @  @㿘!#ؒޖ ?#؂8` ,㿘'@`$ ?` )!`$ $ $ %!$ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   @ڐ ؁";`D) + X`S c D@ ((c `L< ;@?" (@ Ġ@ @ ``H @$ 0  ` @! ` @!0i$ 4@'$ @V!%`@`$@   @J 㿘1  &  2& @8!P㿘  ah  >@ 㿘m`@2  `2#& a` %"W``@J  : && &   7 8& ?` & ?`@!a )aa@  .`.` @  @" ?` & @@!p@!@"㿘a`@ b@@bP ( @bX ! @b`  `܀`N@H@2 HN`@2  㿘a ` |@@Y |@㿀) @`G' `k @ a b#aH-Ȇ(H`%aԀ((H` ( @H`- @`Z#! #$ L L ($`D `H`-2(a?`,`````\````` ``$`(b `L `p `T `` `X `P `d `l a ` `t$ ` `H  `<, `8 b  H`+@H`)`+@ @ a `ڒbhJ`L# `D@0K`DP !$ L % @ L ($`D `H (8``z`c" ! `d`a!І`!! `s!Ђ`!!!Є `@#a!!Іd!!A@bx "#@b  $`@! #H$ L !$ L@  % @@ܒb  @N"X`@#a`@ @@a|@  .@ .` .` .` .` .`㿘 ,`@㿘  ,`@ @ސ`??@"㿘  $ $ $$ (`@ @`  '@ 㿘  `   ?$ `$<(ݐ  ?$ `$<(㿘  `a``@ `(@ 㿘@g -@`Sa`(_`$`#@aȠ Q bbaT%@%` %`a֐ %`&``"J`Pl`P```` ``l  `` ` ` ` ` ` ` ``  ` ` ` ` ` ` `@``%% g#ffal(%` %` #a@Z##@a`````` ``     D  @a@8#(㿘   * * @ѐ" 7 * a*  @? '`2!?  &? &@8 *?  #@  #@*? @?ݐ?? 㿀m%aa@ `?`@؟ @ ؀ a a0(` aM@9`9`P a p/X`@@ - @;>-g'#a `P8$a f?a `2* 45q0`(`T?h@ #a@ 2 ؂@ ]a'@@ Z@b!Ђ`'!!Ѐ`!!@V X@ !H耠`$!@J h@ "hHh`2h'  @ ?<@z ǐ  @ ?2 ?@  @| b " @ "' `@耠a   b1dǐbb *. a@`"$ `8`>@+p3@2!?: d    ? b? 8@v"妤?? @   ? b?p, (`@@@d?'T@J @b ``@ @v@I,@D `?'N ha'a``   `''''Բ`(0`@6 `2``"``Y؀`h "  쀣@8'@8@(, / @䀠,@ @`(0`@δ @` @``@` [ 4T @T# #  # #  @!(  "@ , ``܀2 `2 a``@Ԑ! @dٔ?  @@`D Ԡ + 024&6*6,& @ 4T2 !@b ``@ @@j  @e?;0(`(`@@&@;@u!Hb ``@y @h@;0   (@ ' <(`  '20@H!0b ``@L @;! '``2@` @5耣` @!@E  7?  ``+`0`@ڠ ( `8`耠"' `"$  a`` @!h  @ e ? @ %@E ?$ 0` ƴ2 !p@b ``@ Ӱ @@!` 4Đ@u?? 4@!1" ``@ @ O&"" @^aȀ 1 O&""`21  41 "? @` @ @w!Ё@r!1" ``@ v@e" `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*J`   J`2 "/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ @ @J(`8`` 2  ` @@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &      ??  8@` ` 8@@@ B 8@  `"``"``"``:`8㿘 ` a``@ `&@@  `&@@  ) `h C@`/?@ ``d0 , , `@ 02, $@ ؐ -  ?@@耠`@&0$ & &.`@`8 &㿐  `P Re8<` %  `(@8`eD`L  Ȁ@ @&@%@& @  c 6  H@  Ȁ@`0a  `=`#  @P$ $  @&@%@& @  c א  ,84(@@ ͐ #@ &@+ `d`  *  Ā $ 8eD @`0$ 㿐`; `@0v !* @(@`" @  @C <@ @ @ @C <@  @C <@" `.@?$@$` `Ȑ.@㿐3 `@,, 􀦀@@@@ <@`@@"`2&@ے"` `8в 㿘 `   @6`0  "  @,`0 @) @%  `" ݞ@ 㿐` @0@]ฐS,Kx``*༠8` @Yd``0 ,  @ 0@"x @% *  @@ ?%% % % % % 0@ϐ0x@ В  @@&`@ % ```    "e\ kFaT `0@g`t% `t% `t% w    8''''N`p`/2   N`/`"f <@@.8``/  .`  8``/  .`8`/`R%%: 4* #(`"  @2   2 / h< (@@!'@@=@" /܀`0@ _@8  d8`` 4' @)e(@3܀6  : 2Ӧ@-` d 0``ܕ*  ܔ@O耠`/  B  'ؔ@O@  0' @((```@ " ! !00! `0!  ! `"@? ` ` ` `(?(@) +`? (?@@@ @ "@㿘`&@@`&@.@& 㿘& @&@   ?`Lh''ߒ`` 2֐ D D6 &"#\#@#`a b@Y   H b? ''h쀢 Œw #' p> ?`X  '؂'''#a'b'̐? D D4 ?$!̒b#@ T#`#\ @   <#!b@˒""V'4b *@2X  ?@ِ"\`L'  `L3`` "xx*cȀ  a` ?@!؁    ??  8@` ` 8@@@ B 8@  "`"`a$"`  :`8 㷐O @L`@_ G`D@   `,4  @(* :  /􀢨H `g"''`@ d (􀠀 # "'@ @<@  `@4@ @" ` &@@ $ '@1逦`@8〦㿘  & @  㿐@ (# b( h1h@Ĕ  2" ``"- @ ```<` 2(:  (@ ( @ ( @  (`@h (`(@@ )  @h```!(@ `, ``  (` ( * :    @ d(gx@ 0ڢ `, :`/ ` `  , :`/( ` `(` (@   U :TK (`@K    "@   + ?` `:K@`` `a՗, + :`/` ```  ) (+`@    -8`@@" ` a  Ն?  x:/ 2 "? `2%  w ! (< @  ,nK@ @(1 ```?8I  ̤ @  ``` - (:  h2  (`((@@@  I`.`?`;92 @   @ Ő'  , $''$L#\@#`̐1"a@ "X &@ "01 H&""1&""㿘  "& @ O x&  0Ȁ` @ l"x ,9aN`ۀ`/2 `0 N`/" `"&``0`ר @ x@" " "N``/   `/ @ L`   ,@ X``?`?`?`? *    @ +'(@ h#\#`"  @'? l  h, 0`"" @@Ԓ x80`@զ`$b @   0@  D, 0`䀥@  ?`"?` ?`$? #`#\@ ?A , ? M@ ѐ (@d& # @ @@ O`/'@ x@{BN, @ @q x .@l x@  b 0S&` ې x@Uאܰ ڰ ?@ꔐ CD  D 4` $@@ : 1  80`@`'@ eԄ $#\#`a b @_??$ Ԁ!ؠ"ؔ @ K $?!?$ 8$ 0$ 4  נ   b? b? H b?"@?2cą(c@2  @ 2  @ 2  ?Ā`  Ć` ă(`@ @@ ` ` `㾐ab@p\'Ĕ?< 6   '?'?@ ? '? '?`` '?Ă?#\    " {xa$ d@?  H `  `& @@ " H b?'x 'p't'|#\#`  p  !"@?@ " H$"'?ؐ6  o㿘7@& ?@c2?``2?``` &@ W"?999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999(949@9L9⼝㿘 ` ! @ H H@;0. xcpccbc`ccccc0cHc``@*(@` 㿐'X'P'T#!$`P `'$ x@Ր#X ``.&&(謐 [ʒ  .@ (7ʂ 7/΄  /7 ``///y/bL/ ./ `y/!//// 4/@D#\  0XX0X? aX$` 0 @? aX$` ? a?@3 `?@, H㿐@ b ? `5@``h`f`` `@ɔ   H|`И 5`l +` TЂ``  9  89   9 + + Ђ@@+` Ђ" 8````)` # .1@  ?#8?" ͖?cd`((` ?c`(`ݐ d`h(`((@@А Ę 2Ӑ?" 㿘` (``   0 ,? 4  0 ,2  0, ..??yc"@ Ђ``  (8) )  @@"@ Ђ`` (㿐 J`2 ޒJ``. ՒJ``. ̒J``. ÒJ`?, ,` `,? c 㿘\蘦   )?+"`("$@`@ ,@Đ `4 ?" <? b㿀@Q hh" ?`@?<@ `0`<@Ւ 6(`0``Հ &@& `6`  @ `% `%4 &&. '''''6 @ &&&&&  4 (`0``?&&&&& ??@I x&$`$` $`$`$`$`<(@@(@& ,` 4` ,`  $` @U$`4`  6 4 4 ``` `&$`,` '''''4` @;4 &$`$`$` $` `'@{ܖ(@? aЀ`"`@ @@a`'@_@ ?`)c      @ " `@ `` (`ꀠ ?88@( (` @@< 愊`;` ?# @8@)`   0` (  :`( (@ + 㿘弒 ? @2  ` 7? @'aH "` 0㿘  61 1 .((?((0 w( 4?  @ @`2  ?  㿐'H'L'P'T` 'XH@'@ { @ H㿘!㿘 a, @  , @, 㿘 D`?   !?& @`&$" H@ &  L& & D"??& @㿘 a֐, @>   ːȐ ?& @ ?   `A```21  D@?`& @ ?`0 ꀢ?`0 ? & & & T`?& @& &|   Dtq* ??`i?2?`㿘a^[X?, ?& @, ,`* 㿘. `@ @li`e % % 1@ /% @ @`2P P D`2L P  "H P T`P ` D`&" L@ %  % D"2t P L%@ % @  P@k" % P Pd? @`2 P  @%  = =   @M % P @F" % P&?@-` @Ԕ   " @@% % % % @f   "%   & @ C = @ =  % D" Ӡ% D`"  P?% @ق% @㾘 . U. `TC\O `  @ ?@%`L? @$@$`$`$` $`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`@$`D$`H$`L$`P$`T@Ô$@$`Lt$`H`2@,@ @I?$` @> ?? b "$` b?? b א@e !”: 2 b2 bdꀤ `F@um ? b?l㿘 . . `@  @} L@@ X@  b? a 㿘@?`@D X. ` @ """ " " " " " " " " $" (" ," 0" 4" 8" <" @" D" H" L" P" T? @@  @M X@P?@&`L &@&`H@$㿘쀒@a؀a؆ ?@* @ @:`? ``   a   #a!ؐ?"  ؝㿘 . a```` `@` $@    b? ``" ` @뀤 b? b?㿘  . a  ?? b   b?? b 8 ` @B 8㿐`  ` @@`  ``  b?` `$ $$ '͔ 2/$ `"'$ (J`$'ऀ`  ` त@ `@@ ``  @$ b?$,, @@$ 㿐 . a ? b " @^  `  +`0`    b @C >  '`  b& ? ::|::::::::::::::::D::l:::㿈a  @,즠  ?L ?㿘a  a8H@ *! (xb @(`8` % ` N@ %`  @N@`` ` % @(` 0  x @  ` + ,3`3  ?L*? @y @Lq`   (`8`G (@@ @?  ,   (`8  8 (`8` 4 †`H@ w`L  o@ i@ , _@p # V@"S@ >O@ l0j  - bc#㿐bH'H'L'P'T'X',#@   ( 2 @ "@   @@* (@`@ 2(@㿘@`"`h`f`` `  ``.` 6` `(` `(` (`  (`  .(``.` , , , .` `)  `)  `)  `)  `)  .` +  +  + ,((|`ЖH%Daa@J @D @ ʒ  .``@````@77'777& (77ʄ 7/΂  4/#\ .`,*!܀?D`. $D . . . . .  $D$!@@t't!h㿐 b ?h@``h`f```D`(`(`  a ?::H:H:H:H:H:H:H:H: :x:::8:::\:d::`::8:P::T:H:L: : 2 $?  " " " " " " 8 0  ( , 0 8 < L l P  2 $? ` <@`  8" < (@ @ (@" 8 㿘?N`125?@22? /? ($  ,` ~ 0  ?0 `$ $>``"``8 ,"`$"`4$ 0`$ ("` c|$ , 0@?$ $  `  㿘 2 $?` ,``4 0@ $ ,@ 0& $ 2 $?  `" "`0  ! @ `"    `! @ `  @@ 㿐 2$??2<`?`h<8 `$<)$$8  * 8<1 $8$<`$hh @$@<$h`ð?ߐ  << $ 2 $??`  <`?㿘 `W?`$`2`(?N?`,`J `0 ?0 B`4`@ `$`(`0 *@ "1`0 @f3 aa0`Le0*`la,@8 `l`P0  @$P$L`l @e0$l`$`4 ?*$4$ $ `,@?˰ 㿘 $ 4T ("! $&@@ :( 0"@ +"@@26 0 (@@)$ 0 ,@ @$ , (@$ 0$ ,$ (&@@ * 0"@  ($ 0$ , "@ 0 (@@$ 0 ,$ 0@ ڰ  4"@ ($ 0$ ,  $ ( 0  (@ $ 4  㿘 2 $?``` @`     & `( `4@"@`($`, $`  @"$`,` ؒ  @S @P`ڰ?$@?㿀 2 $?`? ``" @   `lbbĂe0`8`<'''`p`T`X ''' 8٦?) "&  @(@`  ?5 5 - ? (`$`& 8   $@` `p  @ $`& 8 $@`"& ``   5 ?$@Ĉ"&  @(@`   a5 `$```5 $`d``$`\5 ?򀠠 $`h$@`h`\(  @"]&  @(@`   ($`h0p5 ?@ ( !@(`$`h@0`p $`l$`L $`T@  ` $`h$@```d`h   `T`L( (`@` `+((@ (  `2 @& & && `($`8` $`<@`  @"  ] ҂     ' &@@> C > ``@ $` " ` `"@@($`& 8`@`<` @ (`?(`& 4`"Ѧ?0"&  @(@`   $`5 `@ "` $@@0?ۈ`@ $(@ 5$`@ $@`X`P (@ (@` @ `q(@ ( `  `c`2 @t& `, @ $@"i& `D':@`@`0 @`4`(  @@`@8 % $`@ ( `@`@@|$5 5 @$(0`$`D$`H $@`H"`D `D(@` 2 @& $@/??5  @| $`@   $@`@`<  `@@ @$$`@@%@,   $@ ``  "&  @(@`   ' @> ``@ $`` @!'@ $`& 8?`5 5 ? - (`ʸ "(&  $@  ?  5?(@`  2 @& ``  $@҈"&  @(@`  5   * 3   `"`$b(&  $@u?$0`5$`@`  `@  ` $`H$@`HЄ  `@(@` 2 @S& "P& `@/@` $@$@`T`L (@ (`  `u`(@ ( ` ` g`2 @&& '@Ά $@ C `"=@-?٘( (0` @0@@ (`@ @    $( 0@@ (`@  @ ` @2 @& (0``(U+ `` $(@` z2 @& $@(&  $@`R(``L  0`( 0@@ (`   у(`( 0@@ (`@  @  `2 @&  "(&  $@͈$ @50`p$`hj !.@(`2@(&  $@`D $(@ 5$`D 0`$5$`@$@a $`P"& $`X$`L $`T$@ $@$50` ``   /`h ($`h@0`p "  k$(@` c2 @0& & & & &$`<$`8= @ $`l$`L $`T@u즒 M`l``$`P`d $`X*` `p@d@  (&  $@:5  `;(& ? $@- '$(@` 2 @& (`0`$`@$5 `g0@  i$@$ ̩5+ `n@? 5 u`$50` `m` (@ $` @ $` "& 8 @? `` $@㿘?6 c`V U a?GbP![          @@@@ @ @ @ @ @@@@@@@@Ϯ ##a@aN-@@`@?c?`c* ````````` ` ` ` ` ``@`@@@ @ @ @ @ @@@@@@@@8@ @`@!?⡒##❐-@@c@?`(?`(@㿘 ?@!? # {u##6`6 @#@&$8$c…8&?c8&. @ 0@`` 20@"@ (@ ( `0@ / @ ?/  0`(` @`(`(@(0`$ %@ " .@ڶ.ڂ (`@ І`ƀ 7@0   +@ ( ?`1?(7@+     (@'''  '?  '"    `(@ (@. (@ 2@ @" @(`@`0((` (@ 0 20T * (` g` (` @>0 @8"'@@(`@  (  @ . @.  @ `` (@ ( +(* (`'@$@80 }@ @ ";7?Hbn.''? `? (@U'"&   @@   @2@(`(@@(`0` (@ 0 20 -@$%@ @ @րb}''!L`) L c0  8(@@ `  @ 200)  ! @  bHH`㿘bH1 㿘`X bHU8?`@``(`@6 `(@0``(`@0`(@0``(`@0`(@0``(`@0(@0Ʋ`"8`@6 `(`@`8g8` `2``2 㿘 $  2㾘;;n c  'x @`@(6>@ `, 4`< @"ɒ..6>@㿐/l  &%Q   @`   ` < ` <@? "`??cV? c   `1@2P) IG`ܦ<@2     ƀ @` ƀ  ` >   @`   ` < `u`?n`    f . @ * 2 6 @4 ,    !A`  !!`!8: @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @  `G a0@ ( 0 @><@` `㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ݾݹdvma_mapoutdvma_mapin%lx pgmap@ %lx L!%lx %x %lx %lx map-pagesobmem %lx L!boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s node %x property %s length %d > %d Invalid controller number prom_mapin: length=%dprom_mapin: invalid maptype %dprom_iopen: "%s" error=%d no PROM root devicenamemakememarrmakememarr: hope version %d PROM is like version 2 memorymakememarr: cannot find "memory" nodeavailableregmakememarr: cannot get propertymakememarr: no memory founddevice_typeblocknetworkbytecompatiblesun4cpagesize %x l!sun4msun4dUnknown CPU type (compatible=`%s')%x mac-address drop swap 6 cmovexmit: not a network device Can't open device `%s' Can't open network device `%s' prom0promsdstxdxyfdie   2.6>> OpenBSD BOOT %s can't figure out where we have been loadedbsddevice[%s]: boot: Booting %s Loading at physical address %lx Cannot load %s: error=%d lseek phdr: %s read program headers+%s%lulseek textread text+%lulseek section headersread section headers [%s%ldlseek symbolsread symbols]read header failedread header shortELF=0x%lx bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_read: hit EOF unexpectantlynfs_open: must mount first. getport: %scallrpc: error = %d recvrpc: reject, astat=%d, errno=%d Input/output errorInvalid argumentbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorUnknown error: code %drarp: bad socket. %d No response for RARP request sendrecv: short write! (%d < %d)readudp: huge packet, udp len %ld sendudp: bad write (%d != %d)0123456789abcdefexit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O error@@ !1Aa  0@` #+3;CScs 9l9 99D9L99999x9ˀ99h9@9ָ999X:;H99@9P9H:;P9P9@99H:;X:;`:;h:;p:;x::p:;:<@` /:Z9@:L@:N:N 9:N!:N):N19$?9lR9a:Ng:Nr:N}9P:P:P@:O:P:L:N:N:P<:N9h 9p99p9l(949D9Q9`9t99999|9X9L9p999909 99$9`9T9x(949xD9Q9,`9t9h9H99T9999909$9H9999999(949D9Q9`9t999 99x9T9H9l9999,999 9\9P9t(9049D9,Q9@`9t9|9\99h99999D989\9999999 99!9494?9dG:PHQ9XZ:Pc:Ph:Pq9Lz9:P9:P:P9`99:P:M:P:,: : ::/:NL:NH.:P8:1I:1[9c9p9{9,99H :W:09x9H99:8 :XH :U :XL99ݴ:MD9p#:M *98 :W@F9O9a:Ld9j9x9ְ :U9:L :U999p :V9999:8 :V:M9#9$)9ɸ39@=9D:LLL :XPS:pZ:LD_90g9ˀs9$y :XT99 :W:99P:L9$9 :XX9l:\ :X` :U :M$9$':MP09P= :UC9pQ:W9 ]9b:NDj9p9 z:LH::L@ :V: :Ll9T :U9: 9h99( 9/9ָ89B9Q9ތZ:%Lb:Mj9|q9h{:99:M999\99p :U :X:09X: 998 :Y` 99:LP/:L59F9N9@X9b :U j9Ls:M| :Y9 :V9$: 89T99 : :T9:9: 9l 9 9 9 & :Yh -9 59 C9 P9 W9 ^9 f9 q9( 9 :1 :Yx 9@ 9 9 :U :W 9 9T 9T 9 9 9P $9X . :U 3 :U @9| L9 T9 ]9l h:( x: 9 9 9D 9 :L :MH 9 :3 :D 9 :7 9 :D 9 9 9P 9 $9 4:L@ A: 4 L:L R94 ^9 h: v9` :U 9 :U :/ :Vh :)d :M 9@ 9