ELFa( 4D4 (  NN< p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -LP@x`0 P  'H0!@ 0',0 0` 0 0' M-L0&HHH0$H@  , 0&&, $, 0`@ * 0 0 0''X(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,PIM K 0 Kh?M99 p-LM@`P3PUOx3e H0 P!M00 h0 \8M3 @M89 M3  : MM99:9 99 Q-L@L0 L49@9 p-0L @P ,00,0 R 0$ 0 00  0 pV,0`0,0 R 0$ 0 00  0 Cphꈶh -PL;4p`V$ 4! ,0 J0 LLL,0 000,  ,  0hVP)@0D PT,0 0,0pw::X9`9l9|99 0-L@P,XD@/T ` Y0舶h -4LSPp `00 0<0000@0003  00   0  dM4S0;0ShgK":4S 0 00L$H@0@@000 31C0 1-L?rcWP`S V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVdM0P0,0 00P 03Q - @p`R0 0L PP 00  0 00000\4SX 03g4   -L@pX00S/0W3 ] 00`M 00P00Zpd3 X0  0W  -0pS0L00@`% 000PU00S`U \J    8JU JJ 0 p-8P@L@`4 00 00S > S 0 p R  B  hJ 000 P{JXp 0 00 kJ9@99 0-L@LP 0( 0( 0h' p-L@`u PUP00SXP ?sp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V z0@ o0TTPPQ @Op@ Q00000@TP3038P060 0 303 R 00   @002j < p-L@ P`dU  000PY YR`pp 0-LP@P 0edH@ @0lP' 0H@ 0_ 0' -LM0` Pp @2?0S3  0BP.0  0&0,0K0,0 Kh  Kh\ 0S |000Khm q 0P00 0S  0P3g4 MKhI -0`10#LP8p&@P@ 00 0000  0 0, |0| 004 P`0  @D0@  00  t  t p9 -L M0PS` 0Sp K@K EPE 03K3[03K0p Pp]3[03K3[<3K0@0 4 @K?0K1 :`@ 000S3033 T] ,3dp0p|14 (4P=303@To3 `3`V㏏H0"S3R1  K0 ,pK @3 00,0K,0K3 f @4  0+@K*K( %&#t003 P3,00,0PQd < P `P||0 R0C  (P 0PP8 x+r 00a=C4`#hl 0dUBx0S 40< `*  `0:0'8'9 p-0L P@p ; `  0002  R` ^L00 S 0PV@p $hWk$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R ; : : : : |; l; : \; 1 8 0 R 0 0 0tx 0 R0 R S 0 p0 `0 P0 H0  0 0 00p$' -41` BpL R = = = P< = P< P< P< P< P< $= 0GS< < < < < <  0 0AMP(@ +P l0l pᲀ\0 R    p -L\M4@KP 03K/P3#K 8#c[Qr Qn 0S3Q  2 3K2#K 2["[`0 2[d h0  2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@@(K T1   D1`  T!T1QQZ@K&|05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[DH@'8$ $:hQ99v'N$99 0-LMPd0  ,@0@800@ 8H=88' -8L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- 0h)V0CRt 72RD >0R@2@ 0C 0h90CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@0@C=@0 1 01@@01@@0x1@@0D@0 X T001@@0 1 0h1@@0 ; 0 0h0@@0 D .0 >0h 0 0R t'?00 0 $ C$ $ : -MLM1 0 p 000CSp(KBKII  D 0T `0 S` @ T $pP@VP8 hi$H:и8 -LFMA0S, S t!000dd1 RX10 S<0K 8K 0h"0C4K02K#K t B("(04"43K@QBK0 5[90K  5K*K L @ 0 Bh$[4[Q04KD 0 D B0000 <  L@0 Bh,DPt 0 P0! 0C0 0 a ; RB <Y0 R 5[TK< 5K06KtNK ppPt w5[K R@0 80Bao$:' `@p10C0P UP  Vp W@P0 `8< 82S W@` d0008#88K@0 $K 0 0' 6S-LP` 8SB  ;p 00Q8  X@#8  00Q`8X@   #8`@@Dt `X0 R0C  (9Tp<8:$ -LMt!0 0 @P  @%; 4QPEuD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'T:$ -0L R xPx`x@0 $0 p0T\ 0TiR$ 0-@LP@:40 00 @0@0|:' p-0L M @RP+ 0`0 P PEun:KpUt 000\01KP01K01K0K 00P$': -0LHMp$Kh`KD( 0 ZK P%  H(@"(D0#K0K"K0 0H00< 0 04P  :{' : -LTMl p |_l @ud?` B pQ  | B 4/0 . ? p 3p&PE?n*T  C>T N0CT R>Tu >TA-p( 0l pX >Tc 0CT 0T  p0l0pX 4W. X0S x ]x\ W- 0:0%`Z(K=T !=Tv =T4 =T4pP 4WX l 5@p x xpBp d=T` '0CT 0TpP,= R p  >p X ,pP4X 0 S <R  R 0CR H= Xp0X,p p p0X \,hpP l 5@= < R9 X=pP gpPpqpX [pP p X X+<pPX0 \U;Q= ;Q 2 Qp;  Q K0XpPXpPl 5 0"0p  * 0*0004K?4K P;$K NK:Q !0Q;Q |:Q :Q x:Q p:Q X:Q\ pH:T @:TE 8:T,:T" $:T :T7pPpqpX 9T:p pX 9T 0Tl 5C = S @S 9 l0p%9 p5pX 8 Rp 010   ,,X X0/ @9 XPX0 8R p 101zl 5 8 R@ 0p8X 0X <08 XPoX 0 Sk !X0 x Zxp  ! xpJpPr !p0!  x * pP xX 5 Qp;x7 R᎝?@^ ]>P x *@N`K@&@ @(7@4KDK `G$K HK  l x5 0x ]pP(X6 R l 52p 6 R  h6X 0X0)   6 XpPnM=@V   B 6!h%0@a   20C%pl 505p0 0S/ 5 pp=pX pP4 R ,$5X 0X0, <5 R 05 XPX 0S >0T0 p X 0T 00bYp 0{SX |0 P\ d0 t UX t0 `9  |@h p  h t0 0$30 R0S    05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 hPPx00x0p0\ | } pPp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 p^pX KpP }p X X! pPsX.p k$2X 0X0, <2 X@PX p0 V \Q1X 0X0, 1 XPX0 p0!pPp 1S 0?X 0p 1X 0X8pP"l 5 1 1 p0zp@ hWk:ii i5i i i iiii 81-71$%Ci8i|6i(iii8i i #A<Q gfff:B#$$'ppX 4p3p0 >! pX 'U  0  g 0 Rh 0 4K04K0$K NK[| P 1Rc 0RP 0CRk YPB XDhP1  : 0 R; l1 4K04KAX0 u {2 0T X 0Z1>p,0Xp ꎝ@? x OxP X 00"0X 0S00) XD M#D2 RlBX0 u 90X 02X 0000 X 00200X0 T (X +002Q' D0CQz >0QDv3Q. 0Q=(3 RX H3  lX3 u -l3 p j3 @k b3 f ZX0 pN3  Y 3 R 3 Xp<1>p,03 -L R6 l | R6 l 0X @R6 l 0X 60 f@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC ,3P 3QX Fd0CQd  80*P/ @rR8 p 0X R8 p 0X\ RL8 p 0 |h2  0TP (K0S,2.`K0K2K02K2Q7 0Q0ST2K?2K.`K02K00C SG} } } p} } } } p} p} p} } 0!02K0"K|.`K2K p10S4 `10S* S[.`KKh<@0 fL/[=  uA$[P& >K 8K  *K  0  0D P 0 0@0@[|.[갤[>0P 6[P.s[ lK0 <0< P `[8 .<00 0lK CM @ 0Zp G,P 8 .<[00 @0@C= G$0 ^  YK''$:x:T::4:: - 3L  8sc @RR2 d 0X R4 h 2X蜢b r0R2 d X 0R0 ` ( RP4 h 42Xsc 0R" D ( R4 h @0X1 Rd &4  1 R0C4 h :XTT1 R0C2 d D1X 2S0M0 R0C4 h 0X0 R0C4 h B=CX R4 h 0X R4 h 0X~$p -L$MHH8Hh}/p pP, (8 $K4K JKP -, 0R(K˯ FK{Z -` p70P8$ @! 0 1( 7!0@t  d > T HH7H'ᲀ0C 4'00,7 $' <07 Ⳁᲀ0d '006 &6岀 ?$K3K@@K0P66#[   6Q Q) Q +>3K ,6$K P3[SX&000  ,, T(6:@K3K 03K5 P5  [^5ࠃv5  P AM(@%5 0pu 00 De0y_0@  ,$000?h$010o4 4@ Q 44 $}.  |42Q x4Q D$0 <004H   D4Q$0;004  W3^ʎ04\`0@  03\0003@ 0c 0 0  0 0 c 0P0 20p 0b 00[R J20Y 0 0b03L (0D  0: 0"01 00( 2,2 P0À 02 P 00 01 00 00 0 00 0|0 0pu0 0Xn0c 0@g0Z ,0`p 0Z0g 0S0^ 0LDi':::::+ $$9 H/ ::$'(j)'_eNa8-0 |0"32C0cPP 1S!0S!0SP~H -0L@P` 00p@P 1;0 8 -L@P 1 0-P@0@@L 00000 -LP\`@0Sp\@0^ 00g0   -8(L`P"x 2l*L@T0 _     qhS: S0-L@ P 0P 101 0 0h8 0hy*: -LHMES, `Ph l0 (ھ0ᲀ0 S0 Nh0 l & l@K`pK!hK 0nPaK hK @0KdP 8\Da [0R 8 8D, 0R(KR0 Bh0 l ͆0?a[ +*%* ?ADPp @P  Y:<$ @ @ 000CSꘛ 4 ț 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 :0 0:0<  P2: < : :P;Uq8[\P2@@O0 h0    h0hKⰀh 0h0 岠h0h0 ,2岐h0 0h0 }040K@@(0K {0 0B@(0K t0 0B@(K i0@ 0B4 K0& LR:00:0:0< 0R:00<0ĕ:0< 0R:00<0L~)8 0v)( ,0S㶃 8 b) ; R  8 S)  0S 㴓 8 tC)01d0"8 D4) i#@::p:X:8::4:': -8(L`P"x l)L@T0 _     qh: -PL @`p8U3>!R 8 U(tUL (jU!1S?!RB듍 ZPP 1 8D  t`10 3k0P8PD "2R:0O  1  0 0@0@<0!0 1Sq<p10q "8   "0% `g(P 0WpP 1<1202T::.':ʚ; - LPDp`0P pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=0h 0 0P0 00@ 8 00 p~H&$$& ' -SLM` 0 ʼ8b(K0L 0  0A 0  V@K0KPK P0SK 0KPP  WpPQ 3Q> Qb 8 \P2  O    0Y$ 2ᲂ $ ڨ K0 K& 58x'  0o'2 R@ 8 c'1  1!Q ʼ89 @pWx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1' '@PU @@P D@T 8^  'PP@101A0@0' :L::&&:|:: 0-8]L@P 0 R 0t0t P00h0X0 qP  x +>8  0h &$&$$Ȳ  : p-CPID@DL`0 #DB@@0 00 R 0\00 0   R 0 0 0 @P?< 00C0p&$& -LM8pş@`h5P, p P5MQ@| 0CQ 0CQ X&pş, 0R(K4Q :4Qpp4 @T  0{S|㨐K˯ 000@TI 0|SE:|pH|  K  KL4K0 6K34K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | pP 긠K  'pPD3 [@T 0S`؀K@T 0`S:pF K K3AB?ᬈPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0d <1d -,0L8l02 0 d <1d0 8d <0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ <`h$pddh\d, Lh$0 R0 R`h < -0L`4Pm 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T N $  T 0pWd>}~@ $ pW /0@W}~ $0P0P@0T o@ : 0-@L 04 00P T0h! -0删S/0 4p 0  0LT4&40Sl  $  0PT  0T  0T  0Tdɾ@T T* 0  T0Se S 8   D x  $ P1 P!0000  T  $P00 0  T  $P00 P00@0S0 0 T !0 T  $P  0T  $0`  T  $Z0P  T  $0@  TZTU000o ,0^ 0 S0 00  0T  $0@  T@0  T0@ 2P |"|Ÿ0 Sj00 Sh QPETD <8 , ᢴPl{ 2 R0  0@*'0@00010 001 RO  tQ 000yTvLDQ000jm}  $x0 r0$ 0440 0S0 r0 @0 0 000 00l`h :$pd\d, : : :( :Th: : :H :d : : : :dWk 0 00 T0S0 A @T " $@  0T 嬐KR #H 2>PP @ 0@ TT F00 T0   B0Tid < N8 -LM#p0`0Q(@E0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@.|0@P0C|0 WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,T)4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, Td <P :1d -LMŸa48@, l ሠpPP(K0 8P`2Wh T2W4 @0CW6 42W I1CWd ;1CWŻP 00#3000000000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000p 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0d <1d]t@yt ktzt lt -8pLW`4@P t0 0@00C S h l 2Ÿ 0i @0TmP 00 T0 T(40 T0 T03 0KSpږ SpGpӌ0Sr p0 Td̷ $ 0Td㿷 $0S 0 T$ $  0T0 T0Sq0 n  0Ti! 0T 0T 0T 0T 0T 0T` $00 pT}| <\h -04Pp008@L `T0 T0  00X  0Td. $Cd%0 T00C S | x x x x x x x x x T 0 T0 - 0T 0T 0T 0T 0T $0 Thl - LA8P4pt0`  0  l0 20 㐰t0  ^t0 0t0 ʱ2000 T<d <1d - (LM (" P4 80 W0qWS [8P@UX ᜱt5% 0 pE   8}PD뀀 0 X t0 1 0傱@(K4  0S' 0v@\ % 5 ťt]+@P t  t0S # 0St@́t0|4 0 0@;K<`$00000090008000604000 0*  :A0 4@` Q ( ( ( ( ( ( ( ( (  |3 x3  @0T03 0KSږ S㇀Gӌ0S 0 Tdµ $ 0Td㵵 $0S ,0 T$ $ 0  0 0 0T0 SL0 00 T $0 1 /-06*tt) 0T 0T 0T 0T 0T 0Tktt0S0   0T000N 8 l0@ *P8 $, 00 TDd < 0d+x < <| <1d@B p-0 00 LR`#ڔ0SP00S PU@ 0@E 0@8P)<TlypP$pd\d, 80$8SH0H0(8$ 0-LMlR@ pt2  B l”p 0\8 0-LMQP 4lB@04 pt2  B l•p @0\84lB@04 pt2  l•p @0\80 0 -0#14S0$0 0A>0 0 R 0 0 0 !1?0P0S0SP-(0#16S,0&,000a>000, R000000 !1?0P(0S(0S,P0 =2S, 0 ,(4 0000 =P  - 0p`L<0@@pЭP4x p-PL@` 8 0 Hph p-PL@ᰭ`p80Hph -LMRp`4`R 0K0S@C  TP,@ 5<*U   0010#Q Y@, Zn, 10"0 0  婮U ,00010# Q#0,0@0S@ ` X00090B,o㙫@PxBo׬hWk : :$0S0$0 0-L@|P0h輬0 I p-LM H`T g X@ 0 8040 05ឬKp 0KIPPPK@   ,0 0 ( (@ ^ 8 -LM408 0<0 =P}<0s<0"00<0<04 @0 ,08@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 4<0, ^0, P<0@ B00p*0 W!`<apP- ,#(0L",A P p4,<0@ 00 <0@ `嵪(08 08p090(Ko(K<0$(Ko!<  (Ko: 0-LPAP@0X0 p-LMH`T ㄪX@0 80$00*ừKp 0KHPPPh@   ,0 0  (0 ^ 8ᜫ -LMP04=Z10  , p8@`P& 0 &$ 170<0@ ,, 00C 00 2`$PL@!008`090a ( -L@CAP 0h -`P(0 SL4p8@jP 00$1l00< @0, 00 00C 00$P202L@0080004 -LM<0 <0, 0@,0<P,0\GFǠ0E0@8 0 4 @4:#:zc>0`P*P S= R; 00  `PP0E  0`"0X$0<\,  008 0PP4P!  0 0R@$PR @(K00C 00 市P`2$<\ -L MP`%8 0+p 0<0 ,8@P, } P $4 0D4 $2 <0 $084 ^080,000   ,K@E,0P , h0440<0@ % t10<@ 0, 0 0 $`0L!,PD10L@0,0,0, ,0 , 02,0, $`ܨ04 08lBpt2  B l—0p \0S <2S  (KP@ TP0 H0 ,! ,(0!80 s2Z P40S`  4P$0U00 W 0SSQ 3N 4 @00b@0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 cY@ 0L0&@~>h0 R8S?X20CX2^$pW@V$0S 4 00lB pt2  B l˜p 0\80S 0 000@G>1@0S800@9>#R08 -$HLT H0S$8>0(8 <e ,@PRD 0-@LPP KPP LQKQG0$,d -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00\@=ឧ, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0KtV8V!0NPPS񟗆!! ! ! ! ! !(! ! ! ! ! ! ! ! ! !h !$ !H!7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL!t! !! ! ! !|! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !h!^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d"F=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( 8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0K^ 0N4S= S* SH(U@1@# H8 C4  0U00U  U0 0 U 0R0* R# R  k U`1 `#@f TP1 P#p@e wT@# qx mP \ J.  Di#  #<<80:<<<4: -L@;P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!(W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m: 0-=2LSP 0z,@0h跤 -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,\C@`XlB pt2  B l•p 0\hD4`\80\89P`z $\(0`0\8r:t:`:D: 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ)C=2 SlBt2p l•p ,4 0S 00h9 -LM@P ` =2S  $K0 40< ?@0(K8pk(P060( 060(202( 0(0 $Lp)(0W   $P(0 S00( 8090lBpt2 l–0p \0S <2S F<2S hP@ (8$0 0 ,!!0/8 $(8 80?P (Kx2|" ,[04P I 090P < 090P0 0@9P02>U 0 .P@0E?01P E 0R904 0 @RJ1?P5@TZ |y8>$3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ mdxAlBpt2 P l— 40p\dfAlBpt2 P l—p 0\@ Ϧl—pt2  l2p ,@ T@P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  "`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\o@lBpt2  l—pH 00\lBpt2  l—,0pL \0@ K@PD@l—`pt2 ` l2pH ,@ T0@T 004 0THPH 孼L lRpt2 ` l—4p1 \lBpt2 P l—p 40\ <:@%I$ < $,d%! -LMl`ppt2 p l2p , H T81S[ l–pt2 p l2p ,lBpt2P p l–0p \@?l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DRlBpt2 p l–p 1\: p-LMP9l• pt2  B l2p ,d B`0 @`0P T <0`2xV0`2xH;:: : : -QLMp` Q Q P>0=2<2l0<2pt2 p x2l– |,00 p\lBpt2 p l–$0p \lBpt2 p $l–0p( \T8SPHT lRpt2 p l–@@0 p\>lRpt2 p l–@0p \lBpt2 p l2p8 ,l–XH pt2Pp  10CxN>C 0Cl–0b "!HQ0p4 \lBpt2 p X8! l–1p@ \lBpt2 p l2pH ,lBPpt2 p l–pH :\lBpt2 p l–P 8p\V>lBpt2 p l–0H p\2D><2 0C<2X(T(P(<2l0<2Ppt2 P l2p ,PHpT lBpt2 P l–0p \2><20C<2l–Pxpt2 P l2p ,l–Tpt2 P l2p4 , Xl–pt2 p l2p ,@lBpt2 p T(l– 00p \%I$ p-T0L@`TP @T :S  @Tplh -04 10@LP  >00x*R90  q@-@p+ P`^ X) 0!"4# 8̓ \0S \0S  R` VPPP \0SX P Pp0: p0C*:p0: _0C*:0p30 P  0 00@-: Q3 @00S)% 0S$+ 4 0R0 40S  40S0l04*lp  >0@  P:TJ00Sp0 Q 0 0Sp0 Q@-Q 9SC!C!xC!HC!C!0@9I ) \ 0@)9I 0@)9I 0@)9I9S f -RL`0  R* Ó \^0\. XIr 0! "4#8<W*9X ",0( 4;2( +>pP % Q 0SS 0QBTX ",0( 4;2( +>$P0"@ 405 6478`:p ?;P L<$+4"2X)540674 8<2X)! 0"#4 8̃ˆX405 6478;P8p 4 ? 4 8\,Q0P , D8K00K0S@P`P`D0 @@ DKB2MP`0 K ii?c`XP 0 S S 0PPR,0( 4;2( @$0" 2"  W? Xz -`Lp@P3@S X)` 0!"4# 8<P T+ " "202 0-X@ 0 9PL)p 009`#R 0 ϭ`p30C! 0-LP@@T0p: -L M0 4 X, 04 8 P ,$0S ,0 S S] SA p0,(Kp0 08< 044 @0 0@, $04``p4 `00p` pX998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@%:\:H: 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0:: 0 -L4 8<S: 0-@LPd 0 0 9@)0h蜚 0-PLOIT R0009 0  凚0 -0@L$.0XP hꜳ!: p-@L`P U 3PS @ XX PppP lQp0p0p0:lp0*R *R lQp0p0p0:lp0 *R*R lQp0p0p0:lp0*R PP Q00090)R P -@L R 0S0S PP  0S00 R0  00lh 0-@PL YU 0)9  @2)>0 9Y   @)2@9 P R0 p-dPL `R@ 0S0S  R  țP00pplh -LXM@ %㸛,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8[,(K@: 0-LP(0U@  0hC::: 0-XILPL @08 H5 0 48 K: i8 -1L M P U( 0 0@K4 mP& p3S' hiV#`V P0 48<S@@T (X JP @ ( 0R$K Xp OhhiTEi8 -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @ w  P0 48Q Q QD H ᣙ0 $ (,   048 < ?  Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   T0 $ (, BM 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPP ni(::8 -LM Xy@W ßd9 "10 0 0 P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00  !" 4#`800 00 (KDh :0X08(40.<:P:t: 0-L@㤔PP 0p90hܕ: -L M4 XYUp, m00a 0 0 /0C 0 B0C` 0 B<0C 0 ` ` `4 !L`9' 040'a)(Ƞ 4 b90 0'4c)!000(0C "#567@0`1`2`03` p4``````````0[40|YU0@ :  p`D PU# 0 (0,@X h )0 8,H 0D$ (0W TPU4 |9S  0`4p0S0 @49I)(KV`p(`0@S 0 @ 0-!PQ* * * @Lp*tlJ`J\JXJdJhJxJ|JJ! CU cU U 0U U UN0000] 0)000W!x!$A!LW!A!V! U!L! -`PL+ d:pS PŖX P\ PhIT PP嵖㲖U@1S10 #h袖 -pQL @T `0T`SPP }0` {`d㆖U@00hWk p-@PLPC 9`S*U440P:?l9S  p9S 0 3 1C#PQ T PgxphT090 D 9SU X 0jxp:<: 0-L@PPP@ U0 -Lp`@PP U 3+S @ X pP10P h:S  -|ILT p@T `hP P  0<% @pTW m:h - L0410S`Ub t9S X)p $:S90,0hx@uh0pS s R000<0 0 8Pᨓt0808 0< 0P`00%SI 5S@ 8(S *SP*M04,0 S S SP PS S SPS S SPPP{ \<::h: p-n `PLJT lQp0p0p0:lp L:0L:p -Lp`ӑh0@S ' R000<0 0 X8PNt+ @80P<08PpޓlP:lp0*`L:0CL:h输: -@PL YU y@ Lz < ,0 W :*Z ZZ ``@WtP<0S8<0F --LM K00,< 02 K -L@PP U 3S @ X pr`P10P X9 t ` `` : - 1LM` pP( @`0o/K\@yP ( 0R)$K_K 1 S h 0$0K 0RSJ/K 0``p` @p@`pW`p$VhWkiedA:8 -@L`p  PAPX v d)R_ 6|) R 9 Rd9"100PV| P Q0|9  0S00Q| | V#ڀ9PP 0 S0 S RQ  PU | 9PPU|| P 9 P2T!   ѓP\ (<:: --LM K00,< 0|1 K --LM K00,< 0l1 K 0-00LS@P HOD0  -`PE⣣P P0$,dLEi -LMS8# 0 ,K dP`XI 0ؐK:0 . d0h0 0, 0 0 P` Lp 00 H D P P P l0 0l00 .z @0 + 0 S ?04X@ `p XP1X#\ 1  ,?04X@@,PWas(K 00P@K00@@hWk\:4: -L,M00p@P,0 P U@ 3S X +np P10Z@t, 0RV(K4K4@TG@TD  PPP; (08 @4K P2 4K@ X)04 8D \<0P@P0hP-Xɚ! 0"#48 8<S8 048<0###,  0 P@0 D0h X@)H@8@( @i\Ei:(8:::: 0-RL0 0h 0$: 0-L M@P90K0 p-d9PSL p  y|I`T X u>p\m@T \ 0PP: 0-L Mɠ@P 00K0 -L(M0P ,0 P0 0 L0 B`P <K@P|yW H D @ \q P 0P048 L2 $(T\= pWH0SZ  @Qx P|9St \pq $0( 4L8T\r P 9 X WW \q0x pP 0P L1U% $0&'48 0S> X)0,0 p h0? Q@ @8 R 0 S@RlQQ 8 R 0 S@RlQeT 0 ߺxY,h 0(Ko褏0S*4P@᷏ <],\ $P2"0CR202 0S00"})::<::V -LMe\pK 0, PP P  dS@, 0R(K  8G@,w}Ki_@P ;@U 0rP G\P@ 0 r<\.K0@ZsP 1 S  t02(K (RQ 0 @ 0r\W/K 4"  @  ! 2  "<K@K  ! b 㳍 \1`02 hAK"00B@(,"042 ,B<K8 H0 F@X@ ㄍm0a 0 0 0 /0C B0 0C B0 <K     = Bd1#4!2 1",,(##Ƞ0702>? ;90: =!"#0123456![8 1[ <0@!1H0!X t&XdɀɀL h  " 2|9P"OP"R' 0S0202#@X P㼌Z 㷌t  Q 㬌@ ‰iT:L:h8h:hWkedA:::::: : 0-H1L PR "R6 0 P0 CT\T R R R 00|)R \0S\0P Rt0 0hB0h9 pgP X)p 0::: -L8M0pXK@`P 0( dɔ\048 L1 $(T\ j( 0Rc$K"1   P dTX1U8@K `0` aP 0 4 8,R* R R 00+04 80 0 @00 @ @ @Xh 04 8,P00 $3imarc :<:CRAMD:(::t8 -LPvM0,0 ! %((0"4#2r 40 $ yK]P p01 \ß, 0R(KDß@ 0pP Y.K0pPaŸ 0p@PY1 S  》`P  zP !>KdIA 1 .K<Q pa 0S0$0 $yK! \PNŸ 0>pPC0 @PK048 1 $(Y !0 /plYd 0&pcYtP|L1ZL K 0 0P 0$  0 pFY*ҊVQ ͊M0A  (@ 100 $0@i:hWkedA marc8CRAM:$:p:: -LM0  80 忊pd "10!P040 Q|iV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`VPY K0(K0U \ 0P,\ \ n0\0 4 ^. 8dX Z0,0 000 =;`< ` \$ L`?( \P#0@P0X30(PC0:9@8d >@=P;`p;`Č?@ȌP304p(3PC 8ظH TPH00X0LT"R B 0SP0TL202,#L R,# h8<# K㮸0s 0h0  CR @C00D  0@ QHX( 8_80L@K0C80(3T 0&(T 0`@(@1 0rH3 & 0l @P @Dl3 0|Sl: $X( ' 0@!r(@01 0H3 0H#0(#0@ P嚀p`Č$@D3Ȍ( ($X(  80R TC  9TK0@4@1 6K` p dT< # 2KT>><# <# LZ]8cH@LpT $PPф΄U@Ȅ`W0P @$PP㺄U@$CT $PP㬄U@4Q4C 4#@ោT@3S 㗄DCT 㑄T, 0<R;(K03S(3    P((0h0 $X( l 0SC*Q0ST@c Dc 83S @`$?(<L  %P\ X A P , 0RZ(KL@K ޶X0X #?`@p嬁 ČɯȌ9 0:`8̌Pp弑 帡 ;币崡 嬡T/ᣀX 0OOl 堁  p㤜jOK0 0OS! 1 jK\~K<@  ! !sc ʃ|qK  ̑ ȡ sKPQ a   ! X! ڌ1!1d Z*AY& @ QUKjKpWP`P`B2MP`j/K Mc0`Ap Qod p p CXQ 1 \0Ku 1 KӠKPKpKDP1`@HL!TQdqрK吁ڐKKРKKK K0KPKq 0@0 0少@P004~Pl@!A:lp0q*@P 됁 00|$V됑 0 rXoX밡40QX)...̠%H%%<0@4[堐0[夠X9 @壀妠᧐Č Ȍ89p:`< =P p ;>@l ?$(Yx t .K ^KpWP`P`B2MP`^/K Lc@`hQ,q刁0T0W Z  0 PVhA A9S@ OKp`P0PU`p80<@X)]0\^_ |94:X:L0 t: 0 0)000 `:\*(0( X:d* 0 :p*d!!!!!!h!@-X)@ 0!"#48 <9 p-`LP@h0S  R000<0 0 n8P 808  <0 P4@Tp (&`:|: -@P`Lpz00  (00(00q0  p$00 Q$ * m{ ,00 0,0$0Q$:(0Q8 0(0,0 :SEl0SB Tl Rp0p0p0:l p0 4P (0SYl 0R0p0p0:4p0p0l 4 ' 0  <l9S L:Sg0  0,00,0 0) 0 0S :P h0S 808  <0 P0 0.Py*4 ws::::: -LM0Kh#P`X)0K0P 48<@0 , 0 00080  PP 00@0"0000 0 0*0 00K0@$ < $080$ 2@ 4H p, 嬀0  )XI`< 4 !0 "# 00< `1X R';(K) 0X R02S ! 0"4#84 <S 4 02II 00 0090  \0D0) 0` l00l0 h0SC <00< P<80Y|dy 0@ 0S S PzX9 !"#$ ( P8 0ZA 00900 000C00X)p ( :!hWk:: : 0-L MXI! 0Y"4#8 0 K00SPڀɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> Ux!!!!!x!\0<' \Ɏ$ K0\0<&p 0*\0<\0< p 0,L 0  ::!( : -LMP@`x)q0X@T) T !`!!p!!!!V V y)0X)p 0PV0X`t0p9 0 T 壴 Kiy0FSV ViV V:Ha! -@PL ;k -@PL P P M-L0Rp`d KT &X9%:&,%%̠&&H? 9;=>@8P<`쉇@ :d :X0 t:)0H 0 09`*808 \:X*000 d:x*(0( :p*@ XBd K QHQPC@K`pK X9T P lK H0TKXY( hd d K D| x 0S @d K P 0Dd K x R0 S\ X0   |K| x  T@K0 PE06NPU>E DKT p t0##8 K 0 )|0{1 X Rz P N(KL XLKX0S `P D Tˠ| 0 p`/P\ 0 `"PD| 0 P `\ 0 PL0K0S @L0 H@ 0w @K0@ P@ P DPPDP p t 0 ##wdK\ X S026 |KD `\`p| ^ 0  DPc` `WdV| ^ 0x\AG  D@|0 @P >NP v 8|R.t됀PX 0 0@ 00l 4l*p :嘀  0 0S S PzJu :: : : -LMP@`s9q0X@T( T d!!t!!t!t!!V V $u)0X)p 0\P7VX`t0p9 0 $  KiuV!:Ha! -@PL  0-@PL P 0PPX9\] ^_  p 00 M-RLP0`p/0S/  X)p0^0_p\p]pX PE] \0^4_ 8<40c@o  1.#@$,#Ƞ#$T$h? 9:;=P>`80<@K T@!:8!:@-00 0 9 0@ QT8XH808 `:40*\:, ,0X*d:$ $0h*|:@"d!! "0!"X!-0 4 8<S, -LMp!(KP@P W0 0(0 KX)04 8<0@(K ( $ PK X!=00 (0K0@$ < $080$ @ 0 1000 00 0 pH p04p P, p90  \0D0)0` l00l0ph0S! p<00< <r`0P s00900 H X)p  L!:d!hWk:H!: -800 P`p@8`Lt`(  (0@(@ht p-`0P(0h LR 8@T P@Tl9S L:S pphn\!: 0-4 (08PS 0L,0Mr@s0 p-(04`SL8P 0 , 9r@{sph p-`PLF 0P p0_uTTXp4 ^Pw0@pPqP7t$@T R000(0 0 <P0 R 40800咠.u$@Tt pqp! -2L@P 2S P P :u"`卪pP P t0S0 (  R,(!00P2  -LM4 0@00 ,@ 8 P4s$\ R000(0 0 @ s@0 0$00   0 00 S Se S $04 4cQ00S4 0088 0 ,"?P1SAO.!0 T8XH0@0 0s $0000$00 00 8PU p$ 0 0  ,0 < $<(<SO S 0 080 (K400  0K@ 勧00K0 @00 ,@ 4P@U^ p 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(D#Lp4 0 , j<00< 0 $ @ @0@ SV 08<04@00 ,@ M0sm 0480@00 ,@ >0 40804rt!: -@P`Lpp00 C ,00,0$00 Q$0(0Q00,0,0 :S)l0S& Tl Rp0p0p0:l p0 4Q l 0R0p0p0:4p0p0l 40  ,Q  oq  (00(00q0  p`P 00D < `4p@0ʟvq :!:!:!: 0- L0 y@P@ 0 <0<0pP0娟P00@(@Pq00h! -LrM#P@L K 0`, A A  PPppzKDPLs@ 08XP$.K0XP1 S02(K01SSx  3s 0@P- Lp`AT !PrrU@@V@Y rP00S 0"0 XAA, 0R}(K 0pPp`405 6478<sc r\`!0p@0@` \  y/KATS @T, 0 48<S ťL Kp`  㷥L Kp`L K`z`x@p`rL Ktp`j0 W@ p``L K0`Z$׫ihWkedA$:!:T:!::":8 0-L,0\@00P q P0 X) 0!"#4 8<90 P 02 Q " RP0#2 -LrMt% 0L K@, PPFyKrCPP$e 0 WP U@@T $0 WI@L K,, 0 R(K.K0YWP 1 S L K\@ 0V@@L K$02(K01SS L K@ q\@1@P`0LK hX@PX)LK5406748 <00@4P!(@,P CX  8⭤H0  ]1X0 q@m0a 0 0 0 /0C B0 0C B0 @p X = BzP0407 P!@! " # 00123568 9 : ; < = > ?  "2H%0"X  Jq48Xy01`d99  hɆ9q   |#0 -q @ 8'q00!   08   Bh90X)h)(0*+48 <0# #Ġ#+)*(0PY pV@ Ppp@W p\<L KPZ pihWk!:edA:T:!::: ":: 8: -LFM@`KO_Kp@1 , @K弣㹣\ᶣz  ɯ@! į Ꭿyv\s, 0R(Ki88 -LzM@`TpP@K zX K肏K,frPU @ @rrU@ -LM ,( h9i)Pj 4k8|WN@ P`?< L#?1SDOpP3400  D0 `P P0U|r pTXpr ^PZ0@pPq]@8& p 0^0>' K^0> ^0>p 0H@T `9`X Tt ::":":": -LMP@p000 `,h, 00v㸐,0V0,0 P H< P H< 0 Mk0m$00 Q$<:(0Q= X0(0,0 :Scl0S` Ul Rp0p0p0:l p0 4P (0S{l 0R0p0p0:4p0p0l 4P4L C 0  [l9S L:SR ,(Ko i0 700 ;0,00,0 0F 0 0–@,(00(00q0A  p0 H< 0H000  X$ =00  808  <0 Pᅖ0 0ဖn=4RA00 : :::: - 0L0 0l0*lp :8@T  @T -LM00K0 @|.@ PeP`X9`]!\ Pp"@^ $#_` p( Tp $Z 0`KP 90@Q0@G 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQP$5봀`X9pPKK l h lK KQ t p p(` ̂Y ʄ K I5H K  B58KX 80K0 @ P Uʶ 0K@  Yʦ 0K@  P l0K EP6NU>E ;|0 x B X \@0##@`KDp WGڴ 0 0 @ 1X R02 X 0S `V  @D  RO P R $ `Pp)90 KTt zD^-`@P\p | K ` X t@K00TPˠ ppPpPDp@_W dKt0KQ d `  PK`P`P ` T``T` H0SP  tPP tP } 8@/pPvTt 0Tt | K pKt`Kp @pP5PYt`K| K p @p#PGt`K| K p @pPP6tKT  | K  P#t0K| K @`@  pPtK| K P pPY Yh  ?(KY@ 0SPU@ `VpW@^3 X"Y .dQwdKt p rX \P0##@@P P@ P wH\ @  t`K| K Tp pH\@  ?P I0X]T^LCK:@0 pt T(tPK`| K `T`ˠ  @@`pBPfD\`0@X) R+ \. ; 0 t K T0C0| K  P@`DP0OUʓH\XY RPU \^K0@0 @$ t pT幚t@K0| K T`0` [` P`P Pt@K00| K TP `PpPD`VL`0@X- ^/ Q2 PU5 ; 0 t K T0A0o| K   P`DP0OUH\ XY ^P Q R PU\HPH\H^'cpPW 0 0@ 00l 4崀l*p :帠 0 0S S P dg":D#:@#:L#:ph :":#: -LMP@`c9q0X@T( T &"&"0&"`&"0&"0&"`&"V V d)0X)p 0\PVX`t0p9 0 $ 吟 KidV!:Ha! -@PL 4d 0-@PL P 0PPX9\] ^_  p 00 M-RLp01 X)0^0_\]X PG] \0^_4 8<40c@o  1.p@Wp3$,##Ƞ#$T$h? 9:;=P>`80<@y$Kt#:<0 : 0 0) 0 `:\*0 X:d**"/"("/"t/"") -L MP`pb, 00 E ,00,0$00 0S$00:(0S1(0,0 :SHl0SE Ul Rp0p0p0:l p0 4Q l 0R0p0p0:4p0p0l 4l9S L:S% ,(Koc0,04@ l@(00(00q0  p $f  ::: -L &X y908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8<  29#:#: -LM  0eT#4" -LM) 0ueT#4" -eL`Pp< (00p04S80,0d0804p 00 , 0@07< ww&((0"4#220$00 (O 0i薲`<#:#:WEV4" -P L d&@ ዤpP` |1TI p1T) *`9P1T* H1Te/㓞`(10S ` 0 ᇨ`P @`P0T$ v0 00" 0`0 elc@ 0ce/h.c 0V 4,0( ʱ`xdrdAhdsd edAk~gd4" -DL!88#!P1 .p" D0020p(P00`4Q!<00@aT@!0   H<00d@0_@ l` o蜞0 <+0400 @_@ [o`H xd`PPg 0@^SD喺 0H@K 0p SpP  }G   t>  0@^SiP2p/-t b l\h0`*`l0QP8di (::h(: (:0(:DF;(:8(:((:B%':h8 0-0LSP@t   0hx d -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P D P hhhhhh@(:T(: -L@P P hP  \4dP 00c0XT(: p-LM`KP Kp @@X0 0@ PPP PS@ P# K`P T 0S T U  # T$T  0 4T ) 800T(:d(: p-LM`KPKpD0@S@ PK T00  00b0 0 40@S@P 00T(: p-LM`KPKp0@S@ PK RT002320 0 0@S@ P4 R$ 00T(:t(: 00Cs0 -(0L @Rh^ቒQd -@`LpP 0 @0 SR0 ӧ P R @ 0a0CSa0Q-S   RD徸@T 0a_S@ Th诸808(:(: -L(M 0sS  P `PLKV>  T a0@S( K$ \R0S  0S0SQ+0@a$0Lv U TA00 01 m(KP0SJ }1 ^` "t!0S PPBXaTU Up0K0 0@ =00cP H 0 3,U`$0S@  @ 0a0CS0@SV P0P000 R  a0BS(0K +00B R0:S 0:S_0PE$0L000C SP0 \Yhh(:pd^" 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0hh p-@@@`08PcL0`000phhh 0-@QLPJn @TZ0 0@-L@~S~f"g"Df"Lg"xg"g"Df"g"Df"h"h"Df"h"i"Df"4j"Df"h"Df"8i"i"Df"i"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"Df"g"xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @J hhhh8d@d<dh4d(:h -P@L@PpP`P0P @D@PPP P  00`hhhh0 00 hhh4 P00 0 Q4#5Ddhh0Dd0Hd -L 000HdDd -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070T0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8M0J0hSp P@>\P_P 0?SCq"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"@r"8r"0r"(r" r"q"q"r"r"r"r"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q"q">P D +@<P*@.P @  ddh(:hh(:(:(: P 00Hd -(@xL0P 00@ hhh0Ld p-LMPP`V Dxh跳@8@峳0 ,$0媳`xd(:):A%:8): -SLM@ 00S S h0Pd  0^0?l 0F000 P  0 P ddp):x):P):X):`):h):0 0 `R嗳`dLd: -造倀`LpVl0@EWV@@ HT0fp`Vp =`TdLdXd -1L `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@@T cP: qP8 PP@ 0P0C0(APU @0 0 S 000P@ߌ00CR 0  0P0X 0000@0 (0 h\dPd):):Ld`dTdXd -DL4M088 S, 2PLKHpKPKTK ` 0L @@ β L (TQ 0P PL0P 庲P R嵲d P0Sl0HH, 0R (K0@,坲$屋PdiOd):d):: Vk):<8r<0  4 40pQ 0hhhhh40,0, @pQ0 hhhh<04 40pQ@ 0hhhhh cR(0$0] B   0 0hhh -8@LP }00@P v00ldhd 0-H@LP  Q 2l 6S Q X0X 0S 2H 8S T p$0l00ldhd 0S00h -pL0@SSHP S 0S i w`0 Q00 2| 6S Q e0000SXP 0  i;ithh -PL`eHpj@P8 00CS0 @TR]@0S S' S: SJ 0S 00J 0 00C0 4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8Jz,F 0Q/ 2 8S* 0 RT T U 0Q 2 8S0"00 CR@@DTG` U\ 000D 00CS0u hldhdhh)::h):hS; -L\  h - 0L0S h -L\  h -鄐@L0Mp`0 ,0 P \ ,0K ,0SP11@5@T00 P(Khpd -L\h -LM@PP` \p 0KPV 00@0)V 00h 0-t0LM R8K L@PD0T 0S@ xP UP 8dpdd -LM @K< 0S0B :00A0 R 0 dd -LM$\  h -LM$@0 0h -L\  h-0   h -0L0Sh -L1L`MD0 PP(0 `pl KtKx KHtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$廈did4];):):L8 p-L@P`P 0S ppp3p - LR`P; R :R0p0E@2S P @T:00E` RZ p|0"P@0pS@ hP WPT:00E0Pppd):h -LM@ 0P  K -LM PR@ ` R :R0p0F@2S .P$ @T:00FP RZ `0P , 0"@P0`Sh \0 KV@P(KT:00F`0 , pd):*:8" -`pL`@2 RP P @T$h0 pd*: 0-LX@PP " 0 S0 00 堮0pd@*: -Lp`PU0FS to苮@0@S S P 0@S opl*:d*: - 0L@ h2TT p0\ dpPb`\ 0 40WP$p$00hhk<&:p*:dht*: 0-LAPMKQ0!0P 0Q#0S$H0@0Q0 R0 R Pd00K0ld0S P D08 Vkeih*:hQd ei*:+:*:*:B%:: -0LS 0 -L\    00R0 0 0  p-L`P dpP0S @0 @SlP@pTPT0S@0 @S P@pd+:ddhPdOd -LMtPl.KP l PL@KzP dP0K d+:-:x+: -LM KP K K -LM@KP b 00(d0  d 0-dPL0ST0@T . . ,0@T 000 d,dlZk -L@L0S <@T ( a @Th,d+:+:+:L0 P 0S0R:0S00,d<$: -H L@T00 ((0 R 00@Ӭ(d$dhh+: p-`@LPP P 0S 0RHph跬P 00@0 00 pph觬,d`$: d,: 0-LM@KPPP8 -L,MD @, 0hS ?lSC /pLK@# HPK@ x` 0@PiL 0P`L p@ ZPTl h0h hp, 0R (KS bS Ti,:B%,,:4,:<,:hhX8 p-QLM@P00CSꈒ"""ܒ""$"P"l"a0K0, pP0S 0S0Kp-| pd pL p4 p1 R= p0 R p kp0S 0 R 0 0Q ,0 t00S  0 pPH00 0Sh`/ddd`d\dXd i/d0dhWkdWk -T0LPD00S 4 40àL4ddWk\d -X0LPp@0P 40à$ L  4ddWk\d -h0LPp 40#D"B ,0S 0P 4d\ddWk -$0L0S dWk 0-LPL0@S P0 T0  0dWk 0-`0L @R PHD0`P |0 0@P0@  _8 phu0 0@0@p -L M5=@S (K,@  1 0R! ,0  10C11 DP  O_:> Ø10C4\`   p,:Π0矠 ("(<W!<3P 0  0("?008#8S0O4C08S00`?p 0` 30D#T 0` 1 60C00T#T0X#T'4\#T 0` 30D#T 008#8R0 0 90/0Q% 00Cs B^ AT \@< p0 P0U P0t`p@Tn!, 10C1N5;5;啧,: -ML 34c, :.0038@ :.B0@ 30 D#T0@   3 |#T l#0T p#0T3 0 t#T0 x#T3SB0 P#T0 H#T L#3T #0T@ `#0T @ 0 3A0 D#T @ 0 p P @H#2 TXP@84PK4@d#0@ TTp! 0 08#800`#@DT  0@ 30 D#T  0@ 9#  00 t#T0 x#T3S   0@ 3 D#0T9@0;9>T, 0R(K |#H0T5 h#0TJ~ih8 -LM4S8s@` @0 30D#T@ 0 D@@T (H`#$ 3S -PL@p`Ah1T. 0CT  08Cs@4T5@,@C 1T 1T0/tw@@P505 0S %A0@S S  |wB4@Dp8yw@Po5@05Ji 5i 6i( 0-L@AP]Q0hB -L M48p@  0@ 3B0 D#T0  @ `#$ , K 1+[[P35#5000b00a 0a0 " 2 0 B S 0B $ RG`A0SC_0S? B("(+[ 0A1P07P#0C220 T00 R 0×  b$\0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝh h$h81s s080 080Pd`d; 0: 0Pკ@-44 0@0 0 @* @@}hpd<8 -LM   0y hx"lh -LpPL@? 0}, `0P`P`h?tdpdh 0-PPLM?K< }40 0@0@?8tdpdh P0-LP `z@Tz00 -LM~?00p̠`0@hP \hl 堀0,0 ( @P?,K\^? P@P\0 0S@0%050%\8?$Kw<dhLdHdhhh -#LM0pŸ @ 00, :Bp PP'? 00 0bC2S0c0S U 2@xP x| T>(K`0D"\B"\ s \p 00,0&:#0 1 1b 8 4 @ `P`P`P`}p=8K !\!PP``dq儁$A00SA > 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUh> 0XXfP0@pP pt 0KhoEJvhh<dHdLdhh -LlM蠟0P`(0 %UpK8K pK8K*rAC*EU@1@#F r0dPU`<^X[X( 0R$K xid$h8 -pLM0lK @,0 P1 ^_KD0 0# 0Q >!$0S:  @0|[KJ=@  { S|= Ar0p P`<p@ P`x P$`p = @` @, 0R (K^_Kn 0Sgxihtdhpd8 -LP`p  >PP  P@1J# :YpP  00 RA?P PpX 㯸>zyV -p0LP \0R E@ <s00 hs !@Fia0,"lhh" -LRMh@0T`$0 $ 0RM K  > TpP1Q$  Q@1J#U YK @f{ X@P UJ9>X X@PQU@ YK@`3ydPKYOK@D@?@ zX{@ Pwi8C-0 pR 00P`U%  p00 N @ l3)^Q<0PU hl 0> n1 ^2R P R 8 - Ql08! j00Re R0O4P`P` 4P8`Wl004PXP X< <p* K<0PlD"[0R <X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0PK0K |K0P h `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@lL4 K0T0}@0TV ^< t"D06040H0D 0  H0t0PD@0 :@^^ `P`p4P8`2@8P 8< d UL0.S#%@DP@ L T pX :LnPH;8jHt STN8jt0< t"D060<t X@L0T04 K@P>V UF40H0d1@0P 04 O0tt H y\@ @p0plLP! Pl0*0 04PXP 4h 0K 0Pw h0Sl* ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KP0 H00@PQ -L4M  $0 0<0 @K;   1KB Kd -L4M0@ $ @K <0 3 Kd 0-L M(0@ P b$pg!0S(0 K0S   00 p $ (0!I(0 L: F p-0L@`P5 Pk00 x |00  000p0P x0P 000pPlk00 x |0 3.Px(P 0-@LPW 0h(,-: p-0L4M"`@l1Ph sP 01`l1D jP <LK( 0P H0 t  KpD-:d 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 d d p-0LS@P p R R`d P0 <0p`8 P0 S P X-:L-:d-:0 <#<0@0  p-0L@ S """"0""""""""""""""""""""""""""""D" 嘗"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ Tj$0V0$0000pp-:L:ii -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\h""p"""""""""""""""""""""""""""""""h@`T  i 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`֖p@`d0\@`0pd `㸐 b@` pd@L:-:ii0@- 0P840 0,pdhWk( i@dih.:.:.:txi -LM@ pPD@`00@<000 ) ;<00 8 0@  QP H@P 0S S 0P@`UVP00 ;0000 $B Q0BP( ^8 Z 0^07<@`0@p P:0p0`007\0 (Piᾋp 0 , o,O PT.:WEV D0s 0s0s(0s 00s 0s0s 0P0" 0s 0PE00CSp######p## 00 <0 000 d1S  0%000 ;00@- - L.: -LMPp00匀0CS<0S q x ` 0D0,  K0S@0@G`P0s<Hb@`:,@|-`004`;00-,@o-剐.:0@ p-0 @j- -L@ -L@ -L MH@Pd1S p K0 C1 0(K pP (( H 00S@ 0S0 S%*70" K.P 0S0  R*a(p(0S0 S*[ `Ip<L"[00b0"[000"[00b0vi -Lpp0`0@ SP:@#R D3S PD300C@#D3 )IP4S8c. p-LP\ 2=SL` ` R1 CRR6 1S0S&000/V0 ?! 3CCap?! 3$CB9apB2. +P0S / P [P -LM0@00 !@K -L0ML @00@ 0 D0 H -@A@BAH p0#L@0S40 80 @3 H 0#280 -4 @8 D#0<3H0P`(S,cH0438CD0h @ <0 <@T'# d1PS L0 R UD38@0c0L40 00P:H?0 @L0 <30n-(K@Q  0@@ 0P0K0D~Pl00H @PT  0@_`/PP``(S,c Tk0Xg !0T"b0`L0 04020O (,#d1S& O,Q!0S< ST d1!S000 *0K  p 2[2d!R!P_`e!N0* K *0[S2 / P PPPW !/ !/ PB0K D0PP_`)4,@02!/ ,CRqL: -LP 0 00]>P0 hU> -<1LM4@pK(1pP@!, @F#00B`@ dt]W, K ^P , 0R'(KD| K0x t |@ PIK ;Pd| K0|@ x t Pp P000 ci.:.:08 -LpM40Q|,0   PKA ]`dA$0h 0 @ 1|0 !x 04 t 0 4p 0F l 0 0S0h0 4 h @ 0d 0LK0`0 0\0  0X0 0T 0P w h  K1 P0`P , 0Rn(K01 P0K0 @=10 @ Q0`K PK` ` ؀ Ȁ 0 P \`P0S` 0!00  K 0 j=`P000 a=`P 0!  0V=`P 0! 0100 嘀K  P`P@00TP T   P0P@T P`bi.:D8 -"LXM"d0K, d p'PP pB, 0R](Kd0h Kd PP`@K4 ;\ ,d`4[ 0RKYPKXPKHP @P    00000 n04 8 h X T*"!Bp2P@@00 Y ~400 00 X T*00"!B2P@ hY@0 b4 00   0 <.>, 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y 400 00< 0S0c<0la0 , Nc@_@[@bW@y7#6#6# -L0M 0 ) K0 3SP`%PP!10C8S1< R (KBB ''  0@{P &01 1\$ @pL 0 Sm*  0YPbp\ @0SY SLPL L 1S D L0SYE SD l3 410  0 D3FP 03\ @)pKp 00K \PP)0[002Sa0H @<0 80  pQ QH  Q 2pSO0 @<0 80 QYx P}tDP( L T{ L 0@  c4 8K@ &HD 00" 0D00) [ 008D1 %0 F80!1{80! 1w !10>0>0 1!D4 8K 00b>01 ! ^x 0L0lQ@ DA@ā P(0K!    h 1t>00>0 Sa2Q>222>303h0 5X) 0! 1 1 hKP Ph DA! h0\ . 0C0b!0@@DA  ! 1Sʴ#[R@@Ё R @8l h Q\)  0 cd hKlK d0KH\:h0\d%* d b 00b$1#[0d0 hdA  d   P KSil8 -LHM@aD1V@$0 p 8Q$K 0P tP b${ KY${>0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 9Zvi -L@P @1S<@ -L$M (18 @ `@ 0SX P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S% T L  0L0  T LL @T TT D H 0;00 0 40  8  0 0  f ,*%,K.p,%W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 #?< #0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 `P0@ `  0` `P0S   . . 0`(` -LM @R`@" 0:#:S%0:#:S z'zW Y&P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?!00P0 -0LS`P pP2C@0 0 000 R00P0SPp p-@P00L? @!"`!BT 0P?!`p p-1!1!0@ 00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp6#W0MhWk0hWk -0LHM,0 0@ L0 T0$ ( TK BP T0 NP P $儁 K倁@.:0/:/: -L8MA 0R<0 0 !M0S $0` a1(K *0!@0P0 `xPW ,0hx0PUL +0@c 00 W0`Cp0K 8@ 0p VX.@F 8KV80 PKD KP0 L@ Hp P% P  PU 0- ,04 KJ 0@cs 4K3K2K00 V<@ `F<K V(K,($ށ iP/: d/:i/:/:\/: -P6PL<hWk ii|8\: ii i ii id/:0p0p1J70p0p 0-PL@@ 0@&0 p-`@LP/ 0ph 0-PL@  0 @0 - L M, @, T4 Qb0epP , ,0 S@0P 4`  "100 0c4 0 @X 0eP00e0 0p,40 0b0(K<8 p-LM 00tt0@T P0 S `D0 K0S@Tx*d<i*d0: -LM`@p0S PP0 J0Sp@000 0hm0: p-L` 00 ;4 00I@EPPp 0-LM@ 0P00xZ0S h0XX J0SD R00 0S008h*<i*d0:*d 0-QLM@P%21C @P l@l 0S \0LL J0S8 ,00P8B~@~<8<i*d0:*d0:0: p-@LTP00U00S p0Tʄ 41Cc00CWPpH0`WTp 0@@Vc<< p-\0LM`PP0PHH0@^ ,0K(P $@ ,` 9Kp0p `@a@巵 @0 @P0` P @6 (K U@堵>0`0`,K@0 @P0` P 4,G0, .Id -LMp4 8 @P 8K` IBP*840 @10@0!0P,0 P@8 ,K ,xCP8 0,0 B0R,0 P8  "BP'00K@ (K4K  BP`@Z`J,K ,PCP0 ,0@T0P,0 ` J AP'00K  AP -L M"0(0, `PP 0pWx W P8:c 8(K0  0PPL0$0! 0@;00 0 PP1 I 0  0PP O@0 Pp0 ,K +PP:, 0h0b 0 RP/Pq@ P41<  T T (1#29P0 pS00S 0S T P P @ 0S* P80  0 08`bwPT$1 !SP#P3R0! $0S UcPaDvi<d$d -LM0X T2 0\" 0 P2 pP (KTTJ,` 㳺X"c0? 0 @ lp hp p d 1 ʟ8" 0K < 02 ," ">K K Kq 4r q q (r $2 Q%bP P" 0@\b(L'1<? `U  RLB LBP0S 00S00?  R? 101 0,1 ', X2PU Hr , R 0 AHPH 00@`d,K 0` ?P00KP p?W8pGHr LW0S | ! 0H"0 00010L00a0 !0S00 pr 1  !81 P p041 K>0#6`001t0,!0. "&h0d 1>0#6l0(!x $1|0P00H"1cL@KD2 @ H  KL2 $P = ?`P0 % Q[aP \TaP" 0@5L'g<?  `ㇹp?Ppp 00C { FO @ ;#,a<T0S0# X00 <T2C 40T"0P@u@1`1ET,00 Q0Q `50  P`:0 00 0  T",0Y#L'\` 0P"@TT2( ,0S KP D"\2 K ( PsT,0  >!<?G 01S# L R  S  1 3  1S30D 0R K  101`ٸ p  T2@F?T0000000000000`8婸0P@0  0 000 0 00,f 040 P4  X,; V`㎸T",≸T244 0Q90Q6`{5< K4K X@@Ph18K5P& 0$ 8 P'h8 <00<040@4 408 40$ 4(00(04  00CS 04 <4 y, <4 o8aidQdvi+d6d0ST0  Q 0(0 R 0 0 0 $ R0 0$0 0$i 0-,0LP@9  R 0 0 0 ,   R 0 0 0  0E P`10CS`1LP*0Ph_w0P_D_@ 00C00_, 00C00[ \iiti(+di,+d -,0LP@`DPL L00$S$0#L0[/00tPiy pP ,㟷Dr(Qi3  -LM0pS00  b  $@T 40Q 0 r @Ti P,q! (0S00S1`Vb ,0; S V5   ,O400Qj 1(K0  =0,  (00S000S 1X,0,!400\R 0[/0(K400  t=,0   ,400Q/ [? (K$   Z=^& 00% 3P{ 400Q [? (K  A=P Q PH 9=P  @ h1: 0-@L8 4P,0S80 80<0@  o51 ^P0SPG I]PB@ R 0T 0000|0S   ~P  Rp1:1:ii4j1:\i -L  -0LM @R Q K00  ;P  } 8,d -L@P PD0 R 40S 00S 0S  Ri -L@p] 0`0 0P( 0$ pp@`Q}8t |8s] 00s80F0 00000<:h 8:R\ 4:,P00,0 0S `,㼴`tii$LT#@T# 0 ,hWk -0L, @ h -L8MP+D H0  |8 R[ = S (K = S  D8Dx` @V@0AS00S 6P# e#QD0\077 0AS00S- 6P%0#0C0ǟ7'@h0*L@ 00NP0 . 4 0 B0C 0 $eQƟ00 T  0p0QP~  0 B0C#0 \D 010[?R`(,k ,   00 @``1 0`1@~7EE8 }7\ O9,0 F;@0  ,,ܳP7 <  ,ͳ,ʳ@ ,ųL0 L0& +$DQM,01H0S  R5 \0 8 H0L   呸4   d0l 000,0  4 R|t p4&70CcNP @ğ0S (4&70Cc 3 R04 0 s 4 `180S!80<00 0a40 0D10Q<0/0S0 00$ 0R00 0,0  $ @ $@ 04 QD   4 R LL0L DL 400L 4000S 40(K=9 =0  h9P  PD\w1C? 0@1000sQY *AD R( 4!<08S000000\000Q`< R@0S ,0 8\ 2 D40|!Q  0 & P!0/,0    d0l 000S$ @  000 * tp d  d0l 0008,d <,+de0+d%:<(+deIdIdj1:i0ÃɃH!>D0C64 P@00 6R80  0PP @@@PP"  Y0 0cC61`0 0@ 8 0 iU *ii 0U :^  ,P @g` 4}_(_`@iT+dHi@+dId4i8ip3:83:3: P>0 à 0Rl PR 00S 00 p-0LP`@V0D  Ppph* -0L(!(M10 p  `@0   PP0S (K*@8K" 0P* p38K)+  #8K* p38K+8K*P hWk|8 -L @ hP -L@ h AsP -40L   @fPhhWk -L@ hs QP<0S8<0 -LMbp<0 P @2Pp8 p (K)0  @qV2`00Dp004P,P@0Sprp4P 4 10S 00<000 00*  4, 0 00S8<0<0<0 T!00T1T!R9i -LM$PK*q` )0TlP@T@PV 0x倀 0@,0 @T ,0TW00V0S`piiㅡ -@L 0@ei -LP00,P0!00 @\\0$@\@T1   SB !1R,40S23 , 0 R[?Z`U @, ,  !03P`R KI, ,[?` Z T@W,  [?P  @0`@*$ <8,q+d9: -LQ@Q 0,  10 OP,0 1 1<0 -L MP,0SmR0 Ar[ RY1P RS ,0 1 (P1#@aQ,0 g$ 1H10,0 1, ^ Aᮘ 4 F000 I$00Y00S @T T @T,P 10`S{ Su S@C T (KoY ( 40S 10S (KNHz, 4 A3p000 Aj,gAT,@  0S00ʅ 0 R 0,0 ,0 ,  @$,p34P00SM0P00S@ @A6[?㳀H(Ko,*12S201Ņ"0 ,0K X 40S 0PX0S ,0 ~,@,P ,0S@ X0S@ 010LaAA+dh - L N -x0L@T@T ,0 ,ї0$ 1  @Ti -LM@,  P$`0A s  hd\`Q Ki!00000 10! !1 1 0U1 0!10101 K+d Pp-L`P @T U  ,0 j@Tp P-L@GP  h -LS`p) T1@TN @T 400S, T00Q0S 0PP W f@TX* R P$ PU PU @t 40S,0 R  0%P W 100CS7i -LPp`P P U 0 R Q 00S U U U  hlP @T0P \ 00S U U U @T U  -P0 UL@p #R#0R = B @U`P  0S  J`P ,0 0P  U r R 0ir 0i b0i @B$$10CS$10$0 >,i 0-LP >$J/@!0$10,i 0-$0L$!PR @$@0 -`L$P!R p`0 @ ! 0 !1@ A T101!0R1Ms 1P 0R 10P0+d -L M<< X4@0 ,J 0@?Ki( $/d9:,i p-L`P @T @Tp%@T R0000 0  R0000 0  -pL@` P-P W` P 00  00S00@ P0-LPP@@@T:P T 01 R0D00F$9: 0-LM0PS Q@ R  R 0A@S0@ 80SK` P  0 B0 00 0@@ 0 @8S0 -pQLPT\Q 0 0CW .\, @ R W`1`!P$0 70S( `^ 0 f0 0 0pf0@ fW0 @P0S    hWk -LM0 K -LDM 0P@, H0 D@ PP #0S CPU0L0 ` P`P _`P`U`L` pP `#P P3P @1`,3 P3P   "P`Vj p=KB 2R20L g"D@_2P Ppw_,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0e`TV @ T @HK ^P A @0 B C  D! EFG@@iDW00`C,00, 0PR=(KU 0`V Pp P P@ _2,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0`TpVv(iD,dPEi\EiL,dP,dlEi:d9:89:8 -QLM@DQE q`PC X:@09 100CS8,0L5 0  0R5,0S) PZP"@P᠐@@ P( K0E0"@E0p0@P (K@@, ` @@P-P  0S 34\^ Q0S :P00 (0hWk -QQL Mp`1Q1 $0K `P) @$ P$0( $$ $ ,0(0,@$0 400$84$<8$@@<`B K(K`P `h(0@ (](H Z(0` `\  0w` -@LPp`]T  0R U T  h  M-PL0 0S R K P  -PLM0  0S R  P  K  -QLPMQA0FS-/P Y 100CS,0 0,0S (K  l P00P0 =1X 4 @ PHK`0 \@ p80KlhKP 8 TP h0 dP L gPV V V< Dx x H@0xp0 p t 1 0 0!^,0 A aYt,Kt mPbp00KT d  @P80 l80KhKP `@ \P X 4 h0 L -PJ0 R= :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 P.V2 0S@-0S @T000Y(, !P ,0 0T ,0 0 0 00 Y(K00 t l兰P@LJ , P ,0x 0^x ,0 tt Ypp n D0 <0VV07  00 -LM0< &. p   0@ 0$@(, 0@ @004@ P`8P<`$0@@0D@ 0@H0L@PP`XP\`(d,,000h00x0000000 00ˆ04ˆ0<0S0 -01=L  00 40=9 =X2 01A !P0[0T  <0@1A8 !1 1!$!$0S1(1$0S1,11001 M?3!C/ 0 0 [F N[ [0S`00`00 S`00`01 0BRS' 0S X01 `01 h01 l01L1@0@1 0!x00| 01 111!2!tQ  [X0@X1\A0SP0@2DB100CSL0@1A!!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/!0O2B/ "0O2B/"x0|d1t P= @ @ $0@H2LB \"04 l 0S04 p 0S04 t ,0 Q p00|0S00C|00@P0T@0|001 0BSR 0 08 K0K,8K !1(KT00X 0X2 \00@d!l01 A?B -LMRD0 @ D  Q8 PU `V&U0@ qR1,0 <  & G< 2@@4 0 T2 10S, 0 R( WVA$B$B$A$@$A$A$A$,0 0 0S p0S,0#80SVI00000 , R 80SVN00000 @T4 RU040 1@0 R @0 Q @ 00S 04 R @,0  @0S @40S @<0S  (K<<  P8  e`F8 < <  P8  e`F8 @ R 0b0 SD  300 100D 0ii -LhMp o/W| 0@  (0 0  00  0@ 0$@ 0(0 ,0@004@$P`@PD`4P"080<@,HL 40P0T@<X\ D0`0d@Lhl 00CSJD$F$xF$`F$E$PF$ 0 0 R 0@80<@W$x0@p0t@0 x 0|04 0@0@L  LQ ` Y 0 0 K5Pt0O0@pPK`2D!0xP`  R 0F 40x10 00@A40=9 =1|Y R0 !(KZ 0y0000$04 t!$0 l! p$0< `d!@h$01 !0@1A 0 1 0$L0S? @1AT!Q $1S# S S 0@X1\AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !|D0@(1,A#0!8041#D!(0H1 !mP0S 0@1A4d -QL,MH0 Q `oV RH @  @  0@V8 (Ko EoV01o?#TD <0 n TK T4  DX4Y0!0  H0S 3#H8Ph7@T P4 4  4 @T 0S @ R030#Z0S 0D\D< P@PfJ@ 6@T , 4 ,0P ,0S 10S S 8\*0  Q% @T80s{ 6@T 0 4 ,0Q0, R 10S S 8\g40 Sd @Tup\ @ R030#Z0S40040 \ @P030#Z0S40040 0<\ @P030#Z0S40040  RP40040 PR0Q (0@P030#Z0S 0D < D,2P ,@  f, @  JDp\ @P030#Z0S40040 \ @P030#Z0S40040 \ @P030#Z0S40040 0<\ @P030#Z0S40040  R]P40040 PRU0Q (0@P030#Z0S 0D Q< D0P 0@  f0 @  J 0D9D,< PQ,@  fJ, @ F 0D#D,< P,,@  fJ, @ ! 0D D,< P,@  fJ, @  0DD0< iPa0@  fJ0 @ V 0DD0< SPY0@  fJ0 @ N 0DD0< >P(0@  fJ0 @  0DD0< (P=0@  fJ0 @ 2Dii -LdM 0P  PH U00 0(KS񟗐T]$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$^$T]$^$^$^$^$T]$^$^$^$^$T]$^$T]$^$^$^$T]$^$^$^$^$^$T]$T]$T]$T]$T]$T]$^$T]$T]$^$T]$^$T]$^$^$^$^$T]$0BMS_$_$t_$X_$\d$8d$Dc$(c$b$pb$8b$ b$b$a$a$a$a$^$^$^$c$hc$^$la$a$a$Xg$4g$g$f$4_$_$^$^$^$^$ e$d$h$4h$h$g$$ 06 0/G0|D(i,dh<888/dBdxBd400 0@ 0#ph/d p-LM`P)@T00   0@T QxhT  X@(xh 8Q' CRQf4];$:::: -LM@P8`p$P  !0K`Di p-LMP@ R00xhR `'0 S ` <0 0Sxh:: ;: -L`p$ PP @P `@@y0@ 0 Mأ$ p-h` MLP\0 T@ P>  9  [0D$ @P @Kph,`Di,;: /dأ$ -L'<;: -L@bP wL0 0 0S0# Q!<0S 000hWkhpVk p-0| @1P0Q0LLL00AP|0 0CS|0 k|00CS|0 KPLphh4k 0-@L L0P0$S$0#L011S1ԅ1ą0h -`0@ L< 0S 0 uL0S$ $000 u(EihpVk -10LS@ S '0,   [?0S 0CA}u010|0S0 S(| <0!R 55030505P;:hWkhpVk p-LMQ`@1 K_ \S 00S0 acP =  0B 0 P! 0P=9@ =C 0%PT0 R0 0S"o 0S*0@ #uV010 000 00Kp  K 0S000S0S0ShWk?BtWk4jpVk 0-`0PLP 1 11 @EV000n0h/J&hWk\;: 0-D0L @1 P11 =000U0hhWk -l1l!`0Vム\1L`T1@T< Dq@T7 10x 0CS|0 0|0x |0T S5T0 dVTPP P"1L0 T P Le1Q10S! !@TP o!"1!S f11Dih4k@ii4/d$Ei -<@L 0,0, /C!b0 h e$4Ei -0LS@`p3 0S$0S  0PS'0U 0S PPp0S00S0x#0l-"0S T'"p0 0"i"8/dP=:8=:^:|=:L=: -QLM0p0 4 ,0 (  0 Q0$ `0V 0  P0S 0S 0C8S  0J@0 5R 0Z P0S`V`0 R , R $0DS 000!,K4K^!4Ei8/d=:=: -LM0r,@\0S 2 0S008Xb 0 Q `\ P 0,0 A0S00W ``00 @XQ ` z!Y   <1\ 0S 0S U 8CR0S00 S00 0S\ y,0 t00CS0X Tֿ(K`@ 8CR00)!0Ei< c080 4K  00B0 S>?( K Q02\ 0A1@T (0 P @  9P+ @TZ \ 080 _9P0.S a0BS8 a0BSW0B$Zi\Ei:: >:48 -L MPp`r* ((0"4#220 $00 D,KP 0 @?(K, 0OP ,0轣P 0t $` ,0 I,册0<  0,:,w p,>:hWkedAx>:P>: -LM`00PK  0 8P 0RK00[S  00C S00•0SLpQ @@Q h8P10Xi\d@8 p-0LM`@K Kd0 _PP"0 K0 @@0@0  K0\S QT0 QL0 QD@0 0RKp @di".>:Q->:P8 -PQL`. 00S`S%p0@T@T 0S _8P00SgP020$ 0440apCWPE@:\ 5P pW (0 P @ 5P @VPP}@ [,`@P 0P@ P`i\EidEiTEi`di@d:?:<?:DdHd?:$?: @::0?::L?::I:X?:DF;?::?:?:`8h?:@:.I׻ 0-P@Lᴹ,00S,0 0h虹`l -LMp P៹,00Cs,0P 0KZ,d 00`Q`=Bl0 B1h @BQ=9A h =C lh l0Z00K`0d@)U /PP`P`80 0@80<@PPT` U ($z(K /HP`P`00 0@004@HPL`@0 0@@0D@?B`@: -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0x  0r pdRd$pd\d -|0L0@S PR 0D00  0 (0 BR %LEilEi\EiPEi@: p-0LM`@ T P@T $0S (0 0 (0 0R Kpd0K KpP(0(00(0P\Eiih8 -,@L⮺㒸(00(0@: p-LM(0@P; e عP7 XS``00 U@0 000@ 0$0 P P 020$ 044$0$0s H `w@00S x\EilEiPEi$LEi@: -LM`D 88#|p 0 @P,  L00! 10  @, a0 ሀ<  R `U 0O  < ?0 R0Q4O0@ @L Q: U:0`)p@0@P@8 P050, 0P 08 0rp`,@P 0 0a 0@` (K< (0R 0 A%8XD%@:b;@:A: A:A:0A:@: -LdM\@ <0 p  <( 4"4&, Pd< ,$ !$*,R[04!48#8S R20Y *0P!QE 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X " Ri @0@@T(PKT` 0 Ȃ50 A$,0@(@0 00<@9000bP4l $0 ᴂ@K0H0 K 0)l 0sH 0S S0S  $,0FS@0$P(` 0@F,@ ,0 0AS0 0Q  0 0 ,00  0000 0 ;P R D00  @(K0S0 000 u p 0W0 0    P ,0p 0@000 0  PP  0S00P0P0@W ጱ@8e<e@eA:pEi -L$M@PD P@  0D00hp`0`D Y4 D0Q  V@< 0S* RQ< H 0S%0 0h 0 @ @:R  Z3 #0 58 5, 50 %8 %, %`:*\ 0S4  0@  i0 0H cH0I  Y4 0LS@0*P* 00h0@R20S2 < P0@ 0E40R\!: d0R0 e,0R0#03P0S<08  , 8 0 00h0@R F4< E?* ZX: R e 00R0S dP,0R0#03P0S<08  , 8 0 0@ 0  i0 0H cH0I 0Y40\@"* Z %0 6:4 S R!*0, q 3P R . D000D0 P (K 80@< @D <0l@4@< 8 0 , @D@#40 8 , wA:-00 R0  R 0 Q R0S0S0000 00S@Fia0 P008Fi0 8FiDFi< 00b 0P 1 Qp-LP4 1Q 0Q  p 1Q 0Q0 p0 00  0  p` 㦬0 @aT0 @@pP8 4 0000 00p}f~fvtwt@DFi@Fi -@L 4 R00 0S00h跭DFi -1Ls@ 000 800 <0_ 00@塭l/d@FiDFi -l0L RX@0 D 80Q0000 708FiHFi@Fi p- L@`,A@P <0 S ipb@p@FiHFi -1L @P `p\ 0+`P A= 000^  S 0El@Q@1@!T `P0Q 0Q`#`@FiDFiA: Q0-L@0PA 0R .x0 0 PR0 R P P0000 0S0SU RU@Fia0 @ 40h c Q`m>0>0S! ! P11"p"l00``0SS\60D D0D0D 0 0 C0`FidZiQ9|/ddF:/dPFiPPi%%%%HF: P 0Qp21C c ([i -L MtptP`@F ` 0S 04:`V pPKDe([ilF:Q9 0P \| 2 1C cU([i -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U   H PW \ 0U00U <000 R {iQ eiei4d/d kl00l0 l@ l P 0@@ P` `  $ll l l@ P0 P` ` ll l  l P0 PoV dP l00d@l0 00T00,Kp } R5 ,K2p 51`:R Kd`Pp@ `0U  S\  \ l@\\ l| h\ @bTZ T W00 S 00  v @DT`Q Z T W00 S`@@ 0 b |P @eTvZ TW00 S000  N @Dh P0 bh x0l@@l@ 1>A Pp00  c`p0 l@ 0Rp p000b ap  bd`Pt@00Dx!0000@ Qx t h0 x*P 0@ \t d x@0P!0t 00A 0 \?d0 x x l00l0 l@ɟ X ^ PP `l0  00l@@  ` l@ ` !x0l@Ll@ bxl @ l \x0lPl@l @x0 l@ l Pl  P0P 0O 1P0P0p0 p7Qd0P Sp [ !P] p@dPd UdP\ \ P@`@ `` l@7 X0 lk P 0@P`@ l { PL0 H@  ` 0S6 SL S`H@L0CK&@@CD R Z T W00 S   [ @Pl 0 P`l 0x@ X 0 t@ ` xl  l x+` PP0CKP p \P C0KP P0 `\PP `CP0P@00 `ctPx PCKp \P CK|` Rx0x@ ` xl  l P0P@0h0 h0\xP0 -Pu`` <  @D|T@W00 S   pp PU):p0Z h\ @bTuZ T W00 S000   @D0 @D`0 @Dl h \0@cTZ T W00 S 00   @DTP  @Dl2 ZW TW00 SB   $,Kp %2X> &BP p0`cp0  cJ` rV U-Kp ,K,K @ 0 >o0d 0/oQP` @Dp@ p@00 d0 P000T0S  Rt @ ;  06t 1l  cl@` P0 8CXo dl Nl @K P@08#X` (lNl0@ P@0 尀lHl  P 0 L H zl l@ P08#X` l  l @ P@08#X` P0P` P 0@P`@ P0P` P@0Po P0 5P0 L H 4iF:tF:F:F:F:8F:@: @8Q pL0H@0 `P  P@ l@2A \@QLK<@00`!0@^S!0@^S^<,Z9 TW00 S  j !0@^ST@W00 S  [ !0@^SZ QpR/P\ dP?\0 H@L0CK!@b 7l@ P 0 8#8@L0 H@ HL0CK "Jl \P@0 P0 L H ^ Z TW00 S>00}  zPx 0?d0 P0x 0P0 -L@MQ  K" 0(@ K 0 K(90 --0 L M0CQ0  0( K  ! K0 K( 0 0-LM@TPž 0P40@ R 增81坞8/d ei --LMP奞 0 ,0@ R 僞K/d ei -@LDF; -L\: --80LM Q0 K0d --LM 0 K --\0LM ,0 0 Q @@ 0  0@KhWk p-LM`0@< 3PK0 0\ >3[P @ P >  0RKpi:8 -p-LM `ޛ 0@PP PJ00 R0PP >rKp8Fi -p-LM@ `廛P 0@@ @%,0 R0@@ MKp8Fi F: --`LM0PSP pAO d P PL0 R >p9K,@ 0@L eiF::/de -@0 LH@00S S S  Kh>hKF:/d G: -LM  0(G: -LM,0P20#R0`0!!R b1!#88P$H*0pK@ P1[0 1K]P 5 -0L0S  c1 #880S$H:H1D0H1,M0 耱h - @LT`pT  @ P! 01 01E-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0/d<H:K: -<3LM `R#$SP3 P8CxnTNT N@yTYTYTyTz (K(Ko 8C800 nTNT xM@lyTYTYTyTcD2 Rp @P( p Wp 0S$ QY` P0 sp p0ps 㵘PZ @ ,@ x0 8s dPCu08s<lY0 0%0(Ko[(KocvW@aA00c10I0 0c10 |:(KoiP! ,P,  ,(L(Koe/d/d 000 ,,KP, 10 ",K& K(0K$@P,"[2[n0@ @P,,0@ & K(0K @Pf"[2[,f0@ @P#,0@ & K(0K@Pc"[2[,M0@ & K(0K@Pd"[2[,=0@ & K(0K@Pe"[2[,-0@ /dL:M:8/dM:P:M:B d 9l   P0d d0 /$ `f0@0Ƕg k``^#`\P000f#pN:ii 0-@P@L D@@@<@@P 0ٸ04 0, 80($ 0 -LM`P@Ppp@P (K, ,K8 Kv@P@,0 ,08 ,0$P,00K4 Kv@P)00 0 0000$p0  hSh03,30""21C09#8>gfffON0  jitjiR  Rx0x0'' Q Qx0x088 RA⹶ -0@ 2L ߈0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qtjiji p-QLM@`@00CS%@%L%X%d%000 Pp@Kp-@h0`0X0KH02 0婤 @Njixjiljijitji -` @0L0C0 R0 <00  0 (H>h,tjiji 0->L@ CS0PT;:h0h0h (h Hh ~D00 8 P0$0 0P 0jitji% 0-LP 0N}P>T0 -@L`^ᤄVpH 00RUV hp t0`0t00VH0U 10 XH Ņ hWkT@@Xp\d 0-@<` 40#"B LP R00 0S000h7\d 0-@<` 40#"B LP߃ R00 0S000h\d 4 0p-#Lp"B @`!r r p<0P80<`㶃00@p0P80\d1d0d -L0MpP(K$3 "  1ˌ3Š"10A0 0cK0S |0S \P \2 U+ 11 A0@QR  PS000S Sv S 0AS00 @R  R Rm R | |0R:,0x ,0`P\1 T@0BRS 0< 0K$0< 8 KT!,1N͌\40, N=L L0 , 0^8`4 =N` N8` 4 108`S40 S( t 1Z31C0!02 ;5,.ϠClF/<@nB 0 `@PL L0Rl:4 40R  Re PXL@,0Th4kQN:?BN:N:O:h O:N:N:N: -@Lgt0 | 1hDZ -.H0LS@ t0hO0t0H⵱ⱱ p-@LPᚂt0p@ @` 0t0t0N<t0уp -t0L@@ 0  P H Pt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HQ PL#0?0S $%P%D%D%4%P%%0r8#(.a0HS H0 `0HSqЭ%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%ȭ%%ح%% 0 .0Pc0>pH  P``0O0@d  d >V0 H>{  0@d 0 d  H P 0>eHb 08#(,!0 Q0A8#(|A0H\XSPP 0@d \ d H Pl =^P!P(P'P)X)P2 l 0@d 0 d  NH PJ>SD @xji8?; p-LP@Zt0`   U rᒂp0 p 0-t0L   % P"20# P0  @@T 0h0@T00 P0S P ^T @^? -LMPP (`$pKW @P $ ' @P`H @P $  @Pt0:t0!0>0> p-`QL@ Pg dP`Up -LM2@0 SP 50 ^ B?@0CS+1 ? R   t0 ! X0N>O2n @ :t0\ 8CRnt0 :t0>%`(pKⰎ > PP ( PP0t 5*0t ᓁ.8C8Ac Q.PPQJPUZ8@O: -LM0`P0 ,0 8" p4b #t @0  82#3SUY  GN\#0 R|  VR8 0H0XDVT V(ڠ0@ "?0K@V' 0>H .` . 0O0@d P d p`l?ʨ0H0X VR  ^NVP)0p`FH0XH0@X#82Tt0!0t01H R`1l#OK OP@4Vpp4b ŚH0CH0@Xʀ\,  |0P| 0y w$0!s1Fp0S7   0@P< T  4QK˵, 0 R(K ꖀ 4 Q 02R#ꊀ #}ꅀL4K⧵  oi0dhWk8xji0d$Ei0d8 㕵0d p-L@P` (Q)Q#t0 >;.t0.?phIq t0àLp <t0HQHP (Q HP\d Q-L@ t00t0t0 0t0 0) P P 㸘 -t L @0\%0 t0 0)P P 㔘zQ  q, 3 2CHt 00t00 Q>|  00CS0 tt4d8i -`pLp!A0 㨀/~@q  0@D  D 9@P ✠$ !,t 00S s PWP|@  =?= t {RyW  b @h0(PTh ?R](0Sڜ0  P HPt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ XzY| t h 0@$  $ i0 t@0  Xth0@t t    0R50,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   }t@(0 h0S&  .H0Stn  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >08#8S>>>t  ^0SpSn l >(B8CS@1@#Td@DpT]0p  x t  (Wt{pp !W|pl 'W`pi W Xn0|S W 050;|[(0 0S050,| tWctW   ^tɌt z Tx 0>(xW 0S tWW9 tl 0W tW   >Rq iQc0>t>tW  |@i P0 P p ^p P P 0 @POp0 P P W 0@0S tt/ W   t}\Wˌtxoq0̌#"B0t )W}p ^W~p}  R @>0S(| 2|jijilji8\d p-LM4`K@P0t2Ɍ0t[Pt09t0Kp -4LM0p40 0P00 < @ 8p ,p 㨠{@Z|0 0S\ s{@w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#p|8\ 8 0#p  0S00SW#W00n㨠p%{@ ke|0 0S, |0P 4 $0!41@0S  x|"2@=pPu =(0S( 9|` @P%0T: 0TT X<VpP<0S X` T 0T 0T 0T  T` zh1@/ b\)|8 R ᘴ8}(KT =  S| V  !1pP 0PCʡ#W  ] 0%>0S8\, } 8 Ʋ8v80S, 8m0p{#pp{phWk0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0e-H0P R 00c!0R#<0e p-@Lv`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@wp 0-@LPOv0S US 0S\ a aR QPb0bU00S0 00hsw000 0 -@L` vp^P V  0 PbU0PbXw 0 b PP 0eS0 1S00PS0eS0 0PS,w p-@Lu0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0vp -PL`uV@-Q@)pQ$ 0S`0`Q@@  P 0ay0 0S00`dd0Vp@hQ  v -@LP ׫>xP 0SB˫>x000 p-@`LP >xV`0 0 0P  pUB> x -pQLP@p1*u Q( Q* `0Q! 0Q a a0RPP ᅫ`P  0a 0 0S 00pe 0WAv R 0   p-LP@t `R4 R0S) 0 0 0P \  a 0 10 0 P000  0vp0 #0 00  V0up -LMpt0S" 0S 0R up$K@@KP@K $Kmu00  ,0 0 P ]]hWk,0 0 0S ?] p-LM`P, @T \Q Q 0 S ,.'Kp`]at -Pp L,0` 0 @T  <^ 0\ `^` -Pp L,0` 0 @T  <^ 0\ `]` p- P,0L` 0 @T  <d^0 ,\ `]p`p80 P0S0SPji -L@PP*0S( BT 4P: P0-LP@0P QT 4Q R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUji p-`0LP`U @ T*$04@S  RPUph舭ji p-`0LP`U @ T*(04@S  RPU}phkji -LMQP@#P P EP U Q4Q0S0\ E 0 $K*A$Kmw 0-0 L 0P0S@ T* 04@S  RPU 0|S00p0 @h0@d@ TPP 0㨬40h褬ji;d>dLdL3drimiejimi%e%$ 1S!P@\2d.R0>> S9>R0!03Q>  p-PL@`p21C0Nnpp@-L!La0P 0cS@(010,1  1 ^  >!R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S*0>p, 0 0cS00`isi8dririe"!B >0>\P 1 0 STQ X0\"!B >0C>T@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  \0S   @00cc@ 0b1  \0S  0  b @ L0 0c 0-@PLtl1!dX H@@ 1 @L X PTDH ` \0(0 "": ,0 4#t<#d\;1hO:O:tO:P:,P:DP:R:0R:\R:pR:R:\P:P:P:Q:P:dQ:Q:Q:Q: -LpP`A @A1: 00100 P1@00 -@PL 0@  !@T 1 @L @T -QLM`  p$R KPP VU 0 @@cV@1 `d0 0 VpP  S:R:R:R: p-Lcph0`PU @ T*,04@S  RPU 000phqjiji @0- 00@ 1L,㧦0<0 -\LQ@ `0`0` \1 01L 1 D0S H @L1 01L X @21C cgmi0S: -1T00!L B!1@@u1jili 0-@PL oPP@0hq0 0-L@oP@q0 0-L@P@0SU 0 ' 00 0PP 1  \0S5 0S P00 p-@L`oTPt@P h 101p@0 001a ,0<0pppliji -L@pP`doW P1T% 21C! cUPP@# W 3 p1@ 01 $ 0L H0X`TpD0`@\@P @ rp op@Z = hp@mi p-PLP@pv`PD  R 0 1 .p0`00 01  1@ ^1 0@ ,@1  $ @@N1@ 01 `P\Pn@p@p p-@L`nTP\)@P P 101o0 a 100popliji -LM@Pp `QP P R*P`bU1f0Z P 0j0!: @@@00kn\0!\01\\ 01`P`o0 0 `0 P  rP&0!0g00,0 pZ 0j0 ੤0 PPS,00< -LϠMϜp0 Q10 K0 l`P} W0,0 ,@K,n@@0@0 0 0m\0!\01\P \0``1`P3o00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O NW1! 0  00b\! 0   Pd0Wp00 W,(K, ʚ;S:pS:TS: -LM^ -LQӿRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0xPP" 1 `000 0X0j 0    0S 0S00P 0PX 3 -LM Q-Lp@`9W 0 0g 0 1000+P& 1 Q@ PQ QPQ100@00 0g0 `` p0`S: -L@P  40 0 尦`irisi -P@P`U^LpL P <0@T0hmi(L0693h2 -0@080L06*$h# -L MP L32C0bC^ (K#0 0Rx cP 0A0 00 0 0000008 $ <048@0 ]PP$0S DK PP, (00(0, 00CS 0& 0 (00(00 00CS 0 [848PP @>0?080 D>,?040 0+?,'?0d -LM0pP K$0 @P $`0A?AS  00CS 0  ?%@K $K0@P 000  00CS 0 $PNt@$@P0A?AS  00CS 0 $:$@ > >VP06F4  0\Ӆ@P LWC03DU: -LM0`Sp  0KⶎPP,K PP (K,U,0< $@ P  3S%P0 0F6"唅PP < W 00CS 0|>3S  #P5P55 P#P 080 iP\ ,00,@0 UZ 4 KEP,0ZU@{G@,0 ,0 ,0! ,08 $ @8 PP  R 00qPP ,#Z4=,>,Y|, (00(0, 00CS 0 4008 6,>媹LU:0dTU: p-LM`@ KjPP x0$. P 00CS 0=x p-LM`@ KLPP Kp K0TPP   00CS 0=0 $ 2P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP a&P( 0S0 0  (0(siP 0  0C0 00C0=si -L Rg r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( I @T@T1 &W `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P d@TZ@WPi=@TPZ&tW00$Q d0 R0 D)@ Q 0Q@siisiiL3d`& -L M`P0S p2R P(K Q 00\828 42 A0!/@!b0SPq4 1`j PW @K; j1] ` > W  @l^@T 4 0X0 N0@p0PK 0sC 0s@ 0SB #, p 0X0 0,@D000  0  0 <\,K , ` PW,pKˆ@ , `F 0V0C 0,00C0  B tPrV7Pm` PPh`P$ f M00 /0S 00 p!0S  P(8K, 400bS8 00PcPELU 0 R0 R*npL0S:00700eLP``80C6O0P@` `d 0@< 0$0 0p0hWktisisihui,0:si\uixti 0-00LP 0E Q2 1C0Q 0  0 00<000h00000L@`M$ 0000h\ pdRdhWk - LRpa 00Sx0L0 P00S $0@LQ X? x0 0@x0|@P `00 0@004@ $ 0@00<000KP0  0l  l M008006X@ @{h0 0@h0l@g@00sihWk -LpL0PS` 8@<<@ R @00 00;00X` RN00 hv00800hz -LM`mK2V  B!2P, D``䁟䑟A!1n`U`q q 0SX0S` PPU 0 R 0 R4? ,6z0 R ,ocL0 R0 R0 R0S0 R@ 0z0 RP0 R0S0S*gfffsi\ui80#6pǏ#0 ORʔ C0S @Tz PHP `X@Td PU*P`00`P C 3 @ P0K/D0( P@ p< 40S <KP< K 0 0440`P@ PR00 T2`@ \p,K(K0S*,2 ?QzP|wR0S0C0bA 000YUP` 0ORڤA!0y,LKpQlg( $0SZ PO8Q0OQIPG@P `v0 R20 R-Q00@;004@@|BIPi,Kp,Kp|4 Dti80~pW (K4K 0H ,@K@2 PD,04 @r,@ T P<  LPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @00;00k< TDK0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /00xP`900040K  0t8p0P $hWkW: p-P MLddd 0 PZDH0H `VPP@P U$@Kp/d,W:vi3d3d -@ LP ( R,0,0,0,0$0 00l P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00 R XY V qrruuXuVzrQ4W: p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0=E00C0hϗwi 0-L@P/EUT004僘0P0T$0 0   R0wi4d -0SL 0R& 08 p_{ P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS &&&&X& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cXQ t0S\  0@  0S @ K  `V $ (0@(, P$0#0k0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P D&d&d&&&&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'4d4d -LM40 1\00 ,0 080 G\C`VB p pppV4X 0 P; ,Y0 = @PMP$ ` p4  00 08 0@$0  8 0 ,0 40Y40' Y Y P\ P(K`P`(KoY0P1, 0 'P PUhWk -L M((@ $8 0@KLW:/dwi -LM 80@ `I%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 $xP > 00WL0$  P WL0$  0  R  0  ,0S L0$ o L$從 弞TW:hW: -LM,( 0 080 R0 0`(40 S P< 00  , $<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  x$0Sy 0Sv 40 ,  00,P !@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "sP, #,K0 pbW^ ,P,P00 S SJX30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPPw,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN Z T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@* ?@p "pt,@0 R1L0$ ,  0p " , 00S L0$ 4 Rs L0$ o p@0 0 jȌp,0 @pwi@  -L(M0,0  p0(40P 0S 8+0s`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq  P8 ``800(K Ps8L0S < P `Pw,0p 0L"H RU $0S0$0q0S8㵓0`0K4 PP 0PK@4` H0 D@ 8 `8P傒 ~ 00b Ru `?`wivi0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-@0 S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 T- P  P 0S 0R Ptxi -LM 0 0p00 `R 0|040@4 Q0$0 $PK @$00$0 08P#8@$00K pdDetxi 0LP  \ @0D0<0804000,0(0H0$0000 00L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D0|xiHyiD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 0Hyi|xi -L@p`\ L0S XPPU L0S \ -L M0   K0 P K&-2L?0\ \ x 0S00S`yix0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMD0P,4@ ` @P@0d0(HL@Pp8<P@ Pp KW:W:|X:X: -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @T85dY:5dY:HY:Y:Y:Y: - pL| 㱱,0S' 0 ,`0\h0h dx<0@@pP`0LP T0X@DPH`Z iZ i[l ii -L M$ R @0|"( Pl  0PLP 8@0H @`0 ,0 04 00`KP `p PX``@000p  0 x@0h0P @0p0Pt >0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L Y:Y:PZ:Z:Z:Z:[:D[:h[:[:[:[::[:[:[:: -pL@T P` 0 `@S JPQ 00 R 0 QR03d3d p-0L@`T  P @T P pH0@Q @`0(0S pp3d3d 0- @RL R000 00@ dP h0S& 0S0 00@P0@0hP00S S t0d 0?x0 R <0< Cp0Q@0t0t0t0!Cex5dVUUU -LP  p R R000 @  h0S 00hp0\@0t0t0t0)!Ce[: 0-0LSP@@000CSx00 D0D d0S0d 00dP@0 [: -@L1D@ 0tt0P \@ 0P0 PT 0@h20SP0 P0P0T00@THyi|xi -L@p`Pll\ 0 @@1aP  -L`p\1h@PT! 00  R 00@00$ <20WS:1h@PTW 08 h0S q2hj2兕 \:[: -LPp` 10@!h0S O2 0 @Pb0l0@Sh0S Z;2`0d R% V@ 0S'PB @VP 0S00&00 X*00;00@Ud RhP' V P @PP 0S00800X 0u`@P 1 1 1@VR \:$\:<\: P-L l00Csl0 @  S 0@0lh_T\: p-`LV@P00   R000   pl00l0!Ce@-Q @P -\ 00 R 0@X i 5d -1 RL PpU. `PU 0 00S00` 0@^1aW`pGZ`V Z ,6'P0@X PU`(v shWk3d i'5 x\:l\: p-L@`\P0^0%S I p\ 0S 8P%3 @0  0S pp@  0S p p-LP`@`T0  200%VPp& - L@0 12 -LM\@PT`n T]dPZTXPV1 2p`X\ 1hPG\ 0S d RD@$T@6 0\ 000   0V0P@@T@!0400P m0400 R R 0S 0S $1 0\7@1`2@@\` g@Pd 0S Ǯ$0 @0400P sm 4 $0<$0ji p-0L@P`    fP$0<$0p8$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 KiOP0x  Ki7NQ0PU 0S0S PU-P $1@$ d0 00$ 0NP13d3dsi -QLMp`0T@$KW00 P@ $]W -80T 0CSL@80  h680S@0 hhWk -LM8P@U08040`pI<40y4`9U2 V$P7U 800CS80 0,0@40, 04  KD0SW 0a<40 Ki]  0EC A6d|\:\:\: p-40L\@ !04ph] L0S 000CS'80 S0 @0p-D0SXp0S P\QT0T0T00T P0SP0 P0P0T00@Tph.xQ 0S00 S1 x 0S004 # x0Q' P`Q x 0S0 00RV`V 40;404;4000x0xQ廑幑巑\:Hyi\:\:\:0qhWk -40L @ x 0P Q x0  R0 00R8 0r03P0S 40 8 -80LS ; - 0RL@  40 <0S 00S 80S 000 000CS0,0hWk86d 0-80p 0CSPL@80 0 \P 080S@00hWk -40L @P`  P<400!v\P@08#1pQ  R8P  #PP 800CS  R80 ,D0S P R T0T0T0 @00@0-8P RT 0 P T 0 P \:Hyi|xi -000CS1!2?01L`P@p 0 00S 80S1p@T @T x 0S @T $/x Px0Ppx  x0Px PxbT` 4 +4 40;40@ XPY00S    ,0 0,0 hWk`yi -LM1 `00U0 4 8 ,0 OL ȁA0 ?0S0 " 0`+1 `RD!0S9 P@UKPPUH PP RT0T0T00P T0 @  @ ,00S ,0x040@0@00080,040P80@(KT`p 0S 0S ,l 0 0 `0|0 P ,0ڏ00TyihWksiPyi@eHyi|xixi%: -p0LM@Pp0 $0KT `P00 $`0p P$  $``86d  r/ 0- 0LSP@ 00# @x/P0@V/]: -`L@T& pU@ PPp0 'P  L冎Up@W 0~X $z@TtxihWk]:,]:\]: -L3,LiH0Q P ,h^$h[ h]: ei|]:]: i -PLM4 8 \ 8 0!4 |1X> 4 0 zP@/ R, ( L0S300X@PY5:`,K,cpP T,@  L0S YX@%:P cpP ` L(K0P @E0T0 40c8 pd0 R X0P4 0b8  p0+,0p 80" - txi5d]:Pyi -0LP@U. PU+ `pP !-@p P 0$0 p0 00$0$(0$0 j/00Y 0d@3d 0-p0 ML@d@P@XX 0PP<<0< P0 P K0hIPH K ` 00SP< PP8 0PP1  00Sb  0bPP%40 H<00<0(K  0,0@0,0(6PP0S (0P#  00l PPSPPK 00 000 @ 0( PPk  09PP@;40  00 @KP 0@p@ lP <PP -LMPp, @P t 0000(K`H0 00 it @P00H00\ 00 0@P 00, @ hWk -SLM 0 `  0K0 @Pt0 PL 0C"(40 0΁Y000Q 0 010!La000 Ѝ8<`ziųE.hzilzinmX8p8dzik_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q00088E-@Mp 00 Q 0C 0.Q00P.Q.0W0ЍS P J Q.Q 0 S.SQZ0.SP.0W00P R J0 S .SU \  RZX \0d`c `hV 0 S  PQ 0 0LV \00SQH\ᘡ'P0@ S  PR 00A\  Q00SRQ 0S0C0P W\_00W @0'0!00c000l0Q0Q Tp:Su  B0 S 00l bS0a  ~0 R0P 0 Q0I0 s R .R 80@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S 8p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 0 3A0qQ P@ R .RQ4 0?AcQ 0?AcON -PPLpPP!0S|0 <@Ph@d1 T!T10Q@0!81>@ Q  0P@ 00C0$#Bb2 0a༐ 0> 'b! 1  b0àD~ pLAD RlPEd31C 0 !000(ktzipzip8nmX8Q<_:0@- P$@ 2 001^   R 0\$0T0U00S 00|zixzi R0S  0 -h0L@ h 0-PL@ P +0 0=C 0 -LM@pL $0P PK,`K@9   4 00 y    h0  00S K$ KM PP\$ C>$d >>h $0 $0 i $0 $ 6$ #40$ 6$ #40$ 6$ #40$ 7$ #40$ 7$ #40t$ t0$ #40h$0x   h0$ y000h0$ z000h0$ {0004 $x0sv0004 $x0swW `Ps  j li0 y0rp h0 0h0k [ n -LM@0 4phP4` x0s $ h jP(K g x0WlW;t0 00 , tpdX01[Y0xp$00W 0, r 00KPPX0 G2#, 0Q= x0000s7 PdX0A1A ,0K+PPdX0A1\0080 Y `X ,0H `0Cd04K PP 4弸 JPPX0` 70bd0 40dH80c= 4唺4__: -LM@\0S` 00S` w\0S aL $00  %0`\0 -LM0P4@4 x0s` h0p`x R#*d0X  B2!0C03r T0Q` 0`P0$0xP0i5x 0pj_: -L MxPQppD0 @ "@@P< `<0#0 0AT@T 0S$0W0V00S  ?PD0@`(KT#00K`P'= X 0@,#<`X00@0 ` `8`00 P$p@ 0^v`P 0uV2D 004 0U 00a x0s[ ,K 40KP,\ <,d <,0 h ,0 i ,0 4 &,0 4 &,0 4 &,0 4 ',0 4 ',0 4t, 040 0 0x04 x0s? 4gh0' 0 000tQ% lD @c@0Sw0 40040h x0st`1D @0t0x0!76i000 0 t80KPP X 802x0,0 $ (t (h`&hWk|zixzi7d`:`: -,0 L;P0c"0<|zixzi -@LplP`YB0p8< U##00V 0` S 0!40X l5B@-P`@p |\00|0S 1P| 0\ RP00  |0Q0|00Q000S0#0% -L MßD D@ `0 <` 04P p t\0 o ^d0( K0`"00K,nQ4 |P#000W{x00 00 s@0A8K4 K@0Kr4Q <P n44 0\ B 020C!0s 620C@ 0WFX4@ 5PP10\ B Z! 20C@ 0W,P4@ Z 02B!0C0s  ZX 8 R4  <0(K0Ki2,0 C8  -RLM`PP0R (K0m>0K, K40K,8K 40&PF8@ xpwC 8@0H0 2$W y  00 s00( x1\a |9 :C\H00 40  0:80 H 00 8@, C@0h08@ T ᶲ8峲8@0H 0 4 00, H00B 0  0$  " 80"H0080"H00",80H00 8@H 00" 8 0H008@"" -0L|MT00T0R1@01`  0K1P 0! !TATKV 00 -L Mt< @0 P4p h0 c4 4(K"000 r <0\ 04  t0,KS0,0  , 0K,< 0cP4 @0 Q,08 040@0 t0Sd, 4t 0 0A 0 B0 <8 Q< `X, Hl0B , d0 MPH<P6Z0@0P0 00As00 h0`` Xd0b ``1` PX00b> c @SPQ0 `P20s H< 6Z0@0Ph0sd, 40u@P0, Pg p@ X,0K@P4 O W0@0@4 , 4@ B<`:zil`:zi -LMP p 02@$p  0 !P  0P:0RT0P$pH0 L1$^A   !T00T01 01$pP0S2:0<lP<WP`W*( K,0K ($K ,0DPP$px~H 04 0 0, $pP K$ -LM4p`P4K(K 0:@P$,K(04K P,(0H R:S 0S Q0Sΰ$KʰPǰ, -LMQ@`PdX 032`DnP6"\050@0 0 P˵pPX 0\ H `X H0N a 0P崵pP 到00 -LM$@ 40   -LM04`<0  <0nPD p,K8 K0PP40K,08K|PP.0, H0P*0@SH0 @0S0S 0 {P 0, H0 @0S-p)(KUP0!<\PP0<00<0 -LM4p8K,K 0T@P80K,08K%P30P,H0P *@,0PH0 @0S\ 0` \ {P d {P 0֯үpί(KT0ů`:`: -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K˴`P-(\0H0 R (0S  @000 A @D\0 0S (|`P 0\ 00T00S$Kt(q -L M, ( h0 h0 p`(0S$Ktt0\p \H 4`x0sA ,K`X H `0Ld0 ipP@,H0 @ 3  zP,0x 4qP0 40Xt0S( U$ q@0S (0, (0K,p pP(h0 t@0\p,p\ W,,p`:`: -L(M(PxL ^p4:dX0  a<à  0, `PX0x ,(#x X4K>< K,0K`P( ,0H S\00K H 40<K`P00(\ H @\ '3d #3h0 0 i0 0& 6#40& 6#40& 6#40' 7#40' 7#40t  t0#40h xh0y000h0z000h0{00040x rv00040x rw000,0SKnD  @  D 0 @ 8P: ,0 @D0CS,03(0\ C(0;`P< K0 (4K A(X>`P0K40<KW`P00\ (H @x 0(K00 `PL R h0 t, x0s P0H0  H L0,`@0P,` H -,LhM0,0  H x @00 T |  d 00 4| ` dh0t , 0tR-(K@ 0HPt | "Pt @40p@ ( 8K0P P` P0t0 \ X  `\0 0R   S R\ o T `k 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KP@`HK@0PK嗲@P2@PHHPH 0@ s 3SS9\0S`lp R PP pRhh b \ X DV\ `lp V0fl2l Q 0\0"'t X |  ͹0t0 P\`\ 0\`S & P X0S@H` 0 0  =H@8K xPd(pd0,0`0x 4r` <0SPZ V<` PRH v 3`x0s00 @`Rw T 00R00SS  Q u  0FPt dt0S  Z Rt ` <D0KPt p D0R |0 0;0x ti7\ X d\(p\ 0B,00.S  R R0.St`R <` T dt0S  Z R= ~ | 0  |  T0  u  0Pt ~dt0S  Z Rr Z | o0 40@hQ`K0t0 cH8t@ _P t [` <D0KPjp0S T x 060D0| T   d00S  0Pt 3\d 0A,0l0(0p0\;0t %x t0 6t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t060x \NP0t@ 6t@ 0x 0CP060 D0t Wi8 00  $00 0-L P @VP004  0 0 -LM0K@ SP00 0  -LM"0K@ BP0   -LM B`0$0 ,` (  h0PSp 0S\, KU L  0`P$  6$K]'`: p-00LSP@0 0< 0S  n`P  09P =ph0S 0S p-` Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z c/Z ^/[| Z/ | wp -L  pJ`P Rx x0`@W0Q -`i<;$0 :$0 " -L8Mx0Pp G@P (KVPp7 U@` "0` 0``l@ vT$0040  0@P(K@ H H :唯@P x0, Pd 4 0R   GV P<; , ;00k000,0 H@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$02 4$ 40`^\8 2@SQP  0 400 0,0 0 @400 0002SL0 #PP80S 0 4s0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T 480D 4t0LP QT  3R 0D 0 D x 2tQ0 08l0l040P S@CZP@l0 4p0u0@4 C`\ d0ud @0RX O@@0 40,0P 0 S,?0,0 |QKP00B 4P< P P@P$00104P0010h0 0 b删 x0m"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 @Px,0H@ tP 0|0,00 +0 ,Ө0,0 y\ }tPH wtP0 qtP i`:a: a:8 -LM⬐K@ | Pq/`P$  0S    `P$ -` 0S0S K`(K ZpY ,0K0`P W Z 0:@0,0 0C(` 0p000夽`PP00S` yx0d" 0Q`P $08 lm 00 ` 'V$0I 0S`LV R<0 0@  8400 0 0CAx0s00< 0KP,  * `t 9P010kp  00 l` V ^ 01`00吠P 0P,0KY B0,Za;,Y s0Z`,0 2, [| 1,2 pdE0  B40Rh''''|''h'' 00 ;0 000   -|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (080<00 080(8d88d< R00 0S00@Q 0S!0?A01,0000@Q 0 S 1 91 0-L M Px @0 80髹K0 p-0L@`t $0D{XP4P%(,0(0%T"$lXp(a:la::xa: -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSD0P`S u*  x 0D0,  0S40@` X0b5 ` PVQ @P 0@0@H<*P`0@0v@M 0s0sXa:0<0< 0 < -L@- -L@- -00 LR@`Pp rp0V D -LMPPpW4pP 0@ BpT2pP 0 p p-LM80@SPP Kp `K#%0 00 4 0 00 000rp h0 0h0i0lj 00n0 -0@,LLN0 Dvi -LM0 ,0 @Pt0pS( x0R`# :+N), 0Rb(KK )d K`P 0 !0 04̀KX0K00  L` H` $0 00 ,0 "0.00  K0I`P0  0 # 0TKV KW0Kk0PM0NKP K`X0[ 0X0K0 RKW0/ivi8 -LM0 ,0 `t0S4p( x0R# :M, 0R(K@K 0@7PK@KS)00 p ,$0 00 0  000 `X 0H `0Cd0 PPP+d@H.)H@ -) H 0#40%[ 5[#40%[ 5[#40W [ [5[#40$[ 4[#40%[ 5[#40x tr= !4 0 0 %[ 5[#40%[ 5[#40W [ [5[#40$[ 4[#40%[ 5[#40x r aP d KP)  b0#80 [ t0#80w  @0S 002y TKV KW0Kr0NKP K~X0[ 0X0Ke@ PK K 0H XKL @ P 3P0  0  0"8.0 RKS0LiviX7d8 -LdM@0 P,0 H L h7`LL 0L^|0 p H0U HPLƟ, 0 R(KP L0^\ | XPL x h0` T  0S x0Q 0 0 x0@x @0` 0T 0Hp0 Ppt (0 d p,L | L tt0P TQ   \  Zt0SH&pxPf0 N HK ᦶP]HPp Tt t   \ It R h0oT\atpP\H0 4Ht 7 KPJ00 0 0 \QZ  LKjLPX x X \l (0h0 Z T\CQ@L L|  3x 0@00L*)' | |-0 .R=| tQ H00 \0 0 PB `0S  | T R0S8x \p BK:'7K 6'p0 ,0d 0( xp @P BK %'0SLxl00h 0( 00lx@P 0S | L}|  L垭`\Xd x2p 0@P QLcpTx  0S\0d 0$0XMQN | [ R@G X0tpW9 `X H `0Gd0PK |@P'P '4H0px0pst 40  0x0s ','8  0P+@P L@0S 0P(L$T TTihWk8a:a:T:a: 0-P@QL⭾Q0h -LM@P `Pp0s0s 0s$0sH0sL0s P0s@0s 0s0s00S qm 0P(0se 4 0R  P \0  06P40 C 00s 0rp 0h0 0 h0 p 40 Q Ph0h000h0h00 00Dp 40 Q PDh0h0 0 0h0h00 000^hl(0s (n0r00s -LM0(@KP4p` 0 004 0 0v 0000h tI Pg h0PL240 h0 0J004 @ 0 0400H@ x H40 N0 408 <0,0( Dh0@ 8D04 d0$04x \0 00@L0P@ 000 Kx0S 0S`X H a0C$0@2"@1Y<@00   / x0s@0! i0lj 0| (0i 80p 0rh04 0h00 0d0n0m -LM@| 0h4l00 0 <@00    0 0@@啾Km -LXML T 0 SP 4 @0UP Ph00X0 Px0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H xD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QT?PP80K0@0Ud @0jh@HD0cS0! d`PS0!\ lHS@1@!L  P0UCL0ST> @0Wx0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @ǤP,KP8 K0 PP`0K,08KݤPpPUX^OTL0$  JP 000EꠟC -XLZM0 ,0 p!  pAl! h04   KK#l `0S! T1 T 0@0NTlAPd h  T!20 d1 Ah 0 dp1t 2Rx1 Wc@ P L! @@tA l!P pt!x0b0a1 KV Sd00X\ 1 գPa8< l2| \Y1Q 0`! \1 0UP!X1 pR/KO?KNOK@tP K81RKDP @儁@08!H| cX!X! 0S 0PSW Q S0x p40 40Ȍ \p@04 .1KXP KK -K-[00\%(@Kl0S/:MKl! P !hAT d 0L\d 0 @` \! @ hA X! H| 0 ` P @pR0S S@0`1 \A @XA @壞`q\!rKV 1 R0dA0d0l` p0T!00b0p1x P Qڌ0 0C, 0R(Kx0sy 0@t! P1 LA 0X!MKX 0@@@`a \q 0 4(00 s<1xSX `H a0C"0n2O@ 04 .1KFXPQ-[(0K 01BR@0@`1 \A @XA m @%KV l\} pt!x0b0a1 KV SX\ d0rPa80 `2| PY1Q U P!P{A0 0z@0RU RU*ږ0KK,-1Ki-1[!00(@Kl0SC:MKl! P % 0h!`@pR d10CSd1 `hA@hA PUlx0s@0041 41 0U.1K U0KK,-1Ki?@嫝KV K>KXnK?VB? @Z(@叝t 0OX iD>;L:8 -LTMh hT h\ 00P hX 4SL P S ` | HO\0 PXx0@0 @X0R࠳` jX0P` e 0@0@T` ]TX\ ,0KP` UPXxH Z 0PM XpǏ p X4 PLPd`0@X0@031@ a< QT>QH @PTA 0CP0PP< c P\\ \8 \A H8 0PX<4` 0lX@Q  ,0X00`(KY  PsP( X ` 9 LHd0X0C03>< 0Cd D @ \8 9^ 0nSZn@ ^ZRQVt p0 X 0<0 4 ^h0 d RPHx0S*h0< R \0 L` \0b@ 0l5 \ Ql0 |tXp0tP` P `5>VNP1V0lR3Q ʧ Px0 0SXU L d0TpppҠ0 <H 00@p00P`Sm 0s] LX\ dP`0iZ! /P x0Rp:PxT wT}00 HX 8< Q,L0d 0S* 0P<0P00X \d L0XPRL 0Kd0 T6P< 0 X0MQ00MDU];0s<0SXX< 20SL `0X c51 a0 QV -X0L0CS@X0P 0P, P((P$,P h p-<0@#0 LXP` `R0`0 0S00ph -L@>P t !P $h@0Sl0 l0p0pzi0  0- LP X0$ 0X00H0H8d -@L P   P 70007 -QLMP P- K@K00, P0S0H@K00, PQ0 QL8dH8d -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 0㎹ R;W@0D0Pzi$pd\dX(zi -pL@` PTP <@p ` 0 0 0e07Lzi $0S;1 $ ^!\C :0S \K | 0(X$@L\":@T* 0  0@   N`0 @ 0  0$0LpP` #P0Ss`Qj`d0 0 0 0 `ib: Q-Lp`V Q CiQ Q `QE ?*00@ Ts 0iTP0 ;s17`;s @P `P 0gT& 0Y#Y#  xP ` pjx Q0 0Q Q000000` V 0 0i 0 -LCMq0  0 $ `P @R` P52` P`$ 0R& K,IK J/K0_`P(h 0Sr(`81(0@ R0#1K0@ (`Wi80@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 00A S@-2*Qf 1@ 0S'$,($,(T,(T,(+(d,( ,( ,(0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S RL8d -LDM@dKP@pT@D` @0S񟗾t4(l4(T4(<4(04( 4(4(4(0(0(0(0(4(0(0(0(0(0(0(0(3(3(0(0(0(0(0(0(3(3(0(0(3(0(0(0(3(p3(0(0(L3(0(0(0(D3(03(0(0(2(0(0(0(2(2(0(0(0(0(0(0(2(2(0(0(d0(0(0(0(2(d2(0(0((2(0(0(0( 2(2(0(0(1(0(0(0(1(0(0(0(0(0(0(0(1(0(0(0(x1(`1(0(0(T1(0(0(0(0(0(0(0(L1(0(0(0(0(0(0(0(@1(0(0(0(0(0(0(0(81(0(0(0(01((1(0(0( 1(0(0(1(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0 W*W$ KH$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ 0P:01WeWj 0P:0Sc b0bS] RP010W:0 0P010|0S4 0< 8oP 01fh0S 010c_]`[01@U0R0 K10D`L0 K10DF`DB@0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S0000p8dzi R000  B zi -L$M@0Q0  %2 @00S@0<5  0RK@00CS@0ʼ%8005 5 2K4 K iii 8 -L$M␡0P(0 p8#(`HK503K5P @T@T 0S 0ST@T`00@T V 0 03K5( 0R"$K0HK03Kx5 P soP P =Aii Ld,8 0-L,`@PQ \0000  `00`0Q0hY8d 0-LPP) @S& S嘨|@0 0w@@T 0S Xk@0P 0f@@TPP@0W@d8d4];d: -L`p;H0PU ,0S @A@PUhji 0-L,0P@T @T0h8d 0P c 7Z p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPPu@p0@ 0@@P -L M<@KP`p 81,` 0 P 0S@ 0S  @TKT00 ,6Q d8dzi 0- PR0000 0@ L 5 P  0h0 -LpP@X78!`0hP 0pq@P 0S@0S`L@h]zid8d 0- L0@SP 00  0@ 5 P  0h00S0 000000 p-`@P LP 0R ph?b:-Q 0P P P-@0 H0 D  p-0L@`T$@T %YP 0 RP U 81 SPUppph8di$ 0-H0L@PT $@T XP0000h8d 0-<0L@PT@T 0XP08d -pL#W`P,PU) PU7 0SXQ 50@^)*0 0# 0 0#^ XP Q  yXP PUP^ -1LM@ T$ P$@T {XP0SP 00P$ 0R! K@`T SP4pK` 0X P@T PEU;h8di88 -LMЀ 0R$0 Q   Q$ 0R  K@`T RP4pK` MX P@T PEUiL8 -L(MP R0`,0 2Q  R ` 0 0S0C`R `QP `, 0 Rb(KP0@1XR5LK0  opW7 VD0c`V  1P@" 0Y@p `FWVP0S <KF Y @ XVP0 0fP 0@ <K.  P `FXV @P 0fP 0ni8dX8 -LM܀0` 0V$ 0& P"PPP0@TU 4pK PU@00T00S ` {W P $ 0R K .izip8d`8 p-@LT`P@@T= #WP R000 0 0 PP 0S R000 0 0 q00CS00$ R( (080(0 0$( \Ypph8dL 0L0N 0- LP,w P@ @ W 40$    0$ (0@ 0h8d -0LSPp @T @T VP  D`P"  >P V@E0/SV09S@P 0@T$@T qVP000@p 00   00 ` h8d 0-81L0M0Q@ T $@T GVPP @ T(@K0 (0K'K@P <Pi@PD@K l @P <P@U@P 0RK0h8dib:T9p8 -0LS@ S 0SQ 0S 0Sh< UPT 0S  UP S9 0-0P@0PL lP$ P$00 bP( P(00 XP, P,000F 81`VH `VC 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P 40 P(0 Q 0 8dt8d|8dx8d -L0LS@  [PL  $1 0L0ahO(<Q -0LSp 00C SP@ 0S0 C RQP@T`U 0S U0S9 0`V`V SP SP0gS \ 00L S0gP ^0P@@\00L SL0!l/@!b00RPXP0S p8dgfff p-L@`P FPP  R 5p]@ p-ppp p-LMK`i@PP PP xPPP = -LxM␫PU, `p@ p;U h;Ua \;0SH`P <;U ``, 0R(K:UK 0UP :UI P` :引UY G:U1 N0CU0CUN*0CU> 0U 0CU~ \ @ 0 `5 0# `05 @|`PJ```j`9U: !f0CU0 0CU 0U% h9U`P1S  `4`y C9U k0CU 0U| 0CU_?P`e P` L@K gR 0K`8UR 70CU 0U 0CUu`PCLPK 0K`Pt_OGm 8U 60U[h@f`P(1S@  h0`TU 3R7U h7U?7U+0CU*0CU5zh7UM m\7U-w8`PP`+P @T 81Ro  ሁ`0@0T`0]@TZ 0 0 0S0 R4 40640 0 40 0R 00B 07`㰑F`P `PPK@ 0K`POO@  @ Q`P0l0 `P8# `  0  ! `  08 C(` !`PoP~ȕ`il0`0d `@KO@ eQ@ 0K ``PN5w l x$q< 0 \%x   rr`P4,$5Q6 PU3 0S00-d0S S S `S S S@ 0  P`g99`P `P )6`1%~1`0!81`0-`2U h0`0@"5 @5{@t 8#` 8 05 ` )8#'2U 2U`P 9`P 1U 1U01` ` [` @H8# P `p081r`0@ ` `V^`  P]`0@ ` `VI` YPKii$ii$zi i$xi Fixi i Ji8i i Ii i$i Hi i$i hiqx8di ~i i$Fi@6i(Ki -ԁL@\g P 1S 1 RQ[ P ta%0S 0S 0R0P 0@P0A!R 1 1! Ro\00RR  qBP`P  @  P 1PH`P  / P$000$06|8dt8d8dx8d%:`8djib: -L@000  0@_hj8d -L@00S0 0000@hV8d p-1!S0#RL:5 `0 P0 00   `00`0p`0  p0`0 0 @0 l@,\0@P `p0S phW000 0@@0I8d{i{i p-L0%LQ`U %@ 02phbpx8d -PL5`";5!T2T"1!p,~630 R 010  0 ` a aR0 10  0 @T 0 RM 5 Q 0 0R0B 0;[Q0  0 0S0C 04 %01$(,0@T 0 R 010Q@TYt0 !h0 R404 H040 0 40 lT(<(<(}iiTk8dx8d8dji|8dhi -LM2pS20 Ne00S P, h0C00 0(,0  ,0(@`(000 0 Pe0h 05U0d00H0 a0 p@B  @0PU0doYx8d4W( -L M<@< 04 P-  ZKh Xec:ziW(HH-0#" A0: 0 A  AQ0A0Awe,80@-PR@ 0 0!\!""0"!08@-pR` @P@@ 0 ,>#!^ """!1# 88   -"LR@ \0700"R p-@LT`P5 T T  p/p0S 0S0S @T  p3000 00   00p@Tt l p@0^  0@ 0000 0p8d8d8d8d -L M@A*PK0pK `P5BT+@T(  LP LP00CS0 R07004` R20C2 LP2 0C2P M`$K G -L M@p*K0K` DPP*0[0P$K*00[ BT@T  LP  {LP0007 /@P"  / +00 p2 S0"00+.B 2 02RLP2024P7P -\ \:5S0d0\-P41P0h040\0\ (p2i 1i i i -0@2l D0C"2X 00/0020SL vK @42ǐ@42peQd 0-2L@41pSl0 P4e 1d hfP0e 020D 0h14( -PpL` \81W(0 %g 0*   R P 0S  RP 0 KPL  KP11<<110 0@0@00@0@0@t04 !48#H) 1# 5  $3TT # Td 3T00S 0Sj ]i WKP i]㌐ 1 2T& 2Thsp2@P p0Si HB@ D0RW< 1 00Sa<`10`@  @ 5|x5F1@P p0SV rAt6|1@P pz0S7 b\A0S H1R0T4K[ &``P    kp;[H00H0?]L0Sp%m000 0@@0)000 0@@0c[000 0@@08d{i5݆{iTk}ii -LMp@AAP`2@ V\(KT 4 P:  dX 4   \Q 3 QXA@@@ R+ꘂ((؂(((((((((((((((((((((((((((((ȁ( ( PPv 804 0C@800 0/@6K @0K  @BK h_PP @ *K   XH 6K 㲁@d!1`RBw\1017@v 00K s"P12K@f0K 0tP 1  5  ;@T? 02KP08!Pd 4 U A@9<0!0 1SQ<P10Q!00@  !0@ 0 0@0@z=@0< ^0P2Kl 0 ?e`,dc:ʚ;Q0X0ᬁ0 Qp-LP` 0CQ :R  R R /pt0Q p%0CQ5@@05V (00p0h0pp2i i t( -Lp`P DP 5AUp 4 20S00 0@0@0O   R R 0.[/Q`m@ D0RH00H0}[ 7LQ`t[40 3A0 < 1 00S၁<10@  @ ~0P` @]0S E|P`0@ | 0 OP`P`b000 PP$q/c:Tki{i{i,c: -00L @P 6{i p- L`@YPP(  00$.0 h0%0 1!0 Td0f e ,cD 0p4@P3 pHc:(\({i -@Lh8d- 0  \  \ 00SP \`0S S S 0S 21C 08d p-` LPP0#U T @u T0000 0  Tp QP-@L`Ppp m Tk 1R% 1R`  0S_0pS000000p 0S 0S P` P qP;   R08 PpP`PPp X`1`!  ep @P@VP 01 @P@PV $&P00S`` `0P`5i 6i( -L@`p  P0P 0` pP0  0.Pc: 0-L @PP 0  T!-0P P 0 P-pc:c: -pRL` @PPU@ -L  [0P -H({ic: 0-dPL@XT Q|  &@ T0Q t{i 0  0S-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p p@- `P0Q!U 0Q 1 !@ T0 0# 0 0 0#\pp0 Pe -LMp, ` 0  ``0S@ T00 R *0Q 0Q  R 0@0S`0#0S0SATg@1@0T 02 0Z@T`PU"0Z,PU 0 @P  @T 0SY 1 !]PPU,0S@ OP@@0\à@-0@    @ @0 -L` P@@Qp >* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0   @ 0 p pPP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -L@p`0 XpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0eel(( ((Ȕ( 0-0LS@P 0p 0P 00h0 0-0L R (0Q0 R0PS0ho+ @P 0 0X0X Q*00Q8P 0$u+ s+ji{ic:eee{id:d: p- L@PT0`0 h00 00 0P0`@p TP@+{id: -0 LR* qDP -LMⴒ`0RPPP@@U%U〢xx2 E# eQk*0PSh 0RS BQ:`aU"0S`1 pqQM@!``07Vp9WX00S0 Pp \10@0 H1, K0D,0pS: ^!Q Q\ 0d 100 0  CPpd 0 00`0 R 0d1000<\*Z0N S{ieeH;d{i@80d: -LM `PpP @  RX@U TU @Tp R P 05 0S PU 0ES 0 Y Rp T 000S` 0 P 0SPP0 PP 0p0 00R )  00CS 00 ^ڿ0S  \ R0S P P  0S|)  p P @ 0St @Tz  dCPf p \0SP 0S:0S   0SPX `  0`V  `| Q R 0S g)p50S  Q0A 0 >\0P0\P Q  00CS 00S 0hd 7)T3)p0D0  ( 00d:e:d:d:d:`d:{i -LMP < @ 0`Q40 8` 0` 0<, K,0SB Pp- p@Q V Q 8CRPP0pS @+PQ (K T00S p0 S <0 00 0 V 8 ` 0 0 8000, @R? V 0 0@S@ @R4 00T00Sp@T! H8S0P ,0 SPO 0UM P`Pp@T /P0UP08#x0S5 R 0AS0AS R0 040 DP8 l ` 08#800 5QS 0 00pSp0 S 00 0@SU} Q 0 S R 8CRQ; 0 Sg PR 0S 00 0 P@MP PEUp@T@ r@Q R#3p0pS 0$'P(Pe:0e: Qp-L@`ph0 P PPUp0U PhP 0R Qr r0R@QPr0SQ * 0Sr0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"ey7 p-L@L0`SPP P0  hpe - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0H$H`UT0D@`fPUV00S@ PU P80080>dLd -@L `P pP 0 0 R ?PPU 0 S 0:: S c?P0 Q 0S R 0 S PUX r0rS f@P@P T 000 Rk?Pr r0R Sr -Lp`@r00S *@P @V PW 0P 0 R1?P @PP PP -rXLPpr@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T r`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@_%|e: -@00L^ R000 h$0  p-@LTP` X0X bP P 0< a!0S00@@p7pL;dP;d{i0 {i - QL`Pp0@! S 0S -PWPTZ Q+((H(H(H(H(,(P((`(($(((H(Ȳ(ȱ(H(-P PA @ P @0 P PzP$ 0S( 6dP.dPV X8P0 0 0P i ^dPPPP9P 0S  0Pe: --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 =P P  =PW  0RP 0 dP Pp@TW 0 qdP O(KYYp{iʚ;0 R0%3 %'T;d{iP (0 P0 QT;d{i 0-L@PP P0 A0{i - L(-00 R310 P0 T;d{i}i 0-L@P0P  00<0 R  R 2SX;d -\L`pP@P 4 #P P%U0pS*T;d@( -< LR@ g00CS 5 40 40 r040r040 -0L pR㐀` PP%U s@P P P #P4 #P 0`S*{iT;d( Ȱ-P2 S R 2 S,00CS,0 R0000 0  X;dp@-@` 0 PU1! \ *0 00\: Up lp@ 0-L@0%PP ""0  0 <0 -0LSP' @T=@T O<P,00,0@Tp, "0R8@#xT0W0 `P c<,0T0r,0  @ 0``@00 ``pX;dP -`pL PP# 0@T \ x0$ @TP0S 0Pl 0S {iji}i 0-l@LTP#l@T  R 0 0 0 R 000 0 0  0S0C0 g!l@T0{ie: -`p44!L l@ T\ P@T 0S R 0 0 0 R 000 0 0  0S0C0! X P7 pP `l R0 0l ` 00  000 !`,dd,d{ie: P-L 0S 0C 0 h!e: -@PL0 80CQ840Q 0 $ Q00C0M@P 0S0C 0 [ Dh 0 (h !!{i|if:e:e: 0-L MdP@TX0T$ @@0@@ 8l,00K0~!`;dLf:{i{ie((f: -p0L @R  tP 0@ 00@ R 00`;d{i P-LPP:0A P`P0  J@P ̀Pp  p !9  !3`@P0P  80P($0 0oX{iT;d{i -LTM0P,0 ᑼpKt D @lP 0P @P 0 @TT!` 0p0`p 0 0S D  0lP @ t娽,(K,@ 40 800800 S 8 ,0K`P ,@ 80p080,@T 40  p D 0l0  d 00h0 <0S 0 \ @0 X <04  {i -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  pk@P9  @0 iW  c)dP 80S0C80$0d040, ;Pd T00X R XRX  06F -Lp`Pk@T 0 R P@*@P$@:@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P P4P 8Q >44P30Q  R 004PPP 00 q4 -LHMǟPp, !d @{`P/`  000 0WQ W W, 0`0 dQǟ, 0`R(KZ Q 40  @0 R4 @040  < 8 40 <0000D R0 00NK4,4X0`0 0 P F@P7`  00Y40 ~100l0r0Pr l7`   @PP <P  PF @0  @P= 40 = 0dP 80S0C80Ń0d0h R800C80 h P)40@ 0R40 0S  $Z000 ` @g80Sb080` ^` [` X  `P P40740 0RX0 f {P4,P  0 W0 0@ 0<0: r0 X0 0 PT d PG0S  Z@8008040 L  @y007 P dP @` l @ 0Sh0 q l LLl80l0r 80r hX V  P qP \P4040774040TX (P\ # 0S0C 0 40 hP>dP; W ` ,P` 4x40 r0 X0 0 T \ 80S\0C80>TQW@0S h 0@ 0S0C 0 0@ 0<0 0 S l m  l e g00CS540040 r04 < <4 r0i|i{iL8Tf:hf: -<1LHM8$1pW- PU' 0 0X" R 0 0 0 R000 0 0 `V 0S0C0PUpW J d(Kl@KDj0 0h  r d,d{i{if: -LHMpPU$  R 0 0 0 R000 0 0X  `V o0S0C0|=PU R000 Kd@KD0 0`  r s{if: -2LxMP 0T0 , 080 Qp` d @KD0V0h0 唀 dP  0_/NKl  T0K @Vpu 0, 0R(K _? NKl  T0K %pPT@T 80@ 0CR80 @0S  @ 0S0C 0< @P 0<0 0 S    T0Q'0S$ PIP7p @ B pP800C80 @0S| PZ *H0S3pApoPT@T 0 80S080lZv Hsif:X8 -LPM`PKpDd Ad@ d0K\ T 0 X 40 r <`p@0 0OTd 80SK080d4 -<0LS 4@P  # -40L h0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKDxpK t0l hp d T (K 4P,,@0T P,A@,P 0S 0S40 0A@P   040,  0P, `@qopKDU(0K#x`pK8 <@ l hp d @` @,PP 4`P0t03{i{i{i -L M@ 0tk%&l0l Q  0S0 QPKg:}i|iji{i g: 0 000 p-@PL,`T*^1 @0 CS  @ Q00T0#Sp p-P`0L00 p -L Mp 4  , 4  RJX 0 Z0 PP 0`@PD 0 10 0BR0U ` P@ TXU00  S@2 ,0S/ 00S 0*0S' 0T PO |P @0 S,  4  R R000 ղR000 Z0 P P00PUP U 000004 @ (K 0O -LHMlKP DD1pWX5R pWR  R@T 0 X P_0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P?0`S P 0S  00$l0 0P 000@TT@ L@ `@ pW(K 5d081 0l0 0 P0 008d -L(MP@P`0AS`(KHK ` 0`T<0 H D 4 @ T pdP 0H0L 0CPS ((T((`(D@QPALd``L_0PP<0@ X < : 400hS `300  `LE@`U @%T Q0P U`P  ``0 pBK K ,0K21C0b ?A1c0{i(hWkgfff -LpMⰁ0`S( @2 PKD%< 00 D\0   @0|0 x 50p0 7S0 `;0pS PU 0S( 0R1$K 40JpK""0J0KP  HKw2dp 4 L r0(0 080<0< 0帠 0P00000i`8 -L M 0@0 S((((XP,P @DP00S@X/ , @@  ,Pp @Z `Q 0 70 0BR0`0 GPP$p W@00P0, 0 0(KP@,P P@,P P@,P ; D1@DD 0-40L@0PP X 0^XP C8000a0h400400hMt;d 5U0$00  l0 08! t R00 S W&  00tlK` d0 h fPp  504 000r x0  0 l0 08! X4 0 00p 0PU|}i;dt;dd;d p-0L PRp4`P @5d081 0`0,P0$ $0 ph|}i;dt;dd;d -LP ^@ P @00 `p0Z 0帥,嶠T 0 @0 0mf|}i;dt;dd;d --LMTP @ 0U, X0 T@ @  0SFPP 1 0S p9A, 0R(K `V0S+pWV V(p tP7p  0b@d 0\堠 0X4  X   Ve\W ߳U '7Tx7pv-pZq ̳mRp 00S0 0* ?SKD 0 K0  0Rl0 0#S0S 0#SP)  @P  0 S*`7p0S@ 0  8  e@PUpP `p-P 00 0@S((4(4((((4(0`P/pU  @P 0 `pIP`/80080Q 0 0s03R0#SQ{ Q2KpP-Q 0P -Q   0PEpP @P@ } 0S0 y P` @T @P P 0S  K@ 0S0C 0< @@ 00 00 <0mt40S 4 00 040L $(<050r   400@0S 0S K0SD0p@T U$0T 00T00 $r 0T0 PP Q  `VSp @P @P R~ 4 0@P KT0KpPT`80080 00 0 00 D 7SD 00 <Q 0 @0 50@0|0  |  0 K0P  ㅲ@P  K@  K0@04 (0,@ r0L0 0(0 0$N@K"c"0N0KqP  LK,p@ | `@Rf r00Rb 80p0800S K T0KpPT R L ($.T `800C80T0DT r00 0T <050T 400Q@ 0SS<70S7ihWk;d|}it;dd;dt88g: 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S<000S \ -8LS@ 0CS8 05 8S05p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#p08P0L0Q00P0S>S  f-R(((((D\ 1 RT8 p-0 0 p8LS@`) l8PS (((D(((P(((:0 00CS((((0:0p080p080p080pl8S 000;08X 0\<0<0\8 8|"R f-41 \ Q8 Q-L QQ20@Sd(l(t(|(((T(\(7P"  P P nP P,$`0 lH qPg: Q-L QQZ$P> 6P? P? PG 0@*S))0)))))))@)))))))))))H))))))))))))))))))))))8)HP 0P   `P lP`@ 7n dg: -LHM@ğ0@P"}`,0 . 0<K p h h0S]h  h #0S: 3 0`8 Z <0 "0Ql0 @l @0Sl0 P P 0 `8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q w1rGrT@k8W),0`JKd8g:fdg: 0-8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0(00 @ C0fd -X@LQS QN Q` Q`  V`!0S6  &pP VK  *z  P<, P PP@1 R P48 Sl8娨4S UlX %00S\8<\8 I4``V0 Q2 RP\8<\8P 0S8X p ``PdfJ -@LJ9V+"" R222 hC -LMp f2i 1 0u `!P0`00` VP O0S 5IP? 0 `0`H  V P`AP1 R!  0@!0<)0TL1 Rd  d 10b 00 R" ?2p+I0~1R7 1R7 = Sd 000 0SH 000 0S, 000 >S 000)dRg:f;d:0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫`8>-  0?/ 0 ? 0/? 0/? 0 2") )@P&)))))))))))))))))))))))))))))))  \8 01S]="!B10b%=00 0 == p-OLTP`@@T 0R! ;&P V 3&Pp -LdMP,!@0|  ,0 p` &P.xK   rK &P&lK  LK0XXL00 0C 0 x )0C| P, 0R(KxK  @lK `i))h:8 -LM0a b0^( dpc ^( 0R)$KV#NK 0F89 cHPK1 u#NK 8Kp | 0,i8 -LM0娑Pab0^, d@c- ^, 0RU(KVpfL@H$H"00 GB@D@H$hOK  u!008#_ #<" a0b1p    Br@ 000S0 LPK OK <K    0 pb Fi8 -LM`V, @ p& 0PK0K`V0[ 0p0K    K V@@K , 0R(Ki8 -LM 0`  4R$ pP# R R $ 0R, KOK ! QOK QOK 8PK XQ di8 -LMx0Q@4`KPp $0 P W $$$ 0PR Ki 8 -LNMPPP$ `pVOK   DPK  $ 0R KVOK . P) %DPK  Li h:,8 -LMO`TPp@@T 0S $PP 00l8S  ?H ©P @P 0@0/@D ?@/0o@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!/0(K@ p   YK VL@K a, 0R(K iD8 p-\8L`P@9 0K 0 9 < 0R>:0 "#A10a%=0 00CS/)))))))))))))))))))))))))))))))0 0  0)S0 SCLR0S 5p1S]/phphphph  0@8S"!B10b%=0 0 0C-LS)))))))))))))))))))))))))))))))]5h7hJhy h -0L0C@S )))))))))))))))))))))))))))))))hU" P 00CS )| ) )| )| )| ) )| )| )| )| )| )| )| ) )| )| )| )| )| )| )| )| )| )| )| )| )| )| )| ) )h/ -OLT` @ RD0D0D0?@ D0H "OT%] Pp"W 21C! c%- QpP@  !W h! -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>q4l080S* @4PK   X K0 80VKW0K  PK JK0XK  BD@K. n!P  .2`p唀@@, 0 R (K\@ >0>&4iT8 -L(M0p,0 @0 @00P K080 PNKO0K[  HKW BKS PK  B | m2P  5PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0    D    0 0  00 0@0@<, 0 R(Kt> 0t>3Cih8 -LP@00 0-LP ֦@P L@0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @ OK IK0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90Kd h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@KfY0 0 U J40` YPK 0 0# 0Q`   0 0# 0Q  `ҩl00 ,l000h@p `lé, 0R(KAK ;pK}0 SG0V0K`^^ei|8 -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *0}3@P@ (  f1P0Lk\ 0T@K 0P S  b K @DKd@K @ DK @0@00t K6PK5@K 0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT Kިx08#̠DK#8t K@x0 6K50KѨU|eP |  @2Py 0kR 07 0R@ @ Y TKT K⤨PT0Ed@E 0TEP0#U 04@K|0 0TK PU0K1A, 0Ra(K; 11L0 0. >0>}1 $ 0S0 10PP =11L0 000S 000010PP 0S: d>0d>J1H100 >0>>1<1 71@ d>0d>.1i8 -LP@C00 0-zLP i@P  I@0 0 -LtM 0  ,0 00 2P   0P 0 iR 0 @ 0S p+0 ,P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0t>// t>0t>/{i8G-p#00`400$M400 0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ88G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#008 -LM\8`p 0 wxP 0 031C0SlY Y\85\8  0|倏x? 0|倏x?|O_,0P90,9 0  ,h:<`i <) 0-LM8@SP 88 R 1S00 08h) -L(M@p`Q=)=)=)|=)8K00S0,0K00S00,0KPPK0+0K)0K*0K  H0  g@ >@T d(K8K  2K 8K  2K 8K  2K  8K -L\M8Ft 0x p ,0 h l tT  0RkhT 0 @j h@00S  P` | |0@$$,0@H p#H80@ L#D<P`x0|@ 0@|D p4Rd ` *t0Z.@PX@ 1 t C,P 0 BkR 0 X 0S X hT wX00@00l@!!R x@d0 `,X!8X8U.h"H l0x@El0⠐!1 0 1dP@K8#8  lX T@0pdXGtTP@\  0@a0g T@! l0\ dX\ p.P@ 0W 0pU` -P`v kX RPP B; -1L  t\ @PK 0 + 0l \ 80P[l04@K!T0X P^xdK0 l0 !!tv,, 0XRd(KE pt>0>g,| $X h00Sh000d`,XX.hE =X,1XL0 0ptd>0d>@,X>,X V+lxE⠐2pp>t0>,,X*, X 0S:t!,X,p@>0>dKX ,X t ,X@ p@td>0d>,i8 -LP@00 0- LP@I?P l8S0 0 1!1!0 0 -L,MP T p L ,0PH0  T *PH0 0 R H 0S TH < < 00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 ? LeT< 0bY[H@0`pD @0 D@b 00gT@! @ID @   dL0gY@`p @D 0WpD  0VPT,Pg PY P P U`` P   P L0CoP"88 KL0 1; +1LP P0H@0 ) P,P3 0 0 0PLP!0<T @ @0L 0@P 0$$$$ P @  L0H 0 0 0 T*H(KP Tt>0t>*H*0H0  =H2+H1HH L0 0PTt>0t>* -L,MT pPP 0P,0 L T0` 0R<@K  9K  L}T +0PD0 T )PD0 0 BkR vD 0S D  D0 @  fZTPITD@PH  0@a0h T@! L0eH 8 dZH +P@ 0X 0Up `M+Pp? kZ RPP`` B;*1L  H P@@K 0 V)0L "@0S"T*, 0DR,(K =Dl*D1D L0 0zPTd>0d>)D)D PTh>0h>T)D P Td>0d>)yi8 -LP@00 - @LB P  -L(MP `0P L ,0 0H0 *PD P (PDD 0 jR 0 D 0S P@D P H0\ 3\H01D0, ,400<@K30  9K  HXP0eZHD@`P @  0@a0fT@! @>@   dH0]Z/P`@ 0V 0`Up L*PpN jZ RPP  B;)1L   Dp@ 'P%@@ 0 ##Ƞ#\0PH0D 0 0 0 P(, 0DR3(K00 Ši*P 0p 0LPt>0t>(D(D =DC)D1D L0 01"[@L Pt>0t>( ci8 0 S00RSS   -0.0RL > @0#200   N000N "" N04\0N\8 2S0S ,> 0,>0S ,> 0,> -LMl8@S 83 0S00 =$  0 p-LlȐ@\P p`8  8S 0S=0=p` 'P =0=p> Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00<0!0 8Sh<`10hD( D(> 0-LM@KP ' VP P P K0@K \ ?P00CS(0,> Ld0\ ,>(0,> W 0-\PL0@  0S0 -00S 0p0;00 - 0L S` "!@21C0d!P2Sp 2S? Kt022S  Q o02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S2Sbi 2SVㄅd5S @d5@P-&0f T0@f@dF0d5 -@L~h84]; - 0LSP@ \>lȐ 0\p`\> \  8S 5h#!4 0OHh: - 0LSP@ X>lȐ 0\p`X> \  8S 5h!4 0#|h: -L,MPlP >0>(Kp8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*,>0,>H0S 0SD0H  T>0T>PL 804$@0<0> @0Q>q @Pl"0002 R 3 \87\8 \87\81Q3#541 R\ \86\8 !000 o5 \1\TA@08 #880s8 S808D>0D>UH` 2SD` | SyR,>0,>s+@K D sPhPf0Sc0< S < ]< R pP @ 000t0\86\80D < H @ Lf0::h: 8 -LM@lPP p8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R <>0<>,>0,>;P0S\88S 0 0  000P  pLPPPP p-`LQP@ P   p 0@S R p -LXMlȐp\x |0  (Kp8S @P0"0S 'PH>0H> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SR,>0,>+@K  JP0` S ` l d p h ` ,>0,>l0S 0SpP 0 S: R <>0<>|;"PPx(0BS @P! P 0L>0L>aR6 tX dP> 0P>00x0\ xJ/Pl h0xp\86x0= d0S ?` R ?E(Bx 0 :G P 0xldL KjPx0d04[SC +x0J xx R sD"x0<0| P0T x 0|0 c 8xp p \ L K+Px00`0\ 0xx0 x6T>0T>nȗH0  4[S *d@0 <0Q)[<0@#[ #[  0@S  ^ H 80S\8 ^( Q& x cP7H @0xRR0 00#[< 20[0P0C0S20K}  x@PPg20[.8 -LM `QpP@D @>l(0R@> KČ508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 X :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*,>0,>xQ 0S| R 0p S`1r'R!0>00> p8S `\ Q4>04>`010 5. @ |02PP `P l8TP S 3  p R  YpHT 0S :Q ;@:0 |0  ' 0@ 0  -5>0$0#ḃp0X tt0x @l8S  UR; 2S8  2R ` c0S hP _ *S[R 0X0 V2S tP R SOR,>0,>I+@K D P>0S dP : R7S50lSl /`8 YQ x t ` | p l h d X )l8S \8 hP ?TdQ ?600`p8SP8SMt0XS ,1 R \86\88Xt30( ; 0 Q(503l0S:  6 `P P\86\8 L KP00dPH00@  <008 < #[  hL KPh@ 8f -LMpW( F`(K(0S(  Q 0  0@`W1(PU !@P,  PfkU; !1L (0S 000C `b 0 @P  P  (} ({ w  q  -LMP\, ` |2S  @2R >0>oW l(|00 @R|0@ pVZ D0P0W0SJ\8 1RG  o 1R 0@? P 8SV4 p`!1R8<0!0 1Sq<p10q!V ! 0 0@0@/00@0@` J, o)t 0H"pP 1<100 @0@00 @0@ꈎʚ; -@L 04"48#hV1ھ 0R p  PP # 9g@ 0SY$@P>0>0S0S ~`F>0>mꪪ -LM` 0PSp :@00S lw)w)w)w)#$PP>0>#2K 01R0S= 0F0f8#8 $#$"KC  00 nPP  $K2K  ,K  2K2K  {,K w2K  q,K m0SFKꪪ 0-@LP000h/ -LM`1pN#28 ,0 @P0L(K2>Q 0, S PU @0 0@0@`00 S0 00#  H P00  A P4 U 8 000 @4`n`@*0S00R0@Po,0ྟ ` -LMP p@@T0 T*   ̑P 0 $aO8Pp@e 00|  `P@ X 0|P(K(Kotp8Sl8S 8$8h:[) -LMlhpV80  PU=0= X P  ラ(Ko)@=0= < 0R40  eU=5, %02=5:0S@@T 40 S00P 0 <0S p8S T10#00"-40.   0S=0= p8S 80 0 08 lhVa < 40R  <\l \KR=0=Fl8Sl>0l> p8 S@ 6  TT T 5P  1@ 80(Kop8S `' ! P98 SE >0SU0  0>0>0 0@X0@K(K`8  8S0 u0S0u0.000l8S00)~){)0){){)~)R =0=#Rp8S ' P =0=Rp8S `' P8 0!0 `0`S \8 ( 3 "0@. >0>>0> P P  \8P 0@L0@ >0 >w  P>0>n P  H2 "% ,0 (KoeTPT>0>00@  PPu0Su0.0C0 0S 0 BQ.0S*<0!0 8S<10D( D(0S 805 Y 0V   P>0>U L 1 0Rx |   00C00 3 2C 0%R &80  0 P* ,0 (Ko P 8 00 @@ P 00 0P8d -  jLMp 8#800  bp1*"*RX,  P`M @d20\`, 0 d%0200V0 j = 000d 0R 0, j dő "0h00 0 0dő*2 0R j  $0 00C:0(K -`rCLM gŞ8\P# &80 083 <   - 00c:#: Sʲ00h:#: S>0>@gV@8 00h:#: S  0$KmJ -0` L p# @T  048#  10T:0BPU @0 4#2""0EPU@ 04#2 h -LM̂P` p0 0 S-  0 9 280 c0@Č, 4 0Q00 l \8  <   %80  040 2(K!0S:1  &8 480 c1 Q051Հ5X8  S @bV>00V. x,0 0E8@S`!0P 004 0C0- :0,40 0 #Pd PP2S  P(8  0b0 %,0V0 <   | 04 0b:#: S40 (KobD0Q5Ţd㷍%8dUw''4B* 0S00\ \0S0S *)SS-P\2 ڰ\- ʀ\# \ `>0`> \ 0\ @\\ \\ \0W)0z -LM, 240 4P,08 eV>@0p!"0 =- 0 0cʠ,ʠ \Jʲ 0j:#: S6 0b8":#:SXP`M @d20\`  0 d%0200V084 b!00c0:#: c ʠ B0Რ,ʠ48P0n@ 0d00" R 0 0@0@,(Ko, "00  d50P00 d5" Q 0  \84 b dő "0t0 00 0dő* 2  Q804P, e  0 00C:0(K 0-P@L ! '0:0; 㾿B0 [0C\⸿%#53c0t0d >u & 60 0&(0 l (p08t (780bd -`PpL! @' :0 0;↿pp0 0\4[BCyR8-S0T n3535t0c0u >d 0l 6 d0&06(l 8p0(0t ȗ x0Px00x08Sx00x0bd -LM☟?\, p #x?\ =l?\ `?\/ T?\%\85`0& 000/ݑ@P 00 `>\ .>\ ]>\) >\ >\  0`, 0R(K>\z x>\ 0\J x>\`8@ d>`㳀ᴁT>\1 EH>\ @>\ 8>\=发`P>P<  P1r'R!| 15>008<9p8Sl8SH 8p R 4`=\ 0\ =\<=``P80 H=\| @=\E 8=\<I`P= RT `8: \8 ;4`\8{<\ <\ <\l5+8`k<\ <\ <\\M@K! \p8S"9  LKM0KG! `M<< @R`hF`D;`P>\Ș  0S774`4`\8\82h;`P,@ NP\8;\8l8S p8Si\8  % ' ;P4`:ʐ`P `8 0S\8 <4`\8\8^<000=@00Pp0S `:婐`P0SS0`021Cc `PpW@P`\8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0` W`p8S' v`\8`900z\8`#500(00qp8S3l8S<e`e48`P_l8S\ 5A0AS2`WT( p8 T( ST(  08 20C(吶`<7`P6MK! `P0M0[ SN @ &M [)LK4`  0"-P`7ҏ`P`8@ 208S64``6`Pl8!S \84`20\8p6孏`P0S \85\8  4`$6嚏`P`8 W 0S\864`\85刏`P[@P 8T` 8S SU S` 0X5g`P*`l8\S >`1 5T`Pl8SK @# P PW x0 `~l(R \8KT % h`r4\) 0\dP# P@P 0{S`̠K|P 000O@PT 0|PSP:|`E  | `P CP  `:8pLK:0; M0K$`-\85\8 $4`# `00CS` PN R4 0S1 R b0a ! c%- Q 0S00000ac00 4`P `P P R @ \8 B<4`\8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?\84`6\8  q`{\8;\8%  hPd`n<0Qj 8p Q4`e0` 8iii 6i(i8i4hWki i8i$i4i i5i iiiiii|i  05i: p-LP`d%R @0@S d% T0d50`V0Pp p-l8LS@P9n0S( u0S.00C0\8"0 R$ 0  2S 0 9t#92! !00p08p+f,i: -pLP@ 㟃0p1 -L@h蓃 -0P00p00 0`@ X1\A00x|L B B0SS0 h  J 㔾0<0h -LM>Q` 'H1pW:tX!^3 9 S02 @">)t")"1110S'  2S 00 08\(0C1|200 0mml@ xf -PL@ p[`( \[ V @[0S   [00[0 m > a0 >[@ -@L`Pp# +@P @Ph辀 -LMhP08pl# @PJ 8S9S7 ᢀ00 0Q>J0>X@, W(8R/0V 0S`lQ  q30 p8S 5Q !0 l%0W0"! 8 S 0 oQW 8S S 8;SR 8S S P 8S S 8S 8;SDi:li: -(8LR@`(8R p-PL~#M`@kPQ phLp -LQ@ 08tP00Pށ₸ ‸ h| -LPp`@P ~p0S  0S 3 #0S R@:0S  0-LP@P 40p0n~0000d H 0i: -LpPY~`V~@@D@T8S h* p-@LP! 㩼02 8  PD} <y.~`#  808phjp1*hD* p-L@`4PP8>08>   ''y8p p p p-L@`PP8>08>  p 0-@PL$ Y0p1pP 0h0 L p-08@!@1L<(84!41(8 $1Q( 1@(0 1Q0`0 >B&PPt" `8 p0`B 0P0P2  | lh ph۵XX PLDPd)p)x)h);d)E*)`)i:8i: 0-H/0L000000/0P  \8 00000S /000000001`(  13` 00000000 P  R⟻ 0<0 p-L`pPp1rGT@<)1@$R@ p0R@l8SFF \(t10S: :  D)@R :0RD @\ 7$ /0/0@@ @@)@@0SS S S@@/0< @@ 0 S@@`8   P@@p @@@@@ 0'%  \P\\ @ ;SP@ -LM\0p-4K , 80 4PK`Y @'0' <0 0P/ T \P , 0Ra(KX@8KP*\80\8  [@TN 8KP/08 48KP T1@!P@T P00P<@0@   0`!3 '+0 <%! xXh @ P\8KQP < 0 4i:j:(j:Xj:|j:j:l*:j:S;<8j: -5LP@h\80\8p@ O[Y'p !T Pl8S\8 l'00'09 :0@ ;? @@- D10303\8 03\8 !    >/ ?0/ ?0/@ `8  00\800 L @p } = :0:  = `8  0|r00 ڵ0t% ٹN@0= ۱=X< 0\,d`<= j: -L$M☃5 p$  \8||# t0X8#]S\8P0\8l8@S P`GS08>U@ 8PSPV 0RU`@V(  Hp2\8 0108l(R9 0  1l8S\8  9S(PT(0S  ީ0T8 0CT8֩X80X8b$ 0RV K T8  DK!N`P p 0KQp$@U0@$@E`P\  r7 S1 0K $0RS1\ 5t{<\ 1r' R! P:)ij:L;j:fT8 -8]p`LpP`V5n`1GT@ \8 0  8p RhQG8 p` -L@ h~ p-LPz`# @P |0S8;S08P@F{ph^ -T(L@'l8 S\8>00T(.\8>5 . \8XX  P0Y(0(00 (0j0X8hlj:L;k:f -0l( @RppTLP`> T3 T 00SX y p@PzU. y000z0PS S R  '+PHRK 00S))))W 0S00l8SX HPPX X '̷[[ Ƿ2S  R RR 'p34 P'p3~w88d -l8LS`p 0 X"y000ezy@#PZzUl8SSPP [[ o2S  Q0l8SP 0.RP P PP 0.R 0.R 0.RD8 R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQl8S S \ p0  ˌ,40\00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@f8*0 0 > \ R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-`8L P@+  0 0S$> R 0  0S%<0!0 |0SxP<P10|P @0u0S 0 0S0 R>  0000  p--0P` 0 @ 0 #4L0 ! \\  0#40 ", 0#80 "$ 0 000p  0-20P0 @P@D@L 0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ ᯵p`0`   0-0P0@PT@#@L ᓵ0 0-0@0@ LPᆵ0 p-8L`#Xs@P   ;0 B 0P lp -(Lp"hYPP @  K0 B  0`R  N -(L"H<P  0 0 K -(L"H*P  0 0 K -LhHPP&$x 0 $L&  p@开 -LMSPp" +@Kp 0 0  00CSP)<)@)<)<)<) )<)<)<)<)<)<)<)D).@K ۴00P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pa`8 R(K00P @`  㔴00@`  ㉴00 (@"h  |08#h&4  0`@0P`  j00`P  _08  #hP00P00P{ L? S0C0P <0 0R  <P 608  #hPw +00 (P"hi88k:8k: -"0L@M+pK0`P 8   00  0d0C08 0-00@0PL00C0d0C00 p-@ TL`PP T000p; 1phXk: p-0L` P@P 00 P  0#40 b p -L hP @P&x . "(0T0+0C0@"4& 0p 00b0 0 -L H` PP$x 00$,0CW0@p p 0$$@ 00 00b0 0#4"B 03#05C40 -0Lp @S`P% P" l d00!0C0 ?@Ì,40O2 C40  0#40 b R0 R S * S 7S,4 0,ȠL,4 0,Ƞm -L[ R\8P P\L@`:V 0\8%1 -\8 0  00c0 0p0  k0   L0  z\0  p0  e 'b  -L`pP<0Ȁp 9QA0+ Q00 0 P@P ) 0 S0  00c0 0&0     0- @=00 8PLp0  0 -("x![@0T``DLW ;40T 1 #   P `P(  W'40p 0 0#4[@000,[0 S@W003 00c0 0p@  W003 /   g{  -0@L0p0 -P\L:0[2` lRppQ@@\L&" 0< R 0  440\ 1 #       bpP pP @00 岀< 8' 4 㶁:#" 3#4!0 )\8-  [@{ l8S50 R5 [0S*\( 0 00`0c0 0;: ` \( \(\(-f8d -t2堈 PlRL[``pP: \@@\LS 0<O ^I 0 E 4 40\      `P1 @ ᧨8#  ȕ 3[#4 0: ;  l8SA 01 RD [0S5\!* 0 0c0 0(0 C\ %9(0 Q\ s\ @_ 0 R f -LMQp`x PX P @ @PP`0!P21    ' `8  VV?0B 0@005l8S> <0!0 7S㴧<10ว'0 5'$Kl8S  PR 0"A_p`pPst0 00d V 5 @0 @   7P b8$8k:xk: -LM@ P 0iSS2 0 S@Pt>0t>! 6K  ቯ pPx>0x> \8! |2S3"[R>0> TW 00@(K00Sp))))08\(E0@0 P0`U  ```"[  @Pt>0t> @0PS00`3 < "!0< S2 < 21C0b10"R`< 0<<0021  ,2  "[2R P < @ 1 "!l8S񟗁)))))))pxPLpPM 08pyP00  ۮ' ׮0K Ӯ\8  1  0@00l8S pX00' 㼮0K  㸮  㴮00  㭮0K  㩮' 㤮 !P0@0p/x*p000mqW0 x>0x>ꈎbk: -PLAAP@`p Q!2 rP& 0iSS"`V0 p`8  0S 㲁o!1R1 01&q0Z7 0m<p10!RA<@10A!00@  !0@ 0 0@0@5  pk: -LMpQ@P o000p@UG ڰUJ PUz Ue |>P0|>&U  U 0U("(`P U7 U((0 `Pt> P0t>U `P 0 PPX䈄X`P8((#8`P l8S ("(g`P 5 !%0 0x("(B`P 5 !0 00`P pl:0l:xk: -LMl8SS, 2l1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, d1S* 0$ ( >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@dh! ,@0l1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kk -LMl8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#LpX!4pR >0>\1SP>0>0   00C8#8S0 \ 00005 !ޝ ,00 ^ tl:\l: -L,Ml8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 X1S*80 H P>H0>8@ H HP4 H(  04Pa b04P 044.J@"!Bb%=00.D 00 , ӣD HI8 ,@0L9P@H0P9F E0@$@4`D0@Ap#DPC 4 p0> 0$ H L0 %Pa b0cP4epX:d d`0X8 %< % *0PpX`): 0X%:0SR+@K ᥪ P0S0>{X1S:<Qt L <04  0Rk0>1 S p ]O Jx 7 P' 000l8Sx200Sx2 5 0S00KhT0|2!⛚ L00@p 0Khl:\l: -LMTJ l8S, 0J, 0R(K`1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp: >0>X1S*(9   @B P0΃! lpKJ? p P@-P  @>0>T@ P ZP a b0cP4epX:d d`0X: S 0PpX*: `0X%:00S0S^ PP Ro@K I xP0SP  S83P p否QG R 0SA  Q 1S `@5 pQ  0R  00 0    ;P^  KP 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1% < Tş0L 0 PPk :  04P#  | P r@K ዧ P0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O W1q刁x1PQ B  Pp3#  `VX ˿  0R@@"!Bb%=00 0 & HI0P)L900P9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 X\) T)0@   P@PUZ `0S9 D0D8S221Cqpc%=00 0 ɞHI0P L9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  T)`~p  P@h 000  L0  lQx200Sx2w0|2qi8d8l:\l:8 -LPMtPlPP, `@p00CS, 0R2(K!00 0BτlK/JP3`P>0>❡00`@ pQ 0 R 00 0`c :P5a ᆗ$0 0i8l:\l: -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,X1S  >0>(K\1Sa b0cP4epY;:d d`0Y40%0>Ox t0Jo  㝤$t L00 <xx X1S>:i8l:\l:8 -P0o0@0@pL0P 0 0@0@WG i0bS 0bS<0S>0>0S; S=  040\a0b $c Q00\0S 0D 0B8S0SS#R 0Q' 4'  4 8  $cpPd>0d>0S0S1S 0SRjpP   0S   y   | x t -"0LM'`K0p?0P0@ ʣ ƣ 00 0C 0 "40040 "880 "4<0 !D  㥣8 -"0LM@'pK070P0 `0吣 ጣ00  ㆣ8 -"0pLM0 0'PK00`@ \p l00 @  1S0000 \ 8 p-@ TL`HPP T0 00p; g1ph2l: -L` pP @a @T2 0%! !P0 0 0S000 0RR$  1Su 0S q "40 0@ C Cq0CB#4Ac B a0b + ?PdB!1RE<0!0 1Sq<p10q/00@[0@@0 e0S00#$ @ ^0S  0 400 0  P@d dㅞ!1RN17@01@ ꈎ M-LM0, 8 #X40 0@ (P( Z c @ 僚;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@%,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!ⲓ0 6 $Kl: -LM` pPK Pc _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 5 ?$Km!f X00L 0#40  00:4#(#< $Kl:l: -L M0 0S` 02="!Bbo0%Sp 0 00  0 CP,  ,0Pc ᝙V?0 @X1\A$< 0\!c@"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X! 0S\  10, "4F0E04D0 "88C0 "4 `c _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0% ? Kiz!< @004 K?@40l:l: -LM0 0S` 0pu0S^ S0 0S0    'P l Pc ი1BS brpV?0 @X1\A$< 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D  < 00cS3 ( 0e)$ 0 0%  ?(Ko"!B10b%=0!⭑0 0-@ 0@(K(  "4F0E0 4D0 "88C0 "4  U=*<*8<*8<*$<*U U 0w! l8S S w S SG^P# @P 00 0@Py_l8S 0 8 R' '  770C0C777 10P RZ 10P+  R( (  D8D80C0CD8D8W_ Wf00 0]5\!P808M RZ 0 0<W:00 01l8u\8, 00@ $l8S<1Q  ⌗x000 l8l000 0p8'↍0 ]@# +PP > R >C0 0^l8000 l888tm:m:m::m:m:m:m:m:m:8d(m:Tm:88 -LMlX ȠU@p.h, :U p8VS/ p>0p>p8VS\8(Z4 5D8S808D>0D>p8VS8S< 000 508  Ȑ000(|8`]/  !ȗ \000_Ԍ 00tW PpP  '':0 0  8p p pPV: n:n:4 @c4p  ' 0h]ꫪ -LMP@`L\ 0pS0C 0 S h]*>( 0c  ' 0y꣋. -p21C0g1@LM _*>h t0P &h 2X^0/:0O00 `np  81B* 0-LMT0@+;:0 ="  7P 8h. p-@LP[2`0S2,0,  * ph] -=pS@bO% ``PL ,Hi8 P)L 嵲N@T `8  =S1NO%  PP HY8N@0L P9T0   ht(F* 0-LP|[@\ 0h֕ p-8LS@` p0S8P000 P 000p 000pt -LMp8@S\8 l8S R`P XU0S 2P ヲpP 0 ps J⌙R ㈙ 0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 0- @0 0000 PL 0PPT LH0P0 80B9a$!B30b03@L0H0耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@HPẏP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PKHM*L8 -L M0@ (KJ 0 @PKEN-E8 BS(00"S: 2 1C00 2 1C008GD  tQ 0 S"0!B L8wt P0 Nr: p-`PL @HETP4?@T(ph: 8Pph3,s::*:H;$s: -@PL D'8#,$0 h0s: 0@~DP `QD@U (`0 !Ps @<0d R0d RjPP 㘌0P0 㑌XT ㍌DKT ㉌< 0 :K がH4K }T3 2K0; K<0K< K 0C?@ 0 R  i 0CU 0CUluM @0PP' ZON 0M W  0P, 0R+(K5P 0CU ^5U0 0U0- WR V  pP`8M@%000@4080`@00X0090HX0805h0H00I0 pbN0P4U %4Ur 4Ui W 1S  Pp4Ux0S) H4UV1PH4UlZ0CUh4U= 0UXP3U 0U0P,0\0u< 0R 0`V 0S 0`5p LH@L@&pP5  pP4ណzX0\0@,0-P_MZ' H  <0RZPv t d@ _P AMLH@ %@eDQ Ipciiihii #i i "i i@!i %i 8Hv: -LHMp0WR`,0 P 2Q 1CQ 1CQ -, 0R(K0  0S?0S<1SS81SS40 S1d2U0 1CU- 1CU0 %l@K@ \K 1FSY0 ;0K< K8K  0 p0R p@K0)1U  @T, p@T' 0 RP 00X1U" lPK@㻁 㺁8\K8 嶁5L`K&X X⮁  0wp1nLK!墁88 囁5 HFH 唁\00V@|L`KHH 冁Fiii@ii 8Tv:!Q Ƞ Q00* 00* 0TiT~i -,RLM( @"h@$, Ġ$&Č Ƞ.$p$,,  ! @ST, P@T l0  3S3S, eP0S 0S$0S(0S8, RP 0 ! <(4"4!<0 01@PT3S @T l0  3S,, +P0S 0S$0S(0S0S R000 R 0@@Pd6k -P @L@$("h,!x$ Ġ!$&Č$, Ƞ,(' !@T'@T$ l0   P3S3S,  P0S R000 R 0@@ -LM(`@"X, *T1,K00 10 p<( 4"4!<%0 001@猡,KT] @T l0 3S3S80S(0SW2 @ T00R: 0 <(4"4!<00 01@T'@T$ l0 3S3S08 0R(0SĉW0S R000 R 0@@(K Ti -(L"h @(P"x៉ <4$!4&$(%<"8'0 001@T%@T" l0 (0U3S3S80 SqZ0S R000 R 0@@ -(L"(M0 p0@8, #hK04&40 0APT 08 40 @TL 6U3SE l0  ,0S00S` 0S0S0S 0Sf , P0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S ,Q ,Q30S80S Y Y, 80RSY 40S80S0S0S0S 0S 0S0S0S  *Pe30 Sa8@ 0S -LPQp `V @U l0 (0V @xX@0S 0@S  -L=H R 0 0 0 C04$48 #Ȁ  1S0 0 0  0 0  04!48#(  0!0Q 0000l  C C0( ,$ <$$.4( 4"(!(,< Q00 !0 0  (0,4 4 ,$.8  $#8!8,,00 1  o I(@cSp04%4, $&8,$#8!8$,000!R  (@cSpƇ04%4, $&8,$#8!8$,000!(@cSp媇04%4,& $8,$#8$,!8000(@sS`叇04%4, $'8,$#8!8$,0001`` -@HLP Љ0H0 0-@HLP 40!80S0C8080H0HP$}@0 Q Q H0(P 0QTP0L 8⯄H00S 0S$0S(0S X0 Q0P 0L0,┄H0脉 p-@P` PLb}00P30800p -L` QpH P@ 408@80S0C80W00T 0 00@0X1}P <0S 5@P 8@8oP1 P@0P 100 0\@<0SS PU l0@T 0@T 0U᫆81P8100phi -LLMH@PT p``KHpD|40P 00 \ 00X0  T <04 40وKr 0 p-L@` 0 \ P@ @|00@30(00pph{N -@@00LP<HP㦈l0 # ڋRF R 0 0 0 R000  Q00000 SCGh衠>Xi -@0L @Q0(0 Q803@0 hS9 -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 j Y0801 0 4)4 S*NPo0S@40 RP @0 00 080ᾓ9(K04  00#0l0F  NP>hBϠd, `PUPE,10C8#8S1y, Sv: 0ADP044$ 80P P0S P10  l1l!08#8,0 ,!XH,@^7PUPE108#8X1*, R': 0AP044$ 80Pq@ 0RPS @0 QN 0e긁q긁(KoN000 @Xo jhiTi<d`>di -LLM `᷅PP$K40ppWPl@KDxh 08 (0Kd < ` P(LLᴄ(P<0 0EP ᩄP᥄ P ?d$* 0-PL@P9 04$48# X04"48# Q\00AQ\<0 h0 0QST JQ :<0h QX0Q:SX0he0T0T0>d8 -0LP 0h>d>d -L MQ`@P`  K0S S *` 0` @Yj`^` 0[P Ki/ipp0 piX`P PUឈPPll>d$ih>d>d -LMKrp  0C`$#Bb20aD c @ Cn<(4"4 KE.Mb -LM 0@p@A`0d` 0p0#!dPw0 0d0  0pp K -L(M0p,0 PP  P   0S -A<, 0R(KU` <p 10CH0 S0 0QP QL P- P L0`S " HPS PdU`0S S@ U@UT# DSS  Bw  ' H04"40`8#8 $ #$ ! 0`0 0`0H LLw1P <R1P0PQ 0 0 Q L1PU0PU 0(8A寀T<Q} 0% L0S SsDKv0 ;0K< K 0( <K80 ЃPD  T00T0~AOP  0 0bL0 0@L0P@D @P80S0C80<@̂<< }ihipi8 --LMP 0,0 @04"48#hdVʘ%000?(K 0$V$Q0dp 0pvP 8%000PP 0%000 0 0 d 0 0(SFԔ1 0  @AQ:ꔷ***$*$*$*$*$*t*P*l*$*$*$*0*T@vʲ1#V0 0VR00Se 0)S 0 0 21C0#10\ 0(  n3 R VU0s S#0# 00Q tdP 00\  0S 05 LP0  010004K 0 0 0MPQ4 M2 R1 | 000T@ӈڰ0002 R x2 R1 Vp000T@o1_02 R $2 R T#V  10VR  00 00K0 0(0弇0P 1 RXcT񟗮**************** @%@#@!@ 1  (00P00000bvsp\00e SCV00VPP000  001L0 09$i>diHd>dT>dX>dd>d>d>dh>d>d* -PUX#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S |"000  P 04"48#8SWQ    0\QP1! 1 R@P 0S!ԑa(0 (0 0b0(U]! 0U0 0P0 U00 UX5 00 01@ 0NS<: 0 0N 000Q 000A ("(04"400  0:0:00:0 0S 0("(04"40 ;r!E> <$ixw:w: -LM@P  P hn p- LM@T`@PK0`0P@D 0T PPd@PK![0(( b!("( 0P0 xee>d -L0MȡP@( ` p;l0- @TT P<  0Pl0l0`@  LK# 0L ( 0RB$K0 Pl0l0`0 Pl0l0`T@Kyn 0P`HpK s0 H0KG K 0 KAKBKCKHpK s0 H0KG Kyi8 p-L MQ` 0SP Kp XŸA0`raP 0BS ********************* *8*********-P$R 0 P`xePUJ p1 RFP X 0PKphd 4 0$A 0@d@PT2 @0S0@ 0 @d0PP |  0U  0PKphd ` 0Kphd0`Pg @ci4?d iiTi ?d?d?dipi?d p-` 0 @ !PB bLr 0!0e 000e00 000p p-PL+U` @ r0E #10`pg?d -@LP`W`P @ 0 0pD 00 PL@~r0U: 0U0 *00?dg -@`LPpP 0S 80S0C80H0 0 ,`0@P @^~pihi -0LM@( ,0K,K0 +K1K'PP 4 10 S 80S0C80;K00 R{0p`V&`V# 81W@T@T 0 0R 0 :P80S0C80 ~80S0C80~8d -LM1@lP1P| 0SDs(`GV  0R| 80S0C80ž000 0 00 x`V 0 $#$("(DRD #0!pP 0#!DQD#p00C0< 0RV P`L"0 S0!0 (" P3"X$00$0: ,00,0W P3 .P P 0(1 R P 40 80S0C80Z00(Kh!(00(0(KoH!(00(00S(P3 7PW 400 0P 0 RZQ (P@Q ,0 (0S4000``PP0 `L00PL0  0`}=}pihi?dpi>d?d -LMtp00@K`P 0 p0 00K/ K,` 0cP 0RK<0S-wi8 -LMq00@KP` 0 p(0 00K/ K,P cP <0U h1 R 0R V1<1 0% 0RCK1  0S' 0S( <#<U0Q 0Q 0S8!(0R< 0S 0S <#<U4U8#8U4U8#8U vi?dhi(8 -L(ML 0 01CX@ (@PT0D0 " Tp XpW00W0SDTR 1T gXP@TD0S 3 R(KW @R0W`B: p딓L  (ZbP < p000T TH3 R ` VH 3  L0(:bP 0WF* 5 W@j<K o:[P; [R 0S(9 ["200 "S9 K .` oTY L (SPP 00 <oH0  000S0D0 w,`K@ o90[0S SM S" 90K@j L 0P!P00P0i:0[; [0Sh@ L0 ^PL < o:0[0:0K:[0 A0K vo:0[0:0K9T6@L  (aPL0 (bLu3@j 0@j :0[; [0Sl LoL `(aP :0[0:0KL0(P*@@j @j >d?d?d?dpi - @LTp l` P R0P00@ O0U0C0 $R000 h@0?dii -销L\ p`00S 0CP`P1@ 00S 0CP @T 0 00\Di,?d0?dpi 0-0PLP @000P0Dipi 0-LP80PPT 0@0C0S0\ 00 0T@@P 80S0C80000hq9zDipihi - p0` 01 cQL ( 0  0Q  0q03R0S |%0p00`夒\%00C0R R00 \  0"# 0TU @13 *D0 $!$("U:@T\3  04 !4$ $8(#8"8PeU#ڲ 04"48#U  !04"408#8 $#$  04"40a8#8 $#$ T0 P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q P R0<00 ,#@U00C0X 0S00`` @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S p<g Pӑ0U0C0  @Pɑ00C0SU("(04"40  00 R000 宑0 01 0 0!B W   0 R UP !00S0<0 0 0 0000 0  00 0S0 0` 0 `0fp  `("(04"40 04"4 04 40 B h0 p0h0pii0?diDi -LuL0@S 8U000 R ` 0@SX00X0 oY@P 00 00X000 0XY0SD 0SA "F  "t00t0 04"48#X000 Q000 0S  b[ 4 X VP'PK0S2 pE PC 3 R(00(0oE0%p00p0  t 0 00t @P`000lP000~ R 0 R 0Sh R{ Rx 0P0SF 1f2pW pW 0S 0S 0S 0S0 $#$ h("(04"48#( 04"4  `00`0/ $ $)"(04"48#YQW40040 p1l1 L 0 @@1  Q d00d0V@P `|  | 04S(00(0ڐ Pd00d0 000 @`:@PC @00@0`0 0$!$ ("(04"40ohipi?d>dDiiHd ?d?dhiiDiT~iB8K48ow:iw:Tiiw:?d?dw: 0-LM4P [[@[0[ P@嗗K0gw: p-LMP0  A0d ` k PK  0S S S Kp !K 0S 0S  0K 0S0![ p-2L` Q 0 H0S 202p Q 0$202p p 0@@AP0d 0P0#!dj 2 d<2 pH0S 202p -0L`pH BPP @00kj 0hhʚ; 0-PPL 0S@ 00@S 5650h60 p-PL`@ U  U# U -p0V 0p0V 0 Q p0 R0 R 0Q<00p V0p00p0hi -0p01`CVL!PQ`dVPQ Q@0 0S@@0  `di0VpPh 00 -L$M$`V, P@p 0ES*8*4*`**-@0S , 0R(KT 0S @0S 4R 5065-600T 0S @00T 0S00S0SD0  0; K<0K0 <K80 /vPD  fiVf 0S @000 @y TTd0 0 l 00@B hl0@ 00l0Zl0@0 0l0ThWk! -P p04 48`G#8SLC*0S010@ fQ:*տ@P3 0 0000 B0p P p   eP@ ep 04"408#8 $#$  0 0  0 epri -LMP< 0p01 cX80 6(0(K 804"48#8P, @4 0 V0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P <0 S04"40 <0 H0S9 0ke!4H00H04 04"48#8S.@`PI 1`80 @@S00!1,(01(4 00-">0 02 02x  x , c,8#8 $#$<0 S  <0 HP 8e0Dl <00<0 00poW7050<00<0202x 0 x 'piri --:L0?@p0 , 80 F^ 400q  x0 0 Y Y 40 c("(04"40 8^Y `\0@0x 0 0 %(0)* @p 00 , 8 '+,p!< 0S;0H P'ri @d?d ?d -LMQR@`p %02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 ]<( 4"4!<0 ] <(4"4!<0 0 6S-t0 p aX pʃd XXp I r0 S X Rm0!0bS70ODH0@)H0L@DᇥpP IX00S; 㧥1 0X0 0៣X0X0x f 00 0x 0S0 (p# (t00t0NpP HX00S 0X0 0X 0P0Px0S CKx0 0 |0 @B t0 1R B X40 <(4"4!<0p <4("4!<\0I 0`#P7P` 1Q!0\ aT7`2 S 0S0S"("(\0 04"400 cQ0ՠ0 & 0Q 1("(" 0 0|1S S S2p0 2 8#8 $#$("8S 2|< -|1S' |8 %|( K]0 :0X! 0RKphXxPT 00|, | O똔ji@jj\j8 p-LD@P`TP 40php -D@LPpT Pg 40 T0 00h0W0P 7S -L0Mp0<`K@ 0 mH4KPdk+j8 0-LP@@@3ET0 p-|0L@P@`DP 0`V GPDHphT0 Q`(!10bQ 0 0`V`!p@d@d3d 0-|0L@@PP l0GD gH0S 0h40 \! 0 `\!0@d3d -LM⠢pW`, P P0SR@ Q㖟K"! * @P 0S:QR K /C@PW2[S S' @, 0RY(K  W2[\ SD S KP <KL0KLW X DP @0 5 <K 0'P  VKLK0~'@P @\ X# @ 0  0X0 T0 \ / C@1T0 @ 0X0  KPP T1'G| W[0Q00 Q4 P4 P0 >P*P% P  P `PĪ40 0 0r 44 0Pr0 R 0S0S0S 0S R 0S0s Q PP PU  IP<P 0S  ϷPQ 6PP BP 7P3dlj@HK\8H@KGKdKK 0D0 S8d@KcKK0`0 0, P#C0 7 P000000 jP #0R1@› 0v8 Pe 000徑: $00"!Q$008 @p妶PU000! 000^+ 0 7(@  0@Pk8 R 0R( R 0R @p( TKPK00  0 0vkji x:Ljʚ;(8 -L>0Ž`AdLj-Q@P P*R 000P( 0^)hjdAd -LMP)0Kp @k)0[ !#R)K R  (0/0(0(K%aVT l5,  , 001S %1S ,5,  , 0701S1S1S ,1S Q ( 㴓Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ႓P @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z ᅐP#(0/0(0l00S 00S0 0 0@`000(0C8#8 $#$"2 I 0 -B 0()`[V V` Ll"(0/0(03 00S Sx) +0K₏`0+ K*K*0KL 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(100,<$"*)0+ K00(0C@   00K00,<$"*)0+ K 0嶐0+ K*K*0K*0[0 +0K0  000hj?d -LMl4 8  +0K`+ ["2S S (00(0咏(K( 0P "2S S c 0P9`P + ["2S0 4* Kg0S000i 04 8<,<$"*4* KN0SY )Y( 0S:Y )Y p 0S 553 R1 (F?30 PU)PU& 810 R@T@T W 0S 0R Z 0S |P$00$0 w040`O0@Y0@ )YuPB8 R DP  0z@ D0pR< 1 00Sa<`10`@  @ 8圱42@P `0Su 4 t 04 8<̠<Č,ʠ*K) K)KP>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K ~P  )0[R 0 0Q34`P)000 00 0m4Pt@gH00H0\ 00 0000 @@Ghjxx:dAd8dTk{i{ii -\0LP1  0 ($ 00 0- dAdhj --\0LM R1   00 0 d K 00 0 dAdhjG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [4949 -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(K4948484848G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Ko,@, , G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q X s, 0R(K|2ihAd\9< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hK4```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao,@ , @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ k, 0R(K*iAdh9< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 $1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcQ? `P0`?SpP`0L`@  go@@pb  y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1P*d( 0R$K #ix:99G-*A) 0p"#l0P`00#@$0@\! "TX b?  CZ8@ D0 L)*0pT0P`P! "80)`*  j 圡dPZ=~1A^_`>q嬁ZbAa0@,00@bZP`P`$P(`.   p!f?p(P`P^?`0  - 818<,!$00 @! p$(P,`0Q004@ލ9 -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P ^@1@ T@D 9 `phP J@1 0S@DRH0 0@H0L@P0@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP @1@ @D  pj?X@<@H@ ?X@D @pXP @1@ @D P@1@ @D 0-PPL 0@ P@0@0D@H0L@09 -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~-<H00@<@P`P`(KoPPp`<@pPP0P0< `PP  -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Ko^ -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Kob^ 0-PPL 0@ ~Px@0@0D@H0L@0T9 -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+8.@00@0c8( 4<"$$ (  Qo]P@80P0P@8` P@@` 0-PPL ( P@@0@0D@09G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L _9H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `,9(90949G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @P49,9(909 - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0qL@(8< 0X0(PP(($.7  .%<!...Ff0.,A.40 %.( %4,F0!,,, ,40a,( !q, %8!\fA0!!!!08P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` VdT,T,T,T,$S,T,T,T,$S,T,T,T,T,840P(pE($ 8 d, 0 l% (Ƞ 858% *|aq !40` 0`0 4ap %D q%ȠPQ` P T*d*  0儀 P0!P "0%P@ Tq|D`Ql Add " ` !0# ! "0#  ` XuW,lV,lV,lV,V,lV,lV,lV,W,lV,lV,lV, V,0,4s(,X*̠*(48t ß0 (3P !Q*D40d t@x lP !Pq#T3(h8@`| @p q`Q8` hP 40&\l`p  "#`d0Ÿ!$D0&x`@ q aQhp@0#| ! " ! "X[T[M[J[2"aQ2" A0 0# "! 0  \\ 0  0 0  \ ^\ 8KTXKTHKT(KM[J[X[T[G[C[>[9[>[9[G[C[SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L 99 9$9G-M 0ß 0@R$2.  B$,,$ , 1, ..4 4<.ß0#. 0#p,㟠0Gt0} pd **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000 ) ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'000 pW*!0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝ|x **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000t)p ))l ? !  B1 ?Q,0d,'F0  ,ˠ0 000'pG0W*3333UUUU89 -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R௠p㟠0G 0d p **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000 ) ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'000 pW*00  Ѝ|x **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000t)p ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'00pG0 W*890 Q8p , @^ 0 (KT 0SQ<PY AdUUUUPU;32Cel N`P2 0@#"B c!I0@c>10 㨐  l `0 /l0%P0P 0Ac P PtBdpBd -pP0LS`P @VP#:32C0f A 0S0C0000SP P0  0S MpBdtBd -LMpP_ <0S\ [8QW ^S 1P `U:4 R 0004 R8,K P,0K0@#0(0 z$K32C0e 00C0 0,0S  0@/00@0 @  P p(W80(0 ?Q8pBdtBd 0-LMP0| 0@Q *#d0"B a! 000@0P  (0  K0_tBdpBd jXr,-0PxBdP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL<PLL0 0-$@PLP R0000 0 PL$0 -L M4 0 , L PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL w0@00 ,K Kq0P,U0  000\ $@  (00(0  00CS 0嚷LdcBd -LM 0S0,0 0S y,z,x,z, y,QR 0,0 ,QRL h00  0 p101$2d0 0(00S {Q0S$@PP0S@p(00a L $ Uء >P, P0S@pP,  X 0@0$0@S (K$LTL,QR QR 0 P, 0S,0 A0T1 (0P` 0SP`0@0! gP, 0,0 {,x: -L% -8 4(0L0(#Q 0,0hx -LML4pQ P, 0S Q : Pm` T3#@p0CX@@ 0C@F0 0L@;0 3PRzpP 0,0 N RZ 8Q4H3  uP, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100"00`< 00@4PP Y 0 S 0,@ 9P,   ,2 PL, , ,0,0 0S 80  0, 0 00S Z D0@0 0!,00S *32C0bt!10 @ 0S P,  (@0,0:',0@0!, ,0 _,0S00S,0 ( R, Q 0 GP, Q 0@ =, 0 S Y 00 0 00 0ct \ h X {,tBdpBdx:x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^@P 5P  -0S,,,,,Ԁ,Ԁ,Ԁ,Ԁ,Ԁ,Ԁ,؂,Ђ,Ԁ,Ԁ,Ԁ,Ȃ,Ԁ,Ԁ,Ԁ,Ԁ,,,b0StPK$P@K$VJ  0t0 p 0R0R+*hP p0QIhLDP L0QIDLLaHaDa@a 0BS>t,,,,h,|,,,,,,h,,,,X,h,P,H,$,,,܌, ,,|,`,,pu R0 ! P0pP @T2 `l PP7tl 0P  0R &"( 0p P @TPtLtHtDt@tl P0S l 0S 0S 01S 060#0 R0 P 0R &"(  0!S0!B("(H 0S 01S 0j0#0 R0 P0 0R &"(  0!S0!B("( 0S 01S 0\0#0 R0 P0pP 4(ru$rs r20P ) rrhrrq10P ql 80P 0pP qqql #P0S l0P 0S 0 S01 0 R0 ! 0 0R &"(  0$0pP ppp0 00\0 S077P0BdBdCdxEdPEd(EdCd`CdEd|J9J9DdDdDdCdBd8DdCdBdBd@FdFdEd@L?l00 -A@L?l00 -z@L?l00 -@L?l00 -$@L?l00H -@L?l00 -@L?l00 R@R-L`p l >Q @z p-L`@Pl z!Ppp # -LM 0pP@$0 4`K3 0#0P\)  0#0#0QA#0P0 Q3@R 3x 0#3%?$ 0R K Fi|K9   ; 0-LMP K0 !4<"D\0 @  =z K0 -@L  00 -@L h R-L@p`l A! BPP @  p-LM`0P0 000S0A Q B,@K 00 0#0Q> 0RKpiK9 p-L@P`l  Tp  D p-L@`Pl X%(pH L  0- LP@ lxcP ]PWP00 0- LP@lWBP00 -@ML0,K - ML̀@0@K 0 0 -LMhK@P@Kp 0  0S2"Wh@ @0 < 8 dP @l P A "0@ xŸX  @ P TP /ZP.@K`HP(d0ST0T0SEVSl `P @ 0X 0 PTP WSAl P 0 S  @l0 @SWP(KG(1!@0 X T@ @ FP0l 0 P W- F0S$ `pK0@ 000lM`e0 pS 0PU :@u000l8`P22lFd{:hFd -pLP 0   R`@0 0` 00"@ T000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000K9 -(0 $ , 08 40< 00s -@Lz r02 -LMD4PK0` p$0 a 4[  Z 0R300%0[0%0K–\@ 4[  V 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 z;$ 0R. K1 0#P1  0R300% [x00#%0K  0R300% [x00#%0K&iK9 -pLP`@~Vz_1 0#P1`F OV@  b0`R1!~ 20VS  21!0#P1z_ '`h@ hy -LDM⬀0dPK`$0 p @w!v@0\0#0@@Tj Z V6;$ 0R KiK9 -LDM܀0@R@$0 P`(Ep 4 01dPK@7!6@060#0@@T* :$ 0R KpAjiK9 -LDM⬀0dPK`$0 py@\ @0\0#0@@T 0 ,^:$ 0R K7iK9 -LDM܀0@R@$0 P`(\p ;00dPK@ @060#0@@T} :$ 0R K\p@iK9 -LDM⬀0dPK`$0 p@X @0\0#0@@T'  Q:$ 0R KiK9 -LDM܀0@R@$0 P`(Xp 00dPK@Q P@060#0@@T s:$ 0R KXp6@i L9G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ!06PL0` p2RLH `08?>   c 02L!0k6PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 U |FdM9\M9{:{:{:{: -LC cB SV@QVS 4 0  0  '  B ? 0@3C L" 0p0C0\2Qj d08<S c>Q SPQC ` 0v 02R^ , 2P000 H0 0P; 0ᭅP L 娀 ?D @0 奅0PO`sPK&,D K `p \ \ JD K ` F.0PX T `KX X`T0,, @?,Hp00C0 0,RT0T!00C000 0<K(KP00 X 0  H , Q?8 `p0G< 8 P`<8`8! a, QV.QV1 4 P@p3#U T -LM0 @00_Bd @PR 0 b4Q0 RPQB  K }m@P  <H 0S 3SKGh ChU -LM `@,0 Sf P, ? |1HP 0O0@ pT1 AR\0?00S:p* 1R\0?0: 0  00 W 0p5 p;0@4DL# 00* 0 R0 ,i(K 0lb=S XB  B ?>0S@3CL# 20C 2 0/`,dU <|:\|:|: -LHM\ 0pSPo0@0T8Z0LOPo P` 0OVʶ <4 S?0 @ \00 P4 7HP 8P 0O0@ ?600` Sp 8'08S8@``00`Q8 ςX  !D 08P 00`4PR@0 0  R,6^88@`0?0 0,p0P@`W 800@$ b $ 4 D0@4 DL# 00 08P5DQ8p`0/ 80 0cQ@< P0 U`08X3%@_Q8`0  0}P"004(KohUF\ 08^0Bw \@ 0U0şp 0 (K8 8$ 8@`$80@_ P LÙ n 88P   ? 0@3CL# 000\@4Q d0@S8p4 R 280PuW@`00P 0008l3 R8TT0 !000t84S`06C cB SWAQWS 3 P88`0 0P 82 R8`0  0K 08 -80   ? 0@3C0@L" 000\T2Q1 d0@_X@ TP S c6Q SPQCX K }8p1 RZ 20, 0PP0 Z5X K ᵂd ` 娀 ?L H0 孂0PO`sdK&,L K lp h h RL K ` F.lKP `0', @?:P00080 ,R8TT0!000\ 0 1P8X 0  P , Pu8X 0 \ 0,(`,dU |:|:|:|:|:T}:D}:$}: -L M 4 4L0 @PP(K  4 P, H 0S 02/ E`00a0 S0"Q^Q\0/ A 1P  <2PR\0/ 1P@| 2 ^\0`ϊ1Po pR 0@ QR` ?́p1p^\0/ 1> R,01^\0?0  0<0  B ; 0@4D0L#00 Q 00C0 ,f04 bd^1>0p   ?> 0@3CL#000040 08`,dU :}:d}:}: -LM4 8 8PAP(K48  P, H 0 $h0Q 0 S 0S R BQ0N 0R P3,od02SQ0 Po 0 ΀8 0OP>  0l0p0^  0@0S  P 0  Q`10 0O0@ ``0`8 V@p 0@_4, 0T/ Q8@ @d_0  ˀ`00 c SQ QQ0O@0 <@ < O>P@` ` PPU`%<0`ï^P`1>AU80pV,e D`,d}: -L0M L `LLH PPT P0 00S  L PPD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D%@ < 8 Z?M `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00Sec 0@ <0 T Z p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADd@@ 0 0 R#A4mb 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004c0@ d! 400C4000 c! 400C40`,dU -LM ,  @_ 0B~4  0<~0  ?n40 00~D @ <  P<4p0@P400W D 0TALCB<4BaGT@!V`Z4 P80 tt80PQ, 000P#, W<,Q!, , R Y, L#20T 0V0ZH3,p WYULØ0T 0V0ZH3, QoUYL20 40S02 e04@ TUYUYL#40\R04 QGU<0<000D`q,@i`TPL#2 P ^04pW00pWPT PL# Q04@T00pWPP (K* 00 ,0  Z= H#0S0C0h0 K AP 4 L0 pP+0匀0Q5h@T'dp@l0S 0l0@l0Spl@l00S0l0 00 ,0 H#0S00{  _0 DP0hp0 0$  gTM9D~:|:T~:, ~:}:~: -LM $5S. @pd`  02 f V@ SQS K @0@ P |  10Pp7 K X\\t|\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00(00 0K 80`S 2 K Ze㼠 1Ÿ ?ep^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,Wa P0S[ 0OaZ&`pQ d0 c> @SPQP#00d0  c6 0SQd " 80O`p X_000K n dP' 0 S@P0(0SK ,K_H K@00,KhdP,0 H0@_0 ^,+a02_0%a00H00 f4@000Q 0(,pFd0 RtFd M-L4M00P L S@0,0 00 S `3Qt 0a0S QARQ< D?@Ě@c.d 0PU{0@0S@TmP0! ( ?Q< 80 . \ 00,KPKcP@ p,P ^0,0 0C@(K,0 < 0  cDpǏT  0H@  P@  <K?{< K @ D@ @P:  0HRh h  d0,s c4rc SqQP   0SpPPP@  8ß@ ,0. @ <4 Sʕ   Rm<@D4@D_@Ě0e.d z 40PS 00ŸD Q4 0 wp<K 0 e0Urʰ0H@h  h Q d004@# c4! 0S#Q, 4 d0T30, 0<0,00<00,  @Hr,00Q: @4 K 50St<,T00<00, H X,00Q0R 0Y=<@TD4_@0e, 8z 4S P004SP84@ShdH4 RET@0c\D4K_ 8@0 <0@84S_:\~:(gTM9(:|:<:d,~: :~:~: M-LM@  0 00SN `0S `3Q 0a0S QARQ< D?@Ěc.d t@0d Py0@0S@TOT/ 00 , @P<4 S72   Q`p2ڰ0h  h (K#3 nP @ 0Z@84`S  ?{ySP 0K0Yd,0gTM9(:|:<: -LM P8%@  @=00 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@UY0C00YQ4K 0KyP  04 1 B4 0X0S0 L0K `p0   @K@ ,^   @00,KaP , H00 !@40T@_K R 0@[V00P @ @b b3a R`Q R\H:D 0`( 0`@_00 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM 4 P80 1\ plWRl \R^Q V0 #400p004 00,K0 XPP80S,0X< 8P 0` 4 @( X0<0 8P 0` 4 < Ki<@$0#= ,K 6,0P@S  0iP@ ?@ =S >P@(K  ;-:,: p-00LS@P0 0h0S  hq`P p0  1P 5qp -LM, 20\%R64d 00  8@_d t,`p`p<@D_@,Sl`Vp` p, ,0C@$0(@[`4P8`,P0`Pj3T@: -$0L Pp   4i@P`@0 S@`V "i@P  <20 0ᲆ @則 -LM$0 bp `PUMT500#0sPPP@ $KPH㪠0@x @  0@@?l 0Q PnL占㊠㇠$0 B:$0 -L@MRx0\ X 0\L0 0  < < hP (KoPD7 X4\ ᫇@\0< @@k\ ZX $0 0@0 \0_PƟ(0K8 #H`0 0PPR8@t8 I Y` 00:00,N, T`/:SP ,6H@ \%R  VWP x0@@,PN\ K@ \0R< !\ 墆P0S PX Bw P 5-0RP5 @0SX$0 L5@s00!PT  O P  YP h P0\%4RP0 0P,0h Hh0 S, 00;00,_NP,P  4 0P4 =S540@@4@D 4$5 S,01@ᮟD4 QH L480 ,0H,0N4,@ 80D Q&D04 \40 i0p40 PodLDH4P`, l5. 0\`#Q06SH@P0 H0 4LD<4 $Q,0HSP 4$H04 ,0SPX L  40S 0S0X 0 X004$ (5*(0$ LP@X  t0$0P0d 4( 80P@,0@x0X@ R40HCL 4 X@!00K0ua!4P0S^`\Q`a004 S:O/ 04@ P  TQh 4 +4 0040 X$00445PyPP05S404%@P 4, ؞4HX<02@P440L嗞4H哞iO9TL::t: -L,M$0PH ,P L  (K 20D0 ÅL0H DPPjL DZu 2D0OO[/ P`$:,@K@:RP],PHpPML3P#L3P#h th0 S, 00;00,L(5 (0/ 6,L  40@SP@ L080p ` ,0H L,L80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@QP ,Lr5$%R ,0PS$% ,0SL0K << K80 4@ < 0 eRD  H0\ :I- -L$M8@pTl$K mP@ 0 OiPX, @ @ 04 0 4O  4$"0@<0 8@ @_@P< K @@Px`0d  , l1. @\$Q00 (KWQ@P (+Lk0,xv,(0 H , 0 ,0 (Lkv : -L|Mp Kl @PU$v5%0SL t  ` 0S P :P%=S$04 x5  0 0 P, V0H0 D KiP .  e 0 L 廂X CP,0KY -,N@Za&Y 0Zc,0  cPPh P5H00#0؛@4: pdL:t: -L1LMDA@!00pBmPP$1$a;mPP P k KnPP.  'PP 0 0 R  0 0  2Y @0  ,<  m0 0   B m ~_k,pd( ihWk@di`::.:txi p-@LP`PQ`p$jj -L00pSr 0Sh `RI 00600 Rh@T ?LIhP`U@6 0 1P0S00I X 0S0S 0S 00 X10S  P00700HQ00600Y0SKP Xh 0S" 0 @x R00S0?00x0S 4p 00S U 4 0S6 L00 KPH0S tQ8  x06000@ 00  @0  L,P?lQ.x 0Q0"' D  @0  LD 0S ` 4@8P 8< PT ,0K00P D ot R 0S <  0>vPD ah0S0(DP L L/ ?R0 $$ 0H ;R00D0 ?H 8 w06D 058  w00 K60L 0@PH R U00@0lUB < 0uPD  ;;SP0a00S L00 KPD 0 m <0\i p0\f 00 p\a ^D `2@0P 04 0S*,"L0( R0000000@0 @   <  0uPD 0S0D0  L00 KPD @00 H 0Q;0 8 Dv060 8 ,wP'0D@ 60 W@ 0H @0R H8 v060} W@ x8  _w@P060N 0u^D@ kxQ `d 0LQL `  d ;;S dP D00b00Gd:pvi:- -LM0@ KP00 p-LM0P` K@P0000 R^@F@xl 0R -$ L0S00<g 0-L PD @XP004  0 0 D0d Q  0S 000E00CS8-<-<-(--D-؃-؃-<-X-l-<--ă------ă-0L 400 00 00 ;0 @00 00 00 <0 000L 000 :0 00 1s s s 4080<00 080 080HdGdGd< R00 0S00<0@Q0 40cP ,0 000P! 001@Q!0001 0,0000@Q 0 S 1 91 -LEMXŸP , @00Y N?KpP  \, 0Rq(K81 `t0t 0p0pP  0 8\ \  }pP000@1P*"810  0 . 0pPMOK e 8 0p{pP0 $ \810 \ 0008!08\t P P 0;0vivi4dO9 -LM@pP0 0"&1S00:S/,0 (H^`P 0 00, 0]V]@`0$KS40040Ž\$ \` 2 1C0 00 \` @KS-4d86d p-L M `@ P0dpOKp -LMp0P$K`0 R` 0K00  0:0  0p 0t  0( H 00 @ 0(0 0,0 000 040 080 $0<0 d0D0 l0@000S;$0 SL084 $0$  h0O$+4P L00 \0T0X@K00$0 00( 0 0000 00$0 00 $  \0 0@\0`@0 D 0 0$  \0 0@\0`@0`,d 0-LM08 PRK#0 R 0 000 00* 0 000K00 000 00   \0 0@\0`@0 D 0 0  \0 0@\0`@0`,d p-LM0`8 PR Kκ0 R 0 00 0 00+ 0 000 zKp0 00 0 00  \0 0@\0`@0 D 0 0  \0 0@\0`@0`,d0   {0   { -LMPp00匀0CSB0S q$ 0`x0 D ,0 K0S@0@r`P0s0s<HX@`r@;"`004`;00ӈ@;/븂:0h0h 0 h -0L (0Q Sh0S Sq (Z -L"D~:T~:@-j`,d$:P: -LM @p ` RP s Q 0R 0W p!:(@l6 `Pڰ6 $ 000W $`ջ(:<: - -LM @偂,Ɣ 0PQ(K 6 6,K ~5PW,60 RR 4 $0`a00 ,0Hp妻Y P _ 00ab P 0S =  0S7  \P 0S P0 0S'  RU 400cjQ`e PJ 00` PO 0\HDd,/1P!000 , B 0 0C0&,1$0"}U 0+1S101P!P P 4a0 ` :PP ;490\ 02 P!H::{:l: -LM P,剢@P40 (K6 6,K 4P0 Y,0@TH% (ֺ!\1@0! 0,0C040* 0C R0,& 101,)1( 0(0T0 0d qa P 00`A@ 0Thdp P0`  ;40,./10:::Є: -LMRP`0 0 0V0 8K 0KP 8 0 B18 0XpW/ HK  㘐K . ,K6 4P ,80H QAB T  0~4K  0P  4pp40 06'30 63O0@0 <H#00 @ 00P  2Q(K 0 h  q< ,0T0 <4K 0 P x4@ @80( K20h4  PA0 ,l06 PPP20 6 3O0@000(K,0h UGA0( R 6,K q3P w,00(0 4K 0 P  4 P(0006 2 0, &402O0@ ,0<H冲,0@, .H0K S`# *@` 6Q` R0 `0P80SK 2@6Q2, 00P;00,-80@SVv 04C0 00 0m,-j  0q4K  0 P [40K0H0 62, &402O0@, <H,0 @ ,/P 3 D0K0 H0Kp "(K@6pD,K2PM, h0H  ,t/|-  0K6 2@P100 0 ,-/q4 X 0 0 0D0K 0 a 6 10 63O0@, /00<H崱00@P0;-@ ,: -LdM \0  00 R x X 00 L Zt 錐 P|  00t04t@| ,K/l0KPx :,\:! (0( 1S@ Z* @ T'P|0S#ڰ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN W,p 00t 40/100p M p0H`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T H, 0 0Q@@$0PS,p 0L S,0 p We,(0 30@O/+P(00 3)O0@0 d`0`  (0 0@(0,@B+@P 9,x@ j0@fhWksi@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D 0F$!0 S T^T >HL0//000D}8@ $2ŸP0`00(80 0@80<@(, 00<8 9Q00P0O0@c *@PT0HS࠳@ 0 < D |D0< &@D@&0"!h! B n-0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"HcP0,040 4 H48 4 `FX p@DT 0?^00S <^( o|40@(K@1S D F Dw 0B,KH %00P0400 <,0^4 00 ;00+ + pdhWksi: -LM@LP$  @(K4`K70 00 T@ 0 0M!0 000 00P(` 0PEp$ @,6 6@C,K6 /@P10,00L RHP@$e`0P : 10:7Y ,,@UP \0 0@\0`@0,w*,8,`,d -LMpRP }00 0BRSvRv (  W(   X 40 6` 6PP7 c SXQ,K/ 0PPN 0 Fh~n,0fH,0<@2 ,,V W0``1 aN0 ` PRQ0G0/,K0 `P  1~7 ,+000  0(K  L0( 0OT R~0Sz(D   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 p@D0@V] p~@ 0[PH 0 T@0d00S] p L00 KPH 0  4 @0Q0 0Q- 00 Q) D@H@ 8 p]00 K60pL 0@PLQ V00D 0;p8 ]P0H@ 600LD\pL8 \0608 p]@P060 0DH@ p=pD,$H@  K x K Cx0<0:08(iPg~|i,P9H:`: -L0h0S 0S -LM 2p1#R_L0(S, F" d0 T``\Pࠃ\ 0!P`\\ P\\`\`6 Ɨ0& 0,f"0a0`0b@ 0@ P,`P`0@PU`P `P $( 0@,00@ Z Z  | S: p-LP  b7@P@ V0 0aU @8Vp -Lp`P) BP,0S% 00Sx 00 V,0Q T`=,YoVoSo$0 :$0 "zP303Q -L M$0p@ @(K 2 @  0:Pl,K ;#@PU,0$HPs@PM 2`+< 0@c&+0J OP@Ɔ& 6FL0 S $( 6(S!P &,0,H , 6PS6& S,K/"@P ,@0$< K8 40 <` 0 6@ .: -L(Mx0R 0P80 0` P7pP (K>Pڈ3 Vp 01:pP$0040  0SpP(Kp!H H@ ;@^"pP < ,P/ U4 0R S U<0S Yn<Vn0 2,04HpP Yzn< cun<+,0Hn,<,p 4 0R& 03S030s6 0@cF+,@0B @@ FD /&@ Ɖ &D0.L0 S@'$(#& 6( ,n 6,S&@&,0,H,0@, 6S6& SH/!P0 ,m0p]<  0 "8@$ @*<0(0$ <@`6#1$0&0,0( x0i -L M8@T<(K =P@ 0  =9P2`@(p@Dᢧ$宧Pᪧ,6 6PS 6,K c!@P,0L H`$6RU@P e!器,' ;,: -L|M Kl pߢPPA$ A `0S  PP. oP3 # F06$ N0S $0 sP3 S030&#60SD K:P(K Z;m,K`Y 08PP V lZ 0@0,0 0C(P 0`00PPp00SP <4 PP x0" 0QPrP $0 LMT 00 QP kSU$0M 0SP<U 2l!0  0 ף, `џL0Sp9N@Z ʟY W0Z`,0 徟0S 3VS-0 0 x@ S 00 QP SUB R P@p 0? {,@a∟ pd`,dD: -x1LMl1l`=P\1\A=P H]DD K>pP7  xpP' 0 0 R  0 00 000 2PKH 0 1L0S  , =0bf 0   B z= k;@@# ? 0 ,pdhWk( i@dip::.:txi p-@ MLTPT` 0DP8 40P@{Kph/d:j:|j0  0 0 0S 0-PL@x% 0P;Q  0|jj -@QL6 0S00 hI -LM @`0P0Y (0KpPK(0@ 000,1P!( 00 ! 0 & 0pP 9 000( 0(9 pP0  9(00 qP 1qP 0;0$94dvi- 04d p-L M0@P`P dP`^,Kp p-PL@`}L0(0S S0S  phQP (phW -LM 0P@  0I`P  KL0p( P@ (/U`P00090@0 0,0 @ 0`@=S`hWk -@L00PS` 0 0 pU 880  pP0! B!S:8 -LMP`VC:8p0!R BpT88 P 0 0 0 p HpP10C1   $8@10C1 0qp# -L8M"P0 Qp 0 ;;I,0KpP Hp n8(K,0 `0 0 0@,00 0  @ 101 0pPNDpK 0 D0 0> K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ K@  ,0@ARpP L0  00Q!/2pP 0! B! 01000,7z000  <pP ,00m vihWk: -`@00LSPOp7L L0R O7pU  PpP.0!R# 00 OpU  O !0 00 0pP 0! B!HOpO  pP vi -LhMP @, 0 L L0pR` lO,0T ^7,P[7aO808 (K\ L0R0 0 80   P\  PP08h t !R| 00tt 0 o0: S\ X  8,0P`0 hd 0h! !h h0 0`PP Y 0 FOPd0S d@6`6\ Rh@ 0000OPh0! B!h 0600S$ N6,6H80F800 0 0N 000K P* 0;Ni0 .Rd 0NM  NH  NC0 0wMP 0N`X 0R^ \T0 Qp SQl  Zd R,6`h ?P0 ; ,K *P,0P`0 d dQ d `0Rh0R>  03M, 0p03R0S+P#0S t0hS 0 0 0t h 0X  0\ 07\P0Ql0 p T0  0vN  0Ld0h 0R ` 0   0 R `0R d0Rd0 0: S p0S `h RPp0TQ00S ` 0! B!`05d@p Q10C1 10C8#8S1k d 0d 000,500 0 0N 0K R)0PI h@0YL0 e p R`L R5Y05'7[`0h 0RBl R `02!R !`` 000` 0Ph PH l0S `@0! B! 04pQ6p+` d wP d0!R\ Rc  VB\tl0SP 010C100000(A5oL@HK! B!00 00 0 0 @0 0@WOP60[S#[0R    0T  0X 0C0< @ 0 0@5Od (:Ї::<:0::hWk..P: -LM@ 0PS, `p0s0s0s $0sH0sL0s@0s (KD0s! L0$  0R ^lP 000 0D0   0000 00l#00D0 R0 0 x L0$ x娀 0 y㬐SX +lP0 S R 0000R㨀 0S 0;0Q 0S 0;0p 00S Sq So  0p@P(0s L0$ d 0R kP \0y ,0 KPr00s000(0s L0$  0 0 00(0 0PY`v0 L0$ 2@ 0R kPI R 00S  O@kP 8  0:0000   40 0L #L0$  iq{0 S ZkPRMꨀ0j0s6f00sz -LMp0`$KP}0 00$0 00T|!0 000  00 0:#:0 10 00 (0H0 0 ,( 0 40 0 <8 0  D  0000D0 d0@000S;$0 SL084 $0$  0@+P L0  \0T0X@K$  \0 0@\0`@0`,d -LM 000 1K p- Px0 @L0 B`P 000Hq0(&300`*4`p4dNP  ,0S !5%PA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 p-LM@P`P  0H 00S  Kp ꄈ:l: -LM @T`p5 pP Q*Z  $0( ,@ TP ,Zp Px($0,  \( $0 , 4  $K::Ј::0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP+ ,,0S "\" R ,0S 0R:\ R0P 0  \/ 00!-P,P ,0 S 0SP 0 S00:S P 0S0SP0SP0S  -L$M`  PZ 4 80  @P,K0pK $ 0@P P @P (K40@$0(0,0l, 00f0eaQ80  P 0S0SP0SP0S PQ00SQ00S -L`p@PPU@V4 0S2 `P, $0(,  0a@PPU@ Q 0( S$0 AP:,00P* DPU@:`P4:h::`: 0-@PL@ @ P0\jQ9 0-@PL10 0 0000ԪjP9 p-P`L@  @` p蘫jP9 0-@PL  000 00 0jP9 0-@PL @ P0\jpP9 -L(M`eP@H8 <0  6 vG @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j  0L <0`8 ` 8000 D08 0(K80   0800  -L@@@DT@d@ -L(M8 `P (Kp@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0(0@ `0 p@jP9 0- LP@$P .P 0Q0 0P0묉:Q9 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0ȉ:,Q9 - L@P묉:@Q9 0-LM @PP8 0:XQ9ö@j忶Ԫj延ꘫj巶j島\j -LM Pp P  t$0(,@ \`,K 0` `P P  (K2k -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: K@P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP!@ vP$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0<P 0@@s @X: -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K ']@T# ( $0 U:,00VR 1 S0!  $e P X@T (K,40W@:00W8pX080WxpW*Xp -LHMpH L0 D 00 ,P(@4 0dP4`K004`K@K@KࠁS0%5R 0 UP0T@%5 P@ `0f S* P0KU (K@j  DH L0`@ @P -L4MPpU@80 { 0$%Q01Sr:0a bU,0 50 R 10 >0 ``  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P僶 0P{ 0Psxx 0Pk` 0TP@bDD0*0<0 K0/d:\j:jȊ:Ԫj؊:@j:jȪjP9P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0傽倽T:t: -L !Q0q됋: p-@L !ƌ\`"S  QP P 0 $ `p Q0S  0  0 00`pA ?=봋::ԋ: -@`$0 L0b#6<@ SpTQ&0@ P P|$TP\P<@0!PR00R0S0 !P b$\ -LP@!ƌ0C  0S0 !h : -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb [P  0R000 00 0 p-"fL@P  00b0fS 0S 000  pom0:T: -LM@p, ,P0, a@T; 0S"4PU(0 (  0ᭇ,P ,P(K 60A0C0 ( Q  6,00,0 PP  0H7PB, 밌::|:R -PL@PP) $F%6@[0p0!a @ ppf bZPP@ 0 0!< R$0(0$ (P jj -b@LZ 0@sbZh j 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0=0PS0000h劻0Č: -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(Kmj 0-

-4` BxO((A<L 0 c<000C0n4pi "101o(04(0(4y(00 <L 0 c<0(p T2PK 0 000Ÿ<0 00, D0 LPPb0 X` ,K400p 0Q40KPPo U0!Fy@ P6/(PK  0gP0 xx4: 10 14(0 lx4(H4(PK !0J000z4@mYx4L  0PK;n4@a'()4kPE'(0=C PK 01x4\4jpQ9\:8:P:hWk::h:$Eit:D:PK`P`YP@TJ4(0 x4'4(@<L 0<cP V  PK0wH'(0  !(0 Q-L`pP#*@JV  0P T   @- 6@004@ 5@80<@ 3@ 0$@ 2@(0,@ 06@P0T@4j -LM KLH0#&R*0R*0a"!B10blZkx4k -0L@T`" P`p :S0| Q *Q@T ,0" 10Sx0S`@pTU T0 RZ 0 0m 0PV 0iId4j 0-@L P0 PL*,LQ0Id -RLP@ * L 0m0 0.  . Q! ; -L΂n^P`Up*S N@1 Pe"0$ ,0 h  hlZkId.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 PP  @TF (18P  14@K0@ 4 0@ `P(P)4 R @Q00000 0J8 4 R| < e<@ P 808y0 $8 E 00QdIdlZk -@dPN`@ RL @pp .0  @ Id -0LM R' 0+ KK( J.8HX0@$ -H 80@$ $H KM4jh4kId@+d: -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @wP 0d,S0!D <0 Vd`  ,4PK@ 04@ 0P @L l #Z<0cX@ (KId -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<峪0R*0`"!B1 b 0 00  000 JU gx '0 A0S(K06u@MH 0`S00.H "u , $N0 0S lZkx4k:j>00   -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: u`,K < 80,  00\0P!4@,pT 8 ` ,:,0 @T @ `\ 0 8,:,0 @Th4Kg&(KHAG0S 001@ v0S 0SG4KL&0C! S, 0 0 0Q @ T00 gtmG@ 0@ `S  @0RV< "f @0 4K` &PS ԏ:lZkjj:hWk -LPp눀`T0t@cIG 0R 10 P +G(%G*(Idj -LPM r&G 0RZf 1   G PqG 0R1   FhK@G{h`Kt!p *\0@P0 phP`1XFP1 Q 0 hK!PR UsFZ sFU1h K@U@PQ x0*1(K0@p  P0 u00 @` P@FVjId# j: 0E.2k: -̡LM vF Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, D$Kj`qdId# (. -LMP$ Nl@T`p(KT,K, Lh0   pP, 0 s ꈱj': 0 p-LMP h`K! ̃.' 0@P0 JPKp舱j 6 0 -LM\ ~h(K!p@ 00  0@P0 &P4 1W , 0( 0cP`f8 0{ :P@zG`W h 0 "@P(p0x D0pS .W00S,(K, `y,,  aSꈱj'IdhWk: -LMp@ `.` $PK @ 0$@ P @-r K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1hp  a(RP4K@  0 4@ #P7,P0U/88  ,0Z0S$ :@`p4@ P00000 0 !(Z0 8,0Z0S$,8 Id4jlZk -P`pWL @P( (0 M0 1r|0@P`:P@`XW%&* /%% ( Pp00Cp0 :4j -LM>0`~0^p@0P 0` `P @P 000T 0 00 02P  K0 @Pkig''L::x: p-LM1P0 @|`|0 h0m  `0R0 P b 0K@P0 {P 0`Kp5lgjlZk'Id: p-PLMP*@`Kp 2P \0#&R*H0R*0a"!B10b (%JUxlZkx4kԐ: 0Q-L@ 00SD00D0p@-x|0@\ !1Q# \ 1!^`#`3P P00Q030" aS P\  Q0#02SQ0#03PQ1!1%ppP 0 S(0$ ,00\1P -L`$@0@PS:0b V@cp V:E~ f@U>0e S 0SR F@~U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:2k$0(0@-@ T0#03 R0SP @1 T#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 02k-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 5P@ A,P @2k P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<uLp000Xk0@ -0L @@h@0w@ -0@L  @i@p3P 0000F@0@ M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , PZk 0-0L@P ?P 0  000 .k00000R9 -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CSH.H.t.t.<.H.0S]40S0QO jW A$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0 P00S @aB00CS00,0 Id: - L@T0000͞Э: -L` PP1 .@Y T #pN U $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x0S PK0$0( ,0 0 $ (,@ @bЭ,:`: -Lt@oNB@ p-@`LP$ 0 q= UpPP+  @PPP@ 0/B000cSt:PPP@H0/B000cS 0p$::$:<:VUUU8::: -p ML`8@0P(,0!0 @04 0P@V (0 -P) \ K& Q QA ,(01 !0B@@0S!0S W@T PP W|p \@XLL:R9X::::::j::ē:@:X:$:jx:$: -L M蒟p`$0 , (, 04 0 $0@"Z78\ 0@P4K0<"P< 0U@ 0L, 0Rr(KP`d pt x| Z )PP 0 $04@ <@\@H0D0L  P0FT0T  XF T F0T0o(0$D @,FTTF T `D0FT T  0lPPmLuiP:h:::ؔ:l:p:x::$:@:\:|:::$:<:X:R9 0- L M0 \0\0\ 0d R@P 0xPh 0`dP@L 0Dd@(K0h[ꈱjg/d:2k:2k:3k -Z%ZULp`e   @ < @Iv$0X+*@0(PS$@d,P  << D05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtuLeisT$0 -\0L@  Dh褐8h蠐5((\ P1\@0CP1h273k2kj4j p-0L1PU 5`P\@T P10P1\70\0T0000p0 P )@P \P 0 @Pd0. d0d0S0a1P  1S/000P ,0 10S#02 000P0,0 0l   `  l0000  c 0(0 $$0| R*000i4jId p-L 0a400 P30,@ >0>0094j -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  0-LM@ʠ,ʠ\ 0^+ @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0P 88`0S*#84j -L A -LQ 0 0 ` 2P P0#00@-@ʠ,ʠ\  0R lR >0. R 0^ T////$///  0@]  0@F  0@O-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0&@-@ʠ,ʠ\  0R lR >0. R 0^  0@7 -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  0Q -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @  -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0 6@ Q 0@T; p@@0 `,K0.@P,000 R  JZ 6 0U@(K 0@pW P P @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 AP:00 z 0u  S0`  XʽW@ k 0K0 @P 0L 0S 0 @ kj 0CZ p@ 똠 p0 S -L,MH T H P :#:S0D >0 Z< * p0 8 40 \8 )P L 4 S TD8 0P4 H4 PP , K<Pq ,P. 0< R*L`0,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0,>P,  0<Q PH T8 NLD8 ^L(4(K@ Y@  Y@ 0R0 , < a$P 0S0000S 0S,00 @4` @dP aP00 PH T8  040 4 -LM`@00 SpP (K 00Q, KtPP00@0S 0 0K PP000, R 00CS 0, 0,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 Z0  0 0 0, K0 tK0 Px F,Q *@@R (0 (L 4, @RRP@ZP  000000  ,@QQ, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R' 0S$\) \ ^ \A 00\0 S 0  0S  R 0000@00 R ^- R / 0\00 S 0  0S   0S 0P@ 0S@ @0 @ 0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pIdx4k 0-00LS@(0P PR0 00 0  (u00C0(0 00 0000000  R 000( \00C0 R 0  0 4jj 0-@PL(A0hK -@L(6hu -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 4jj -00L0CS00@008@0 (000 00C 0舱j4j 0-L@\ $0X(P 0hQ(PA (P A000A 0-(0L@ R 000  0( 00C0(0&0   @@(Pt`0   6(0 D0 0hs00  @ @ꈱj4j -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!D0QBP`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VUO0@< 8 K (P$IV 00 QSti4jsihWkjȱjXyi -prL@T]`2$ RXX0S ^> 0\  \*RA 60 0 0 R0 < \*Q0C"!B60 0A0C Q0 T: `D^` 21C@PDP ^V@4Q 0 Sࠃ$  $0 \:^T `DV` 21C@PDP ]V@ʮЃA 60 0S00T `D^`"<0!B@PDP ]V@Idj4kx4kL:x: -LhP \0*0  0P 0@ 0P 劃4j:` -L MP0P`p00 4 ' @:#:S ቂU0,0 0 GZ%ƠJ, Rp'vY\N4@$F ,00!"&(Ko(K̘: -LM0.`p,@K 0@(@  , ,@T P000(H R000(0  0  0 ,@PT$KQd - LM  0S0x,0 @ `0 PpT0 `p 0 0,  S, (KoId:x4k@:d:p: -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KdP% $J qU奂hh@+0>0>0 0U 匂劂Idĕhȕh2klZkx::ԙ: -"LMŸ0 @0, 嬒 0 @@ #^ pt 0b\0L"6!v21C!@cw PbT0SR  0`cW@"#s:21CcT E V P0& PƠʌ008 , @00D  H00L  P 0^:0^H! 00 0PUT0  c21Ccl0S 0pf`cV@* P 0, >0>00 00>000| 0P0X0 $  0, @ (00`\0T(XL(Kg0́,ˁ눱jId|4k5x4k4jĕhرjȕhId$:: -LMt4 \80 P 4Z*L"`Vm V80S (0 SQ21C  4 80 0000(K 4 pj21C! c0 0 {@P4 W,@ W ` VZ%&0RP08P@0D0H0L0 :8RYE (000`VT@Y) 021C, T B 4 80 0,]4  (KoWU40@P 00Lt(KoH j21Cc, 80h7<!8,4jIdx4kId :`::К::t:L:|: -@LPP`p (00C0, 0 0, U ,00,0 `$pP(e 000 p-(L`P4@ Th (@aZ00C0, 0 0, pTG(`A AR0 10 0  <00C0( I RN 000 *00C000S 0  00C 0 R 000 $0S0 (p0S (0``p(`?00C0, ( @, R 0  0 4jjy@Id -QL&P`  pW& (0T`VP @0Ds(0 J(0 (`VP !( -LMP0KS4 0P , :  .0 Pq0@T( 6P` P ` 4000pH(b R000,0  0  040@T(K봛: 0-L0LP@L00 0P Ed0 $0dE@d_J0hdO/رj -L`\p@PP P W, (0(0  R (cP\@()J (0x R(0(0   0p  !  -LM00 pP@, 0 \     0 ,0  , 00 Vz 0 A`,0p0 0X1 0,@0t03TT/ 00w03 R0S ̠PxP3`W`, 00X (0T 0' T.UV(K0 ,@0t03TTS   00 0w03R0S , 00' 0$# T U 0  ,0p0 0 00  -L(MH L0 80K@0L0p 00K@ ,0 PS0 , 40 Sʔ 0K80K 0S @PoD#Q {x L 0 0S @#6:1Y<   *0D @0 L@DK P`P`Y ,0S<Y< 1@D0 @@ 40SE < R p(K5 H @P (    Q (p( (p 0S Y0@*A0DKP0`0D0 (p00S 80SPL`0`0j00`Sf*a80@SfP`8P 4` a -`LPp@T6U#:0`V @@d$H04$ 00 F$0H0S |h@l0TX0&ha<0d#8 # bHV4k4k4kId 0-,P& L@/0hlZk -LDM008 ;pBf 40S0l0 00V70#4@hKH0@THl P0)R@(0@l  R00 S (@(PU@ Z0 ( HhKY 00 POs(Kti -0@L2Id -LMp aP U 0P 0S U@ P4# @TPU@$  0DI`P0S U@`0` D0@Q@P404$0 84k4k̛:hWkj -LM`@P V 0p @ZUJ 08 L0prP  ,N$  lZk 0-PLqD`@0` 8Pd `@0@0S T04k4kjId0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH004jVUUU - LM p0X0XW 4 5 S; 6&0PQ0 P`@ R 00R0SE 10 1D `(0 R  010010X0XW(KW  X_ 4 0S0S0K,0 000 \褟`p4@, K00KP @P4p@T X* (06(P(0 #T`^ TP;V (00`8!00 0X8!0 (0 ```@@ @|/`xF04 S0K,0 000 c40(0C405(0u$1 0$1(@00  p00p01Y0100`,10,1Q0@ 0SRJ+ h p0Si l0RO (00 000Y| PlW0@Y Y1( K0 00' @ 0(10(1(0004AtK@P`, , K00K4A0 P``@.00  0$#0 h@  0P:)(00 {0F0T0  j 4K4 \pP  @100 0$#m(@ 0$#e~0  (@tisi4j -2 Po"0PU`V0P@ 0eSLdB1011q d0Sa8?P12d R~@!\D`Plh0Qh p1@T4 eZ``WPP0 *X( Z``WPP0@ ( 0S; U  0P( V T<1X0J<1 0$# P (pGPP 00(( pG40(0C40( p0Q  ^ Rpl}ti4jsijjj -0LMp ԀL ```V  0LF``V 0I`0d008 0B6C0 P@U`<,04@Z0џD(DhWkj4jرjбjX0:jȱjDj -2LM 2刢D  `=td8P@UN 0 00, 0 <~ 0,BS40 (0"@ ?CSD00D0UE 0KeP?@w ,0R0SRDU 0T00000 0R0d!000<0 0 :DD@<4`P(8P@U$1@ PE18P0U1 00 ,@ 0ȟ@ 00X@T0@`0P@W D0`0Q RO 0@W @VVhWkj4jjVUUU؛:Idtisi 0-d0LM\ D0@QP D@C00/0PUE8$6x 0 QhWkjjȱjDj:<( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q _0S 00;00 4 0 0S T40CT4i@0S0_E5k4k p-h0ML` @P0 K@ @VP0,d(4Kph5k: -L,MD PH H@p_L HL 0<0  DQH H0@@0 0Oᄤᣫე< D LD  ?0 PD#<0eX@_pYH0T0 ,o@ 80K0 P,x2x"@`\P`0 <84Hp H< <00b ccQ3R 3Xᜀ H0 R  H<<00` ccQ3R 3Xᤀ 0L@0L P0SVL, 00 0DE>D<  R< " 0O@00@0 D L$@D? 0 8K 0K,0K@P!80sg40sdgPL0 0R0  RH004 ;00L@!^HG(KpPL@^4k5kT/!Ce,: - 4DK#6:Lp@\P# (4@$0cOF#J06T[Qd@ Qg@@P0O0@}i i00 ;4 00(@iiT: 0-0($@,0LP0ʲP 0000(,P $$4R@00S# 0@ P 00 \t$h00bh0@P L0(,$0R0S\0| @ 8gi4j5kp: -(#LtM@t0W` 0 0PP0@T` T P"0W 00 (K*40"!B 0S p@ @0OD0 K4#R0 A0  ZPRCN@ 0` !e\0@ I``@S00S\!0W0 q 0!000h0P0h00K 0PPL0 ,pKPPL0E4 0P44;L$@(0P`L08 1ODK40 @ !FJZ`ڐ0 0RP d`e Xe0 RP 8jf4hf0ffiRd Jd:4jwi:::ԡ:: p-x1L M@tK KPB\  Q\P L00@0`[ @4\A$4F P4 $88#Č@ a@0,  @d@ P @U\\L!eKp@e 0 dHdh:hWkP:8:t: -EMLPMt0|$ ,0 `dp50S_ S  @PGP(4p P@;0S 0CSK4////ȯ///3Y 4 ` PU+ W0Gp'p $:@PDTAnU` pW: 4OF#J64; 0,#r:@P , 0R(K Y|@2@d |4 @00Sx0" @\ `rPP  D&P@ 0C@@P\  R\P M00@t00Sx00 0000S_  0\ 7BK@@$0!;PU@P 00SF \\@B~KpGB>KpG0C0C+;P @n+0DD0GKL4  0C@xt p$ t4 PD Hd Pdt0BKA00CAx+:P hdd==\@]0 ` ||I (diJdi5k4jDd::4S9: p-`QLP@@Tp -LMp`s0@,P@fZTK0$@K0@ $ @ ` PV@P$(P R000 0  U @꠱j4jQd -70#L0`M)x0 000p  t yP| D W0X$80 S+:S %0 80 S :SQx t`Q$ A[PU$X |~lKi@ lK ptQ  PS|l@(K@P3P#D0Qx0S,#t0  0OF*p#J 6|Z0 2"`,0 Hp``뼂@`6Q<080 t0SM d2d"D0h2\@0`"000 @ Pp | @0`U l00l0x0S0 k |Pp@`*=`(VZJ|(0Kp# p倀| K|&00x;@@P00 6|ZpW$`Yj Z *s=|0`S0S PbXY88Z p|lK|Z QdtihWkj i!Ce( i@ dF/ -L`@Mt0q0 t0  p<09L KpPPp0 0p04j00  -L M0 S0d @\0!@@@O0P  0x@}[h d0@u[KhD07P 0b,b( i5k4j:5k:4k:5k,pd::0@- x0Sl061cQ*0!a"400@_#& U l0T -LM pP `@P; @1R  @P3 <` H0 ,0 ( D0-H0 0 R 0R 8 $0r40 $000 S100 x0R :l061cR80 58 00R*0(0  < KP $KcbId(: -L8M< @ 8 D ᴀp(`}PP@z D000@ t< @1R PPh D0hH0 0 R 1R `$v8 ^#x0V3:8l061cV`1^ ,<,4R<̠(Č"Č!̌f04 ,  D<@4 K0` rPP@ 0 `p` <D p0 ,0@Y@P  ,0  CPP(KaId(: -LM0 p>0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 P  aha K f 0d 0f#&Bd 0S* 0d 0c#&d P: P-0L R.  . hhat: 00 0 -L,M0T P ` Zf @<0x"0,0S[ R@@ TT p 3ZPJ 0R00}T0 0@0@T0 B? 0!@00KP0 0 H` Dp < , L 80 @ 4 V 0S.0 PK0 R0@@. T@ 0X0X0Sb@( TF0 0C0 S/ T(K" Sf0 PK0 40@@0 \ Z00R0S ` 20S|h+ 4@P  T{ꔣ:hWk -LM> -L M@H \?pP` 0 \p:@P`0s PP,  (0  X 0  0\00 p0\P P(K(خ,000P0\`p \:@`pPUY   U  R(,  (0 0!,+PU (㒮,PP 0 P/ R, PPU ,K 0PPP ,@(,D,000, (0 *, (p,ꬣ:: -0LS0S\_xpD0 0@`,PXW괣: M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` \P(:@p Q P`|@T 0x@K0`@ P P,0 P ` K<P a ( a  D0(@ѭ( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$*0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   (n0"R*PK`2@P`P ` Ps:5O, 0 S0pK p`K, K0 ,` 0 xPK``PK` P`_P   <`Vm 0^\ ,0Pq (0S(@&G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R00 ( H0(@ \0Ux QQ`VB(0!( T\]PZ]@   㵬0pKj x@R,T:أ:: : -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| W)0S 0 Sj00    Q$0$0$000 K0K0h(]`:l: 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 )0S    R$0$0$0  0 0K0hGK00 K0h:)(`: p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKph_ 0P6k`6kX6k -0LpWP  `0V0 04@0 0 6 +hWk -LpMp 008"0U(0\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !0K  P"pPK`t 000P`@P0 80S 0  0$0p0$<0K  K'0 0@0 K?'8 0x0  40  L( K0 P$0P0( @(`0 @Qd&x , 21C0Q@x꘤:`6khWkJdRdhd0 `6kP6k: RQ-L P P00S00S0P000\묤: RQ-L P00 P00S00\Ԥ: p-`PL@ P.00P30@ p p-`PL@ P-00P30,@ p -L0M`PV, pX 0S , 0 R(K0S P HK0FVSD0  T L0 (8#"xuT2@0P0 Z l0` ' T R ,0S00SD 0L00^00S @0S p0:0S\  tP@0S W 3S @@0S<0S80S40SX 3SXQ PX @,@K tP @40S80SH0S 40X tP 0Sz0S0Stg@Kt0XVpX },@K qtP 40S;80S89 0 Qy 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 P 0 1(K 0 000  0, X,  (Ko04(4 S:0 0A]P @0 ,00 ,较B0S0S P ,8Ukd6k -L4M⠢ 0 ( L H S@"0S/0Sr 0S 0S0si ,0,`Sg DKDPK%04"43KO.WiOd`,d8UkP:S9|:LT9,T9iiT9::ԧ: : -LlM`S, p@ 7#QP 7Q 47Q 7QUB  CP, 0R(K7Q0CQ*0CQ d7T,0CT*P7T 0T&8O-P,7Q $7Q7Q 0Q7T 0T/Z !6R/PU&P6T 6T5 1CT4 1CT/ 6Tb0CTC*U1CT@ x6T< ,0T9 X6TI0CTX:Z @6T 46T 6T 1S  P-PU  0Py|Pq5T :50SQ 0S0S 00S GD'@5T $0CT 5T0CT*"0CTM1CT n4Ts 4TP74T 0TUm ZO p 4  R:p |4  R:qL$00000q,$00P0P00 4T . 0CTS 0Tj r 10aR001#050%p9 10bP001#P3P#050%1P,3Tn 0Tk 0CT.gD3T~ 0T;@ x2.(P3T 0T*5`=P o$BP(10P0d0lh2@ PqUP K`P  ` YP4K` Kd@K|KK0P 00 P@0[d 0@0K@["tp0  K@ KT0 P %TP + 0S00 \00\0U$O@M x2 D(PDP %04"48#P R 5R00K KQWP0SMP$$ %04"40iliHLi0Ni0WiHPi iildiHX:Ji(KiUii eiHi"i ix%i i Mi >S9Ii i Qi `,dRi Si !i : -LMM$0YZ,0 0T X1  4Q 1CQ 1CQ -d, 0R(K0  0Sq0Sn1SSj1SSf Rc3Xb 1CX_ 1CX0I P P@QN@0`SI0SFpKx   K@T00   1FSK00KTp X 0_ p\`K \P<0X@P80T@40P00  \P X@ T P fPP  ~<@K^0)P2X  \KT P! pWIpWF 0SP1S L`K ?LP<0H@P80D@40@00 \K LP H@ D @ efP|1X3 S_Kx  (OK( 5 NK`` || T X 01!KT00   `I%NK(( 5 `F` 00`LFpKx`  K .iiixii S9: -LhM0,0 FP!T @0SgT`VW` p0S0S 00S- W`&HPKF5,@@KD#D8!0H0KGKCKl+PP <`VU , 0Rp(K R000 P0& 0S0C 0 p V00 0S0C 0R* 0S> V00 0S0C 0A*( 8!(+@P PKD/40\0 r@|00 儠 删 =*8 0,@KD40\0 0 0  8r l, *00 R  0 KR$i,T98UkOd:T9 -LMq q3Q^$ `$ 0R^ K\_0S\ .SZ ^ 0  PM .PK P 0   0 a?R0a 0tPK0Ke0[ K T At [R A0BS 00 R@KXH K [4PK 00 <0 %04"4  0 # 0 a0iT9 -LlMp@K0`X 0 oh0 `0PK c0 000#0 QK #iiiT9 -LM 0夐K0 x,0 ? eT@KpPK`K@p0   pK哀K\pK[KxpKwK40 00 @ PL, 0R (K<0 R 0  J]#i T9|T9Od:T9 -L@\\ 0SQ  R dPGPp P %P P P UP#P P GPUU` dP  dP U U00 0  00  0 00  00#0    cPHJd@Jd -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 ,J`0S 000 !J0 J0S 0 @ P `p tP@ P`pJ8`0S 0004 I0$9IOd8d::d:D::: -"LM0PAK @0x,0   c5%#00KH2 >K4 KK 0 _ r`K 0 0K K唀 吀 |@  IZX  @P 5d0S 0 000匀K`P d@KKK4K0 0Q0@0[A0@0K@ [ @ KP T hOP , 0 R&(K KP 0 R tYI R/Z80 R 0 $DI!i\T9Odx::U9 p-LM4ad 0R@0 P *h0 S*1 R 0 !I 0R&Kp0BSh0 S:Zd0S 58J0 R 0 I|0 R bP L~!H,KPP iOd::*1 P9  P 05 00S S R P RM ("(04"4 8#PAQ <(@ ]P R <0S@00"y100i|8dt8d8U9 -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bp% 0PcU@0@P  o (0KuP ( 0R:0PD (0KuP ( 0R0%p *CpHk x:0 x6k -PLU%@ 0 PU `\0 00 pW oPUPQ0 D00  0 00b0 00C06kx6k6k 0- 0RL@ * pPP Jmpo070  0 0C 0 0 -|pL!0Sd`00aP LP 0 0@ 0$@|P00hKPhx6kpHk -LT0DqS009PU 90P0C0S90a(0 0@(0,@JUԀP 0R*0S`0 R 00 0@004@ 0- 0R:\P00P 80S0C8000 o-!Phx6kpHkLd6k  0l@484 <S  ZP| ZPh p Rl@00J,0 8 l0 p@,$8 j#8Qd0 (K0 0S0J  00T^t4 Rğğ0R&0<0 0 PP lP 00Sl@l 00@@ P 048묫: p-LHMPP` 400S T00X0Kp\@KD40 ,0 X 00T  P r 5>ܫ: -LLM p`PP% 40h@KD080 d` 00`0 r $0KpP$LL$PD0 <0PP KPPMdI0 -0L ,p3,MdMdTh -Lp:RP`@ P00T0S.jPPS *P0S *k 0 `PPS T *PiT(P R(PP Q FPP -pRL M@kP `VPPj P 4 ; Dj14 R(KX 0W0 0 `@   p`*hT  Yk* 0.S  \R0,0 _V0 ^* Y 1P11Y*p@0S .S p W@:00 0R0D>S@ALaL 0RS00L S0SA Na0NRS00N ST` ALaL0QS0L P`0 P-\QPNN0`@T Z0.SP P00S U* , , 00 Rl,0S 00,0 S`00c 0a'i] -L ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P TP,0pcXj Y X`Y@   TP X0j S -L M0(  @ $(,L<4,4"| W@P( 0Ri$K1ET+ 10SPD@KL 0 C0KD K<`K0S7 (nP 4080S0C80?1@T @T00ST0X0W*< x20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0 FiMdMd4MdMd8GkpU9 -LM@P1`.p+$@0 p9KTh: -&LM0`,0 0i0MdiiU9 x: -L M@ ,  `0Rpf x" 0@,W@-P>`0@ 8$H0S x2  ,[] (K 0 S4`  K:XY @,: 0<@ PP. ̟! !=0@@8DH@Ti JTe T TL,P x2@0  <@T^ꄂ0@0(0400; R+P(8,H`0@(8,H,0S 00KbP 0 0R0% *l A1, T;@P $(T5 Ty 3:T T ; R, 0#Px@0,Ks,00S x2@08 8< <@T t 8H 0@8H<\W8 >0@*084HTV T,P x2@0( (, <@T[ :T,,,0SO x2 00@0@, ,, @ 0,0PT,00S x2@0  W}T :0DSivT:WT ,0S x2@0x x| ,d(0^@P X,00S x" @00@@0D@<0S]F,0S; x2@00 04 ,.,00S x2@0h hl <@T9'WF,`'0^P s,00S x2@0` `d <@TW),&0^P  Q0,00S x2@0H HL <@T,|&0^PO  t>,00S x2@0P PT <@TW,&0g^P\  m<50S W W,%0T^P PP 5 8X,#0]pP 1 0Y 8p UU[P8 8 Q@ PQ80 QPQ81<8  @0080( @P= 980 0 0f(00 X8(~04 p(0<  "p8X`0@84 4$D8X 0@ 8$H$6kOd: x: 0-PL @R 0S0S R  SP @0$ S00 00;-4Md: -Lk$0 0 0MdMd(MdMd -QLM# @P`p, ( ꥙@P 5", K  pf`0, K $K -`L#40@!0c480!0c4<0P 0c4D0 0c4C@@D0@ 00Q0 00Q DP@10 R d0H, 00 S0 L 0C # 0 pPPP@ꫪ`,d -, 0LRP"* L0S, 0S*4@pD`@` i@X4<0,0 H8@K00 s끊, 0S:j,`,d -LMd(Q0( ,S  3S001 001 R0P 0-L MQ090L+S+000x0x0x0x0x0x0x0x0x0x0x00x0x0x0ȕ0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x0x001\0 0EK0-0 K0ht0 K0hX0 K0hT,,0 PK0hNdԯ:HU9t6kpHkx -L8Mlr@PP$ ` 1$ 0R KQ<R|00000000000000000000000000000000000000000H00|00000000000000000|00Q:N0K jVVN0[0M0[ 01PڢQ: V0KWV%[00SVV0[0(Q:L0K( EVVF0[00Q:N0K 8VVN0[0M0[ 01Prp *+iU9: p-PSLMPK0C`@0%T  @0FPx@x -LM p0@4(`bV`!3T (P  1T +T (KZP*0V':.0K U,0[S! -0[.@[01PY3T0V:*0K U3T)0[)0[1001*@[PP<T000 -LM"0K@ pU3T!0[!0[00QQwWPU@; V1` T ` `TU* 0U POV@ -L(M0@,0  Ply /  DK)0D fgPll 0 R 0 0( P @3T 0T6 P PP p3T0000aa 0V 3T T#P00P0 @UU2@P  t, 0R(K<T<T U+T+Tl0 3  l0 2  )0gP0P0P0 @U@@K @0[S` SS ZZ 0SV l0.  )00 fPllfL@K ,1fPW 048< ̠<Č,ʠDK= )0D fPllT (@P  00Qwl0 1  )0f0SSUl??0[0S SK?0[0S ipHkU9 0-0L0@SP ڀS S +U0S00 0@0@ 0S 1  U0T@00@ P @P00 0pHk -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K 00 <4("4!<^00 >SM: 0V R*K"[04"48#8 00@P  T+00h n`*0p@0@P0h @P],0T0h `@0p@P@PL,00h pHk -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KZP , 0R:0( ,0KZP , 0R0% *8[(0 EP00@pHk x: -0LM40 < ! 0S 0/9I 0@/9I0S @ > > #=0@8H<0S x" 0@<.P`0@ d~'RP00`S1 D.P0`0@0@0S x2  < S(K (YXP< 00@X0@ x2  0x-10`p  H-Pd Q0SW Pl 0Si0Sf0Sc0%d,P0`0@0@0S x2  $ <0P t,10@#P (bD,#= 0@(,8HW,'= 0@+9IL+8H 0@+8HA 0S$0S00@0@0Sd x2  $ <ZQ0SR 0SG P 0SQ Q0S 0s ,K %P' *P0`0@0@<0S x28 8< <0S x2  <  ,00S 0S0S0S<0@p0@0 0 $(00 ,0 P`> <0 (0BS^:(R 0S 00< (00<0S T  0S 0S0s 0S0S 0s <)P00 @WP0T@ x2@ @D 8V X@@0V00S8 <K21C010  8`P 0S @S<,0 RP(P0`0@0 @0S x20 04 <0S0S 0S$0Si <5x Q Q ^ ^ p5 ^ :00@@0 S^ lg0S 40J8'> 0@'pP#0S !hP @T< 0'S  0R ( 80KLVP 8 0R0% *$00Sx}< 0 0@ 0 @t 9I 0@<T 9IPh0 R< @  0<J$<pHk{iLdpGkPJd00S S<,P ,MMP80`0@80<@<0S x2H HL Z H00@H0L@ %㉠ X}P <剠%Z, Xj,0Se 0 __0 SPP8Tl0P0 0l00l0P 00l0*P\1P$iHU9 V9  R-L@p`NDPP T V @  P; C1,C77 (R-LPp( B(0EP @@0S1` DP  0 0 7fAP 000 0 0 0 -LMP`UCP1 @0 0P <(4"4!< $K= 0  000.AP @ ZCpP ; C1B77 0 @0 0 000  0@BPp -LM @4 8 4<,$@a8#$@D  X00(@0 pR@m4pBPP@e P  eA@P`1 (@``  @ 4 ,0K0@PN40,("Ƞ0l08#80 #0R!$ ,000 g4<0#$ 0L08#8 $#$"  0DP!  R4 000,0) , )<)00p,08 Q EB@PP7@(Kri -LMHϟW h0S  P(`00S000 00S0 0 00S x2Ph0 0@(`h0l@ 00S S00S SP 0S 0SN P0S 50SN00SJ>P 00Sj! 041 S  c1  00S[!041 00S SJV @!p000 @p0t@P00S S9@T@T  +P0S 0S  (V  `00@l `0d@0S x" h00@h0l@ 0S0S,00ipHk0V9:|8dLd p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0KCP  0R0% *T+D0@P0  x0 01 xpHk x: -LMP8 `GPy 0>pPq >P 8!( @@0( 0@0 0`0Y0 0* BVw  `0 0@80P0PPPPPPP 0S7 ( :04K 40  80Pp1`00@ X0@0 K4  x2  80S S) S Y00 P(K 00S P PX x2 !X x2  X x2B  !` h  cz=6kdhS9 -pL0S0 @` T& `@V P`P( R  BR0( 0 UT` `@VTVi0$0VPԛh8Uk 0-0@%x04"40 dPL04!40$ R 0 D*P 00S 0hNdNd -LM 0R0%@`P .:U:  0S < 00S0S6 S1@0S 00S P 0S 0S P 00S0C 0 0 (0KPBP ( 0R0%P *2@P $(50S 0S0S0S0S P 0S 0S P0S 00S5 $#$"   4Ă,4! C\5 $#$ `V.0S$0S!Z? (0S S vn41 ( `V p )P 00S0S 0S  r)P0SFg`Vb`V  _)P0$0(00S1R 0$0(5 $#$"  60 x:6kMbNdԛh 0-L@㌫0%P04"4  0-)P 00S 2n00 ($ 0$0(00h讬Ndԛh 0-P0P@LMKP0`0 00P 00@8ԛh\hdhd0GS S S SS 5S S S p-`@L(P0V00@ 0`p -LM< D @ 4 <P@ <0000 20 pW,p  0,0 <P 00< S8 $*T R<0  08R#21C<0,Z, pW< Rs D0,@ S @3@#4$(K <G @  PPL00X 80$0< ( 0538 r0,0 H10aR001#,05,0%\040P !0 T`V ) 8`V! 8#X"B0 08P#(:8 00@   `08V#(21C<0#6$ ,@0<@POd̰: -LM`, bV0P0@PTp* p@U(PT(p" V(0 X:(0 0  0U01(p10 0 %"@(PTVp@ ,0pS @3@# gUk S-PLp@P`Q`R00SPRV  oP P U U*P X 1 0p03X0SP V  %P | -P!Ll@p dP P 9T 00S ; 93000  00  00@T e0 4 90  :: -L0St0   00PH0@ <<0@$hh xOdhUkUkL1H: -Ld p0`V x2P@T 0>CS0`Vh菪@0$E D k0( #5#3 0L1Uk8dTOdMb P-L \  R @T 0 S *01 0 S00@ 0( r p t:: 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q 5D ZS H@  L0 0X $ 80(0< , 053@ 0 TPU0- @ `1"0Hr 0@880S900S # H0 8²0 : P`U VP`U8#830%0@0Z0 Q0S@ ȀD*PP 00StH0001 1BaA0 iP 000010!$10 %1 Q `V p p<00 0 P0 p0S 0S 00l0 d0Ba  040( Nd 0P @宫00@ 0000 @噫0@0  0   R0 p00  0| 0S0C 0 @ 00C0K+ Kh$:l::ht6k: -@PL P000h뼵: -@PL P 0Sh000ܵ: 0-0L PR0k@P y R0 P00  0| 妢 0S0C 0 00C00|Odht6k 0- @P L0hIA1 -LM  PK$,  e@/P d 00 @00S81(0 R @00 0 pp    0: 0`000 0HKd`K|\PKPHKGKdKcKQR S ,04!45K4%KT P0 X @ WK Z@0K0@( 0K婽P @K  ?(`w0(0@0 70Sj S 0S ^ 0S~ ˠ@,* *4*(:0 0( @@ 40K K0@@Y x"P`00@0@x"00@0@2@X\$P PX\$ 80S0C80 ڼ, 0Rg(K; .19.1 <1 KK嘐 5 00S0 0 0<1 R9P 80S0C80?_. 00S Sw e0R| 000 Ru e@ 0 @@ 0P 01 0 e @("(04"ă[ҩ@ 0I iri6kOd:pV9 -LM(PK$0 , a0S e@N.P d 00 @00S008!U( 0S @00 0 pp    0: 0`0@0d`K HK@/,0 UG0KH Kc0Kd K \@K Q R R 0 (SK 0K ( 0K`P @@K (` x0(0     0 0S S 0Sk +@"40 0( :@@и 40K0^0 K@@Z x"P`00@0@x"00@0@\2@EP PPT$ 80S0C80y, 0R~(K1 <10 K0K嘠 M; -1=G-Px rPs @@K {@@Kzz P e@ 0 @@ 0P 0h1 0 e c@("(04"$t 00Sk0 0 0g% 04"4P ,5KP@K4\@K%KXP T0  00S SRp0 R P 80S0C80E,Av( 0tiri6kOd<:V9 -LM0 005  @0000 0 -PL㉜UpV u`PY -B 0S5 0RQ0 0S0R0SY0!00SV R0 l10  0| 嗟 0S0C 0* 0 s 3X R7 Hd0S LLKe< 4 R \K[ yT@Q0 00Si <KD _c0S[ L [ \K ϦPp`P`6 lK@+X e0 00S b0S8 \K Ae0<K P P <0S 80S40S00S Q(!@KK( 00KK@P 40  00 Rs a0S N[0[0S%04"45K71 R ;H0SD0S@0[S <0RPP@S@ !80S40S00ST0%% P00 Ġ"Č0 <K\ KK~@ 0<K @a0%  `@R000 <K\ Kdv<Km o GPP 0p(` `0iLdOdHGk x:6k::x::й:`:8::d:V9:,T98:TP0S0SPp4 0000 0p 00000`,dP|0 PP h0 Q X 0S P<0 8000   t8d|8dUkh p-P0L@`TP @T 0S PpUk -LHM0P\p 0S K P40 d@KDz`4 0P0@ 4 ` \P X` p -L@PRp0`S h100S 04!40 PW1 -L<8 Q l0 R  0Tq@ 00D00D0|$ 00 0@0@0Od:`,d -LM\#X@0p<K,0 傣 BPP` ڡTW00Kx0   K0K 0K00K0 <80 4`0X@  @ 堀 >0 0000 4 0000 8 0000 < 0000 0 |0K<K0tK{0K<08 P0 T `0@0`0 PK@ PᏗUW K⟤1 R], 0R`(K`0L@K0 `0  ᆱ<L08H 4P0`D0P@ P`0`@00 0@tK |0K<K0{0K@ z<08 P0 RT 0P T RtX #310" cb ` P `0 R K⧡0 PP`0 0,iOd: QN4::V9 0-\0L@PT@T 0SX X0RբP 0POd -T@LT  oP HP 1S@T|\000͘ -0L@pT"V@ HS0S P0T0SPU P0S0@ 0S00SPOd p-LLM\`K@DP< 00 \X0 T P   @0H0 D 4 0Kp -LM┢P0 , L Pp p2 R X0 T], 0RS(K,2@T@T T P0 X0X R%P 㠠`PS HKi@K(0H0K @PL@ L@ @KDV 00 0`0 0儀 0 8 L0KPLQ rLP00P0Q800C800 RL ~@XPy` v0 0` L`V 0 R `V80 R XX0 0$niOdl:POdV9:: -LMLP0 0, h0 (2 R 4X0 P, 0R(K+0HK0 @` @KdpKG`KH@KPK (\Kc`Kd@KDH0K0 p 8 h0KPP#P0h0QP0(1@T T P0X0X R @Th R 80S080h0 R @KԟX0 0PH`'P pP D0 R ở0X0 0$p,iOd`:V9POd:: p-LMS@T @T L0 &P @@2 R T5L0 P0J PP00P0@T 0S00S@T@TL0 P0PUG L01@T 0S00S@TQ@T 0@ 0S P2@T R 0@00 RxPP0P00P0 3PP 01 R &X0 P`P 0 RP0@T 0@ 0S P000000@TxX0 t`tP0T L0 P00P0@Tv 0S00SPOdUk8UkOd,: - L@`0T#1P`p5 p@T 0 R0@ =X0P 0P 00Sp`0WV`\00C\0/PP\0`0\0%PP\0p0\0 -LMP0 xbP< 8 \0SK4@P 0 R uX0 0@㪒 pR000 TP @|ٕT 00CS 0ړ|̕Kh 0 Odl:: 0- L@P |P PT0S0T0T@0h0 -LMhQ0pS@xb ?R70S2`| ÕPP, ` TP@XT@((0( @0T0?0S0 00P|L0X  00 0 K @P @0 R םX0 0@JMdPOdOdԾ: -L0MP@pT@@  1 ; S00@0 &`P L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0 W GP L0o @TZ p@TM 0 R0X0P 0ўP 0@ < KH H0 84 pQ*<00^*r 8200`RL0 2% 30%`  ` 2QR:R40 @ R 4 <K0 D HD!00Y ` 0w03"! 80S \0@0\00l!@P\00C\0@ ្(K@P| ,1 Rx  X0 0@~l80,` S L0 , K@P 0 R ,X0 0`Q,P L0`J8@,0<@,:,`B4 8<4 8<m`,d |g1Od :l: -$LM0ȠK DHpK,0 d`K℀ b_PK[Xx@K0  @H0KG K0Kd0K Kc Kh p P ` @ 8  0KQ j 80S04$0, 0R(K080?ziV9 -$0L@T @TUk -,LM0pHKdK,0 `Kp ȠK Dx@KP0H KHKGPK0 KdKPKcPKhp ` 开 w 0 8P8 0K?@Q  800C80T0$0ᦑ, 0R(KiV9 -LO1pQD1 R@ @T: `P@T V? $00S0U  RPU00S d@TV7 U  P HP 1S@TV UbiL0 R  h0l6 P HP 1S``ӱU `V`LdLdUk:Od: -0  LRPxb0 R)$0Sp! R 000  0 @T 3P @TW_00CS0 |hp 0 LdLdUkPOd<: - 0PLxr呏@ J`PL ATd $0 S A5 @T6 R0000 0p @T P@T P @ 0``000嚐00  0``@Tᆐ1S 0 R0R(| 㜒P `LAf`00 R$0 R  UkMdLdLd -LM40P,0 x™<0K 0 @p<K c6 R 0Ɵ, 0R(K`V 6 R 6@P 哚@␚0 0T<0[S 06 R <K~$ ;0[0S 0R0%P :Us @KG vP 0 4 d`K8( L u\K0TL0K 0$0H0 $KD  <(4"4@%$LT0T @P0$%#5$  %#3 000 0 4 8  <,$!$ , P`P% @ P 01@\:0SQE 44 R  <y0,4@P $(AQ 0S \; 0 A9 e0 00T4 3 R9 <Kיe0 DL/ 0K$P  0R0%P Q*TdPU3 R  ,02 R  ' @ 0<K@ @0Sz St 0 S PK`C0 K0KK70x [0  #x K0x [2 00x0KlK0 $(, <4!4"<0 0 $(, <4!4"<| 0 PF @0 $(, <4!4"\ U *(1 RT < 0DL Rh0 h0R@1*T:0PU> <@00S0 R  p0 R&  0@@Un 40 R  0\viLdOd`Gkd::`,d6MbTOd: W96k: x:<::::8:: -LHMP`@0p,0 <K X2 RL2 R#,, 0R(KX 2 R 2@P  ᮘ@⫘0 0<0S80S* 0R0% =:P1 h@KJ P d\? 0 A= e0 00T8 1 R <Kye0 D40S00S 0 R 0@P $( @0K"P @ 0R0% *X @ 0@ <K@r(AiLdLdOdXGk:(::6k x:W9-Q P-R 8PUk 0-)RLP@ :R PPy0@0h4S @0h@0h --dLM0p,0 0 0 0 0 Y P`0U @K3 0 hP @ < 0 :R) ( pP: @ x @0K  P4 00 Y @K Dȟ, 0R(K 0S0  0(0 pPW pP700 0 :R,0K@ H00 厪PY  'H R 40<00 p0  0#$#̠`#8 0v00僨 0 :R0 q 0\:( 0K!P P@0( l0( 20 K` 0 :R ,6@0P 04 f0S100 _#0S x2A0 0@0@\ 񟗥1,111X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X11L11܊11l1411ĉ110S x" 00@0@ R 0S x" 00@0@0 #0 0@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" B?0@1 A0S x" <0@1A0S x" 00@0@0S x" 00@0@t0Sq x" 00@0@f0Sc x" 00@0@X0SU x" 00@0@J0SG x" 00@0@<iUk,W96k -L0M\ Q, L @P`0 8#8^[H1L111|111111H1@1111111-0L0 XL, 0R(Ku-V P ތ00pC 0@S 0L0 }90L0 X-_T 0SHK @G0[S_ /0L0 0@S2 R 0S 10L0 V 0L0  b2p f+PL h`EPL bᗊP0 v@0 㵌P { 00 P៑႑~0 w|T80L0 tHK 㕿0@K G0KHK吿 0L d`000Y,1 R 0SL0K,p 0pH0ɧP+ Z-<470S 0S 0ss S0S,$吱Pd 0aP2L0S10L0 8+B 0L0 i8d:Md MdVkS98W9t:h: -LM0PS`@ $K0SP0@S'P% P 0 R Tp  0R0V0Sp  t0(>P vP Zp0p@, 0PMdT9Vk* -L0Mğ0堔,0 Pp`0@`L 0P ST  0S 0S0S HK㸾0 X H0KG KHKX 剥PU TS PUC @0 l0  v0S,0S00ST , P0S 0S$0S X P0s\ 00@0 @P0 T0b bP"I 00@0@Zm l 20S4P0@HK L0f,PLP(0 0@(0,@40S80S @!, 0R(K 0sm0sa L KZ& !0@P l 10S[P @HK L0,PILP(0 0@(0,@0L0 L(0Sq jP0`0@0@!  00@ 0$@T;\" Pp0S x2( (, 0 0c Wl0@PP PT @U!^ L KiUkVkʚ;pHkDW9CVk -LMßPp, S0@0 3@0 `K3 0\P `  (X K!8, 0R(K T 0S 00 0S/00 0S 0S 0S$0S(@T| 800 0S 0Sb ,  0 pP700  Z0 (1"(1(`0241"4101 #0 !0p0@  0# #$#8`00 0HQ 40<~   0(  PH, l0 , 2(0H P e$0S(0S900 [ 0SW100 T(HKH`K[0@K DP[@ ,KH0@P 3S@ K n ᎏP@0K 0 f &ihWkjPW9 -`0@ 1 !0L  ^0$1C* 1A00 P  10!R Q 00!00>0^P peW0^*"!B0  0pP  >0> 0 c/!oggLgHg6#6# -p`q @ !0>0#6610  !0^L$1Q*2h1C P 10!R P 0 0 p0^;*21C P 10!R P0 00p0!0>0^ P`eV0^*"!Bh0  0p`P pp mffff6#6# -0`1@L  ! 001 $!0Sa <0S[o 0RN*2h1C   P 10!R 2P: p0 p 0R/*21C   P 10!R P0:0p 0R*21C   0  p  ppmzf_f [f Wf 0S 7#6#@-@\   0 S  0 \T 0As0 -LWMP  0`0S0@+  @0S00f+cYU ,0KpW0/Sp Ň(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Cp0 l D t` KP/00%Y0`, ,0 0@fP?p  ᙽP 0p@0H0 0CtKLp l p0 t` D KP p,0K✾pt`UW\PW@ 0LKP 0 p 匠 fKPP0`K 0lPP 0 aKlPP !p1R!l1RP%W`#Wpu -LM  4 0 , 0 P  0$00 00S (K ŸK0llP0UX# R 1  @p2 l YnPy0LŸ0 @ P< P< KH0 8 \ X0 DP L T P  0P 04K \K0K,0K7mPpL0 pcW]0PP`\ 4Q0 0 S+ 40 0C40 phW*`U 40SG XDE0S U0 0-  P1U0O 0ApbW40 `P0,0S X P|0 @m㊆b R ? 00 ` Q000hWk -L`p; P@ P! P9 T00PU0S+ ; P@00P P P00W l~`FpGW@ Lv@T0gG F`p(kp@ @0:::DF;0thWk@-@ tϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@thWk_ N$@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^8#8S    2  0\W9 P0 P 0Qc R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@R P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S RbR0@-P@! A0L\aL  S00`P0S 0zP ^00@P0S ZP\\  R0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0*O("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApqlW90@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00lW9Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@220% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_<11ܷ11x111ܸ11111111ĸ11 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0Q1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P a4`0P =("((8#R  < 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH << 0 h(̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  X; 0 < 0  ,0H,0(8S0b00l0 $0 #4᜶4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d v@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lV (0,00 d K`4d D(0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4(0,00 04d ,@0 S E B0P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S|111L1t1h1L1@11181d11l11X1d1 11p111,1111p1d1X1V_ L`F0zL Z0Sp6 ? 0 0VK L `F0zL  Z0\"'X?P  Ud 'w\`Pd JRh ? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sv  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Ts 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R8 080 0  0bC1 @00@@0@d0U0P0S PV pp$(,80>P 0[SP# 0C 0;4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,l9l9tk96k9P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES\ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S x8 0 80 #4 0 8q000S 8 P T  06 T XP ZB0SiS= 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y& 00S#l 6;CRP' q c0#2cQl0S 8!JG [800SS@SP  BR# 6 0S   0p W p  0 S,0S ^* n8(8 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:x 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#@ 0 \ ,0S ^* n880 R I00 0_U n88 n888!if 0SF~[00hg00nI00+ n8n8R n8f8z ]8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0 r 0   0   0  R 0 0S!0 00 q00L0D 00pCL   BDx8 8RʟR0m9,n9B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P pm9 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSU``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPXbtPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z008 l0\00 RtZ\ R80 b0$ l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`ZTp9Tn9  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b0 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-XTp9Tn9  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0vl0\0E0 R l \,0 aA?C0CR:Q800_l0\0.0 RpRt0p03VQS \l P80 `V00>l0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  6@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p m9 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0M_22,n9 -LM@ 0 0=K{:0`,n9h h 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@OdOdOdG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z < VCP 008#800 "$ 0 c\ 0C0PU0:0. $e0nPuʰ 0PU00*Y   Z  0000C^ Zb \" 10. ppP0gU\058#800 "$ 0 c\ 0C00`F3pP0gUo#058#800 "$ 0 c\ 0C00tsPUJhF058#80 0 0"$ 0`!Q@ V?3pP0gU+= 0%r0P UڬF058#80 0 0"$ 0`!Q @U Ѝ<F0 5 0KŸ 2 % 2pP0gU-1 %qP U>ڬ F058#80 0 0"$ 0`!Q @D0 5 0I$4!058#800 "$ 0 c\ 0C0p0P Uʰ F0 5 0+-058#800 "$ 0 c\ 0C04p0P U[F0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  Tp9Tn9 G-4@ MP %!0t`P0fUl058#800 "$ 0 c\ 0C004 Q*03 0CⲐ Yp 3+ 0ण` P0fUڐ058#800 "$ 0 c\ 0C0 0<3QU ,3  e^`aß0>8#800 0"$ (0a"(R#A IX223pӗqӅ!0p` P0fUw\058#800 "$ 0 c\ 0C0 02QUw 衟2  e^`a\0>8#800 0"$ (0a"(R#Al1  QV:0L{`P0fUD4058#800 "$ 0 c\ 0C00 0 Ѝ0 5 0[00 5 00x0 5 0X 0 >0 < 0 >0` 0 5 0Tp9`v9v9Tn9Hw9w9 -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Utx058#800 0"$ 0a\à A 2RpgPL+0Რ08#800 "$ 0 cZ"0C0 0!a0P 00eS% U8h0 %PQ XH<0>8#800 "$ 0 cZ"0C0 0g0  ;㳠 0 0 0 % 058#800 0"$ @P0a\à AX 0 >0Tq9@-0@0Sڀ  0#4 0 L L000S00 0 0000 -0L@ ^pP`=0>8#800 0"$ 8 a#8S2 A0 0!< 0 ! !0U0 0 \  0 >0 -LM`pPP00 @2RU+&(+뤅@010> 0 R@DT0pş  d5 0 ^ !0S  W R0QS3 U@ T000 4 0$00S (Ko40S 9 S Q<S Q Q00408#800 0"$  8 a#8S2 A0 S@ TJ048#80 0 0"$ 0`!Q @Z㈂P10 10> 0 ("(  0#40 P0b\à B U  B p P0 10> 0P U ,0P&M C@   00u00S%(K00H048#80 0 0"$ 0`!Q @00058#80 0 0"$ 0`!Q @tJ0 4 0mT0H . H4A0 5 0# QLv9Tq9u90 ## p-L@MXPKX T0 H `l @0D ( 0 , F@P Kp,P@ }T@D@00v@{: -LM ^x9 qB%  -LPlA2tA2|A2A2A2A2A2A2A2A2A2A2A2A2A2A2  $(,04@DH:( (0 -L0/ hhH2Pd -h0L0S P q00P0S p3 p3hWklZk -2LMS`p2P:W) @P0@0PU P P(KQ 4 P< ,, K00KP ,  ZG Z 嗿A8;01%J 466cRJ80 [104 8\! l\4   0 R0PZ4 Z&  104 R080 :#:N:cR@80 0<0 00 R 0 H,00 R ,h H00<P0 R 04 H, H N; :lZk:xVkhZk -L@` PPT T pT *p00 p@P0T0P@iPP : 0- <LM00CP@ S G2F2F2F2F2F2`G2F2F2F2F2,屿1??3 0 008 0  0   00#2+!  RG2G2G2G2h00 K0"8\81 00  Kt8 0A100 0L0 $:UU33 p-L`p P 0 RxJL lX Z`@P000tOo00C0 \L Ah8: VkPd 0-PSL@2~s 00H00H00 R-L@ٗ R-L@Η R-L@× -L M4  @,  R uRu B,  tR RQX10P4400C`s0 40 * U( @  x  `  00 Ep6S 8 Q q U:*P400Cs40 (Ku, RPE @`04 @D 00` tU: PP p _P L1T,P @ 4 Vk:::4:x:[:\:::D:: -QLM@|h製p堽h坽`噽P唽$@叽H4,剽D h腽x::::::8:`: Q-L C=: p-LM0PK  % @`P  0pxL2 0- L@P! 0h :L2f -0L`p3 0-@PL|> `S  X0$$  H000 # $00:9::x: -L,M`ʟPQ 0S @0S @Q9% (K @2S% %.9!  p@A0DS, +4 3D 4 P0 @9L 8),9 < 9)TH 8 0 @ w #0DWS񟗣V2lR2lR2lR2lR2lR2lR2lR2lR2lR2lR2lR2lR2lR2lR2@0L!0*4  40L0C0$KPWk i`WkxVk\Wkl`klZk<8`qdId@:QdQdd4jX: -t L@Q00 ' hIP8h 0  "!' Qd:p:@-@Q >0^ 00\R 00$0(000Mp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ 2P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , K4p 8("(8Q, "*46*, (00S 0p lZk  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . Id -LD: ->0LMd1@ 4 0 P0 @A 4 0R0  800` p,0 P00U:& Z0SjzGW2 3 0@P! @@X4 Z0SjzG,04 0S,0 <@(K$ 0 IdlZkxVk: -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V !0 Kx4k -LpP 00S 0 Q Q w2w2w2Dx2X2X嘲|z 0GS(y2Py2`w2dy2 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM@dPQ $3\ b  S] 2"S0"Lp凱ᄱp1E~p1@8 yp1 8t2XRR0S Z$ t"10@T ``"$Km]P2 RJ D2D R ,, A0B%@FZ$K@p1  ;8 0!!dpPP%L"Z2 : Zp18lp1 0\T$KmH1 1R0 \a0@PLŠB%0P @`p1c`]߰۰ $KmհA9P:Xk|:: :(::VkVk 9:8VkVkWk\9 WkT:0:8:::::|:WkVk|::::::: 0-<@L`40P 0h1ld!0hhWkxVk-0 .!  !!-0 .!  !! p-LM@0P`XT T T PK0p03V0S 0[0xK0p03V0S xK!0p03V0S 00x1[0xxVkD: p-LM@84P SP`< 0!10 + ' % # $400S @D H|t8< dH T H`:8:\9h::::: :H:p::::t:|::: -x!LM0@00 0.!0 S=41HpPwL1@  0pngh f W&: `N @04 P 04P P040S! 0S0 F/ x啯  0pCgX0 RH  0?  0p0g04jhWk:lVk -LML@\ 00 H   -LM \`Pp@  0 `0!L1 -L(MDpH #D 000 0, !D3#P`3UPQ\LXpH0H0XN@ :S6? ` 0 PP X \e(K DH 0HN@t T*2 R0S H 0R6BS 0"0SHD0C 80 4 0 , 08, 40fH0&R P20S 6S 828"0S`` 0C P 2 R)0@  0 0;@0P< 0$X L80K0DH 0 PX 080 DH0 4 00 , 0SL0 ; 00 H {X@\ <0H0q<  0rDH 0(< Q 080 <0 SHD4 0 , 040S 0S0 F/ tP 080 `JLDH 00xVk4jhWk\9 i:lVkIdh\::,: 88#4 S #00S - - 88L#Đ<0 40@ Q: SP@hWk`qd - 8LM8#tP`pB` 0P0V0S @Qv Wx2(22222222222Ȋ2\^!0z`P `0S a0S^  Q# g`0S`` `Q@1H#R) PG  g`0AS .00 P 0 `Q! g`* > 00~0 0CS xPQW8@0Sxp MM`Yk :Yk\ZklZk@-@ 0 @@00D| 0^D@ L0H000L0H0 0404550055 0404lZk-@P@0S 0S0S00 40C4P0 Q L0H00C0CL0H0550C0C55lZk@-@@\,\) 0Q0RD0 0D0 0@0 @"  4400C44 0Q  L H0 0CH0L H L0 0CL0H  %5 0C5%%5 0C5%lZk@-x@Q0000  00 0 0S00  0輫h- 0S Q000000 0 B 0S H Q 000000  0伫h - :8LP#  Pp#$ 2C 0S0 0*"%`Q000 0000x 00S `0H0*"%`Q 0@@0lZkDZkhZkxVk@-0$,@0S!*4*6 ,<10P  21C0P : #P 0S ( 8. :(#8 #:T000 -,0LQ  08hWkxVk 0-08 L  0 RP@0 h0 Q X1S 0,PH@0DZk`ZkhZkxVkhhWk0 0 ZkZk 0-PL,:8#*! #P! 2C 0S0  ! 00+0L 00S<@ 4@H00lVklZkhZkxVk-  0 0 0 2 100s00#:$ 1  !!:10!\ 2C 0S0 0 0200 020lVk@-`Pp !:H$$X 00S | $:1 0P  21C0P :#500C0 -LM !Q:0Q*0b"!B10b0 @ R  R 0S0P 0`0 0 K0K@P4 0L000S 0H Kx4klZkhZkxVk p-@LP`LT pphP$ !:1  T0 R 0S0S R: #:Qd -L\  \X0> 0+ 0!04 00S 0H0$ZkhZkxVkZk -0!>00@ +.  0L;>00 <0+. R 0H 00@hZkxVkQd0Zk@-X0@P R 0S \ RZk@-X0@P R 0S \ RZk@-0@ @0L 0,A 0 00 B 0/A0 0| |0t t0@l l00?00?X0 dZk DZk(ZkYk8Zk Zk0>0S,0 T 8>0 + 00*< 01 <0RWHX; @46XS#PP <*: R[PS 8#8XS#&0*5 p ?=@`PU@ VU>0001 R 1PHU@HX,(K 40 *5   0 SHt0H`0HX0X 0 80 L00 040 x 8嬩 0婩,姩$ZkZk8ZkhZkxVkZkLZkDZk::d: p-``LM^P @ 00040@^KpZk -L@\pP \`0`$: RP  d$5  P0 R 80H,0` NK8ZkhZkxVkDZk:: p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600plZkL: p-!:@L P0S P9 :#0L R@" L00 00S`@p 0 0S : 00p 00Sd` @pp<`H$`H̨8ZkhZkxVk$Zk t: -LF 0 \h4Zk00 R$0 Q! 00J4ZkQdQd -0LM0S | 0@T00 KKhNL00.*@ @@@ 0@4ZkQdIdQd 0-0@0 0LP$0   R00 Rt sP ` `000@0  0@0$0)$UI4ZklZkīhh: -L Pz -L Fz 0-L\80[0P 00SDP 8PH,@00h~`ZkhZkxVkh p-0L0b8#^@(0P% `0P$0 2 0S 0 R 0R 0 R+%1?00CS0 p0\phH0 R <0H 0HlZkXZkhZkh hxVk -!!:LM1@!T, $ ,0Pr`j0S 0j0(K媞 0  000S 0 A000,00P㓞P @0S0000hlZk h - 0Lap@L80 R ?= ?0R% BP 00#! @R00  00#!H0S  S 0 0iD0ShWkxVkXZk - PLPD*%!*41! %::6 Sp1 p!P!8 2C 0S0/ :U# @! #* @`ZU@*0S 0@0Z00U0`@:8#(00b0L0 RY00j  0HlZkxVkhZk -qL0PS* N@$:8#*! #P, 2C 0S0# :#Š0L R` L000 Rx`0+x0S 80H`HhZklZk8ZkxVk - PL` %7*&!*0! &::6 Sp1 p!P!) 2C 0S0 :W#@@PL0HS @000jV@:D 0SYhHxVklZkhZk -L$M㻝 (㸝2 " BϠ01l! 40 ,E4Qj 1< 8 P_ 1  0K@ B0P @0 , @"PQ0PiUX5*PPPq@0PJUV(8 $*(": 1 0"P 2C 0S0 *"%0L000Q H8  <8 H408 S <@0(< P<嵥(K0履h h :#5p^8 Q8>0( &#&R+:0R(*0a"!B10b @\\ 0T0U 0 D  D 00C D#&R:0R: q 0h0$  0S 0 R- 0a"!B10b @\\ 0T0UD  D 00 0@0 R  pHHx4kxVkhZkP-0 R0P  0S 0S  R00L00 08   0 000䄱hlZkh -@LPP @ `$4Q 0 `R Q 0\` @R^\RT PJ @3\ @TB \ 0``` *(":1 ` 0 p^" 2C 0S0 0*"% PL X 0S 2 R 2Q 2 R 0R 2H@T2p2U  \ R V TJ*PH @ `A ^ 2V^:`p(*(":1 p0"\2 2C 0S0)  ! 0L0 0SB  0S x10d1 R H1Q* D1 R& 0R# @T0*"% PLy Uw} 0S $0Dp0So 00k 0H0S t0 0S 0SW L0 S80@p0PplZkhZkXZkxVkDZk -@PpUL`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  i - 0LS@ 0L0000xVk 0-0LS@P 0SP2000T( 00S 0 T 00 R 0S 0S  R00p00 0\   0 0 00P00xVklZkhWkhh -LM@08 S:(K d=084 Q8#:8#*a$#8@00 T9 0 Par0f0 R 0f0P4@T @T 0$"*>!00Q `$H@T086Q00$<$4,4b>p:#:S,3#$PQ,K Pt '*(":10"P 2C 0S0 ,00*"%0X0Q*^s P*:#:"*S3*3#$@Q  0YP: 80,0 %*(":10"P 2C 0S0 ,00*"%0h0Q*"s8@0PpP<2 PB2$"$Q,KP PJ 0P 8, )*(":10,1\"Q 2C 0S0H : #5 L Q? *r0S 1H  0 21Cf  000 0+ ;0 0P 80,0 ,,KIPdPX H@24 He HlZklZkīhhZkxVkhjDZkh8Zkh -L,M0PSpT $6P~ 6 Rz 0Rw 0S 0L L 0TW* H '!*! '::T6 S1\! 0"!B P 0P W0#D0 %*:#eD @L RpL 1(K0L L  `DzD Y`u Rz 40C4"&R:0R*0a"!B10b@  %R55SSH0SL L R0R01$$0XD0`0óD0D0` 3U  DD0`00D0Z @ 0S@ 0 0S@@ L RL R{ 0ST 0S00D3 R 03HL RTH0R0H0 C <`K0S 0S0Sx00 R 2UA 2 R= 0R: L X` @Tp2 0S 0SG 0S 0@0S 0Se0S 20H0SL  0Si000L0 PD 6TQ(K1H p 0S80S/<040, H!0S 0L 0$1L@Xm 0Sj 00e0  60H00L00p0@X0P[D0 80L0 (0L lZkXZkx4k܆9\hhZkxVkQdhWk -`PL 0S 0Sw000pCWp 1VV 10S 0 V0 謡0s1!VLG 10S 0 V? *.X0  0 ( 0R10mΔ1 R 0S 0S  R0000 0   0 0 0@00#! 0lP0  00#!8000lZkhWklVk idXZk ZkhhhxVk -LM@4 ` 04 SPa40 U3#T0` %*0` $!*! $::4p6Sp1\!m 0"!B Pf 00Sb Wa:#e\V T ,&Rk:0Rh*0a"!B10bPp"000SbU , 4  0  , %R55SSH0SL L R0R01!0XD0`0óD0D0` 1ZF   -D0`00D0Y-00, 000 JW`@4 R~Y 0 0S> 0  0S 1,  (K0 00PS 0H, 0S ,0 0S 00  0S `0 (Ko@0H10S 000x4khZk܆9lZkxVk -LM` PP "&R :0R*0a"!B10b080 8 p@@@@V  iY I (K**(":10"P 2C 0S0 Y : #50P0 40  0>0S8 #&R:0R *0a"!B10b8 R D08 d7\ ,  \x < <p%R5 SH0SL  0R01&0QUD0`0óD0hD0`e P0`00Q00S8 0@qxV x6 Z,  , 00S000$ $,0P &VW $6 RS 0RP ,04 00S 8 Rr %Rh85S8 SH0SYL R0R01|%0ATR \5V  888D0`00D00 Vo  < <D0`00D0W@\ 8D0V @S40,D0SJ4, ZQ *:$  0S 0S P4H80L 858 D0`L R<<5S000S K 0SH  3D@0Sk 30f4|3H  < j<Tٛ0SR 83 MW 0P,0 ,P V 2 Z2, , \ P < <p%R55SSH0SL L R0R01X"0ATD0`0óD0D0` "Vu  < <D0`00D0 P0`00P00S 0SU  0S ^ 1D屑88D0`0D0?|< i<Pp P I 0!V0   @ + 8 0S 0P08 @] 0PS `00 W 0H 0@s 0S d0P  < < 00@, 4Zkx4klZkDZk܆9lVkXZkhZkxVk:\h : 0-LM\P0 04PT@a80q,0 08蘨hlVk\`k P-LPF 10S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0DT# 0<0 0 0S t0P 0S T0L0000@0HhWklZkxVk -08PL@8@{K@ p@0S0[ ` @P00shp@`H0[0 0Q H0ZkhZk`ZkxVkhh -LM@PUq 0!L0P0H0 R 0!0, ,0 1p㴑02C 0S0`< 40C4 :#%4 0C40  0 pR 41T( 01 R$ 0R!  @%TP X@,0T 0T.*(":10"P` HX@@ 0S , 0S X0,, @D0, 0S $0, @hWklZkhZkXZk\hxVk -LM< D 0@@0 TD n 4 <0< 0,0 0 4 * `(p":1 0\"X 2C 0S0O :#5,Q080 P `E <0P |"`0 0Ph2ZG  L0H 0C L0H 0Q 0`,0SQ 0Sj  0S 1@PU 81P R'0S,  0S.@T(K 0SL 5<0P H1Z 5%0C 5%18H0S0S 0 00 0S  0S 0DP 0S 0Q l0@ 0S H0PP 0S $0P0HDZklZkxVkhZk -D0L0 -D0L0AQ,2$2(2$2,2$2(2l 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0DdRdQd`qdQdck_k -3LM , ~p@g00^0L PU@`H@ $@K,0  $ 40}ZUzj K˖QdlZk: -`1LM0800 0(0KpP (KKpP@(04 P 4 Kp0p , 0 pP0@@ 0_  Kp0 pP000GH D 0-LM  $ (0 L!\ + 0.Lrp 0L!.@ L1:40  4PL1L@E@0L!L [p$Q( 0800` E`0(0004 K006nhWkl8dp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5m`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhRdp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4S(pd40 $ R ((0"4S(pd 0(pd0P0  $0$ 0P0 d@d 0Q 00 -0L 0+R 0  h话l0liP \0 RPf PD0D @ 80 VkAiiqd:qd2 <|8\: : - LM0S @009P@@ 2Px@pp0 8`{wPh<P, @qdqdL:@T: @pqdlqd0>02 a<2"&   0* !1 D2@"L8͎(Ȏhh!ch1^h巎!1 1!1 嬎婎 ! 0 圎,15#1( 0 00L\1 @0 (K<f8dC,`@tqd:xVkVkAiX`k` p@Thrd< 3 01@&P&BQ  @P phv 0phmk60 @ a^xZpWhT60,XO LK60, ::H:X:z:n::4:<:l:::::::|: -0L0S S S@ 0TLH @DoXP 41Cc.$EiT: 0-40L0p0CS Pࠃ @^   00060 ^@3@3|33343d33\333d3\3p3$0( R0@(0 @@@@X0SC @0A P$RFD1R;B0CS0h@0A $R2 1R:BSV@@ A04R SV@@ *@0A $R@@@ A04)Z  AZ  =Z  9Z$  5Z@8 0-PL@P P 00$0 P0 P0' - L@P  h^:-  % -PLu@@zpp\`~T W 0m  < ldk -PLpu@@x``L} T V i7  ldk -LMp`H@P~P  `@P 0_Kldk%3 p-LM`P@@~P  P@ 0@^Kpldk&3 -L Mx@T K\ 0T|@@@8 4 0@KhLh:ck:ldk -RL(M000 `  L0 \πpP  PP D# 000 p$0@T08 <0$@ Y0H D0  08 <040a>0"0H@Qt0@uL  R  pPm  PPe 42 0a0  p$0 @ @ @}P OP\s0@,0  Y0 040  8 0<0 P 0 8 <040P  0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  @0s PH K `P`(KY0P`0P`P`P` Nj9 -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0+PP7 04SP1Z00 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"GP0 SP R00 0S 0 480 00S 0 480@Pj9 N -LPp`P@P P 000$ 0"U0 P$  05P -LpP`,@P P 0000$P `|W %%%Ġ_0 P0pP -LM0*S$ SD AS S08 <04@  (0, $  S (S S |/08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040: -0LS@`LtPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0p700, R00 R 0( P}0 00 0 000000C2Cp ~P 0$0  X`P 2Y` -0LSPpF 0SpB`P p=  D^00 P600;000p PpP0:0 00 @ @[@F Z ,0S5353@53@535363530[0 R 06 P h} }P p 0$00[0( $00b $0[ | Y 4(U0[0 Y 4(U0[00[0 5XpP Xp<; 0-Ld\P P1\ H1\00 0`Q" 0$ eP 0ă \ #\ @ 0S@ S Q PT $xh{UP j9 rd -LM0R pO , 4 P`,  VP- 0`S0SB8 ̚P 94 ÚP00 0  ⺚84000P 0R ,P ,(K Q-Lt<; -LM< 0p,0 @P= 8`P XßX ^`KD PK=@KL \  0 P@G2 s B"20 8x@T \ 0SY 0CS1C3 C3,C3A3Px20  P XvC3C3C3C3TC3\C3dC3lC3tC3|C3LC3LC3LC3C3C3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3LC3C3x 02 0SP U0S x 0PS@ QQ 0A_S3|x P0@S0, 0RF(K>0@!080孀,嫀0SPx0P @Rx x x x ĠGE꼠C긠A괠?갠=ꬠ;ꨠ9ꤠ7ꠠ5꜠3꘠1ꔠ/qXi:=;=;>;>;>;$>;T>;H>;:f;j9>;<;<;p:8>;0>;@>;DF;:P=;H=;X=;`=;h=;p=;=;=; =;(=;4=;<=;=;X9 Q-L@^4]; -LMp`P`& 9PP` 02Z@00@0@H4| (0|`庠p000 0S P W``(K0S 2W02 : y@P 3  <` : R:RyV W`2 {000 Q <0 @R xRy R   0w03WP@80  2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P \pPX 80S 2 7?1 -Y 1\a2 `  @X1 -E]`Rr0Sn$ ^P 1!\2:2B2<2  P 0S:xP 000   뼠 :xx@~xP8 X60 RecP`< : OP` X3 rdt9j973TD3 3 3=:@-Q@0 2^2S00? 0R@ -LQp`0P/2\,2 S00?& 0R#@P 2`,Z`P2 00 0SxP`; -PQL`0p2U2S 0S @ KP 0@ PP 0S  -0`L2SpP P@ "PP@PR -L M P`0p[P  P 2 L 0S@ 0S CP@(K>0 !0QwP 0 0P)08 <041S,0  p @,0@S 0pS Z   iw dwj9 rd' p-0PL2`S@2@Sp0Q 0Qq0s q0sK r  r 0Z Q 0-LP@0h4 0-L@hP T,P T0$X0 W0 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0N|03S0 @00h?|040T儺P H4|xh4/|00$P)|Qd rd`>;:M3>;p>;>; 0"640 0p0CS0S 0@ @0A $$R0A00 -L`Pp@P P 000 0P0$P0VB000%$00@0P0p gP: 0-L`@P P }>0UP(0 0-PLN@P P  00}.A0 P0=P0 -LpP`4@P P P 00 00G0P0p`0000P N -Lp`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pp@  -pL@` uPP p @P p  0 0_0C$p P0  $0#$ 0 pW 4fu 0$ R pN0u -L@` uPP p# @P p" 0$000 R0 P0  $0#$ 0 |pOW 0 $ BQ pM u0u -pL@` PuPP p Z@P p  0| 0_0C$p P0  03 0$ "4 0?pW t+M0u -L@` uPP p# %@P p 0$0p00 R0 P0  $!40 00 pW00  t0u -@Lp tP @2 PP @) p$00 0` S$X3LY3Y3Z3xZ36T/ `Km0FSPC m@'H6T:6x6T3 p6T3/ @ @Q QU @@P @mP ` 0@@P&0"  04"400S@  jEl@T @ lP @@0@@P0"  <(4"4!<0 2  04"400 S0S00lu@P 0@ @g@`0F,S0l 0P`@P 0 $ R !G@0Rlq4@me/L@g <@b 7@] v@W 3T D3TM@PL@ 0@/@? Q0@82T 0T.  0@( 0 @t20S @ 0PV@P QZ@V (2T 1T 4@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !%G@k 0p@00 0S!Q0RPZ!  00002  <4("4!<0^LZ$rdc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR \ \ 0L_S BR00 0-PL2  0@P  5000 +0C0 P0 000h꠆ -LM@PP<0 r,8 8#)"Re0!R8 ` `( JP@ Z ?.0 20 Q, Y4 9p00 B J@0@P4`0@P/` R.+ Y#8 `P+ ,0@ 0ʌP P@@<@$ P 0@@`T 8 00(KQ PhLrd' p-LM@`  _jPP @  0`N@jx p-LMP  `@Ej@P P @ 0P4PP @ix 04<S-P08 <041 (0, $! -LMP  jP=  0@P`P 0tiZ   iP& 0 @P`P  i0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0   ,0 LiP * pP  <`K B@ a0 P<0K0 K2 K1 K;@K/PK Ip1@0$P @ h@\ @ Di@ , 0 RA(K 0@,Hp`0@ PD`p0@ P #D p<P`0@!(p#L4P `  0 8 <040 #000000Gi N9 -L M0  pL&i`P  0PP  *@K A%0*0K {I 000 $ 0 `X h K08 <04@0 @0@ 0(,0 $00 N 0-0L> h0 @\PP 0P0S0S0h0hj9 -L0M0P<0 ,0 00 40 80 pPE0EhP P`p' @@K P 80K @@@PP @0S 0S 202" ` 0SYP`p @h@ 0 0S<0S< 0 S  S  S (KP000\hP P`p S  S  SR0D#P<3 0 0 0P0@00 W00V ? U0 P0S<00S S_ 20"S D @L \ $ 0P  $ex  弅$}exA; -P L D$`(KpP 0@ F@  2V -2Vh <2Vm 0Vp R @F2V 2V 2V @ @ 0@P2V H2VR42V8 2V_ 2V0"0 @1VW 1V e/E@1V! :10S @0 O@P  ZS@Pt1V@ O  @0S<@2 e @ 00e/{=A @~ 0"@w Q@p 0 P@i @d4,0H X@LrdrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd3 -LM  0 (33 -LM) 0 (33 p- 0, LP,@p` Rt33333|3333(30SH0C040<S04000@;000 ()a0 O@Uphdp04000Cs0 phc<00 ()a0N[K0C00ph[@040( <@ P4(0<@0p00 -LM p,`0@a2a , <P0 V 0 0D(040 P @0@<0 8@ 40@$0<@K00P4< 0L nC20  YC 0@Q Z  0 U0$!:0 0 0H0 000< l1$ t00@0@p@ZN0 00 000. (K (Ko ;0 00H0 0< 0$ t00p7N2 0@Q  R0S0  ,P I(Koz R 8#8 S  0 ,0  `(3 p-DL!88#P!I`P 0@ 04000< ;00@ y@GV phuD02004040pHp I*ph]DU@#Lrd 8 8-#DL$`IPP 0@ CD0pM MI@T0 !22 022  C?IMD  2<2.Lrd - 88@#tLMP'AI`P 0䀖@ CP 2 C P0 NMPP p0W Z,p ppS 2WP , 0HPQ0"22 02 'MC0" W-.r202.PP W2"02P 2P02.p.l0 PLrd - 8 8LM#T%HPp 0@ p sC P0" 0" p\  * 0 P 20 Rp(PT00` @u(  0 *, 6P,Lrd 0-P@L(MQQ!0@M0ܟ3$,d -LM`2`x2t"0 S2p<24XS2֡(92ơ ^,p 0,"0Q000IOvg" C9<0" X 2P -P@C 2;T@`4A@0 0<0 d0`Fg0@G8@gL(@K 0: VP(0S!  0 P' 0,M K } @ r O0 t(0 )\X 0 PDf<f@ rd3j9:Ț343B;ud@$,d3vd0 ,p00 ,W@ ~00 ,T 0 !!g p-P0`PL00@8 ,000T08 \pek - 0L 0<,ek - 0L 0<,ek -Lq@eq eB;B; -X0LM@ 00<,P 0K0 6K e@ ekB; -40LM@K{30< 0\Kek p-0L@ P.0< 0`\00< ,T 00<0 \phZ00< \ek -L`P@000T꤬3333ZfT/ T* .y9 00 #00    = 2X0@`PT T .q1   B; p-L M048PK4 ` x 0@0 , (` DP 044 L p4 00 , (` CP Kpee@ 3@ C;00~N0@pdVPP * 0d 0T0!*`JWZ V$ K(0KlFP(` 0L000S D0JHWZ K IdlZkhZkxVk(0 R 0Rth@0ekG-0M  "!@Qr 40R PQ R f R0Π` 00P 0 R 0>! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ xhxhekekek0 0ekekek 0-H LP0S 0@  "!@0  "!0ek P-L 00 $ $3c  -cDD;Th$D; -P@LP`p+0  "!0 8R  >@P 0` p400P Y 0@@ 0 N 0!!d dQdxhLD;pD;  -0Ld0 SXr0@  "!@b@Rj 0!!-0@  "!`0   ! 090!0Sf 0!!0@  "!C0  p! 000X!0SL 0!!0@  "!&0    000 0S2 0!!0@  "!  1  0  t 080\ 0S 0 !!sdekekekP 00(( 0000!Jekekek -0L@  "!@0!!$ $0 1h,ekekek 0-< L0P@!!@0  "!0ek -<@L4 &5( 8 0 ek 0-@L@tbpp0@ ` @A10 P0@ 0  "!thD;ekxhxh -0L0@  "! RH 1000 0  0!!xh -@L`a0DS0 ! $40 0   !D;ek - 1L 1`?ops+J쐟0Z1 0!!QU PP 0@  PU0!! ' ?opsZ 008 401oMekekxhxhekek00 0 S ' -@LP  -@LP 0080 R  0 Rp0 0h@0h 0-L04@H 0\T0P T0@P  0 0-L04@H 0\X0P X0@P  0 P-L@ 04 0\00S  ahD;(0_P21H 0#R h(0_P21$ 0#I h(0_P21 0#F h P- L 004,0P ahD; -$1pL ` 0_WRBA< 0 V 33t333L3 3O ]a` _WBA< u0  q o00_W `O f0` 0` hE; -0 cX0_Pp21P@ CL0  _T21C h7h -40_P@2Lk 02h -0 `@TLY000_T21 CPN0 rP_T2C Ph -(1L`p@ 0R 8 R0 R-_T21I$ _T21 C0  _T2$R1Q CTP@ @040 $`_T21FR  0Rh -_QLM8 RY0 021H8Y``VM _YDY0 02QR 88D"0HRpE ?Y0 0,0 ,QW3 18 T0`040  40Q 0Up' 0 P` 0@  PU0,0WS ڊY0 02QH`(K8   ;__Y , DE; -LP p@@}``y@@ P-L 0 $ $^  ^DD;h$D; -T1LM`P@ 00#!Q Ppp@PDPP@PX0hAVPpTX0 p  ,!0P\+  1P`+ 04 0004 804 0$#660 @0`A0<0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 0,`0,X V D0D 0SD0PDP @00@0J< 0 ? R< X b@  G-D0'R0@QQdekH9\G;Xud -LM\  p%PP ` ( `P $04@80PP< 000 @`0`Qd -0L@P`!!(  BR33333333s ,40 \(0\S0000 0, 000!.\08 \z ,0 \ 0!!tttp 0-PH0LS@ S 04g04 HP0 -PLp @`,,1 \JKLM0@0 S S:@@D{9T h0 \ ,; \8 , x0 -H0LS@ 4< 00H 04h-T3 -LM@00p`".0PP  K0 ` px( PP40D H0``$0K00 D $h d0DMrdek$10l 0S 0< #30 0R:l@TP nl0 X `lP @`1C`V @l0 Y  `0lP@K1C` V@0@4\ wd@0Sl@T 0s @l@d gPl 0 0l00 l0l00l h0l$!l0h 0$1l@a0S^h@h@P`@@TL PE h0P0h!00 1P`U50S2hP@F?D@hP@P=D@0SPdPH 0?`S@@C \ 0P8 d\ H0 H0X0l TH  l0X`d 0L , `P@@T 54 | tT@H\ d@` VLiL  0SVH 000000@H 0 00H0 0H0 L 0S3H 0=0@00@H000 H 0<0 02H3L`  0Sh Ri @R  00HS80_0<0 ` 0<"1@ D0 < hG/000H80S , P`@HD@<D PhG/000@P@@% P @Q @ R P`@HD@@0@<Q< D % Q < R <0S P`~@HD@u<DH,80S, FD0SD0<0 S DP DQoWPQ@KtH080>@8H DD<@P.@(H0DDD@@@L s 0SpH 0<0<0H 0;0H0;0H 0T0U PPK0S0S0SH00000@H 000 H000H 0000H00-d P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@2hG/00000HS 0SRH 008 4 00 $0PR P8Qd Q& @Qr00 0 0 0H00 R%4 P\@VD@MPG`A@;HD@L@/P)`#@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D~@xD>눠9HJ; -LM `=8QI 9L< =D =P1=@0(S@ U'=0PS@=> 0 =XX  =0 SO4O4O4O4|O4O4O4O4O4O4O4P4pO4< |p=tm=p  i=`V.Tc=P`= 0S780SNTQj$U=0lorux {@~    :=X`V 0  2=0S S +=p(= 0S h"= 0S@PD\ 0<#0C 4= 0PS@80S  =80SPp<@D@Ÿ^0" T0C@<80pS PTQ  PB T h 0Bd ShdX4V4V4U4V4V4V4V4V4V4V4V4V4HW48W48W4V4,W4Pf|3@"!10@Q^T d00\$ H R$"R; UQ0U PP2QJ PH ,0S42 RSXX P X@T@T0X1V/0\!,0  YP d @P d 00\ pP \ X0X p \1P@01 U\! P1s@P SPDP SP9,p1=@0S@ Wz90pS@r9\ \@P \ V0X0 X0 @0h@^910@p X9W99wdM;4];:x: -LPp`@3 $@ T`Vp @3 $@T3 $PP0033 -L,M 4<`K P004 P  9@K 4 0K40$ K0 ` 0pP<8  4T<@  8 4T 4$ @400 4 4008@M; N; -L,M@QP` 4@pK 400 P 8@ K 4 $0K40(K0p 0P@ 8@@$ 0 <$@T 4( @400 4 4000N;TN; 0-QLM@ Q Q 89P@Y$Q  $T8  0 L I$ṏ9 ᧑8讒9$@0Q9" 0-4Ls@P $PP 0 4 400  400 $ 4000 p-@L`Q PU P 1S `RP 0$@T$ F? R 0S|0 R 0S0 RT p0 =RP0 Rp9T9 -LMp P $0@TS X@T 0S0 S 7X@T|704(K0 0 S0k `400`Pĕ4Å8Å ?00 P 7 4 400-6 PA΅ 0@P |7lz7 A΅0@@P <m7 4 400  _7VZC WZ Y* 0R VZ$@F? R 0St Q X P 1S QPO  0R 0R 0  P6(2("3$2# "32#"30#34Õ8 0T438 $PPT 30CSC0 !$ Y0S 6 P/ 4 400y0 2QP0 RT Q. KPu}0 R 0S6.Kud0 3#0 3#0 3#438 $pP0 3#x0x 3#xN;PO;N;N;N;N;O;9( D  t "HO;$O; ""ĸ"" 0-LM`5Ps 0AS(h4\h4dh4h4@88hh@Ql0lh58l@ll, 0Dh]8ht 0-`5Ls@P& llPP"P+l5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R FPP UX `{d|d -LMp `l%0PU0XPU- 00CS0  0SQ400 @P 0QU  8Ŗ<Lņ P 0 400XPU50`5$K0͆  400@P1:PgoP} 0D5VΆ Pl 0S0d5 ͆VNX5 @ @Pd@D%j5 0SX%Rd008C \1@@0C@D0C@̌0CR2 d ,0X 1@1 0R4 h 0X 0@iPP  0Pm3 P ,00 0| 40@\W3'N;S;T;''S;'$ $:x:LT; <',T; 0-@LP0!R 0S MP 0 !R 0S wMP |0@TGD@T T \ 0 SQ 0SP00P0T9Ȳ9 -L*0 -0L  -@$0L $0 -0L -0L@P @00  h0( Q0 ,0 \00 0-L΂M0P @n n @0>2Q0 Q Dr30 0  P0 08V; p-0L`P00 ,@0 \phD3V; -L$0@P 0hx0h -L$0@  0-LP@T  0y| 0t S0C1o$ 00P0#S@T @ @V; <0@ ,<0   <0@0 ?0@0@0S40Si<0@< ,<0@@< ,<0P@< ,X%XLD L @@$(,P<0@< ,<0@@< , Hx,PE0@0 -LD -<0@Lp , <0@@P( \`,0( <@ 0\<0@ ,   0(W; -pL<@0 1\<@0#8@4 \<8 1@\< :    4@ @T80TPP PF )/0 @0o 4@  @T0H0D0P0<0P0@ 0@ \C<0@@P( \`,?( Q@X0  >X0ST@DXQ* o<0 @\<`@P@0 \<0@@P( \`,( >400 D0H 0X0< <0 < @00W;U< 0 04p\0@4 0\5004 \004 , 004 , 004 ,@ ?#@p~dHY; P-L P P 0-#hhlY; 0-t0L @04 L0\0P 04\00 500hp~d Q-L -LHM044@ 0P h""hrdpAY;:D0  0S S S 0 S~d 0-0L  0S%P0  ^ ^0 PS n @B21n@P0(0e/"b0 0~dQ0 0`~dQ - L0S0@T L0 T,T 88S 0Yv8h8L#8~4T6 \xud@B -@Lpؾ`P@PUPV0P0 h -sL p3 -@LYbh -0LS@ PPP0lPe0P 0P: -LM@31C04`Kq@$PK4 T T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -LP 3Z~0`S @@d`V`pW@@T Z1 lP Z O`V`pW@@T㐠圀ZF@V#0S9 0吠S0p圀0W P0Ӡ0P00 o1:P&@P 0S Z I000 S0S@@W QZ00R<0h40Baf̵9:PA-tr MP`U`2\2PODl28Ÿ1C 0P ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00w~d0hVUUUXgk1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PLP P@0dP0hM -L@Pp`ξP ʾPTU@ p-L` PPPUp     @ T 0 d 0PPPsp: -LMPPPK @ kP+HF101(pKa ` 㩽PV3T0\ `S( $  `X( $0@@)( $0T``0\ (pK~`H 00!00 cCa0 uV d0SlhQ tpp@W (0| 0``-$0 0d( d&$ <00S ``V<QMb~d>(< 0@ 0@ R-T % 0>0>@>00>00 > 0><01H q ! PPP 4ymtS/q[; - !L80PdqV 0 @)0uzh5 0-$1LS@ڼP$1 0C$1@#h$1SݛP0 -LCM⤁1 a$ @0!0P$1KR4h44$44 4>@@3SD4<00 @)a00~i$10$1$ 0R: KQ  IOK  P`0>@>0>400( ^01< q P P 1S44T4`4l4S , 0R7(Ktrn41 (010AS0!0cS01 $<S0!,@P`< 0,1KKOK  <xitghc``X]H00 di~ddd\;\;8];,];:];];\;98 00000S0C00000 000 0003 4 0  <040 0 @00 p-L `@PKv!0 000 0 B4 p8ph p-0L @` P 0(0000 8 ph#KK -L$M# 200l1 0(K@,0 PLŸR00 y00! (Ÿ0 T00 c O0008 < 00i10 > A00H 3@E 8^B4@ 0  @@Sd @ ,0_P 00 00! (\ 40S 0  0<8@00i10 0 >@0400:@e33 0004 \XPH}<,(ȯ4h^;^;^;,^;t^;|^;^;L^;\^;T^; -LMp 200l>@ TP 04 @`=Up20 P( 00  Z0@6 0T R P0000r P 0 000U@ 0@q0@000h$KP 0  00 00X000R000I0$ P` 0 0@  0@$ 000$ bQڰ0?\{P000  0 @ȯ];<_;_;`_;^;^; 0- L0P@K0hȯ p-PL@8`zP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 4000pp444 -LMP \`Qp @p @T V4 0`D @^;-T(  T8dd::x:_; - 0L00S@ 00S00 00S0 0  -L M<`Kp@ PX0<0K0 60K@?4 K7@KSK00 5 KP3[ K -L M@pK0@ `40  @ 09 K!@0K080K4   PP 0l3K0P ,` P@ m  K ^0@0K18 K40 9 K3[} Z  09 S" 6 04"40(Q(A 04"40Q. 04"40P/ 3(( SS$  'NEFX -Ld 0 h莯l:Qd 0-LMP@T |)Azd0d`0a*8LI, 0K8P@$0$Xd`;<@gkQh`;\qdp`; -LM$@K0P(0$pfd0DP `P@ V 00;00_0  $K(P(TH0 @0@,((P0 009000; S l0p20X <@8oS0 , K`P@p@l0, 20, @ TX1d  Q10<P 00p0Sl -`0LM R L0 K0S <0S 0$0  K0gkgkgk 0-X0L P0R@P 00$0S4$00S 0gkgkgk0 dgk0  dgk5 -H0LM\ <0S 040 0gk -Lp\ Q  0Q  A b00@T 04 -LM 0@4`0pbP P <0K00K80( K,0K 0$0+ , @((@ , 00S0004 K   P4` 8` 0p@,P ` <0$K0(@,(@,   p-0`@0PLR :U:0@U0*p -LMP 08  @H@@`4@ 004 X SP0 @4`0pP 00KP 80S Y I (K4 R#: -L M@0`4 004 X S#H@0 @4`0pP 00KP YI (K -LM0` Px@E@0@`8@ 4p0|@j 00K00[140 00[!408XR0 @4`0pXPF 00KP YI (K9 -LM0` @,0`8 4p02P  00K00[140 00[!408XR!H0 @4`0pP 00KP YI (K9 -LM0`@4p0P 00KP (K0 0[PX 4`0p@  00KP00[!X9 -,0L0@,0 0Q ? 00 p-,0LP @$0T$: `V@* ~,0$ p 00Q@$0T:( R*Q Ch$0@0`V//` FY,0ph S(J( @$0  \P(@ `V  2 DHP @` `V  B   B   -,0L`@# p$0W5:  0R0@P 0D0"U G:0 ,0,i 00Qp$0W:( R*Q C$0p00@PU0 :,0 S((p$0  C B -,0L@ =,00,0 -,0L0,0 @,00,0 0-,0L@=$ P* 0\Q0 S):,0 P0,0 : Pe0 00$ P* P: @W000 BP000 I0 00 P:$0L 0R $0PR0000 0$0,0$0 P,0*$0L 0$00L$  -,0L @ @hf,0t,0 -0p@PL`0@ESOñ0 CR±A!W ,0{,00,0mmn -P, 0L@`p ^0 0  $ B 00 ( ,00q0,0 , -LM,0@:@ @@0P4p0` ,0KP ,0 S  @ A @  `00 $( ],0F00,0$K ,0 - L2@02,0  00  $ ( QP,0,00,0&00,0,0 -LM< 4 0X< 0I#0S@0 8 B4Q7:@ Y4* 0 @4`0pP 00KP00  00< S8 0 @ @DP08 80  4Q8 * 0  (K -,0L@0,0!0 Pc`Sbc\02$05$0%,05 % @  h",0@  ,0 Q# Q Q Q  b -,0L@h2S02@ -2"10 @Q"L< 0. -L M\ @T ,40#"B0Q ^ڈ0Q P @ 0@@K,88 #4 ,88 #$RR*Pd\d5n5 Q-LW `; p-`@PLD J UD(D 10< 0 ph; `;`;`; -80pL`PB尦V 0"T@1\Q Q  PP Bi٧ɩ PP  @`; -@Lyt0  0t0 -0L"b PU $P (p@l020@T1d Q-0L@ Q Q /"/000bSP5@505 5RR hhhLhHhDh@ Qp-L`@7 Q# Q p00 R U2 0T1 0P0 00PP003Td 0T0S} 0  0BS0S 4 00P@3T 83Tc 4 00Px00s030o60P@00S@PP 2 2Q"#  0@$ PPO d2 \2Q" 0@ P?Q00 0S-P7 4 00s030mPhP$tPP800Q080 80P1  80 008 0 80  0$0-P ) P0@@0@0P0AR0 00 06  0$ R0S0 t(-VW^WQW PW \P =D+QTI5TI5TI5TI5TI5TI5TI5TI5TI5TI5TI5TI5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5F5DI54I5I5I5I5H5H5H5H5H5H5l 9&l : |0S T1 R4>00l0 0 \PA l0 0 \P6 0T0  T00>0T0  T0010T0  T00$ ", /d*'$ -LMQ0 p` P= UK R60R30   Q@  0K0@0; S V \P\ 0l@L00Ta@P ;; S" 0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00@0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P D 40 9PUV ;~a `=0SL00 RLPSBl0V ;_  0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 Kp8h0S `c; p-0LS@P`70S$ U  l}PP\P l0!R \l QpPphI\P  UQ 0P`0ph300 0-@Lܕ PR 0S \P lQ0h ` p-`0LSP 0SD|0S\1  X@T% 0S" 㩕0`0CS0000 R00@0S40S+0 31C VPϖ0Q&ڬ 0 S00 S P0 fp00PP0 ڰ00n; SP 00S9 -L@Q a5b5 3U1 =t3UM 0Ug 0CU X0S\0S+ p@pZZ p,000 0 d@PpZW 2UF0x02U 2UXP; 0 P (Kt2U /0CU0S Sf S#(Ko XQ 00S00pP dP 00 R 0RK1U 1Up\@@ T 00@  00d\@XPU ό/",000bS` 0 XP 0 r 04 Q(Ko   ^@@⺿@G0S0So(Ko0 00ᘻaWbWvt}fW`WcW@- @.@ꬃd  - L@pPP 0S `0SX`V 4@0H0-P0ᰃd 0-PPL 0S P0Q@ P  \ P0 000调d- $   (00 $ ,0%AQ"h545454545454545454545x54545454545454545454545545 545455D50 10p 80 108p 80 108p 0 108p 0 108p 5Q0 10p 80800S \0  0800\- *00 S0 0Ô0$\  89\0 S 10   0 B 8 ;\0 008tQ0S0C 0  080 p-LM3A@Q55l55|55 d(<0aS<00<0080x0S ` \P 0P0\ 00S0C0@00 E0P 0 P0\ 00`S0d(0$0`0S d RF PE P 0P0U 0<*0S0C00$0#0 P `0S dP 0PS3J0`C 0PU0 0`F(J0S0C00$0 0 P (y (u0S0C07 0`$ 0 0 (d d 0S P 0P0U 0*0S0C0D0$ 0 0PO $0`  (<00CQd(08D $ 0n P 4 ]@-R@(V \S <0P p`W \ \8 \0 0 S d02P# :X0`0CV*^ \ 0LS\Q d 032 C\ * 0S0S\: P@ 0LS 0d 32PC"* 0LS-X0T $0nQ 0 R$ 5` R $0 R0d0 0( 0CR0d0( -LM<@!0 !S`pP␀O B0Sh01100 p0p0 Sa`!d(0S0C00WP00@0$.00Pd( 0 3>l S  0(0d( 03.lR 0S0C0 00 0ꐀl0P10p0<00<0}P<(< B.$0 >. Pd( 0-L!0L@S 5 5X5 5X5 5X5X5X5X5X5X5X5X5X55555555555X55X5X555P 0 S0 0Ô0VP P0 d (0812cS<00<000 S10   0 B 000\Q 0-L@80 8080 6Q-L@.A= 8 %A-L@5Q8꜐555555555555555555555555Đ5555̐55555555555555555555555555  8  0 10p  -@\, `0L<0Y0CPD L0X8@ HPT   0S \0 Q0 t00 |l0 p xh  -LMP@`p00 pM 4 $0 000 00PT0p0\0`0d00000(K000 0gk -LM 0A^SxД55555555ܕ5ܕ5ܕ5ܕ5555555555555,5555545 555555\5T5555555555ė555555555555T55555555p55555555555T5855555555555555550(0 , ,p (d0:3iS<00<0W8\P ( 00p ( (pp (0l0p (0l0p (0l0p (0h0p (0h0, , pP, $p(p ( p (,0Ap0 ((0Ap0 (p<0p (0<0<0  0@ @ppؐ$0L P1 DHp@tPx`|0hl (s<0$ L<<0 x0H (|@P@DpPt`p 1h l0  @P` 0ؐQ<0p (0<0I@@( , 嗽,p (@@:@@( , 刽,p ( -p (00&p (00$T00cS!` 0AR$0 0S (0 CYpp0d0(  (p0 (pd0,  Ap-@LQ$555(5(5(5T5558585858585858585h585h5580 S 4w( d>,0`S] PBQ *0S  0 SQ:(H( d>P 0  01! P`V0<0@"000U0p`B00 0aP( d03$ P| ( d03$ P0H0 0P0 踃d -QLM@ Q Q 0S0C00 00 0\0L0 00 0^0N0(0D d$0 < P D $ 0 P d( 0D3>b$>.P -LM@P`p 0@000 P! 0@@` 0@@` 0@ 00 000@p@` Q Q Q!R<00<0 ,R<0<00<0 0-AL@<)Q15555585x555555555555555555555555555555555555!R  ,R  <0!R@P ,R@P U 0S0C0 00 0!R ,R!R ,R!R ,R@$ (0P 0-QLM@D Q3 Q `P9 $0 R5 0( 0CR0d0(80S0C0T $0 0aPCU 0S0C0e `P  $0 ֹ`Q0A0+ 0`0P 0 0d08$ R Q0A0L 0 ^0N0* 0`P $ R 㪹` 她` D0P 8d( 0D3>b$>.P(0D d$0 < P D0P D0P -LQ@ Q J\\0 0 C00\P A N^ :9Q0!000C^0/Q\\0 0 C(R lR`1`! @ dR0S0C0 00 00Shd>$( D.P\H`PLPp? 0/S5 5в5$5$5Ȳ55$55$5$5$5$5$5$5$5$5$5$5$5$5$5$55$555$55$5$555555555$5$5555555550@Ss `pQ @K 0D@K@P~@0D Pp@0D H`L`(pC`C````````0S@`[ژ, 0`S@q@TM4 'h7 cl`d 0 3>(R lR@1@! bQ0S0C0 00 00Sd >2.d$DE00CS55\5\5\5\5\5\5\5\55\5\5\5\5\5\5\5\5\5h5P54 4 4 <0($ T0$  c<`K0#p  P 1 #44H \Q Rz(0 0S 4\ R$ P! @\ @0S "\<`K20"@p  P 1 #4v T0:4P m( d02 aS0 BS/0( S<0S0! c<( 7 E0S@`j0`S@, 5P  0d0t0 S0S0!0C$0RM 㦵h2>dD \ 01$ >.PZ`S>$0.> PJ>$0.> P>80, DL P0@H03iw$K?l?p$?h?p!c>J?u&e;de;e;e;e;e;e;e;pe;:xe;<:|e;$9 -0LSP`" Q"@0! 0@T2D 1C@p`@D 0! @00T<9\9 p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P Uphꌼ99 4S!D4! 3=8S$$1 0  >08S#10  < >8 S#10  030 W(08P & 0c,A P0P0x0U  01x0   00x0  01x0  0 0 0L       T0L0W       0Q\hXhخhL0S@0 0R, 0 S  `hddh80 P0S0SPdh- RR2C0@$sJ0R0 b0?\00S 0Q 0S S S00q03P0S0 0pd 0-@L oPP@ 0S0C8#80@ q08g; -@L Po`P@I U@ @,0S 0SC$( 80!\*0  \@,P@X% 00S" P*(^  $08 P0NS 0P 00a0CQ `(PU@0@008#80@@ p p@$9 p-LP ko80`@T  @Tphpdh -Lp `PQo0@T0$ R @T UV 0 RX 0( RW P tp ppdh -pL @o $ (0P7 r0封ἀ Ȑ T 0`p1 `Fp <fr< a($0 @Xr8088 Q밁 `(p $p蠕ddh -LM` <=r8 8< > $0 08 壡@4@ +r4 P$H<@ ( $,@ 80<Q<,0 4 P@ U* /.000b40X  B0@0qB(00 @ ^0 0 0 aS2, B" @0 00 PU$Q@ <,  P< , ( ź80 8 0($04 8 8>P8(K4q8q080 0-L@ QnP@oo P 0h0H 88 #Q 01S 00="Rd p-<2LS 00pdBP `Dp0S ph+p000 0@@0oD 0R0!R00 10<P d Q-Llg; 0-0LS@0m0PS 0  墝0S0hog; 0-0L@0m0PS * R% 000 00S0 ĜS 00S0 0hn R <0 R 0  0 hkhkhk 0-L@P0h -00 ="@0L80 S @0S 4 0 8L0dP 6j0 0d2 p-L@PP p[m0`   R h05 :R`0 0P0R HWphn80  @@0 Hhkhkhkhkhk0QD@2L p-QL@` Q Pp008Pp00V= L0S XP P P@ɫX0PP@Pp 00 p-LM0@=2S @2+ `2S0 R8L|Kp Kl 0h 0`Q8 P`=iB0PEB mBT31C 0/L#b1 Rbm 080T 0 @2 `2S 0 @20@2 0S0C0hkMb -LMŸPŸ @,P .`0 =rW@ 2QP 2Q1 5Q @Ÿ, 0R(Kt2Qό@ 0B~S1 0< R 42(2 q$b rKr 00OK8008q1S@ 0B~S1 0Xe a\0I 0\0 R0X0R \0 S08 40 L0 T XK 0P @P \\e aPX| \X0 AX0\0!m` d0XgWe@Ta "P@e`Uhk|L6/6j; -L M`QP I0S@)pK$0[S I0@S P K 30 -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpgP K @2 P0 0@TT -LM4 @P0 `e B``PPs ,0 00-0 X3,  0 P0? @./12 00 `Q 0XS _ 0S[  R00 !  0 PP98pd@ 0pP5 2@[T0 1 00, K.@D 0pP 2@DTP@D1P0@, K}7 0pxPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S 巿 P?0@S@0?080S? B4100 PP0PP   P 0 1 0 <`P 0 0`"R 00d014 00PP ,@K  ,9j;j; -LMB4( @'pT TDk; P-L 00 l9:lh -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KP(0 0$K -LBMPpQ@P` P(K!rJKI8 ,K 0P,0pVp?0@CVT JK 04("8  00X00S" ! 01 R101 01XQY QP@S G 0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[O͐H 0KhP!  -LCMXJOKP@D`K p0,P 0  !@tQW@ p = p<0d fC@;E0:PD`d  TdY6@ d /Pep K(@ d!` 08 =, 0R(K庖iDk;Lk;\k;xe;dk;\9 p- L@` R]P ;p -`LPVp $@T-x FQq T>qH:V ,2q+=:|k;k;pk;a:0@- @ 0 XPX ăP Q0 S $0R ^0 09X,9R R0J4J -00LT`V( 44j pW0P0@0 PR@ 0WPf\8Pf\0Pf\f\0 0T0 -00QLT X Zp`000 PU XP P @X0@PpZ` -LMT p4 000 P 50 @0S0 0S ,4  0S'`T00 @B P P0  DPZ P T0S 4 ` 0S(K V 0S 0' L  M K mP> P 04  0 00  0`PP6 T0S  !0S00 0  ,  0S00, x0 l 00 P00 <~00 ( l;l; m;l;l; 傔B<f #[P8 <X 40 `P y fZqb00>0S Sf ZPa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P u0 hκ0 R0@0/T 00im;dm;pO6m; n;m;09M61 g2S p-P`L@ YZ@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^Y6Y6Y6Y64Y63p0S:0 $ (U **0DS;[6[6Z6Z6tZ6 0U T񟗾\6\6\6\6\6\6\6$\6,\6<\6D\6p\60 @0PU p T;8[6[6[6\6[6[6$[6[6\6 \6\6߹pX0 0C\ X0 d ”0t4 4S 0t4x4#ptX0 0X0\ Te  ᩔ0t4 容p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hTYh @Opp@ p@lPh FlPYplOp8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h l0d 0 l0d 0,0h lhd0d@"tDl xDVn;n;n;n;n; 0-PpLP d@XTp@0hX -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0s00 00 0\00` -LML0S  $@T0K@^Kn; -LM40@4 00* -LlMp4P^ `@ cS 0RKK K4@K004 0@2iP9 -LM`4Pp00 40pPP W40@ 0丒004 4 0PP}W -|1LMQP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KX 0$ S;#0 0 zQ Q Q@0 0  D0 0  0P D0 0 4@ 0@T@p0 KT` VH0 0 H0 0  IUDUU@ 0-50L0@ 050l PBUlPPPTPLP LLP8P 88PDP fVDP0 -LM50`0P@050l  Rl  @KHP fW40D@PH@ 80@ @P@0P< @ Xq  4L0P@ 0PP 0PTLb @8_DfV50p050PlpP8pLp "PpTP Tpf6 0-LM@P0K  eT Td0DS Q020C0 !1*h0\ 50K08  < 嚶n; Q-L@Q o;o; -P8LPP\Pf;Vd\ p p`@h0!R h 01dp@\` Qp-L@` pdQ` `P h0!R Pdd` QP0p0p p-LhM0 d0 @P`Kd0T@P:Kp -LBM P0004P`p  @ X 0S@00SX 0@SP~   00S~@ 0@S@0s 2R~ (K$ Kf0( Po($\`< @P_P0d ڵTP2TL"L ѵ@<εf UPh~ 0Td@H0uCKp H0($ 6PpH0PHWH0PT08` H0 1<K!4P 傔h0P180PW @0 $(P0 $( P0$ (P ₵0p0 K{0p0u0p00S S Sm0@$0 v$f SUP( $ LtZ0p0 p0  `@0$0 0T0H0@Ejo;::o;:`6g6 o;Ho;o;Hddo;fddo; - LP@ P 0S @0 PPQ<0P R 0-0 ((L"!@0S1s s 0D0pP80< sQ00@R00pP800lddd 0-@  0`p 0RCK,1Q $1Q 1QQx xP0x0000 xP 0 Q000 0KP Q 4 @0R0 K%P|0-0|00免|00|0i}fpUAUvtnU~f|9 0-LM` @.Q@@v0@0CS0888ld 0-0LS@D0PU 0 LcB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕp; p-L?L`@P€ U 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !JPA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ ϋD1S BT\1S XM`DP ]K0 \  !D@TN(KK ᫋D_W - 1LSPp @`1 1S`@ !劋b1S 2S a1S 2S h+_ vYh_ nYhI 0-a1LS@P \PPP)P0Xe둷 0 4p;hk 0-DPLMXa@ $K 0$ P  *\K0dQ5 -@Lp`PP D6W30, Xb10Ya1P |:hk6 0 hkQ Q 0S 0-@LPnP h1l!PP @  P@T09 -`hl1pPQL @ ,P@T i9 0l 0-LM00P@K4U ELp8pM8 p-T2@SLPP`004T2S0L P2ph) 0-LMt3@S 8PKL P  0x8 -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ t3S` L`PU ph#p p-1LS@`P 3SL php 0-@LL50P0 Q-L@ Pg0t3 -02LM<00`00p4,K( KP(@0 ,@0( ,D0( ,yH0L0@,(0 $@ P@P h1 R8 \1R #Q@ݮ1LS 500". l K0 S #Q0At 廮1S 0 @HP0$K,(x @P $0 X0X UUP03H03 간6S:99d96 6 -LM@K K= 0PKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp -0@SL  1S01 1S P 01P P1 0C110C1 Xp; -LM@P  K8#T0 0 @0Q00 <Q P p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp0S0 00 0 B 0 R00 -LQPp` 0 1 s@N=00 00 00 00 00r`o gr 0@P00 <Q A p-LM`PV800@0NĠL0MQN`O`PR`S` L0@`NKp -LMP@U`p10@0<0NĠL0MQNPOPPRPSP L0+K -LM@P  K0 08#T0 0 e00 <Q P -L M0`S@- 0BS*6l66܏6 6606T6  0K@ RY0S 0S00S S S 00 b0K\壭T T 0R0 R 圇D 0@@P  RTXpWd  00 b0T T00 =T1 ! X{T%  ,oT[00 TK0Q0  0T700 @ 0  0T5 T 00Q q 0@0 &PH 0PP_ i[   0Si d00 05@ 0@H:S 1S Lq;p;p;p; q;p; p-LM0PS@E 0BS6\6Ē66666660S 将T00@0CS0000 0PP KphB R 0PR 0($ 0,0Kp 4RC@* 0僫T\ @`840# <S  j i(h0$k0 0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@sP`@> VX 0BSP2 X RW .:R,1T0Y 0BS7$666$66d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< 卨ini膨X@Y@\@`@Y0PX0.BxiYiq>0S=}`0T04> H0AP r;r;:r;r;s;9r;r;r;>;`s; o;4s;s;9 -@L0 0 4JS00X0ĵX0ĥ -L@40S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#83 L9 -@LqD00hE -@LgD0S00@ES010,0RR00,0,00 ,0S P, P0,0 D0,0 -LM@Q` ( pSJ686D6`62 %㼠 z00 " 0>40 01 0@0 T0%(KQ, 0 R*$0Q'0,00 ,0S P, P0,0 (Ko`H0,00(Ko00 0 !0,00,0t6s;<0S8<0ŞH -LM @P4`0S3$pW00 0W0 0 ! $T@  0 P0(Ko<0+ R  RW\0,0(Ko T@$ 0AP(K6s; p-L!M` 4 0PS  0RKp0 "K@Kmt PK1Q K1@K L4 兦0 $xis;9 p-PL F@`@ @002408P40012` 902`p<66d p-LM`2 <2PK0@!2 uy00004  W00CS0xx@3 p-LM`022 < ;PK@ 2Jy00004  ,00CS0xgx@3@-@0 , 00\#^? 0-@LPR30# 0 0-PLDP 3hS CT /U0@TR0 0-LM@PH ?P  K0HT 6>P  HX \? @PP w Tѥ̠\34/ P!us;s;p6t;6 -2AML@`x3Pp0 |Sx 0x#C40tx3`7N``  tEP 0 4劥DK303'Э64t; p-@LPDyPh3S 5  `0  BQr0Cp P0`FQ0S*DP D]5 ;%55;5p 10R!!  10C1 -@PL D9P DhI p-L@D,P_ A`Qh3S 3 30S 2 Sh#{phBp0 -PLD`p@P {A8W;H8 WW" 0 0@0@ hW iB0 0@0@ n p 2S0PiB`Lt; p-LMP0 0@0@`X嵤5A0 K@tP7t 1S&jBKpht; -LD`PP 8@ U UUpp#R 00@`0@ 00@0@3 03%PU\hC  0bst; 0-t3P@SLpS|S DPt nPx 070 -@RLp` @ ; 0 0P PPPP+7; 71 7; 00t; -LM`DpPP 8@ U UU(K3 03P(Ua ̠A\0L  @F 00KP 00 ~00S0 0@0@Cm 0ƣ븣+KA ~)0[PU)PK00 0C00 0 00 0@00@)@4  [7P tP  [  q4]A\0 0@0@ꐱ6t; 0-@PLS 47P 3S DP P 070 Q-LDo -LM 0S  0 Ƞ8,Ƞ#8F P 9 -@L \D30CS3h[3 0 3jD -L M@Dp`-P K@0FD@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`D@pP K@0DND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@D`PP Kp?0DF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PD`0K@P Kp?0DF!0KA0!K K KK0K@K@K@K`K{P[ 0-LP z@@T T ;>  ~$ f& ~b;> (0hE~ V^'t; 0-8P=@L8 XC ?x\P P=\PB\S`P PA`PF0`3dP PDdP0d3P 03P h03|P 0|3tP \0t30h30  \yP  p \`jP  < (d[P u;u;$u;Du;du;u; p-@3LP%D{DxH>8`@O Ns00S 0@vnm30CS3s?p xG -8LLp3 @@ TP, ` 㥻P`=QP@@0$gX  卻P` 8<8 iQ8<8 -LPDWP8@@ =po @6T8 1 *7P. 7P0 H q j M\3S 8@0;8>hwT @h>,h>P h>u;u; -PL`D@pP@ `=x1T 0CT'  00n@4T- >,1T $1T0/r@% = S" @S+ @X 5l3@505O0 R0@5@ 4@D@ 9l3  ~l3   si 5i 6i( -@LpP`: &< %_ ([@@T ( T hUu; -LPD@`OpP   %5@ (1@@T ( T &W@H$%u; 0-@Lg  30S7 \ 36S$ Q J DPP;> 0 08#8 0hg, $  0- L P# @@T #  T !0h嵟v; p-L`@PP@4U0@p -LMP`pDS @P 呟 K2"3#CCCC cc1@$ KY@P4 08 Ƞ,Ƞ#8F `$;>H!b0C p/p0PS00ST#0@S$Pf   0PP# PX#DP3SP T3SM X3SJ ;*@K}kP H* r414!8!,1,!1!0` `⟹1! 3 1_0p@$#(3 A 0sp 0L#R  qi/m s<]|Y lT"0q"q0v;06|6Pv;9Xv;v;066Ю666\6h6866v;v;2S -@PL ,P ,h -`3 @SLh#\p# ,KP` Pd `7 -x3 @SL#t# ,0Px P| x7 0-L`@P ; 1P ; 000@ -LM`4 ,P@^P08@ U UU(K PsUx $;qH04  44 ,0KP,p 0 0@0@  ppy:@tP  V ml;,Q /08, #x Q @ 0Kx[2[ :,: 0#AS, Qp0 :08#x0c, ^PP0 0@0@t ΝHT6v; Q-L, -LM P  0 Ƞ8,Ƞ#8 P 9 -L,P hE@ p-PL8`=8hsHP \P>HPDHcLP QPDLPJ0L3PP EPIPP0P3P 03xP 0x3hP 0h3`P 0`303pTC MTC FHP TC |  <00@X,Z 0 @O,KQ <0@@E,G 0@<,> H0@3,5 0|@*, , 0@!K0 04@,  0  " -LM`0PpT3,c @P  08 Ƞ,Ƞ #83ί3?SCCI;3S3CC3.lP |匚$K!l30 p/p90`<40S@00S@#0@S0'P   0P<# PD#,# 0S;946 υ0~p O0pr _ *@K@0@ 0υ(|.?0T]M$f m 0P`✴1!81!1!1! 3!1o0p@$#(3 A!1sk 0G#R*  ld$h ,n 7W R*@K0@$֙ә0>0ș"0vl"lpq8嶙x崙04i906x;t6Xv;6 `0:x;-:66666$6666 x;`tx;\x;hx;$x; -LMp00K`d (0 vt,P ( 0RJ$K 0$2K1 [20[ t"pxP'x% @P ㆳPf$0K Q 0 U A @ PqP  0< 8@0 0zriL9 t9 p-LM@5_`z0]7Pd c7P 0P73$ PZ3 PT3 EPN?0>0d( 00 ;X0< ?P TC hKph63#400@ ?PP TCl ƘKph6 τ07PT崘Kphy6H|3x/ PxV8@0;S8d6Kph|o,3 R09>T,単KphR6x;x;ax;T6x; -LMP@`p41T# 0CT,  00Rf@4T .6 K1T 1T0/j@4T5@"@% = S$ @S8 @50@5 0 R0@@ 5@X34@DX3L"K 0e"0[! [04 @\yX3  "K0HO![" [80$0 Dai 5i 6i( -p0pLM@   8@ 3#0S 0S S" S036?0 A0S  S 0 8P (h跗?  y; p-@PL ,P_ #4`0D3S ~nph^5p -@L?830CS3h3 0?38 -LMP,@pv`PX $KG4%0K&pKh 0`&K 0H @40`T TK!  y; -LMP,@A`PtW K"`K!`K 0`v"K0| o @d0`hT ?!["0[X  T  PP  L̠3,/ P5s;s;6 -2QMLP`x3@p0 |Cx#0x#C40tx3 7^``  t\P G 4塖=K303'6Xy; p-`L@P 5  P0  BQr0Cp P0 5;5pPEQ 0S*DP ZN5 ;%5 10R!!  10C1 -@PL SP hc -PL`pD@P 28W;H8 WW" 0 0@0@ h#W i30 0@0@ p 2S0{i3 [Lt; -LMP`pP K0 0@0@\q20 K @t7t 1S3Ght; -t3 @SL|#p# nPt Px t7 -@RLp` @ ; 0 0P@ PPPP壕7; 1 嗕17; 00t; -LMP0,0 @p`P 8@ V VV(K303#P-V[ ̠A0 L @ ,0K` 0, >p 0 4 S,0 0 0@0@C 07먃0 0 @0@Ἷ,00@0 0@10  _7P tP  M sc02^0 0 @0@6t; - @L#;7P 3S P P 737 Q-L -LM 0S  0 Ƞ8,Ƞ#8 P d 0-LM?0@ PK0KF0K0K@K@K@K@K@KPK0妔py; -L MPp@S P 咔K!1 @/@1!3#ss KX@P /0PS00S#0@S #P9   0P# P#X&@K0``P I :g0 8!0 1!0@ 0p`⽮_lb Hh1 0(0v;66Xv;v;p6666 x; p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KPKp -LM`pPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ -LP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KMP[ -LM@_P K@0  K0KKKKKKKK0P@t; 0-8P=@L8` X4iP P<PAS P P@ PE0 3$P PC$P0$3P 03P O03|P 0|3tP C0t300  aP  pݒ} \ג RP t <Βn (Ȓ$CP u;u;$u;Du;du;u; 0-3L@c=`0/8P@00S 0@f_ ^i00iZ p-LM`<  <8 0@\(3  ?bx0@Q(3 P P@ ㏬P@"_++!(0U(Ph00 8 @D ?4x,_;;1(# (#8d -LP<P8@@ .p" +ogd @%T8`   >7P( 7P w$ #  "  3S 8@0;8/hh@h/,h/P h/u;u; -PL`@pP@ P.d1T# 0T  00_4P@ /5@(@ ~/% = S2 @S# @ 5@h3505b0 R @ c/@ V0@@Jh3  ` `h3 ` i Qh 0-@8=PPL8X 0P<PASP %P@PE03 P PC P0 3PP ڽ0P3HP 0H3<P ν0<34P z04300 # P  p \P  < ( zP u;u;$u;Du;du;u; 0-LM@  ?P  K0 ?PP z LԐ̠HL3,/ P$Hxs;s;7 -2QMLP`83@p0 㔼7P H3S PH PL 070 p-i3LSPp^+`,P f.0,38@ 00S 0@[1Z0i3,pR -LM 0S  0 Ƞ8,Ƞ#8! P h9 -L@ P/.tP ┎ ht; p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K[Kp -L$MpBK@P/50[6 [$R_(K,K0 KP,P P ̠8Č#Č"̌ 0P  ;,-X!0\1 <̠ČL8 ČD"̌#D!L  0@P ,-P,<4("!4l̠ <($Č"Č%̌ 0aP L ,- 48y;y;z;0z;y;Xz;z; -L MpB]P ˍK K@P x0PS00S#0@S lP   0P # P#`塍 3S 3S<嗍 ,咍 0P 働3f1C g-P,& )O@`YP i Z`|0| 8!t0t 1!0@ 0p`ݧ1X[0i3+,K~z;Xv;v; x;z;v;767z; p-`PL@ ;P b!P0 @/D0@ R phM(ph! 0phFi0v;,,d 7 -@0L"MK K0KKKKK K K K -LMP&/00P00 `@p3 488S  P @,gVp `0 0   Ki0!B!O0,0,Õ(0 0P"  Ki -LM8P@` K!)@υ 0p@8/  00 00 s@ o7P {7P z3S 8@0;8Kh:*LnKh3*4gKh,*lP Kh$*u;u; -P@hsLW`@ (l1T# 0T  00&Z4P@ *5@(@ )% = S1 @S# @ 5@$3505q0 R @ )@ 0l@@Y$3  0D   $3 ?   i Q, -RLM R R K0K |%@-,3S 0 0@0@ht; 0-P3P@SLL`SXS TPP νPT 070 -@RLp` @ ; 0 0P' PuPPP劋7; 㖸1 ~7; 00t; -LMP, ,3` S@(8@% R2 RR t3 S% TI t3@!-t3 S0t3ʜA 0  @堽(K`;0,3 <2tÅ ,0Kѽ? ,,L, \ p  f,  R 0 0@0@ a0 0 @00@ '0 V7P tP  B QY0(0 0 @0@78{;{; 0-@PL4HS 27P 83S sP8 P< 070 p-LM8@@ Kp:'Pq 2SK 7P# 7P&  2>P$ ?`P < (喊Kph[(3 半KphR(冊KphK(KphD(<38 / `ͼ8!8@0;8Kph.(τd ? @P  ,PKph(s;s;u;u;7L7X{; 0-@8 =PPL8X P< 尾PA S(P P@(奾PE0(3P PC噾P02@P 0@38P \083XP 0X3PP P0P300  nP  p \(_P  <ۉ{ (ՉPP {;u;$u;Du;du;|{; -`@,sLWP@ =&0T 0T  00W4P@ s' @ @ h'5050 R@0@@ F@ i -邡ႂLM0j`@PT3p ]/00 T\  @00 0! Q " $K0j 0T O\@j@Xc0"!B PT3(/LL  墻PP $Kl30l3d9'7 0-@L,3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP @5 ;%5 10R!!  10C1 -LMPp,C`T Kl%8V;H8 VV. 0 0@0@x ҈V) &$K 0k P ^ `$0S 0 0@0@ 2S0~y&0 0@0@(Lt; p-z3LSPp%8`@ 00S 0@OUS0z3P&p> 0-LM @P 0PP  0 Ƞ8,Ƞ#8D  P 8P 80 SS89 -LMp`r P 08 Ƞ#8,Ƞ 囻P?8@KᮻḻP pS ᯻P 0$S0S? 0SpុPw ,0S@,0@S.P(0ĺP 0S(0!#,0@S3S 尺02 `R@0S2s壺P  @ 00S0"30S厺@剺徺P0p׽@P #$#0`S0@0S$#0SpPg   0@0S#0S3s $3spW3s $3s $Z` O?K0K0C @POKX 2$KO0` wZ@K^U< $8 #44"<,K ,0 hZ032S@ j1!8!1!1!0@ 0P`6RU0z3% Z0Sp G$K233SC< 7310 $00B SAB Qa0B7 BSW B? 2"0 P2O TH <9*v;777\|;{;|;C:{;0|;|;|; -@L7 (30CS3h 3 073(P0 p-@LP0`ٸP 5@00"00p3m3`30\# p 0-PL0øPX3xS TCT 50@T30h&30 -qLM0P3@0` ひC;QA40+ @/033H   ߸30303@0CS3T  dn0↵ K< a[Y<0>303<*7|; p-@LP0QPx3S 5  `0  BQr0Cp P0`FQ0S*DP >5 ;%55;5p 10R!!  10C1 p-@PL 0P3^ "`2x3S \3 `30S P2 Sx#P\ph#pt -PL0`p@P `"=W;L= WW" B? 0@1 Al ƅW i#< 0@1A S pP2St]ix#3H0330CS3ƼLt; p-LMP0 0@0@`X吅"0 K@+ 1S)E#Kpht; -3 @SL#|# 0P $刷P 宷7 -@RLp` @ ; 0 0P߯ P-PPPB7; N1 6б7; 00t; -LM`0pP'P&U& UU h0l0h0ɸPCUK 0Ÿ0BD0  @b303峹30CS3'(K,0K P嗷,0S 04 C, 0  > 0@1A R"0 0@0@h@n 0DŽh3D0330CS3ܻ꿠0R P_00 @0@, t@ @"! =7P P  <  R V"z0 0@0@4-7t; - @L#97P 3S 0P ,匶P 7尶7 0-LM@0\PP K034038 D0.P  CP30CS3^4< H0PP  H.P<D3,9. P~Ҹs;s;4-7 Q-L0 p-LM@PP` 0 P Kp@ĠF@0  KK 0KK`KKKK3 030 Kչ3P0CS3 -LM@P`P 0ܵpP KLN@0 ' K#K(0K%pK!K&pK$K"K3 030(K⥹3P0CS3غ -LM@P`pP 0嬵P K@$L?0 KK$0K!K#K"K KK3 030$Kv3P0CS3᩺ -0PLM @ K@b0P[ -LM@PP`p 0lPU x @ JGĠ0 K KpKp  >   7O p-LM@PP` 0@PU xK @      K0 k% [0[x -L M⬁0`0$0 PC= F-,pK U%[ 0%K$P= @P PO K?0 Q0 U A( @ PP =<=P H $ 0R K; =<=/  0[id9 0-LP0头@P 0  |4%T @ 0h(%' 0-5@=P5LUPXDP =P1DP6DPHP 2P5HܶP0H0P 03P 03P 03P 030x30 h; T5D尶P  4, &H塶P du;u;$u;Du;t p-L@P`0/& {0 5  p t7P,p] Z7PցpH @ 8 3/.H0S D0S 5@0;5tPXpDP ipu;u; -`LP0@pᗳP@ l1T 0CT%  0tgO@4T+ C 1T 1T03.S@5 - R" @R* @E @505>0 Rt@5@ 14@D@ @ (@ @i 5i 6i( -d0LPt`$0ѯ0ί3p0CS3;=@3N -St0S MkLPbWy -LM 0S  0 Ƞ8,Ƞ#8  9P 9 -LM`PpԀ0` տ@P ˀ0ֲ$K2C3C7Sn!2CCS3( K⑳@PL(0 40 0 Ƞ8,Ƞ #8t?>4Y080@0<0 `R>S4 0@S4KP/ 00S@8<0S80s$ <0s! @0s .@K 0pP j 1hc@L[DXL0R CS tPϚ1!=1!!20" d303Nh#t` l3P# 0LcR  0pC-T#R  RJXNP |T N"0R"RC:4v;)7|;t979ty;X};};v;H;(7x;7d+74747&7&7t&7`&7QM -Lp4R,1P@ `0S* ~d@ D0R,< 1 00@Sq<p1 0p@  @ |P`0 | 0@P`P`000 0PP0GH00H0u00 @0@{i{ii -PL@p!1`R-101U7<0!0 1SA<@10A/00@ 0@ 6 0-@8=PPL8X )P<ӳPAS P P@ ȳPE0 3P PC弳P034P ӫ043,P 0,3 P ǫ0 3P s0300¿ 꼿 味P  p ꭿ \ 傳P  <~ꞿ (~sP u;u;$u;Du;du;u; -M3LSP` 8@ R RRpp\30\3割PVhPCm 0~\st; 0-LMP ?❵P X ~K0 ?⎵P I ~@ 1>@ P@@P 2 T~ˠ,034/ @ܰ,0s;s;4F7t;K7 -2AML@`Pp 3K S3 O\\  嵰 P  0N~KD30D3I7|; 0-@LM3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP  65 ;%5 10R!!  10C1 -PLMC`Tp |8W;H8 WW" 0 0@0@ሾ h}W i0 0@0@ o p 2S0i Lt; -3 @SL #$# \P ֯P 7 -@RLp` @ ; 0 0P PPPP}7; 㠪1 }"7; 00t; -LMP0,0 pM`Q 8@ R RR(KP30P3P=VL ˠ4A0 L @寯,0K , 2X0 0 @0@, 0@ @0  7P tP  5 K0PC 04}P0 0 @0@`K7t; - @L(8#V7P ,3S 垱P, P0 7,<7 0-M3LS@8@ 0aP7P 7P 3S 8@0;80h@|0h,|0hP 0hu;u; p-PLM3`S p0 0@0@(|91S phWht; -p@MSLU`@  0T o0T s0CT@ E505 @;  Rh @@3@ @@ @@ ni 0-N3LS@08P@ 00S0G0N3 0 -LMP` 8P -|R!1 `/`$ KPP$Ԯ0`S00S#0PS$ȮPA   0P" P#{2S+ 3S( 3S% s; 00! 1>p!80 `g 00P`@!0@`FGNc8{ ({0v;Xv;O7H7 O7hC7v; x; -LM 0S  0 Ƞ8,Ƞ#8 P ld -@L730CS3h贲3 073 -@PL 0刭P 0h蘪 p-@LP0`yP 5@00"00p3 (`30\# p 0-PL0cPX3xS TCT t*0@T30h'0 -qLM0@P `3"C ;R' @3H /  凭303د3@0CS3T Ἳ T{0. K<bM<+303W7}; p-@LP0Px3S 5  `0  BQr0Cp P0`FQ0S*DP 25 ;%55;5p 10R!!  10C1 p-@PL 0彬P3^ 5`B'x3S \3 `30S P2 Sx#PQphdpt -PL0`pᓬ@P  =W;L= WW" B? 0@1 A rzW i6< 0@1A pP2St]i$3H03姯30CS3rLt; p-LMP0 0@0@`X4080@0<0 `RCS8 0@S4ާP3 00S@8<0S80s) <0s& @0s# .@K`.0`1pP t ꘵ tt@ TtHtZA 0t G tP[1!=1!2 0"d3 03Nt`h#l3PH 0LcF  0p!T#R  |G?BP xqI mF"0RG"jG0v;V7L};g79py;T};|};v;v;U78i7X7d7\`7dS7TT7S7S7Q Q  Q0 D/H(0$ 0,B$ ?..-08 ?0R<  C480?.. 0-@LL P0CQ 0S0h/ =8?8/ 0-@L4 ,0RP / 0?0h4/0/ 0-PL( 0S 0@@00/ 0-D0 L@0P 0000S?0h'D/ 0-@0L@l0P 0000Sr?0h'D/ p-t0 LP@T`P H 0000SphR?0 'D/ < p-PL@2L`0 S Rphn0/<  .?. -`L0pW ͠ @/\8P^xp 0 ?pW<0  0 o;0  o38/hWk \qT ph\phZ<@< 000ۦ00CS0ᦨH(Lt;D(( -LM`0p 0 0S"R" RR9 R7 R@ 1QA 0%͠ %L @嶣00000CS0#K 0K R0 QF Q? 9CS}7}7}7}7L|7L|7}7}7 ұ0 +qK@ 000q00CS0<qq C kH((D({7t;};}; 0-L@ 0P0 0喥P 0xph P00CS00P 0D =, P0 d  C0?`% V Pm%-ob$K0S2*@KP0RK"K2K2R4 0R0SN2K?2K*@K02K00C SB`7X7P7,7H7@787,7,7,770,"02K0"K*@K2K 20S` 10SV S*@KK!PK0`20pLK&6BW?F K4K-BxP`V000000 R  BBhB1! K 0@] 0P `h 0@P @ h0 RQ 0*@K2K0"K2KE      '$$(8~;'($ $ (('({7. -2LM ?Rp` 2RS 0RD Bv2"p 0 00@0AT2T"@ [0P8B8Ÿ   @-0 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 D$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0ASꄉ7x7l7`7(7(7T7H7(7(7(7(7(7(7<70 00 00p p <8# $ $(.. ((({7'(' -QLM0`(!(m$K1p 0 ?% X00DP\Z,0@ /, @e@@P 0 +  %yP c0( Hm 4%=m`9~;/.$( (('7~;\~; -LM?p`0 \`,0 M \@1Q  A1(A(Q0 I 0 10Q @>0 p0pᴠᶐ,0@000`@0 [@0P}@ 8p  @幟 i\0@P@(K(Ko>'//$(. (('({7. -2L PRh x R 00 0000Sc \P400,AP P%OP00 l T8B @p0[ lU lO |lI hlC Tl= @lI(D/D(//(((~;u;$u;u;du;Du;u; -LM@P` ၫP vl KLpP8 1!@! 0 `p0C `d!(0CP\1p p p0`S @00S ; 0@S P   0P0  P0 3l0   P (l #lPbP `lTlL0  @| 0v;''0/4/((Xv;/u;v;~;u;I(w7 -LM 0S  0 Ƞ8,Ƞ#8' <P H90@ 00CS7777ؒ7777 P P@7P,@nPX@l`0 $H0AhSw77777777777777777777ؔ777777777777ؔ777777777777̔777777777777777777777777̔777777777777777777777777̔777777777777̔70 0 Rf Q Q0-L@P E  0@ET  08#0`08#0@jPjd7\7l7\7\7\7\7\7\7t7|7\7\7\7\7\77\7\7\77\77\7\7\7\7\7\7\7\7\7\7\77\7\7\7\7\7\7\7\7\7\7\77\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\77\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\77\7\7\7\7\7\7\7\7\7\7\77      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BF6DV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.P긙77ș7Й7ؙ7777777777777840,($ :~;; ;;;$;~;08 Q-L 0l R0-LP 0hi0 @0C 00h @B B-0@4< \40›P 0F 0h@,;l -LM⨐ 筛P# 絛%`? p0K ,K0KFMX T0P/K@N+K0.K-K*PK)K;N (KlH7 0-CML,@P0PS 000U00 -LM!T K\@Cd@p$K$K#K!@KPK`K"@K0K<P  NiKlx; p-p0LM@ KK!"T`  K@0 0KKPKK@K@KP ҩ ,iKplx; 0-0 @L$8P0 $ 0 $0h 0-0 @L$8P0 $ 0 $0h   0 R   V p-X0(  Q@P PL0@`[o  ph -d@L x8#H,"(q(R -(j(R  hbfdh -LM!T K\@Cd?p$K$K#K!@KPK`K"@K0K{P 3 hKl; F-0- PL@0NB B4<[[@Q \00HS 0\ 0R B0HSQ$0gP 0F 0hB?l 0-|0L MKP?0@!0KB0K KKK0K@K@K@K+P[K0 :hl; -,L@8    hD -,L@8   hT -LPp`@x  @T`hhT @46%CA("(0$(1 0p; -@0L @R ,0 )0 @ h, !0-"(LXP}@Mh @T(g0T Y0; -LPp`@MK @T$hgT $hL; 0-@LPT T 00CS 0h p-`LPV@ V@@x0 AQR@ P@  ("(0(  ("(ph p-LP@@ dT nP dT88gp,`@0 @|@Tp;9 -L@0X3`PPO P@l3l#0Pp1p#S,(7d77777(#$3!3yDp V ""2! "8S 8S F V  F#Nvx iD2!\ (""2!#)D !!1!#@ !1!#)D }VP! -wT!rP1!m#@  f$1!a#)D [0V  T O K0!F#)D @ k -:8 6<0!1 - -X99t99$9\99<9 -LM!T K\@Cd? p$K$K#K!@KPK`K"@K0KP  fKl8; p-LMPK 0@![B=  0[0K[!Š  !!R0!aP P` 0 `/0G-  0G- <0x 0-0h 50LSP0CS005 0hT(e00 @0@0|: 0-PP#C C-0 ß  P2熙Pࠁehß, 0R(Kp3 PʌX 4!R Rڬ8S S0 x q#H0820 003\mX 4l4@D d@D \@H$H@H$(D 8 < 81S'`d 74D(? 0@0'PS@ @ GŸ0 0/.000b0 q @B `PHCM0 @00H!080 '<8\p '.0 8Pϐ! X 0 P P傖՘P@ ḐJ 44@D^ @@H$Dr@l -RL@ ZZ ] bZ& 0 0@0@,0`p lPŀ 0@H0 @ mW0ܗȀ;` 0-0@ L0P 㘔P XPP ;| 1  d0 0T^b 0<Wb0Sb$Obl; ;0;P; -LM`LS@0 @DTD@D@dTd >SdT[  "PP@ $K8p0(OpF-0 NXH M~c 0<21C! c.  P0vU11P@, !ԡB= 0  㴘@P o aa@1B}p  0៘@Pl@P XaR Da8aP a @A!ˠ0C- DP@ (R B 5RN n   550;@05(R  @] B@WTiaP9"VSlxpȁ;x;t;;;(;7DH; -QpL`@MP@ R1PT- |10Sp1TI 0i.@4T@ H1T# @1T  t4P@# 0猕505 0S0m5@ @@ @ t4P@8S 5A0AS@@ Y0i.@5A0AS @li ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @i, 0R(K >KP0!#R0 0@0@0@ TD D H! zpPo ;H!堍1 `"1ӕ p00p0pD0T 48<#8:#:0 0@A@ 0S) 01  D 1p 0 K p0C 0D< 0 $1 1 0H! 1 0@T1T!8!L1L!1!,0@ 0`I95)P1!1#2!(N  X0 0 D0C @<0D BD0(K(Ko0^ (Ko*^(Ko%^l;txp 77$7| ;887\77h77t7(TRЂ;;v; -LM 0S  0 Ƞ8,Ƞ#8 CP 9D p-H0PS0`0LS4 U @T@T 0 R000S PH@ppp000SHPp -@0L<@0D0 -L0` 4#APp0Q |7777777P2M@P 00@PPPe mPP 0 $j0P00P 00 0$0S000 0$S0C40 0$0S0000S0C40 P  0$0S000 @P !0 00 0C 0  00  00  @ 0$0S0000S0C40th p-LM0@`R@ PP0 |$RL  R] {R 40S^ 00 KU02RBH0S0B@@ @ 0 4 R 0S0C40  0 @T@@ @0@8 0 @O@x<8 N0@@!<CKpH P0 $ RA 0CR K\P 8m0R) R@@ 0 4 R # 0S0##40 0R 0RH P0 $ 0$z,@@ ~L@ d7\; d d 0-00@L@P0S R000H0 0  0h p-L`PD@T R000H0 0  PL0S 0D  ](D@Th; -ML@@ ((0@P h[h774];t; p-00L@@Pp0`S0H00H 0@H@0Dr'ph 0-LM0 @00P<@0[T[0L0K0T@!ʴ[D 0D0H 0P [0L004 0P , H[0L0T@D6$K0h H9\h;ph;:;;7 0 0  Q 0S3:Q 0A Q 0   |h~h 0-LP@T00 0P 0T0C? T\00D  00 R0#03\0S0 00sP Q AP000 P0 R0 RP\ P 0 R 0 RP\ -(L"HP T  -(L"HP T  -(0 0@00L0P,00 0,0 40 -,0 0(,00 L000 -,0L0@(00 00-00, 0 0 0 0  , 0-00 00, 0 0  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,00 p-H@LP `0S 000 0@@0ph -00@L PH 0-@LP0$0 @$0P00@0@0 0-@LP0 P(0  00P000h 0-L'M@P L@K@ 塔 0PRK0+3i\9 0-0 LP00@P (P8 .0 -@L00  0e0C 0h}Pey -L0P`p4e @PP P 00 0 ,(0000 PP0@eN p-LM`P@dP 0 K0P  0R 0  0$0  $@00Kp0 -LMPx ` V, ',e B@P$ e <Pe0 P 0,0'0`0 @ 0000@ - PLU`p0e @P( e Pe 00 0`P P0 0 p PP0@ 0000@ p- LP`e@P* e Pep00 0P 00I B00  V@0 00 @pp -@RL`P 0S@p@e_e pP 0T 1 !Rp@+ -`LPU030#QZp @P ` f+W%4 0P` -LM 0`Sp&PUp $K pPe @$0T0 $00@T  pPe PU0 0 -PQLp- 0S* 0S' r`~P@1~@# 0 fP 0 f 00ST  0000 SQ:000 -LMP `0 Ƞ(,@, 0 Z@P`00,p)(#,< 0R)< 0 P0  "< 0Q 0S \  (K -LhM萟0@,0 yTKP (0|pKD (0?Hr@Er@ `e P @  0 Č@ P,Ġ.0< @ P @JW, 0R(K0i܃;l9 P-L 00 1W9:zh -@LP 00P [W00; p-PL(`@V0$ R0 00S 0R: 0S  0  1V0S 0S `pp1 00ph" -LMp@e PP@ 0 LMt0s 0@80z0< zRul0vvuNĠ\0 0l m0qnorp8X 0)`P eK<0<@0P8e`S 8 N0``3<UP@ < @8er` )0 @K0P) 0 P }5P47 0-@=t=PPL=] (tP0 0-LM@P T0d LDT0DD  LPtPjVK0'7; - L]V ; -=L@@ =@0;=h p-`0 0@P0@L4:V5 ;%5@Dphht; -PL@`p0T 0T  x0#4P@  @ @5050 RxX@@ Y@ i 0-LЂ@P ; 1P ; 00m0s@ 0-5@ L P0  BQr0C0@3S 0 S0PEP0S*0hO 10R!!  10C1 P0 5;50PEQ 0S*DP  5 ;%5 10R!!  10C1 0-LP@x0h? -0LM`RP,0 p VV 4#R= R 4#,͠AHX0 L @P\NU(K@34cS0@3,0K`,0S S 0 0@0A2U=@   "U4#.P ,00 0X, x (0 0@P0@   c#0 0@0A74;8{;{; -LP`o=pt;@P=M t@V C? 0@ 1AT2S \P+hA? 0@1A -L M(P̠`ß 0 @@@200 \u)4P TK480 pP T8<p @0%P dT8@ @0pP#@Kl'08$ #0K0" K!0KGK 4P iT4P bT|LyPLTP}T0XS P @8@#H P<8@D @P 8:T07T͠PHX0  @PP$T02NPK0` '2  '83%3  T0 ="0 2 "x@ x`n4"0<3RP;\;@;Ld7t;;;̄;;$;;7@;*`iX;8777bm 0-)@-P1L`QAp#('&%$"YxhO@7 -)LuP #op3} - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0%S "Sp;; -PPppL* 0 $P `U 80S T V0@T404040@/TW H0 ST404040@/S렅; -LM`sx@V spp0$ 0QH< P$ R 800 QPR 40PP  X00 S P<0W)< < 4<8  4   4 @Kd d0, @@ 0 o1P $000S$ 0040$0$40HP(00(0(K cS7|7ȅ; -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0ld(LT $ -X0L@lY( 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00hy$L0& q$\0  L( 0g$L0& _$\0L0"W$\0  L0# M$\0  L0# B$\0X 0@ X h00<0L 000$X0L0 h X0+0 B#$`0  LX  0h0X 0C+ $`0  X 0@ X h00<0L0 0$`0 x 0-TL,0@ 0P 0P .#g0St0 gP S tx 00PPx0S -TP 00LR`p @$<0 T ,00@h, \00Q0S 0-(0LP0tX0@08X0 T0$4P0T 0h p-X0@L$!;98 T8}wPtdU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@ `0   @  P0T$8 8T$8 <8T>X0.L 0\ <#3  `0 + ;8#(0T$8 8X0@ `0T*, ,0$8 8T$8 <80 X000 XS0@}T 8 T0$4 @ @000l@X0 $}&0<;7 0-LTP 5& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Kp0 -T`L0@' 2 1C P ^{PY$8 80T$8 8X0@80T$ 8 $84  X0  h9; -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES88, 880% 8T0 $4V>0$T8 8Z)00C0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP 09 p-`L@P  x N(0pL0 P8 TP0 X0h T$8 40 \pph09 ;$9 -T`@ 0,@00PL8 T0$4 8T0$4T08 p$4,0@0,08T0$ 4  00 0, 00 00300  0 000000000000000000660000 0-(0PL@  0ES 8 8T 8 80%_00y0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S2p -LP T9 p-`L@P  pCM(0hL0 P8 TP0X0T$8 40 \pph7T9 ;H9 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@P(888888888888888888888006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ES8 8X880% ^00x0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S1p -LP 9 p-`L@P  pBL(0hL0 P8 TP0X0T$8 40 \pph69 ;9 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ES,8D88 80%?000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Scp -LP 9 p-`L@P  ptK(0hL0 P8 TP0X0T$8 40 \pphh9 ;9 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ESX8p88L80%t000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LKP 9 p-`L@P=  pJ(0hL0 P8 TP0X0T$8 40 \pph9 ;9 -@T08 L$4@ R\ &RZ X0`0B%S&888888888888888888888888888888888888X88 &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 8 < T0$8 4PT$8 08T Q-L| p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S pq6@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS88P880% 0 8T0 $4T98$ 8`ppzp L0"S p L0"S 8T0 $48;T$ 8p L0"S3p 0- @L8T0$4T98$ 8P}U T0$8 4 P0 -LP ,9 p-PL`@  #I(0$L018P0 0T@?>C2@0 0 X  8@0 SC S  T0$84  \ T0$8 4`phhX0  8T0 $4T@8$0 88T0 $4=8$T= 80$T8 8P0X0 T0$8 40 S@098$ T8P0@0,9 ; 9 -@L8T$ 1<8 0-(0L@P0  L0"SU U U a000% Op0p0YI븈; p-@LP`jH(0L0 P8 T@00X0( R XphYH T0$84  \pphV;9; - 0LT@bP0 3@50  S R ? 0;Z -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 bP bP8T0$X 4 000 0008T0$ 4 00@ 000  000<;0: -(0Lp L0,S@R R R S0%  T08$4! 0%YR T0 8`$@8P30  0T$8 8'H@; 0- 0@ LhPP 00 3@5 ? 0waP  raP00490:<; p-L@P`P   G(0xL0 P8 T`00X0T$8 40 \pphF49 ;(9h; -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L8P$`T0 8@40 p 0-(0PL@  0ESX(8p(8(8L(80%vE00_0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP p9 p-0L P3 LP@`( 0P?> S0P0  F(0L0 T`8 0P X0T$8 40 \pph?( P 0 3Ld9p9 ;X9 0-(0PL@  0ES*8*8+8*80%a000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L8P 9 p-`L@P*  pE(0hL0 P8 TP0X0T$8 40 \pph9 ;9 -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@LN$8T 088T$ 1<8 0-(0PL@  0ES-8.8T.8-80%000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LeP 9 p-`L@PW  pD(0hL0 P8 TP0X0T$8 40 \pph9 ;9 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ES18 18l18080%J0030 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP 9 p-`L@P  pC(0hL0 P8 TP0X0T$8 40 \pph9 ;9 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ES 4884848480%S00m0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S&p -LP <9 p-`L@P  t7C(0lL0 P8 TP00X0T$8 40 \pph*<9 ;09 0-(0PL@  0ES68,68x68680%000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp p- 0`@LPB 0?.C""B(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4phBT0$8 4`꜊;̊;T9; -@L@0S 8T0 $408T$8#8 88T0 $4 08T$8#8 88T0 $408T$8#8 88T0 $4$0 08T$ 8 -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P  00P0P000T0$8 40P0PPP0P0PV0P6P0P 0-(0PL@  0ES:8:8:8:80%f000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L=P l9 p-`L@P/  A 0?>C2@0( L 0P80TP 0h0X T$8 40 \pphl9 ;`9 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S >8H>8>8>8 L0"S0%d00 L0"S 0 L0"Sp8T0 $48;T$ 80 -LBP 9 p-`L@P4  t@(0lL0 P8 TP00X0T$8 40 \pph9 ;9 -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S A8PA8A8A8 L0"S0%$00 L0"S 0 L0"Sp8T0 $48;T$ 80 -LP 89 p-PL@`r  ?(0L0 P8 T`0 X0h  T$840X  \\0 pphL' 0iL' 0a89 ;,9 -T`@ p,@0pPL8 T0$4 8T0$4T08 $4,0@0,0T0$8 4  00s0p  0  0S S S0pp0p"v0p00 p, 0p00000p0p0pp0p00 p0pT0$84 0p|0p0p6p0p 0-(0PL@  0EShE8E8E8\E80%2000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP t9 p-PL`@y  >(0L0 P8 T@0 X0h T$8 40 \T0 $84 0 \;\\@0:\ `0  phpT0$8 4`t9 ;h9 -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 y>T0$8 4 000 j>8 T0$48@ T0$4 0000000000000006600008d7܌;،;;9Ȍ; -|1`LQPp@(0 0GS I8 L0!S  L0"S0% 8 T0$4T0@8$` 4@d0h 0Sd0P0d@/p8d9Ȍ;7 p-L`P@=0 R$(0L0 P8 TP0 0h X0( R pph= T0$84  \pph =;8d9;9Ȍ; -0 3B5L  ,0WP ? }; -L P 00 0Q400P 0- PL004@@0 p-LLM@0`SP Q S 0R d@KL<0+8H0 0( 4KP@PKp@Pd@KL'04KHP (P @P -@L004400 p-LLMdPK@`L8004KT0(0 0+8H0 0( 4K P804[0Kp0 p-LLMdPK`@LL0L 0SD0# (0 0H 4KpPD0[#SKp#0 0-LLM`@KPL 0$0 04KUK0 p-LLMd@KP`L0H0 +70( 4K@PD0  7Kp p-LLMP@`80H-@Kp.@P d@KLz0H0 +0( 4K@/ Q-L QX 800P0 0-T0 SL@P XP0  T0S0; -H0L@<;(P0 hh<@B;P8 0-H@LTP+  @T 80 P80 P \< @THP P 00<800<;$; -80L@H0S 80  H0S;T; -@L   @ !! p-@00L4004PP ;`p004PP h;`[`PP80 400,?PP80p;;a 0-80L P  080ZHP @T0H D0L H0<00J 80h80 0-P@L80 080P ^;0h SP pQ;P 80 0800h,?;80/ 80ꤍ;;: 0-L00P4 P 80 080 0@80S80 0800h08080 0- PLU@  0R0 0000\0 0 0h0 p-PL@l00\  \0`@0\X0 Pnphh0S` -L`NP0PSXp ?PX@T0  P0S x80P0s80 080P @NP0s @T@&"Ѝ; -ML@T $$0@,Ph:V84];t; 0-PL@u:000 4 0X80 H0 L0d d0\`0x HXhld@|@800800h:X]8U8W8 -0LTp3 80R00  ( ,100 !0 $1(!(!:؍;;; p- 0LP ::`1>@0S@ V:0`S@:!1|:t 9 Q \9Hph9L910 ` 9V$9;J;4];:J;K;K;x:; p-0LS`  p   P @p -L Mp F 0S (K$2*@R`  9Pp `@PPUS U0 !U U`P[, ,@P0 U 0 0f P0 @  P!0P XP, 0J`P]9 `P@PD@P@`D@U  0H99|439 ` -9 `o,;;D;|;; p-`L @PT   @PT400 ph00 R0Sx -LLMQp0@0Π; ; lK$PL ` ;00 50p400D p-0L`DP@0! ph -@0LQp` @PP @ p@ 0`S 00  0PD004 0-0 SL@DP0^0 0hD -0 S@LDG0P -H@LT 0S 00 @T -Q0LDpI P@`< 1 SPF UP, 6V-U/1TAS 1S @aU<<6Q 1!S 6Q 660U 66 6@`6@1S6@P 1\ SXE \ 6U\ L6@P06:x::x:܎;I;I;T:;I; m:I; p-0L@`,PPP  0p>; p-LMH@`T 0 PKSJ  0@ 0 @TKpf8g8 p-P@PLD`p@us0! \0P@(D D @T :r0P(  Tp<8:$Ei p-0LS@P p 2>`P <6000p0 R p;d p-L@0`0P 5000pD` L0 `L sP<0SP0 00P0L0P< RLp 5000pp;; 0-LM80080 K@qP 800808 80080">P<800808400 0 4P P 858 EP8 u54;`; p-LLMdPK`@LYKBI$ :R: # i; ;`:9 -`Lp)0S| R0000| 0 @Pa@@@@|@0|0 `h# p-`PL/@T | R0000| 0    p -@LP %00 p-P!3@L HP& `0 0 ``l l0;U 0@|     |\0ppć808 p-@LT` PP PP/ P00p -LM` P @ HQ Rʨ0  QpP -K0P 0:$@K 3sH`DP0< $ P@ -@D;,88@34; p-LMP 4@0 \ 1 `R 0S 0,0Kp,005Sꈋ888888888888888888888888888888888888888888888888888888 @KF$ 81R #0C###ĠKK K0K<1 #̠##DKK@K0K0἟H0S 0 8< 0$08Q0Q:xP 0 48 0R, ! !-R0 0c BSR48 R p-@P`x BRpR0 BRRR` `!  O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb]-in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484< 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O ',@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8d2-@@Pr?0RW` t8P8\8h8` B`p Bp` B`RE0C`R9` 88ė8З8ܗ8888` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `갘8Ԙ8Ș88` B`p Bp` B`p RpPP2-B@P00O0RW` l8H8T8`8` B`p Bp` B`RE0C`R9`888ș8ԙ8888` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `ꨚ8̚888` B`p Bp` B`p RpP2-D@P?O0RL` X848@8L8` B`p Bp` B`R:08`R/`88888̛8؛88` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `h888t8` B`p Bp` B`p RpP% $0000% $00000& $0000d0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  RꄱhhN  0O   ! -- -i?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupU'H'p''p%'8'p%'P''p%t'msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctln; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PPpn:|n:n:n:n:n:n:n:n:n:n:n:n:o:o:o:$o:,o:4o:Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_combinedswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@K--=---;-9-p6-46-42-$3-\2-- ufs_makeinodeufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnter\ .-.--. -p---h.$--L.C.:D.0.0.C. 0.:J.C.:C.<1.:9.,C.B.C.(:?.LB.A.|C.@;.8:pI.C.D:uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insertId@+dIdQdQdQdIdjuvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_rtrequestnd6_freend6_na_outputnd6_ns_outputnd6_na_inputnd6_ns_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_usrreqrip6_inputudp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs0222 2< 2 < 2< 2 < 2 < 2 < 2T:d::p:|::::::   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`@2@2B%Y2Y2B%T:.:X:.:d:.:h: : I:I: l:I:p:t: |::::::::::p ::p 0::p `::p p::@::`::P ::P ::P @::P P:: :::::::::::: ::::::$::  :tL; :tL;,:0:@4:0:<:@: D:: H:: P:: T:: X:: \:: `:d: `:h:/l:;op:t:0/h:;p x:\&: :: :: @:: `:: M:: :: :: :: :: 0:: @:: `:: :: :: :: :::::: ::0::@::P::`::p:::::::::::::: :::: ::0 ::@$::P+::`(::p,::0::4::8::<::@::D::H:: P:T: X:T:\:`:h:l: t:4:0x:4:@|:4:P:4::::::::::::::::::::::: :::: ::eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrrorAh:9Ap:9 Ax:9`A:9A:9`A:9`A:9`A:9PT:9A:9 A:9D:܃9D:9i:\9 i:9 i:܄9 $i:90$i:9 ,i:90,i:9 .i:\90.i(:\9!i8:9 !i@:9)i8:9 )i@:9-i8:9AiH:܅9 -i@:9AiP:9Ai`:9Aip:9`A:9`A:9A :9A :9?A :9::::::::::$:,:8:@:P:X:h:d:p:x:x::::::::::: :0:@:P:X:`:h:p:x:::::::::::P:::::x:::::::::::P:::h:p:x:::::::::: :X:`:h:,:8:D:P:\:h:::::::t::`:::::::::::::: ::,:::x::::::::::: :,:`:h:p:x::::::::::: :X:`:h:p:x::::::::::: ::,:8:D:::::::::::: ::,:8::(:(:0:::::::::<:X:`:h:p:x:::::::::::܀2:`2:܀2:`2:2::2:(:2@:d:2x::2::2::@````` ```dumpsys<:P:\:h:t:::::::::: : ; :@:T:x::::::$:P:|:@::::::4:T:l::::::,:d::::(:X: : : : 4: t::::8:h::::,:T:::::8:\:::: :  : $: 8: P: d: x: : : : : (: `: : : : : : @: h: : : : : : 0: T: t: : : : : 4: X: |: :::::(:L:x:::::4:P:h::::: : : (: X: :::::0:L:x:::::(:H:`:x:::::(:X:x:::::D:`:::::D:x: :::<:d::::::0:D:`::::::::@:d:|: : : :  : 0: `: l: : : : : <: `:!:!:!:!:" :$@:$X:$`:$`:$p:$:$:$:$:%:&;& ;;&:;&(;&L;&x;&;&;&;& ;& ;& <;& X;& ;&;&;&;&0;&T;':'|;';';';';';',;(T;(;(;(;);)0;)D;)\;););););*;*;*;*,;*D;*\;*t;*;*;* ;* ;* ;* 8;* `;*;*;*;*;*D;+p;,;,;,;,;,(;,H;,h;,;,;, ;, ;,  ;, $ ;-H ;.l ;/ ;/ ;/ ;0 ;0$ ;0H ;0t ;0 ;0 ;0 ;0 ;0( ;0 T ;0 | ;0 ;0 ;0 ;0 ;1 ;1 ;14 ;2d ;2 ;3 ;4 ;5 ;5 ;5 ;5( ;5L ;6p ;7 ;8 ;8 ;8 ;8 ;9;:<;:P;:t;:;:;;;; ;;8;;`;;;;;;;;;;;; ;; ;; 8;; T;; x;;;;;;;;;;;; ;;8;;T;;|;;;;;;;;;=;>$;>P;>h;>;>;?;?;?;?0;?L;?h;?;?;?;? ;? ;? ;? (;? @;?X;?x;?;?;?;?;?;@;A4;B\;C\;D;Dq;E;F;G;G;G0;G`;G;G;G;G;H(;IT;Jl;K;K;K;K;K;K;K;K$;L4;N\;P|;P;P;Q;Q;R;S$;S@;ST;Sp;S;S;S;S;S;T4;U\;Ut;U;U;U;U;U;U0;U<;U t;U ;U ;W;X;Y;Z0;ZX;Z|;Z;[;[;[;[;\;\,;\D;]`;];];];];]T;];];];](;]\;];];];]( ;]\ ;] ;] ;]!!;]"8!;]#p!;]$!;]%!;]&";]'L";](";])";]*";]+#;],P#;]0#;]1#;]2$;]3<$;]4t$;]5$;]6$;]7 %;]8T%;]9%;]:%;];%;]<,&;]@l&;]A&;]B&;]C';]D<';]Ep';]F';]G';]H(;]I,(;]J\(;]K(;]L(;]P(;]Q();]R\);]S);]T);]U);]V(*;]W\*;]X*;]Y*;]Z*;][ +;]\P+;]`+;]a+;]b+;]c,,;]d`,;]e,;]f,;]g-;]h0-;]i`-;]j-;]k-;]l-;]4.;^d.;^|.;^.;^.;^.;^/;^8/;^`/;^/;^ /;^ /;^A0;^B 0;^C<0;^E\0;^Gx0;`0;a0;a0;a0;b0;c 1;c81;d`1;d|1;e1;f1;f1;f1;f2;gD2;g\2;g2;g2;g2;g2;g3;g,3;gL3;g d3;g 3;g 3;h3;i3;i4;i$4;j<4;kX4;kt4;k4;l4;m4;n4;o5;oH5;o5;o5;o5;o$6;q\6;r6;r6;r6;r6;r(7;rT7;rx7;r7;s7;sX8;s8;s7;s7;s8;s88;sP8;s|8;s8;t8;t8;t8;t9;t(9;tT9;tl9;t9;t9;t 9;t :;t (:;t H:;t l:;t:;t:;t:;t!:;t0;;t@8;;taP;;tb;;tc;;td;;tn<;to4<;tq\<;ty<;scsibus_printlink>;>;>;>;>;:?;?;:$?;0?;D?;H?;T?;:\?;h?;:p?;t?;:\?;|?;:\?;?;::?;:?;?;:?;?;:?;?;:?;?;?;?;?;:p?;@;:@;@;(@;,@;8@;L@;,@;T@;h@;,@;p@;@;@;:@;@;:@;@;:@;@;:@;@;:@;@;:@;@;: A;A;:@;$A;:@;4A;:DA;LA;:\A;dA;:tA;|A;:A; ::::::::::::A;::sd_read_cap_16sdgetdisklabel::::::::::::::::::5Hwdwd5xd,yd=Hwdwd=xd,yd(xdlxd(ydydPHzdzdUHzdzdHzdzdHzdzdM;M;M;{dl{dlO;xO;zO;O; O;O;O;O;O;O;O;O;O;O;O;@O;O;@P; P;O;(P;4P;@3R;dV;M;M;M;l680~9o:k;lL|=>@ApD FPQSTXY] dK2|9<`4484wddonewdattachwddump   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt100ԑ5$5L5555wsemul_vt100_handle_csi@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!Xf;`f;hf;pf;xf;f;f;f;f;f;f;f;f;f;e;e;f;f;f;f;f;f;f;f;f;f;g;g;g; g;g;g;g;g;888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?usbioctlp565L5usbd_set_config_indexusbd_devinfok;k;k;k;k;k;k;k;l;l;l;(l;4l;@l;Hl;Xl;`l;ll;tl;l;X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@  @  @ Q@  @  @ @ P@ Q@ u@d@d@@@@|@@@ @ @@@]@@@@>@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachDW6tR6N6N6uhidev_set_report_asynctm68/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.ehLiMjNkOlPmQnRoSpTqUrVsWtuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    666P6h66܇6h66065dd5(I*LCDEOMPJQNRK,6ԛ6666P6h6h666(  v      W 1 Q `  ̡6@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   l6  L+ L 6L2 D   O  {6o  A umass_scsi_probeF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 |h6`66H6axe_setmulti B  w *w +w W UP  <1b0 0{&"79n= wF@W wn a- 6666|6\66\6@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0x7 7L7 62V{%1" `"'`~%ZP `|7t 7`7<70w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_setmulti>7l>78=717hF F hF fF `S7P7P7A7k7(l7j7^7url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < 8 <8l7n`̋;@`;n`;n` ;;A8?8l7!8;L;`;D8@C8l7;;;H8TG8l7urlphy_statusurlphy_serviceurlphy_attachsdmmc_inquirytargetlunsizeintrindexcontrollersocketfunctionirqchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterbio%s:%d: %s %s(%s:%d:%d): %s %s(%s:%d:%d): using BIOS timings using PIO mode %d, DMA mode %d, Ultra-DMA mode %ddrive at %s channel %d drive %datapi type: %s c_bcount: %d c_skip: %d missing untimeout%s channel %d: reset failed for drive 0 drive 1%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d wdccmdwdcsplwdc%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete : where did the card go? : setup failed ne%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : pxa2x0, 32 byte fifo (SIR): st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmcomohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: reset timeout %s: SMM does not respond, will reset , legacy support version %d.%d%s %s: unsupported OHCI revision ohciinvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d unknown optional metadata type%s: unable to start background operation %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: sr_scsi_cmd got active wu%s: sr_wu_put got active wuvolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwdfailed to allocate boot volume%s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraid%s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue sr_raid0_rw%s: %s: too many ccbs queued RAID 0 requires two or more chunksRAID 0%s: sr_raid1_recreate_wucould not requeue io%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld %s: is offline, can't read %s: sr_raid1_rwinvalid volume stateRAID 1 requires two or more chunksRAID 1%.2x %s: %s: invalid volume state transition %d -> %dio error: disk %x sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer %s: %s: %s: invalid chunk state transition %d -> %dRAID 4RAID 5%s: sr_crypto_rw2%s: sr_crypto_finish_iosr_crypto_wu_get: out of wus%s: i/o error on block %lld sr_crypto_intr: no wucannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskKEYDISKunable to allocate work unitsunable to allocate CCBsincorrect key or passphraseCRYPTO requires exactly one chunkCRYPTOold_state = %d, %d = %d, invalid new_statesr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s RAID 6sr_concat_rwCONCAT requires two or more chunksCONCATRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocregistersuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchwdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d , address %s RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d lockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %dNo KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITSSTEPSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlestopzombiedeadonprocplimitplcpu_switchto returnedidle%dfork idlestunrsensor_task_unregister: unexpected state %dpausesuspendsigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld dummynanosleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s Allocator%-10s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot %3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_AUTH_AHM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbufferbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASEDNOTMAPPED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNNPFSNTFSUDFsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%ld) detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegressif_attach_common: malloctoo many interfacesifaddritempl%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss passive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturboaeamaratauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) revarparptfreearpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%drip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptocryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_readdir: lost in spaceufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestfituaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in inituvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_initsize 0 uvm_pagereallocpagersegpgdaemonpagedaemon: deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapmount: no device swapmount: no device 2 /dev/%s%d%cblkdev0x%xswapctl: miniroot copy failedswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_ifawithscope: output interface is not specified in6_savemkludge: no kludge spaceCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctl%s: didn't unlink in6ifaddr from list in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botch address 0x%08lx not a valid page address %p is invalid branch_taken: botchFaulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM OMAP3[45]30ARM OMAP3530ARM OMAP3630/DM3730unknownCPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thin%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %ldintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabledmanufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %x for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramsST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) %s: couldn't allocate copy buffer wsmoused_sleepwswaitwswait2wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored wsemul_vt100_handle_dcs: bad type %d[>24;20;0cP2$u/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbpalockusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidevwiuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axe%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d urlwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not allocate beacon %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphymmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctskSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d wireless network adapter%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus hkd'(3  99%WEV|`  08`JP<  IPuD_` /mnt35  JP`@@<@T 08`IP<  IPuD_`[~ [~IP`@@<@TU IP` bIPѭqhQA IPJP %JP %hziAIP9{`IP9{`IP9{`a2YAIP6 IPsIPsb$=B\IPkP(IP`9JP$px n MIP &IPy}4IPy}4cY IP߰h5IP9IP9iT"HIP,-:IPIP,$!e=_icIP|%IPIP,$! TwIPƌIPpoZIPpoZ`hpxKcҠ`/a'QI:~k9lywYJl\g@/W1;?dOwɗL LҐr*#ȭun_toB."FM"xK[T}ږg9Ԩ) 3w#a^6y oTN$iszI 3R\g-;sh^0_֌}WH{iC*]`n˟Xi^M:`k#٥1ʸ0àwsr5iYbNH`1x+'8ncɮhX l{+sbKXc,e6)-x⎿nkvٕlU][/tNGSj&7tMݥ}eL:|vNjmqy` .@.. . ..ztsscalen export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up  . .. bin dev@ etc mntmnt2EŢsbinEB tmp usrCvarinstbin.profileL install.mdupgrade install  install.sub MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(d4"4 (zz|||xMxMMM88-444OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  00PH 2 h0-L` 0 R   1S0B@Ct1P @D0t0$0<0< 0 R-L @ R$  0S00h2 -x@x @0LS ``00T0H 0S 800S$0hz$42  p-L (0P `P dpP L=@POU8  (4PP ݏHH$\  -PLU`p 0S /էt0PPQ @Q P P0 iꌀd\H Pp-L@P`D ph0,0d -Ll  -"L<MȂ0r"`8K01^P@H =lP  P0Sl yl`Ÿ X08@ 6Q P4  0` $8 000P  10S000 B 1 0S0 S?l10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0,I$0S 0S  0 I$0S 0Sl 1k(K, (d=$8\T Hԥ H -LM K `p@Pqx1 po 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@ 04kk 0 fk@P ěp -L0 $, -L0 $d 0-LMK PՎp@1 n 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@K 0,k0 j@8 ěp -0L00(d -0L00(, -L0̂ -L P00 -Lx0 -Lp 00d,0 R0 ,d -L j -L j -L j -L j 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  xPP  / 0S mP00OU0@0V 0000 00 0U0 0 0 0S0|0 0  `je0 f` R*Rb50 00d$̦ 0-LMPKnP \Jm0: S D4 K@MP0: S S000K0m @ -DL8P40  QPD40S0o DP4000 T0$ |4QP 0d `4H$Q0000S|TD $ 4 0S 0@3Pc0S 0{3P 0t3Pl\hS $0   $0 <0; S 0 @c$ #"l0$c`V Oi \MM "0spw R 0Sj*0  Q -4 UP X "0  dpl\ 0 0U(0 0 0 0  P0 0 0 0000000 0 00 00` 0 B000 0081А(q@00Cs01 1R0R#0R 00 l R R *p bQ 30 00$00S:,8 $LKVR$K.A|?̧ -LhM -L=@`:@ -LMpa0@ 0P$ 0$"OTpLq  G@Pp: 0,0 00 K3K|KP7 k ٮP$p0 K03K,p gKp   v0P@PX`$0 p S  0S@P$0S 0S(Kdm -8QL0!P0 @c$ #"0Sp8q 0 30`p @0( zP0 `V`@ Pl 0S0C0T8gP 0  Z <5 {j0,̂( -LB 0hܨH -MLM\"0`p( ,4 4"p, R0@!S!괞hhhhhhhhhhhhhhhhhhhhhhhhh|hhh4!Ѕpt1 aARB^KPEPE@iPH ,4004 4 J>K 0C8t 4 D , sP2 0-S) fРBKAL L P0 z0$RpB.K0 B Bxpppp~0Hf0<$i̺ $ih<T\(@ H -LM@pP4 唞PP 0S nS6 =7`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPt00,K ,0@S00?p @ `f0 p00X0"S 0(e$P 0 0e8g8 -LM`PP( @(K,pK 0 g(0@S *$Ki -0L |HP -LMP@`0p2R ׬U@ 0S T  0((ꌪH p-LP@M`P P@hp lP@v@ -2L`M2\Ÿ\[\ @ll2` `Vp0@0S@0 @, 0C@$0(@,0 @\@`@0e0PZ ,0Z ,| (d  80&`p<(@dlP>_@TP0  R0 0, 0C@$0(@/,0 TTWԬ -tMLK 0@CP#81RL0S `f`0R30 @0@cn.p(j.0E`e.` @b@cP @P   0@Q  0@$0(@0 ,0 \0`0D0PZ ?,Z ;,| 4SWج -PLP@@4P 4`P @{P |vPlqpP \lPDgP < 02$-Ԭ8< -L 02㪴dH -LM@`CV$ P$pKVhz P 0S -SD01!@!=P0@0@V@8g p-LMPP` 0S@^$xY0@V0@@ *P ( 0 @`*J$x Sc 0-\ P0LS@ 0S  0S 0S00؂ p-`PL& 0S# nS$ 0 @@,P'0PP@`00@,Pp4_0oS0 ` bԂ 0-t0L0PS Q @Q  P,0 r300 R00Ԃ -0PLMP` IPp$ ` @$K/ 8`p`3ៗ$@0&T00S#8g -LM` KؒpP 0P?P> U @6PP@ -L0Mp| 0, y 0DSH  `T 7 R P R   0S`7V X00@T0TWS\P\1L' H700W@ T=PPL7Q`' V.\! 6`V&#\!@ 6`V&\! l6`Vd&\ \! `<6V88T&0S`!`! R 6`V$0&0Sd!d! R 5`V0%0Sh!h! R 5`V|0%Җ0Sl!l! R D5`V<d0h%–0Sp!p! R 5`V$0,%岖0St!t!R 4`V0$墖0Sx1x1S TD`V$咖0S `V1$l凖!僖!|t!pd{h4Vdv, 0R(K0SJ 3`V($e\!@IP% `V Y)0D#3` `3V\0K04SS l0F@KLKL0 0.0K<P pPP `Po0Si!R] 2`V,ß(0 #P0S!Q t2`Vl0"1 D2`V<<"1 2`V"1 1`Vx"1n `1VX"ePKLKU`1PPVxA@+0"PϕRXP!ʕ`W^!1R!]P!1 0`V!孕1 0`Vl!墕1# `0VL!嗕86P0S D1 `@0V<!4僕2@}h؂@ 84@<DT\dpxԮ̮H LW_(8  $,}08 T@HPXl` -LMMß |KpG`pG , P@兖P #T@U `P^ Qe@$PP K@A@A <0 f: 3q A R :S@:@S w  Ÿ, 0R(Kip@i PLK@Dtb@DE0h"L'@Β܏0S 8 0Sя0So ðP?`Kh`PYMKZ PK  PP1 R IK A0蕔   KA A ㇔P<:#41 R0SQP@M+h f "}P ` ~tOK`Pj e phd[TH_hW8 ̯HětܯHPx -AMLM6 `Pp, &zpJ A0@6S6`<-P^p%~zp5 `bA0V84 Vm VZ @ D`P PDZP $UPP PP (0YP@4 sPnpi4 RDP`t4 \HPW4pR84 RM pIPDp?3 ;963 R `84@ 0@@Z00S aaP; B`3 RZBKHHኔP (\PI P@0 0  P $P 0DP|0 0 04 2 0@FPP B.K B Bx尕P@4Pp_ bBK@@`Pa ]CPP7 @}P vP qP 84 yZ`P⨑n.P`hftYP@T@h@XPx D]CPP84CPP84 JZGZCPP0D{꜍0S ]84 5Z P@ PUN 0|P 0tpq]hԬ Х Ԃ(\\F(Hh 4Px -L. 0 IpH -GMLp1M ha d!@0P$4 @!xp oP: !xp 0bSQ`A~K pG0pG4 kP- $$004 4 =K 0C0C fPP -P P| 0$\YA.KP0 B BD ,\h,جԲ (ԱH -LM@pP4 寑PP 0S nS6 =R`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPꏌ00,K ,0@S00?p @ `Y0 p00s0"S 0(Y$P 0 0Y8g8 -LM`PP( @(K,pK 0 g(0@S -$K5\ -@0L R  (0( & 0 H4 -Lp00p3 P@@0PP``0 wp kP` sPP aP`  wpt0 RU ` Pr{ݬ 808^ ,.h{W|HXP\ -Lwl@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* 9X 5X댵 -LMp@`ᆋ $K{P0S 0S $0 UR#U 0X谵 -0L W|H -MLMp0,0 /vpI B0@3S3$xH$tP8\> >~> > .vp. 0b0CS/[>KQ0C 0C ,p g>K0C 0C6 [P<ϟ@T |6: S(  S =zlK`F `F@ s"pW@ԭP  ZP @TDP _Wx= =%=^T= p=l= d= R$=.L=H=I=t.0=,@<P.<> =7<,2<.<<)< << < P< << <  < t V5  U,@ P0@X S P {P 0T Q  ]|^ \ P Q U e/_P 00BR SP 00BR SQRG  00B SQA `RCpRAqa@B 9 R.R600U0pup3S Q &R&  5S 5S]K 7p t8@T2 RS DT !6q0#0P` T@ 0@ &TWhX( Tl<$(ĺ,04l8\<@0PDHp77P`88T/@@edAܸXx̻_W<X`ht||h, L`\gfffXdl@ԷAĸ$ĹLtdȼ|(Ժ SV&0S6 S F %&T)`sS 6!&a 0 . `& @P 0 2" p0! 3 ^ 1 6S12S \ 2^0B0  & R 0@, & l&  6 `@P p! 0W3@@T@!^1: Q0 &R0:S P3  3Q2S*& R,C 6S<3B@6 L!!X  u6ttR 00 T@)5S%%R005  P0Lc5 0S 05 Q5 5 % & 6Q,Q8@QLT%5Qh5S%TDPߊ݊Q؊ m$@T , 0RP(K xR tR K@ @q5 K@5 /apP9 % R%6"&  P660X*l0 ^PPS00SB %`5R> P;X9:@X2 &0ST#3*&`p  6PX&  \ 6S X*cQP50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0` (00ST 08 4  (088 [NKR@Dd@D%6|(V 40S66 { &`p 6P &xGX 8Q  ( 520#$ 0 0 P0C"$ "40 && t9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T  &U0& U 0A Ah 6qU s[NK@D@D68+P "T00 5 % \6 S(+u 5S,+m 5S0+e %?RR5 c02?  5 % G Q(<Ps 5P n @ S%X<T E I @ .6S }PPM&wP<Q &Rp5F0%iP%S<R 66  Qk T  Uy,%RP8OP D0JP PFP\CPd0?PpP@$0 R 00(@< Gr$BrH ,@ P-L lOiO -LM( :CP( (( Q5 (K劇`P0 0S- =1@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0SP0$ 0 Q (Q K( P($00P($00P($0 0P($00~Pt Q($0$0TP@ D($0(0b{\H $,4 0-LM 0 P`X0Q @0D0  Q@ 8h<Hhp$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"010 00 K0" 10 0`t - L1PeQot  - L1PWQnt  -LM K00"1PEQt -L h5$0$/ p-L MP@`0KP 0S00Kp Q p-L MP@`0KP 0S00Kp P -0LS@ h?P 0 << 0 -@Lm:80 0 -@Laς0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P 2@P  0SK0 Q0p@$o;    p-L0 `RP @ R P0 00 0 0 0 p01Q @ Q P0 000 00 p0Q @ Q P0$ 00$0 0$0 pp0Q @ Q P0 000 00 pp`Կx 0-,PL0@S g000@0lp -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 HdeF p-x`L@PTd0 \弄pHP@崄8屄p$嫄0plpě  -LMxR p, `0 P 0LS 0 刄P@iT   |@Q t@T] @a R_ ;         0 Qd ~@ X z #L v D %r?QPP  hU c _U YU SU  MU @  BU   @ 9U p 3U  \ -U L    @ $U 0   ( UN0  N U   U_@  U@ U U  |Ul 0`@  < S S 89U      U  U U0S m\0 `p \$ ^ 0 R AdPd␐K 0d'0 `K0p0' W ~~ pG\W K~K~, 0R(Kr0S k^0d ` R@ xY0S  `R^  H. G9,C ?@083U5  -@4)6% 8! U7 h@4 < S2t 9U3     @U/  /, 1 3 *0S3@T P`K0 0d$ @TP0xtld0/X  R2R4@hU   L@]U ` 579 ;.@? ;~ [ zU: @:pt<dp >Xl F LhU=  =8b B ,^U<   ;V@U  S?  SuJr dX @ R @> ;  48 05  1st@w'+\$"0! 04t  4ӁPIρPEˁPAǁP=ÁP9Zoh0TE=<Ldu9D 04uUL]M-|TiHpMTd=<\L,}yxTh$\dED%Pe8 1\DttX -0L G|Hx -#L`M#0㘣p , 0x0 0S`pAmPUH#gp a0@Slt@8`0`K1`x ` Pxt K{,P4Kx t,PXq|B0Px tK`0S0 t 7` l h 0SD PKx@K 00 Q/ PP>P `000C S61|K >|0`SpP 3 } 0l0 00 Ql0S$h0S x,P(, 0R((K` t c` P  0l0 xMPnKjxpch`^KXH0 VKht@ht@(gt  -0L 08|H  -NMLMpp0S( `@pH P2P"L2Q0T INK@D@DP4: S3@PG B^KPEPE0!@x PINK2@D2`1@D2=*NP0S> 1 R ;PO|1P lᗀ( 0RJ$KIKAAⷎP01 R4: Sz00|uz?00 lKAAᐎP%4R%4Rh0 Rh jz0S@I0?h|URltxt -LpMP@"$fp1 F0@-SLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx|4!41,1Q`$!  1Q\ ` \# \ 10pK P.0: S 0 0 0 0   QP @P PQ (I&|tx -LP(@`)*p0%B@D 0T Tdt t0l 0@8P) 0 ,0 0 0p=>P?> *Q-L QP!00(L\ g\hPQèg0PSw84'<XPfP X@ P PfPPXPPP Qx fXdf\fTfsHfPPP T {$`0 p-L M`0P0 @1P  0 R#Kp 00B0 Sa0BSW0B? K Q02\ 0A@ $0KLA0BS70Bh M-LM@0T`pP T0P  t 0@T00 0 }@$K 0-LLP 0@S0@000SX - L@0PX -BML\< M @$ BK L, :L H D L 0'0LD$ƿPG LP00LpP :0P x 00`2P<Vk ;P`KpP Pc p;@TdKBKJ0PJ _044 PSTH440LD$~PHʟ@, 0PR(KP=V4 % 0S!T 0S `T@P44 4$  \P44 4$   @ e@$T @$ 44HX0q e@40@4 j0gHC10e eP*VY 0SV BKJHtJ 0R0X0SpG @0P 044 S H  Ye44\0`P0B.K B BP 9V`rP mPH4 UOH$ OO4$0BSH(̑ (e@H$0@ 8lLP H\P  0D e@@ (9PBKJ0J }044 S(  0d@@ -PBKJ0J _044 SH, 0 T d@40@4 ;;SH$( (PBKJ 0J:044 SH$8PBKJ0J $044 SH0}PBKJ 0J044 SH$4g,PBK@J0QJ 04SHO<OPJ PE P@ P; P6 P1 p~P, `yP' aB0S0SH8X:XH`0B8̑V BK@J0pQJ 04S   !d@$ @$ W @0`Q 04S  d d@R@ VH 0` 4DpP P 4@T000C S 4$ 0 a4 04S   c 4$ H 0 H0ࠀXX XWM n@0 @pP`8 T4 \0 .0@pt`8 y @@yA@HX0`4t  B9P0  kH4R O c@$ @$ ] |c@@ VWT  @0 P`p<$ F T 0 0@p"`< y @@|yA@H4t 0'4$Rle Bc@@ jH4R O 4c@@ \H0hC1 0S &c@40@4  c@$ @$ h\`xWd4<@ԷPdt,LPp -LMt -1L M @R_1 R 1 RI a /"P|Vxx a0(K`@ A0BCGpD@EPF`H,KP`@ Pp`t&`1`V (0aPPP,@@PD('P,'P (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x `VG&,q(o0St$Kl0ST`h !PTiAP!P@bA8_ArdAedAsd 0 p-0008L`@P0S pd !P PUDD !Pp(p#AWEVgdedA p-L`@PkP e/P  V  phJp =0 -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SV 0'Pj08#HP P0@@4Pa 4B0Q0, @Pi 0S# ,b 0S% ,![10!R ,S1 RV, 00CS0U, 0 0(K `1,!X< 0S ,82 0 00C3 0 01 0 0 0 00C  0P ("8 Ƞ @,HP``pP00@p@P,0`a 0p, (Ko`, (Ko+``WxH - LM,0 z3  Rp3 !hd 0 T 0 BCD@EPF`Gp@ A0$ P@ P`p 0 tX02 R00CS00  0( , 0 8 4 G<PP@ 0 Tz7`t0pp<sdn tD9>@hLX\rdA -Lp`%YpA A0@6S6PNNNPtPNNNNNNNNNNNPNNNNNNNNNNNNNNNNP`PDP$PNPNNNNNPNONNNONOlO|$YppTp4 R0@a0TH4 R Q 04 R 4R d 0pP00CS0QXQxQQ RC0S^00#000}#000x3P@&P 0STl#00@ӑ\3@dT#000_<3* [ 3#(3SB0S*00L"000G2 2  >B0S007|"0002"000-HB0S00&{2~Tc @0TY?@TQ1 RE G\@0DSAe/PK`PG >0@PD0@0- o18!0*0DS* e/P,@P @@ 0bڍ0 0 ~@Th l< \<` (8\HH820P#! 0Q "-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  Iq ` -LM@ pR 0P`PBT 0@-q i'q -LM, (0 @q 0p-S 0 q`P 0pq,K 0 XXX p8S P 0< 8PS$K D -p@LpP20` ````aPU 9p嘐Y@  ` 0 @@ < H0 D@ 00C C  d\ (PT$0@X0 T@ 0H@S X K HKm XpKX0pW  W0 00 l@\P0 P@`PU`H K p`P弉pl0\@p`p 0p@ Y0 ,  h d 0 K  00 ,0 h0K0K` X K p " @P`p 0pK9PW``@`hKPH  R 2 R l@\p0P`0 p@@Ws L2@T0XK4f! LQ P K  P K 4 q1 1u* 1P%P R8 K A4 80S##`@Bl\Lpࠀ@@@!0NSnS 9Yᘐp@  ` 0 @P@ < H0 D@ P L 8 4 0DpS:< XD0 SruX 0XKd fkf @@ fA@@04HDt -LzM0 ,0 {'00'72 A P9`p@ ^ @00 0@  0@ Z 1R  000OO[P``4;D1 A 0@ 2 B   ! @00@@Te/ Kg( K2ACt6 9P 1 UAT^AvK 00@0 @H 0K0@0 @ K!Rژ14p1  `1   c 1 Z ! `  0* P@0 0"  ^y/K  R0! 1 1Z`yKd 0   @A  K9@ @00@0 Z^^1A0@1 A hYJ R Q1SD ^ ABT;^9Py/K  R0! 1 2(@K2 @἟@a1 A SW%; U U (K0L1 0/SL) ! P ! Ke/B, 0R(KBQ 1K $ .P!*1K $ %0B 0L K P d=,Zm 0@Sm ^`r!/ 1 P@`p0W`RO {KQ  !  K @ P   R0S    R@PW 0SP1!R ~V{KP`p  TNU0M0M d @GU`p!1`S {oKQ0ST+0AT h= - 2L(M 4 R 08 R (KP6 00C BC1  Pɯ* /0 , `p 0h!4d@P `p0a`vp v 40(@PU 0  !  f 00 ,0 w 0 w 0T @ , 0@0ᖄ## @84 0@D^d @@0 dA@@tH -L(M280 4 400 , 8` 9ᘀ@\\@P`pP@p@ P04xx! @P0@K0p0pp* w1 P8 84 0P`0 10Z  0 R00Ա$/ ,0X%! 8P4O p徉q 0x h0~h L0w(K0@W0 K $4壱Y <H\  -QL M, 3 aIZ00,0(Z` (Ko},  20P` p0@ (Kok,0(, $ 0 Tb, (Ko6 88bP,0 (KoH4    -$ML4 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00(Kf A0 SP40 @P 0P /0U T04 P ༙9@㘀p@ 0`Q 0 , 00K 0S@P`V00 ,@ :,4@0 O09 T 0 TSq 00Sy h0zSQL# 00l UD8 H\   -QLM`N aP@U00? (Ur \9@ @0@00 ,@K$P K(` Kh\5PPaPPP H<Kh< 44DP(0 KhH4   -LMPpk U a@Q00ϓ4 VQT4 "<  0S 9@ @0@084\20    8408#8^8<0 @ 0 @ 0  P `  & R0S  0P`  R0Stp p廯(KR. D2Dx<4 8 8Q`P弙ᘀ4TPO24qP-80P`0(0 @ Q Pd&  VUR VVS U<04P4P 4P4$P @00 0000*PK0@ @00@000\00S a0*PK*0K 0)0KKPP h0t{\ X@/rUUa @HD t   -L M<G 0PP@@P!0 `p0 `p0 , 0 rT 7<@ 0@,@Q0 PG 0PP@@PDL1` X0K0@TP !p0 `ppP`+ 7<@  0@ 00KQ V$ 0KP,0``|dTP00KP0(K,0s\\0 (Koaq880 (KoXU   $ H -LnM0e/ K,0 t6t_0hFh!dzP2 X P: Lf@P PD p@PT`U _ 5_P` 50P@!`pV5 R`00CS`0X0  X0Ude_00@@V UP`8#8@00, P  3,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0p px 84@P0 $$$`p `p0py pl 484C 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    11({ |1yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0Po K !_0B 0S" 0H @P2 0<S0Sk* P0x.Ke/)PO 0< 8xhH (hp@ -L*MgKJ0J e/ ,0 0: P P P ; KAA  J PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ Kc e/K_ X:K@0@: J :   ᛠP  @P | PuQUQ 0ApSȪxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx\x0xxxxxxxxxx,xxxxxx(xxxxxxxxxxܭ̭x\xxhX8x |Dxܫx0x# F0`p: R@P 0STHK@ @H Fp 4/YPP  0aX  " Ke/PA 8P< NKKAe/ 37 RR @W@    P ǟ, 0R(KT[ 47 Re , IP7ǟ e/ZNNK@D e/SK e/Oe/KK x l VUR l屡@Pl  0Cط `@0p`p @TP0,,@ P0 0  0nU @@ 0 c5 R  [ WWU $0N QK0 $TE PB z> 7: 7 3ğ$00s03S0Z' Ke/%P NNK@De/ Ke/ e/K ; 8 5dcV04 R L4 R 2 44U ( =P3 @|#00@@T  )P~ Ke/z51V(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@Ue/ KQ    3 R `00CS`0QX0  X0q0 |:K{*KX ME`2 RT2 Rf "&P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYAU`A 000800C0VZSZJX E PPE 0SB 7 1x;  @P e/K ,0Z((kD%L e/#@PxU 5u[D@/!h6jX$|=h0HxrdA nhl4@hXP3 -X0L R H0P808 0,_BZBXt -Q@PL0. P0 R 0 0 Q@P`0 p8W  0 QdTd `B0@ 0PV0@0Q@`p`Xh -1LM RKxa0S l!00CSP\QT1  L1\*\&81 H@ T\q 0B Q_ 00@TP 04 Q00 AL\ 000SAQ0 0 X0@X$ KK @ QP@4A`Ȉ Xhpm@ -?MLML$LD0\,0 P`040S- S! Q4 0 Q Q R30 QC00, 0 R(KQڐTA0p0\?KK(@D@DV ?{KL(pGLCpG(0K8 P0(K  0P?KK(@D@D?+:gPŸ?+3gP㨢00?K@ 3N@PdŸX@'  rPw ?K#N @ PTA y42 Q P>?VU@@Tʼ!000PQ0 SX Q0SE Q0SA Q0S= TU@Hz?<1 4s?$n? 0 Q 0O Q !P@`@@Q0S Q0S Q0ES0X@0yQT 0P {?@3?00`hXT̈p\L -t0 l0RL T@ 0{  Rs!PJQ F?XTh p-LMP K`@P1*0P/T  g$d$@    0"UPKpT Q$   I$F$@@ A$(     p\   -L$MePp x5tp5 llu d%d5PdU  %P4p 5Q ~0STP } P T_!Pd0: S   S  S00  0 p 0Z0X4X$T4L4DqP0S0C00Z0 P6llTlU #)PlP0#g>Um t#P00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H KMP00Z00V;;S\ @1`V 8p ?a1!``0Q 0 vO0 =O0 =LO0 =X0 X=t 00 KO\ 0x =hȈlX t`4Xm @<d -LM T0St0Sfc0S3 RC1P$K @T0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@᤭P[2@0} +0 0崢r00d2 Rl2 Rd `2 RxL00CS0~0  0(24 a吢0Sy BPs0: So<08@@k1U@f1!11 R^ XAP[PXCPT E>P Y>M V>hlȈpX ̈\<܈td@p4< -ML MdNK0 @Dx $0 SP LPHT0S $ 0R K&N$"< 5PN#<3 R 3 Rs@ᝬP ;@ᓬP 厬P 30S S S l3l ;`;\#00CSL;NK@D<;8;4;0;(<PlcPg &,[RW %<[STS0B&SPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxH=nP'10;$|;y;w;;PP &<[Sh; P`;\;=P P$S;! 1@0@0I;x1  (1 \?;X=;e0L8;NK@D83;NK@DbLP); q0S 00ᣜP000 @0@0:hTtX4X\lȈH 4\ <Lh`<Dd -qL R Q3!  0 XRO PAx` wP`V 0SDQ@%@1S!#100P!0!  0 P " PZ `Z `FVڌ f lQ:`0 R PH:8 `00 R  <:ꐈ̈ Ȉ -LM衟 0, ؑ0`PpH@ 00 T0$P1= 0S, Ut1 RI d :PP @v T 00p34P9 P6U0 R5 9P0@00  ,0K8P P@0S 000(K 08PH989(9̈Ȉ8` -bML,Mⴡ0,0 P70DP10 P,x1 R.b}K(pG$pGTP0  0BS'{)P +P2 DPK`<0KP0( =&, 0R*(K$ P Pb]K(PE R,PE0 <P`D0K(P'P  lḧ -ML M0,0 vP=0DP70 P2/P/5 R /P(㕓b}K*K(pGH $pGP0  0BS (P ,DPK`<0K1P 0( EI.?&, 0R(Kb]K(PE R,PE0 <P`D0K6+PXD0SL4 RL(PU'P.DPK`<0K\K(PEPEP0Sx 3 R}( 0SʢS0S3 R LK(@D@DP0Sj h3 R ( 0S0 0S<0S S(3 :KHP P vP00S SJ 0CSDPK`<0KX0S B0S 2 Rt"00CS00  0000S3 0S0 42P+ wJ "s8%1 R 0 0Sc)( 0S^( 0SG@PDb]K(PE,PE0 <(0S dA0S X1 R=@!00CS0>0  000X`D0K',J 0 &8v|00 a-zDPK`<0K-|j\0 9H0 9 9w 9ḧLD, ܈<H -L%M$MŽK5HU@(KHd%,@  P-KL' 0Z/S /0 0 0*KL5%K(II ]KLPnKHD0: S m7, 0R (K.0[/S _7I0$78.PP-PT4 RmK(`F(`FxP% 4 (K )PPt0S3 R5 :KH5@/Q  ☸KHP  7RP  sw,, jPPt0Sx H3 Rx a=( Q0 <S@j/P%P,:KL%!$PB0S2 R  5P0Su 2 R a=( Q0 <S`R0SBTT2  Q 7 P 4<S S8 0CSWP[0Sc A0S_ 1 RK!00CS0Y0  000M^-PF"d1 Ra=( Q@ډX1@1  tp(KP$@P'( K K(A,A/a=( Qڐ@iZ0 o86,H <6UK(A,AO s8hTX <\LD, 4<܈ -L Ml 0,0 p@WP P0,P2,$00Q.㒐`;Pl(P3 , Q# .P\&P V 04  A3 R(K,P:+WX<30 SS S b$P,K+R P, G0"5+2 R6R0S S=ڜ2 >"000 P60S \R0S P2 RO4"00CS0r0  000,KI`p-P,xPU~M,PM11 0,4 K@,K`#0S XQ0SV^4KQ..PWb=0Q!&PO`20 U7,K+@0 R 00CS00  000P`P,K! D7@0 (7 <7̈LDh܈< -bML$Mx0x@ R  g.P P L0 DPb K@$@ 0RK gDḧ -bML$M 0,0 @P T T 04, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h `剚b}K(pGT1 $pG q-PX q,PDPK`<0KP AP&P0S 0(@P/*wP0S @0S ,-P+P8 D0 00((gḧD܈t <40 0? !t -T2LMR`u<0S1,4P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01 1 U Pa`n,` pPoP` , `, 00 0Q ,P 0  `P0SPQ~8 @0 0@,0 H ẗ8 -PQL`tt 0hpcPP@@ v0Pd0U`00<Pt 00b0[ -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00|t8 -QL`ڀp P P@@ 0Pd0U`0 0cPʥP eQ  -a=LpM00UpE``a 0 cR#?S XP/0@TP0U0 P-0 0 20(KR 0 P0TKPa=p Q 00C h2TD< 0< 2D 0 2 t |  -LM a a= 0T ^,  r  K QPKX0S`pP0 PU ?`p ZX@P 00Kڤ\,K  PU ? U?l1 R \1 P0"2P ,\ 0S4  (KTD!0O20SKP$ a=x Q 00C 010S 0Dl 0d '2<0 RD$ 0$ 2tP0! l!!X! -LM Qa  0p" ,0   KP|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00KR PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  A1V wC0T r1<0 }V,0 R h! P Q-LP`.Āp 0cP 0OT @  ?PU`V S0U 0cP,0PPt 0-D0DP LP0,@  `0 0ht - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 0b00KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l0PPPH/PP 0@xȈt!! -@2L @RPv("0S "00000aPv0 0bȟ` 0 F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P/X@P`P0 00 0 0 0S @0  NP0 pg/ <D 00 00T8tT"Ȉ " -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \</P4?;/Ȉ!"" 0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|.0 h?;.0 P<.0P0!̈tP#"# 0-`@L0S 0HP0S 04P000.ꀆ=# -Lp`PP0S 00SE  #0X @TNP0 @0S X گjP00 0$ 0  000 b#P(@0PKP 00T $00Pꀆ 0-`@L0S 0HP0S 04(P000.ꈆ=# -Lp`<PP0S 00SE !#0X @TўP0 @0S X ]P00 0$ 0 =000l "P(@PP 00T $00Pꈆ= 0-`@L0S 0HP0S 0P000-ꐆ $ -\qL0`SF D1#41C0b0cQU R$0S A0S U3 bP U@ $`@ ݮ00000ZR @@U 0$`00 L Z@P$@(@$PꐆWtz 0-`@L0S 0HP0S 04+P000 -ꔆ=@$ -hqL0`SI P1"#200b100cQU R$0S A0S U3 =P U@ $`@ Z00C000ZR @@U 0$`00 L zZ@P$@(@Pꔆ/>3WtzW|Q  @4S4S  P00q& -$L0 03 Py0F#0  0( PnP0N 0 Pe0V#0  0 PZ P^0 PQ n]PDXP? Po000c@`P300S S, S* S] 6b-  0@pa- p0P`@0S@b-P ``6 0q P_ T0 t(h[ (0 P(h0hqD&q& (,$%% -LTMs0 0 PP2b@ @0R2  0@`l@KS( ((A 0z Pt 0s P \2 TK( 0R~K a=0A 0 P 1 3(1 0L P1  0D P1 0< P1 04 P|1 0, P`1$ 0$ P1* 0 Pa=0 0 P`; 0 PL^P YP00S S S S  HPT0 l'|`Zx(0 H'qh0q&t& (,$&&0 [hY0 h mQ-L P ' mQ-L P ' -2L pRPi nPbb0@ J 2 D 넢  > p2 8 \2 .2 H2a-0C 6 am` &! 2 > @ F 40@@1 N @ V 40@@1 ft1 ^P@n|P0@0Pn000c@07P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh (,H$0 KQ-L "P (' -PL`LPb-0 @ w\1 qH1 k4q e 1 _ 1 $Y0 *S0  0M0a-0C A aM@ ;<P0@0DP0: S 000 <P6 0h$( -!L@P6 0h$( -L@1Pd0ddP 60S 608 $(0 R"P tܢ8( -L@ 'Pd0d9P 60S 608 $(0 R"P tܢ8( -L@Pd0dP y60S u608 p$(0 Rp"P tܢ8( -LpMp@W0 P`0S 0 R KP0Sp00h0 Rh00HgP K7600 2$06 0+$ꬆЈԈ|(\( 0-LMPQ@0P-0Q   0;0Q*0 R0 RP 8a= 0P5h 0K0h#P0P 01P0 l ЈԈ8((, p-LpM`@KP X0PUH0 Q Kp0 Q p#( -PLpM`S@ p0S 0 R KP0Sl00h0 Rd00HfPK500 #5 0{#꼆ЈԈ|(\( 0-0LS@PF04 00S0 0  000h8 -LpM0P/Sp/00/ϓ`K@P+ 00TP pP0 RP@P0T3  /0pG0$Kl? 0-LpMPK@PK00 R |0: S :;P40L "9PU 40 " )) -ML\4M T4` , ( pᤔ ,$00CSX4P444H3 44x3 v"ß, 0R(KxPB 43@P Yڌ3 R3 =P0\#" HF"  x$3 g%3 P2 R84S 2P 2 Ru 2 pB0SF R0P0Q0S<"0;0QY0S8 TB0SH2 R. <2 0a=C}I.K B B$ (K0pC@P4: SB^KPEPE!p@4! 0"U\1埒P P 0S8A0S,1 R  T0t0C @IKAAP40S$D0  d@34p ! h)(,)`)0tdlЈԈ84) ?) -LtMpPK@P1 R! 0R) 0: S/ 9PP 30` R "P X  KXo30p j! 0R H!P0 @S!*)(*(0 P0C 0 p-LKtM @`KPJP0: S  0Kp 0 30 !h*H* -0` LK$KP P0P p P2X0p RD0D P0$ (,*0 R00؆ -̢LP $봒00@T) "0S@T B 0S 0x0t2l (P P2P~0kP2 0" 2 `R. qP00CS00@0;t0  R P- U. 0S 3@;t0 U@I@0S0@q< p{P  P@0S10 2 V0@0E 00CS000P p 0 S   l(2\ $ 1P @̆Ԇ؆H*0 ** -<#L M0`S$$&P 30C S1?$?>$?>>$?$?>>0""2 R D0, K(0K,P0,( 0#0\" Pb]b-0@ PpK| |@Dp v2 * RV  R,  R1    R 0!Π P;01 1$K R1    R!  R`1  aL!0!00 +P5t10 0 mh0 0S 00a͠ 00  00~PJM10SuPCD1X @0 | ̆Іl+P+4++  +8+ 0-0L R0@T P@T 0S0S 0SU 88@T0 PԆH(]+d0 R00T0 RL0  D0 R80 R,0Q 0 "؆@$І̆ p-@PL` 0SphPP @P0/S/0C0T 0SD0 00@ `PPPPphp+Ԇ܆+ -0 0R000000L R0000 R0@00|0 Rp$l0P PT0 RP(.dp`Ԇ ,@-PP:P 00S S R U2 /R/7R+ /R7R10P0C U P 0B0 SA@B0 7pB bTaBWB0 "Q0U S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RPTP Q `K0 ᰂQKpB?Pᣂ -0LXMp Q P@ a ;at`K 0@S0PtK4@KC 0\ 0R Ka=@vHL( (0T@@POPh X,L,@, -3LpMß@0 ßT S, pP`$T2 R0 CR s00}, 0R(K5p2 R HT2@K D2 R@u a `뀐K 0@ S2PK0C@1Po0 @P @@!00CSBa tA 0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R X  0{ 0 "88"$#4 ⢁a-0x8

g -= /0CQXZ] Q1pZ1@TZ pP0`VQ T=pPHމPxN:!P ? P,PˉP%X= R  !Z `PVJ@崉P\ x< p sT@v@P <Pp=! P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P xP=Z+@T @ވPPU p ԈPPJ *^PPňP@9 R  Z PUJ P >P p娈PI hEu@P |)0Sp)8 X8 t0SH0S 0S CP 0S70(KuPkP8l8D(8 @Lg ('hp 60@DStcccccccccccdcTco33+ @$00x#h3 3 $00 30#03H#00L3 "D3 4#43 #00(3 00"2 2 2 "2 2 2Pi[,@PD@P }P !p000ᵉx2 O>B  P!1 h" Q<L"0S(!x1 4"0SHii\i\ii "\!01@Q񟗲ee$f$fe@P0 P@ RP 0 1P@0SP1 bt؈`2܈2̦22\ 2(T2H2<202$22H232ܢ8422(n9l3ȣS̈33 3XD3ԈlЈ@42L$  `dp|4,(03xh4(41 0ȈH3D32,8wP1 R (Ny R0t0 0 0 x0 墼@P  P ! Rh 1R B P 0 0/U!d1 4QAH0pK @p 1P@  T1˧2` H@zT 1<徧BP2  `B0X000X0+PP*B0X<00X07PB0XHH! 3 3  $3  2*P20 R @a0BSLkjjj$kjjjjjjjkjkj Rc3 3 4 4$ 4 $04 <4  DL4 〠 ?\4 @ :l$l4 6t4 1P4 4 +4  &4  !D4P A4  5  5   5Pl,5Pd`5  x5 5  5  5QPI5@ՄP5   l5P36  $F$VQ^8 `0@0X6  l,``&0 0 R 07 F6  y@6 @0 S:y +P6 R00CS010  0 <HD'0 0\\'0 0l P {v  o o ᒶcF p-0@0?PL`A PQQSp[P$ 0QSA?P0QSp*P0*S0*S S 0S P P 0SQ\ 0!SPPU0]S@ S -R \0]S@^ T P ]P \@\ 00 R /Qp$ p-@PL/Q@d ^`\0Q\0@0CR0QR0@00p 0p4 p-@P`L 0P@ 00CSp  0Pp 0-\0L@T P @@x@T 0UP0輈H(]4 -LcMK M 8KK(@D (@D KK(*K, K#8 ݓ KP b-K( BŽKHK(B:K(H K@ KKK8  SPt3(K -KY X1 p! * p00Q  X #R X K*K0* R &R@P \R  U+* R( &R@*K80/Sa9S_ K00CP^K2@0Q S``V 0eVL P U:hPBK"(K00a X 0S  K@0 X:0 X*0S0 X0D KQ *K(0 -<[SJ:K`(\w-<[S4, 0RC(KS@ :K8S K(K:KK A(KT$K KR(20S K\  K>K(d 0CK>K@( 0C(mw,ZD-K금h X<5H45T5H -MLM`s0\cP$0 0S0S 0/SK0S.00 @u ẻ00C00S2 ;0S2P  0P 20SSQ SO 2 R0$ 0R KK @@ ᄻ<B0C<0S0S  P=80Sq  P480Su  P+80Ss  P"80Sq 0  ,0 P PP"00CSa|t\T PT !P1 KQc v@0KH0 D@ @0KH0 D@ @0KH0 D@ s@0KH0 D@ }f% !!1 P 0 P {P tP l0 R{DH8T\8PPȈ888h888-1^ 1!3,H -L`6 pR @00B S R QT P"P~ .RT@ Q000G SꤊXxX<XXĉX0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S0Pp 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @T` /7&pP 00@T`  `00D S 0,TV`0B .TQL@T@Pv W 0S 00 R MR- (CR1 0( R# 00f0S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  P000 R 0`  D , 9|99,9999P9 p-@PLp R @a0S6 #R. \R' ᣫP@9 . 1"#200b100c!QR 0S  RgP% @ 00 0#R@ @\oP Df 4 `  [ />3=8:l:: p-@PLp R @a0S6 #R. \R' %P@9  1"#200b100c!QR 0S  RP% @ 00 0#R@ @\ P D 4    />3=:: ; -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@#!QU`@ p-T`L0S P0@T  0<@T0PUp -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q  壭`VZ埭000ЈԈ p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00gep/>3 -\pL0S ` PU 00@PNTP0`V' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S00 h $qv -MLM440S, `p 1 RQA0Q( @PqkBP) 00(00 徠 000, 0R (K0/S BKAA*"Pp ` P (0  $ k<h0;H;t -L@L0S 4 @00oPg ; -@@L0S (XPP =; -@@L0S (AP9 =; -@@L0S (*P" < -@@L0S (P  P< -LpPP 0"#200b100ca R  R 0S0S@P jP 80pP  00@o/>3|< -p@LP 0"#200b100cQP 0S P\ ヱ`P 0@0 00`/>3< -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  >; P 00 tp 00dP 0S P `$ 000< = -0LCP -$L@pTP> !a@T xP @T ̰@P iP iP 00@PxP TziP(=p=D= -|0L@`TpP \ AT wxP @T W0G0 -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! Ȉ0  S;00 S0000 00CS 0"$@P hP 0 0  0  00@U8&00LJqv = -MLM"@0T,0  pP! @T@T 0S0]0S3 1!-h, 0RH(K@PJ Da 0CQ : <P ! a= 000@ 0SnK`F`F ,P  aPa=0 S0Ÿ\ H9@ ,hG =>=|$>D> 0-@LPU 0zP t0t@p s[`0P008 0$Z0G\T> >h>  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -$6LM0 S, F SS40?4(6T?,? (,?>L?W -3LM3 0A, S 4Xt<:864;0Q xtlhddT!PhH0 $#$(,"(h Q Q  0SkhC <8#"hRCCD DDDDdDDDDDD E4EXEEEEEEFF,FTFxFFFFFFGPG0GtGGGGG H H8H\H -ML44M3Q (K @, 30S   K(@@*cT IK(@D3@D#0s K(@@*bK(HXJKH(@D0@D@#'W` pGv*P 0@$4,<4("4e! d_pW\ J TXV勼0 R 00S* 00S0@  0@P@l\0t X00 c0BQ T T0 0 S@ :  P0  ` 8D@B,X @|J -d=LM0@ ,0 0 e1KpA fAK(]P  p<|0l 1   5D0@3S0<|T|,HT ,H`lp|K1 Z!;R 00 ;! 0@00090:PY00` 0R[OKQP P (0 0<ʟ@P 00zP*:uP  :zPMP  ^ dJx*x:zPd d00T0000f1K1P ^(  K1Y!R m 000000_00w0 0t00q0 KqY!t9RJ 0dˌK 0\Y!eKR6 0K 0KY! R0lȟ(a?Kp0<-K 1+Y!xR 0hy T(9pH8p 0gSn8HPg 0~00= 0'7 㡅~g! A 0P0PPPP  000 YOK ,xl7@6 0ST   DF0S47 00t1 P H x60! 0 Q:<60  6 60<2S@&000 FP ἠ500l1 0P PD'E0@ 5 >KZ0 T5 >KO   50<2S`%;0000U B>BS3  % 4E >K/00@000 ' 0e[R00@ 0  0 l1  0400T40 ! 40<2SLd@K(P G#dK cK0 bKPPtd30 #Y?K@0C @߿P,30 T#Y?K@0C @οPl30 3 [?K徿P{BD_KP#^?K|Q cPmx!t1R\#]?KP墿PL_0;CS00VLb$CP#0P匿P 2Qt"Սې"XR0S@ 0   URO@p Q0 hA0 02qᖞ`P@-$POHX-OtOOOpPPHP N -MLMp0P@AnK 0 `F`F !0  U00U0S0 Ut 0RK@BP < 80 Q ( #hX-PNPN  -`LMd&0 H" @'P 0STYPPW 0SK 0Y,0 ,0@0 p p @TP@P!P YU3oP\1 PFp`0OQ PP P  @, T000000S0ST0S  @|h 0TP0PPP04 6  6OPy|&P -LMܡpP, h 0Ql$0S V0 P# /00S@0@,7V E0 @0 o 0   5"@0@ /P @ ,,0(0  0P` d,@ӝ@ @,0S0S,$ 0u"|&\-=HP p-0 P!`UL*@PP 0S 0 @0VP \ 00\ <0 0S \ PpL&T&- p-@L,嘞$!PL0(S `0 0S0 0 00 lSp 00C Std|ddddl 8#80 0cP 0` ,9 p````````|&, 0  - -0@L d0 (T0 @0AS@4,(( 20000P-P -X0L@RH0 P 0S P 0S -H&Q 0-P(L@T0,_P T00T0S 0 T @0X- 0-( 0LS@P 0 ,寜, 000 p-d`L0S TPT 0@1@P0S廑幑000pH&T&L& -@LP㫑00- - 1 \:q`\ !50:1Q@(@F@  њ,6" 0 0 徚6P,0 $F 0  0  P娚ᶚ00@ ,0#0<0H 000(KHbD0D  -X-- -|&---P&-(Q-- - @6 80(P@ 0L 0cp`@r먠@@\P300@ 00`S mPĖP P, |&-- -------LQ P00P0 S-L30 P/萟0S P,*`$F(pP@&뼠,6 R0`00 |P$F000#0 `$F0P5P@2*X- |&-tQ -1` LV@p$`P  %#T*V&0 R  05"| P%#0VL0 R @| 05", u-|&4-QQQQ 0-PLL@T d0h0 R \d0T@0d0`0000,0 P|&H-,R\-QLR -0L: SpP` RHh PR@l qPqhR -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`+P( 00P蔀0 0`P( @$K$G$ `@0 0 /&8$ 000h 0G -X-|&P-, p-0 : SLP` V pu6pl0@@0P` 0-LM@ T00T0S0 T8}P~'0HግP tq0 R dg0K0 0 D^84Y(URX-RRH-RRAR -L`p1&@B_?) PP1d(P@P( 0]0V 10 A `   h! $ ((dPd 0RX` 0 A8`d001P|&-H&L&@&T&R -MLMCL 0\, |p@  L(,P DC, 0R(K0CL8N6@GTPo#1D 4H <8  #1<8 6"0\P`u!#Znk 0 0@ @ 0ᗪLHx2 Ra D8pW8 :O4HLT >L@?8p^@Y RLH00S00   LNK @D@D0PL(h@  Q $tp1DH000yL4 0\ D(000mD000gY<<P*D,-P- -LP@pT` @0S d 00C0 㝗|0  hpdLP P0*L R  <4 0S H-xSP-,-pSN p-L@M P`KH0S 0S   xS -0L KO|HS -6LM tf@P, C00T&!p" b0@SlX8%p5`@TU 㚬P 啬딥0SE1p`0Sp`FV T @ 0S 05 RYp P 0SL0S P$0S 0Sn0DS 0S 0S K 0S p4|D xT0t j 0S @4X 0  `Q$6S@ 0 0&@R3 3 hbQ0S 3@T @T 됃0S @T p@T X#00#LS000Sq,3劋$3凋3儋0SR 0S 2 RzE PH K4P "0S >;"00028"000"000l2h2m `0>0P"Sn@O00!0002  0b1  85d1 RP 1P+!KvBA2@000) 00 |tl d\ TLzD801(Ha{(?Kt | x P j h-0T mH-4-|&T,TP-<-|UX--UUD&U V------8L-T-(dTr@-SU-[ZN-D&Z -QLp `<,P@@(&T` X [[ -LMf0,0 徇P廇PU      6Ye(pQ ,6& O P ,6 0&E &ᚈ&ᖈ rK㒈( 0R01K1Kd1Ke   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʠğ0S ,6 1R 0h p nJKJD$ 0 ,6 1RJ rK vP#0Sg# 0 ˇ&PL0Sz 0# ệ1&oP_1!̑0  1 +`3 0ASB CEEE C ,1   1pG1\0S1 S,6!0  ,6!{  eK P l2&1‹001&P,B Hp4j eKP 1&់00&PA| M!Gp,6KQ01,&K p,6hAQ000F0S&\"*0 R !Q0 S  1 0`S rKP rph, 0R(K! |@1! 0 u000SL]Hh|&-4-<[x[[[-[[[[[\- \H\@LN00 ᤉ0ᤉ0ᘉ -L>P 3l\ Q-L@ TP T"|\ P-L …P \ 0-/LP@P 00+8<^/00,+ B+B00 \ p-LpM/P@P KP0: S Kp0`rS@ʋ  P0-L@P0 R 0 R 00ht0 R0h0l H0 R <0<8080꜉\A|\ --LM0 0  --LM0 0 K --LM0 0 K -L@rYB h, -LM@08K04P@`AK:,P0: S VPP SV H`@P$K-P U @`0 R000]K@P l1: S 8((ꘉ8\\\ --LM0 0 嘎H@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% |&p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0|& -T L@HP4T~eA f$edA],] -L`p@KPPP5:Pa0@S 00B S0"a>CPP R R,1,,!!00@ S c. P 00C %`f`P0Fx3 @O&6F n  PL @06E  N?P00`C\Nx]xH] P-L@ 00 R$hpH-]A -LM0 Z3 ?᭖3s ;@P (K謓k  `剈#3R 0X 0@cX, 40 "8 @0E8  OƉ 6F&VΆ3 ($6Ȇ 0( І"00ʆ80S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+6P 0 R04 0 / d0\wd0L `P@ 0R@X  aA T@--P&\-|&S]X&\&4-^]^]@^X^ -kMLM0',0 7K@0AA`@`6 PP6: S 3/PR j먦P%0S~ 6 Rn 0`St0Sn dfd6d&@`v@@ @@@@* '0SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 &P0S 4 R}TT0Sp> p0S P, 6S!@Ƒ` 6S3Ɠ,6@ \   0P V[`WP `3 00B10@3P LHC`3P }D3P u(3P 6cS00 ,20!6 S 2" UBP0"S[ PY &m> pr`\P@5尚D"D2f뿘k@@)1 R_b)YP @0S@@0@S H6<4"D0#@1 ]P @0T!1,x&>1\H@ 8(  1R  }hX&-D-^VP&H-T-$_\---\&8--@-T`4-|&X--a0_ _x``_^@a--,--L&@&T&H&^` a?X__`0`x____aaXaTN|aa(]W``@@-0 @BTx00 Q< 1P 0<000  --<- -L@㵠ޚۚ@ 0-LMMpPANK@D0@D\ 0 i 80 㽚 0RK0  h b-N -RSL4MP`p \|1  BR dX$K T|X^0@ X 0X@K( L (0KT P H D @ < 8 4 0 , L % L 0T0 P LP ,p  0U0 ?00j  j @` ؄D0/ Z D:PPU P0P X@KT0 , PP  00ꨉ-x8D -L4M00 @K,0 K -L: S S  S  S 80P , S  S  S4-@b 0 -@@@0 ܠ`L @@``Pp!p 0XD0@@ B@?PTPyyX P}-.--|&|-Tb -2L `R^G@p@3 MT1 RL1 RH0S?T 1 R9qQOYj0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S I P 0S PP I PyTYT nTNT YTyTXEI@XEI@00H-VT-D-L-bbbtb -0L@Sffff|00S \JX0 R LS00,FP0000bH-bb 0-L0L PR@  ,/(+P 0  H-bVc -LMpP`4p 8 <0 Tt@_0/q,0p , , 0K贠QH< 4<P1  8 80K40㠠Q0f<\%0 4 ` 0P @_4 0K@P  ᕁ8 `C0<0 S (Ko(K,88|--c$cPcc -0LS@p PU 0 h0U ` 0`` r0T xP 6Sƕhp@X0Ɠ,6@ \   0W 6S-WXcdc\-|&D- -TLP@ 82 R),r@T T~ `U@ PwwU` Qm!0Y0011 RC1嘶o蕶a  ? @_ၐTG p1 Rd"P  ?rDA P PaP[Q30 R% @C@H0 R 0 @P2!ీ0 ^X0oBUdP `fHJD-\-X&|---4-P&-H-c\&|&c.-ccc -LN ј -LM< !<@`_',0 , , @0 @00K8 OQb8@ @ P4 V <W0K80<QS@ }P@ R 4 ?0440 <啀 >@:< 40040 0@Q$ 8 `P0@_8 0K@P |0 d0PR U < L 4(K0< <-dd8-HdPcc p-d0@LP`\ D0l88 000 0Y `Pp|&D-.P& 0-PL@T 0!S0S @T@T @T 0 d 000X 0000 0 @P@0F|-|&.-Td -$1LpM R  1 qf0S!  p@, P1 P@T P VP pp`0SxKɵPL0X S;30{P<80800 $K.<Px.. -qL0`S8P00@T P@T# tCP0SP@`0S t კPP@XnT0 @T$@PP.PPJY t H0 0D 0s 0D0 V Y P8 P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S =0PP0,0 @cT dv@(Kr rK_P  001 R  z0S 00S Q  R ("(04"400$ $0 S$ Kh\ěrd-0 CR 0R0 S00 Q-L X6 p`@ -0CU3@% R 0S,,0SR00ӑR00Hӑ@ 4 R @0 S0S -@RLP 0S 0 TC 1@0S<p `(<~0C3@ R 0S,x ,m0So|d@ l R @0 S0S400S(>hT>hIrr Q-LP z$Q 1ZA@ G 0(0 S^7Q@娀帐`p0 0 S V |Zt H X00`@0D S% 4o rWЉrDo8g rr -PPLD@DDp(` <h0  $@TpW8g| Qp-L`P 00S  R000 ӑxR 00 0 S r 0 QQ 0v03P0SLL  ph4@@TprrB -0LM0&@K 0 ?tpp0 h@p [Q&0[S &0[< S 4w 0 S #Kh306:i rrd -H1LM04@K8Q  0 t ! t $P K1 ŌP - 0C`p@P0S  80  3 0S--0S  lPU@ 0 SHKh0/D606iss0s8s@sLs`sd -\1LMP1@8Kq`P  ( sV@! V/P  0p@ ;PK 0OsP !400`|"PgW@P 0 w QP 8 ` (0 SZ$Khpstsrd -LMp02@KP`  0 Es @ph  8s0 H2Kp8 0R$'Kh306:i s9i se -L$M蠟0( @K @ @*@0 x\p  00:@KP`㐀  `r| @帋pd  XrKᯋpH7( 0R4$Kh,s(306:i s9i se -L(Mp0D@K$ `|P 0 rt HJh ။PT H4` xP8 0R$Kh06D6i$si$s$e 0-0L$M08PK @0 \0 RP  J[T0Dx 000T0 X0X02K:PDª 0 S,iK0h306i sD6<6i s0e -4L ,I(0( p D6306yi s p-1L$M0.@K `0 P:r0 @p'  I00SA[T"04K )40SK tp001KH0d8 ъpPY 0 S8Kph306:i s(t,9i s0Kp 6Xtt4t -L M Kp,`0 U)$@\P  0j "t000S \_TM8PpH0 p@h  4C8P$0 t@l  K@Bt(6ttX6ttt p-x0LP @ T 10S c lXhmx0 gjHbj8`S`RV$ 9@[N-PTO릉Md0SIB0S 0B@00S ( 5P 1T00SH  4 x07@ phpu uu$u8uB0u@uLuPuu ->ML1DM 10(0  h@K lph )H TbpP 0S=8m:>[KH@K$PEDPE >kp p 0P 4` H BP ~80S >KK$@D`D@DPE*0S  tP|@80UZX (0 S@N$K<6hpw06D6i vi| v4vPX L$` 5P<㽧 0R(eKhHw06D6i$si$spe -Lp#'`PP h埧d p0 @?80 0P(@Pyhlw@K   m, /E 0hT@K m !E Z@K m E L@K $ m E >pwp3`v`3  2 "RS XZ 2SP=@@~)W @[,,x) T KZ[Q 5QnOK@D ImX8DPK mP1 o?K  KfmOK| 2miK < D(4 \Pb[P aQ[U8 G@iJ;LbK봅 [VZ (1SWN_K ),K0  0S l3 l廅p| )>$AT1S1S1S Q!000C S0:S Q4 P`T 0S,,Q(#V @TP"R0S T(0S@d(K  2S*0S' @(04 ,((0 (0 (0(|( "R\0SX2Stx1Q! [0 P01S d10S  |08(10S x m10S  00S p`p@[ ,0 S!(Kh306D6i i8i4iiiii$xxxxi|xBxxx yyy$yWx8g0y8y`xDyPy`ytyyyi y@6,6e -4LEM0P(0 p24 4$p4Q%4Q 4Q|40Sp  \U 0S 0SS0e P@Ked( k 0C iPW $|0PlUuhP  |, LPxԣp @l4 @0R$ $30S  20S((4 N20S))20S  p}hNp20SP` pA00S U8P0z  X`00V pWP``dZ10SAQ 4T0@$0$@SFNK@DP@D/PRKPQKj  B41d ṃP/O4[S nKP[ <P P,hBO[O[!1QppP5K| %NKP[5K < PP,QB 0  (0 S$KhAD63<6y6`zt3lz6xzz066i(zz#4tz6z@_K.h 2@K2 dP01S #KKlOK.h8 @K2$ AP01S y828282828282@82Z 10SC OK.Jh4 ?K1 HP01S) ,8&42S82S @t4P Pdjge8P Pd[X : (0 S$Kh06tWL|<6D6"i X|l|%i t||Ii ||||||||}Qi }0}\<}D}e4 0-h2LM0\B0 0S+0+S 0, ((RM?(K   A?!zP 01S g 1 10 A(0Kt1t!^P 01S g`4 0?,1奈<$14 <8#"10 @(0K0 0P 01S agcx >P v00S  l} 0 SXAK0h06tD633P}%i \} 6<6"i l}|}}#i }}e -L0 ,>(0( pk D6306zi } -L1LqLP`V,W(ADl0P00C S= PQX@3  PG @* P#0@ P01ű0 P0l 00<0 XP0L0 0 贉06tD6i zi <6i 3i t3~i 6 -2LM04 S P qpP kp,KP d,P 00 80 |W X 8 0R00C So-Pm @ Pe000C Sa 00S .if  aR #~j  ]f  aR #rj p= = 0@T2P40 L000 +Y &-P$4 TR00S 0 R@ 0T 0"T0S$@$0S 00 0S 0 PU,lWK_Z@@, "Q(Kĉlw|4433D6(6kH} -PLM@4  p@0P-S#`㨤娔@ AS@@ aS@q`00SXpGWPe @F=P $ ?=P 㰚pGW0`,0 #3@ ,P3pG`@ $@P30,0  3 3  |=#0Wp0t0 @tt,PTpW` 3QW0b,PZWj 20Sa]R,P @Q2 R @ 0S   BR X0S= 4Q ZpR ,,PP QD2Q P 0y  0pG 2QP `Q d 0pG 0030pG`ꘑWAŢ 10S(1@0S1E;10SD1Q< 810S ,0 i<,01,0 }P 201S00S00S ,0\ L<,0 0,0}P 9ĉD6}k(63X6}~ ~$6rf~,~ 6f9x30646H~T~ -LpM`10@W,0   @K2R@PK XXp@K@ td : `P060#0P@U@KR }X  yX X Vd  P0\0#0P@U@KQ `X  \X X0, 0R 6(Khp -L\M` @ V^PP, p t x e 0Csb0l0 cP\  /h hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kgx `d x V@@PKl  c ] c hKc@K c ,0 S (KhpH0H*-D0D 88 Q S RP-DD0 00R4 40R-DD 0R$ $0R-DD( (0R, ,0RHHA*-D0D 88 Q PS R-DD0 00R4 40R-DD 0R$ $0R-DD( (0R, ,0R -L^ \ \ ^ \  ^ 80S H0 R^ \$0 ^h}66 -QLM 0 0,0 5 R    0`0 0 0 0 0 0 0 0 0 0 0  QQ R H0.S 0(@S@ d Dp@0T  ʛ 0 P10S01 0 80 T}  4 RC 4@T 8PK #0D@K9b #04b@ gPg3P 0Ua@P   9 90Pß : S SR ~0S0\0 @  P1 `V0S @T0 | m2K"0 S2 >l, 0R(KTH `ι\2 S~0 @ {42 R0 0 USa0 _QN2 R  H寚s w1 R1 R  @[@TL |1R g@ T000 c E9 0-Su ZrY@K 0! raf0t  x p faf0 l ^af0h R0d0  ` g0l Kafd ЙD{h87@7,7|4766ě 7767̦tz7< -1L@\! ᨿpPo 1 R0SL \@P 30CS8(0SJH0SPHPv ($1 HH0.S% Q0S,Xg00 ĽPn`>0S0v03U0S  㚺80S d0 R LP0S D<8=:(766ě 7`6X7P -LM@`MPh `P 7'0002P7  w0〧倗80 p'岴p` 10@GS p\8tXX<,h0 4&00`P =5 5 %Qp 5r5  0@jS5 R0S 5 R5 R0S|5 Rd5 R0S 80SLU 0/S 040,%0S 0S S S $0S $4 T  4(K0S S S$4 p$0S4 R $t4T  t| 4d$L4T$$443 4#44 03 3 0 s\3 @3 3#D33 <3 d3`3 X3L3 003#23 20000"00H2 d2 2 t2"h2H" 2@20" 2!11  !001!Q ;8 0|x1 x0S !x1 `Q,Kk!`1 !P1 !@1 H1 Rl!1h!1  T4 KwP@#[R0 ;1 R !0 0 R !0 0 R 0 0  0 R h0 `0  ꌅ4D777@7H78687707 76776 76<7p<,7667(767$747, ht@D4:  S-L=  S*  SL2 RT@`0 CR` bX0=  X0 S6 I 1 R `0 CR` nX0*  X0*嵶1 R:`0 CR` AX0@  X0h1 R%\`0 CR` 9X0/  X0(1 R`0 CR` 1X0|  X0=倶|{/v@qp0RX=〶p0RX@xp0RX/pp0RX|hp0RX*` -0LPDp*0 RH0P R 0 R : S=P\@P` 0BO? p 00 ) $87707 77 0-@LTP `00CS`0X0  X0@T 0S  808 R (@T0X  0-0P R 0L00 R00|0 Rp0 R d0 @T ``000 @T087707 74 -$2@0LS 0pp2` R00p1 RpTC ؁PPUK`00CS`0`X0  X0  0P@T+ 0S U0S\`0 CR` 4X0,  X08!P(00S*0S!`0 CR` &X0  X0,F0S!`00CS`0#X0  X0 4P /p0RX,?p0RX 8@ iX 0X i+877074 -LM(K/pPM P80SZUԡ@ ̡`PU: 0S (0S` 0S7`00CS`0UX0  `X0  (0S@W@0S `0 CR` X 00@X ƴ@p0RX մ@0S 嶴 岴``00CS`0X0  X0x0 Rl0 R `0 @^DPX 㥴`X 㠴@777ą p-LMC P KbP@ `0 CR` DX0X0@ T 0S @^ T2 RE2 RT0Sn\`0 CR` X0  X0@0,Sc`0 CR` jX0X0@T0SL`0 CR` dX0  X0xp0 R \6`0 CR` !X0X0@T 0`S T `0 CR` *X0X0@T 0S p0 R \V 0 00l x ޳ڳp0 Rx \p0 RT \߳p0RX سxp0RrX ѳrL$76 -MLMX , 80S <4 R04 RZi 0Sc 4D R3 R@@K/$ 0@3 R  3 R0: S S 0S3(` 8@0Rj ~KpGpG `hpa  Du@3 Rb43 Ra 0H@3 R!3 R : S S 2 R9`00CS`0X0  X0Zh, 0R(K@0: S80SdC^KPEPE0P"ZNK@D@D8"zp^ (0K 08B"Y1 R  01 R r(o!(0(!"$ g, 8Zp1@P` p0BO?l 00;  (2(!0a8@00^C^K PEPE0 @CZ 0e0 @\X 㰲c|_h@7787ЅH7؅4777607 7,7WlHąD -LM,KP4 d R 0Q R  0 l2 0S ! R,@ \ \P0080SSZ> 0 0 !8 a Pp8  P`! 0 Y,0pW @40Sڔ!0S`0 CR` #X0  @X0T!0SH`00CS`09X0  X0000 S00 (K @ p0RX @0 R0 R 0 @:\l "W@P 0P 0@nX 00R$ 0@ @0H6@777ą -0L |H p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@tQpp0R0 S~7 -pL@P`nP` 8 p00pT@P a@TUl0 P @ P@0㕓#PU`pW*L7PHPP7 0-LM@P  K0K PPw\p (00S K0L7l$ -L MP@ `$K 0PPV\p $WpP 0 PPI\p ,00S  u KL7l@0P0 R0 RP= -LM0 Cr  0Q0 Cr P Q1 @,K@P\,PU 0   0 R$ PUQ UPD 01(1$1 R Q @00@S,Z&p`@P @ T0 RۯUpPh` d0@pAP 000 ,O$LIlw -p-M L M0` R P  0 R 0RKp  \`T 㳯ANK@D@D08 W $*hHĆ p-LM0 0P@0<0R\\0!Kp800 S800ta<80< <0\S*@ 0R&D0H@(0,!40Sa<a<Y0Ϡ `Al $!B30b 0@@< <0S  Ko0@ < 0Q =9A =CD H H0t0D R0<X PVL0 R `<`<0@@̆$H@BC?B\ -LpE`PW PPJ\V@PV \ W` `P/ T VPL z0VX0PPPPPPP$0 ( [(0S<0 0P000 P00003 0S0@ 00 P0dh PX P0$8 OO=xȈ, -@PL 0S@R 80z?[0PdS J 0 n?ꘉHL -L$MP`U@ 0S x D  wpH 10@<S<                                                              .p6 6pg RP0S6  0S 0S  ) : )P !P0 80 @ #KPt$0S1@GTPa@ PP䅟k0K%p@PT D00Q  R1 0S0%000S D0\5 D00A00>00:0070040D0 140SDDU 00SHp@PT0U 0 U 00S 0000Sdp$`D0Sx Q 8 R 00S P0So R(KDP000 P0000000`V} 0#@e0003 R 0SH3  0S#/3P  㡮 30S0@⒮0S) -P :(P )#P ߬P - H0W00kH ,0R  -Q  l"31C0La1 @KP6ں3[ ,00cS b0=9 = B 0S!000400 Q- $0< 0bS$0'0$00|,0W003X1 R*Pl!90S @0WP0 0)0 PT0P j02S fM0TX 40$040 Q K00 R hT=8 =0  -"L(M0Sr 0S\ "P@PPP PPPP@XP`T: Ք8P_(@K`$p)$ 0psrP_0)% p,` jrP`@ : L0K0P < LP HP DP @P 8P 4P Xrp@W x!10@Pp|!0x1 0p1@0 `P `(K0xQP((!p!0p0fQ0P tp꽺0 jp곺0 `멺l0| V럺D0X Lp($=T=p=\78===DhD̍0 0 ==0S GS  -L$M,  (K  K0K,@K$ @(  UPK -L M@   (K K0K$ @(  @UPK 0-LMPKAPP@@T P 0SP0P @ U# @8 -@@0LS  GS ,, @0 hUt -LPM☡0H@Kp⌁P `(0 HP DP @P p@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0/S\ pp@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0.S \ p0  cR=9L = 00 0c0 -L 0=7<H -LMq0.$0 P;P `e?V $ 0RO KSgK !0 KS |!A q 0  0 Q 00ӑ0S@KX "NgKA aK 4PKD@KX P8K  d=d=d=d=d=d=d=d=d=d=d=d=d=>0>=8 0  zlL\ -3L M Rßp3S00@@@@@@@@@ L "刓0 0j0e!KgP3Ƞ ,Ƞ("(<3 ",!$ Ġ0^0 `a2 pt0 0````hM8#8 $#$2p` 22@H0KL HP D 0 @@ <@ 6/W00S@ RC02 (0n0P (K ᛌ t00@@@@&M8#8 Ġ#Č M p|1@0K,0@,̠<Č4("Č!4 <$̌8K 8 40 0(1 @t00@L8#8 Ġ#Č L p0t0 0@@L8#8 $#$pD0@ i0R ʉ\_T_0> ?D_>_4`_X_> _<_9(_xH_ -LMP |0 R 00  @d @ @ @ b K ihK80 0+(0 +%P0 0 P_6T@@0` 'S0-LP@媵 0h2(@0dS<Q<DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD EEDDDDD(E4EDDDDDDPEDdE0h^\001@U 0$ 0hI 0$ |0h>pl:0\0h述T2001 80h(,ꤓx#CCȓ̓ -CML MLw@0 @ 0 PR񟗋,HPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHI(I4I@ILIXIdIpI|IIHI$J| 0RKQ񟗎JJJJJ 048< ("#^Qm Q XSPPQf *<J 048< ("#;852/,)&# 娯NPK .0 P  .0P h`\ 04S<xKlK`KTKHK,  04SKKKKJri~f{cx`u]rϳ2  N Q32ijFp徳l2  = 0`S fC -*Rb L尳2<孳8媳0姳(夳 塳垳図嘳啳咳Q 即A*凳;SRNPK .0P 1 t|#V( ppMKk @D K`@D @@ 0Td ;P 0Z$. H. 9NPK .0RPDAhԔ8FCL\l|ؕ@ԖGpDDDH`D_0PD8$Ȗ(0G$p|x -2L4M  , P@A 0Sp S 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0P ᶲV x ᯲0S @D␝T, 0R(K垲. +X 㔝 dyT`X劲P凲X ゝ82D_h`,@4x -GML M號ENK0@Dp, P4 !W `V Q 9   ǜ, 0RH(K0SX X9    @ 岜p 3 >P 0PS- Sj H0   ! ȟ08 R`00CS`0EX0  X0l0 t/lhv P PP 0R8(0 00@|4 xD $04"4(4 G R000t 0 7ǟ 0 B0@tD 0 l0u@F   aP 0TG #D7$   F(ǟ R0004'00F0000I\ 啱0Q :Q $኱j3l kuIv?4 dw\t 0  $0H@ 0@ @@ <@ 8@ 4@ G0KD@ HK0@K00 HKYş0S |x$QtPMp0 ޛE0 P4  R b5Q% Qa600XPPPU`0 S PP  0 S  FKAhd , <$ 4!$EK 4A,,.<A`$ \4 5X! 4+(  T! 4& 0&pD 0| x &|$x4LD( &8D0ğ |x>P|xD|x "P|x$X ƛ° 04S *幰ᴰS 0HSሄ l P UKH@H p P4`U :@TJ4[S H( K#D@Pd $劰P4UuŸp$4\@P|(B0 X u@TI T`m`0jS'V <4("4!L,C0F T@LWX@! T,50OlP t ,*l$$AP1 RD`0 CR` X0)  X0lUP T,)&`p0RX))\PUP q $1  0P4UP | j jhD_L\IJ̋_P_0 ?L_8`̗H4ԗܗ>I@@\dLT4WT `hp|XD`` -NML?M? $ $ $ $ $ ,  h$       \/Hp= E0@2S2m\\|mPm\\\\@dXXpH.\P00 p Ο1 1 0`JKI I8^ " 0@D *Pt0 R=|= `0Q  E=ՃP-0 k4S- -K B B@@@@@F>K@0C @"0C D *Pl$0S 0͟0   00 )JaPulm,0 | `p` ̟ 0Sa  ,0 R t,00`- ANc@P : T̟0Tڴ+00B0S o[+0 00000000`@"C`@ T @D0XD @;˟@ 0\$ SE>K0C0C5  \ d)* 5\ `p D-K B B0$ * R44:0  4 4 ˟: 4`P0 ʟ$0R pspW@$R$ 4S P 0s 00) /d:   t)00P@@X04 .PHZ 00) 30 ) B0X[pP UFnK`Ft `FP@  0)PGl4 RLZPDPl~U@(ɟ0) h$R ɟ0RFNK@DPh(0P?`P9)0P6`Psɟ@)$ 5\ @*`P+d9)% 5@!`Pq(@o @孭|m姭Hg.Q @$@T8Y(Yǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@pP PP7PƟ 04 H0K4 4 4 ̤ D Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50SPU D5 &0:;:0{%0<0v%0:;70o꜕EKAA d6Pb0 R^ `4 RZ%PYtX%000QDş 5   H %080C ?zPRДEKAA 1P-0 R) `4 R% )ꄔEKAA P0`S `4 R 4Pt@@q 0Z" 3#T3P#000CEKA A4@ R `4 R0 S L1t`304 zPd#0 00D#0600#0@00bEKAL L0 P d$2R 0t^R0EK0AA `4 劗@h Q0S 0 R `4h$TQ (sP2, *++ 0S @A0C2S2jDjjDjDjDjjDjDjDjDjjDjDjDjDjDjDjljDjDjDjDjDjDjDjDjDjDjDjDjDjXjDjjDjDjDjjDjDjDjDjjDjDjDjDjDjDjlj40SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'h>> <_ ?`_>Н? \_@@H??.A'JH__(_ 'K@_?D_؝P_>LLl>| _(_'u|<h_(DT_(L4HP(dșؘtD,\Jt dP \̚pԛD4X_J.K B B@@@@@@H1TQ@ N"0 'P0( Bp1 !090r!0701 0*4 !080~"050yFnK41`F`F@P)' 0lD Pv]Pl1)( 0Pm]P( v0S22 0 .0@>@$ 4 /\20GyP-   r 3PWA03@R ]PKT0 G dêCϥ0S? |t\:ƥ0S6 k\13p3=K0C 0C 4 T=I3 嘧P u1 0`POMT3F>K0C0C@)& lD \P8 `u 00) 0t   0,0Q @@$ -<4P @p$)+ 5\ \pSuX$E>Kd 0C\巔b0l4 ~@Ph5P 4 xx%S00  4). \P $u0 Ps `) 0`~\P0s 0) `s\P (uQ 0)3 b\P htpl$xlPF.K B BtPt1VGKA  A|4 xD 4 D s\6 R=;?xq9l$E.K B B% ) 5!\p3LtRWT ^qTlYqtVq Rq Nq Jq FqJGꛤ00:q땤004q 0qW +q{t xtutrt$ot,q4itW$0DqP qX]t`ZthWtpTtxQtpKtp$pAt(0 SŬ˴8ɠE>K@(0CX @[a 0-8P8@L4 A  0H|@W - L⃓h꼞 -\5LBM0pPD,0 3C 2#=S0SZ@@ PRyyyyPyyyyxyx@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0xQP >X1@T,D10S CK@ @⹎pHK D4CK@ c@<$ 8D p CK@@<$ 84 vP1r0P  %HQ 0+SH HXڠvoY X qH4BNK@D@D0H$|>T0hW(___ОԞ@DdTl|_G-M$\ P!* =c?0$"B(0 c.00B `Ñ pU0@\0 0  `Q㰀\$ Z`F pЍ@-A\@b ʁ42C=C000 \ = @ R ʁ42C0C00 0 R0 -0L <|H -P0LMH @K0*0$=,0 $Rp է_`_LW -LL0L r <@ 4RPhq@rp__$W  -LT p-LM@ K``"`Rp @ 0P0ji`@p 8L0P *=Kp,僧 qq_LW_`Px -0LM@0P`p0W0s 0s!,K ㅵP,00CS<<W (00W(00,K jPp Kp -PLdM`AV6P9V&PF QPl6l6 h`QPPR@HƟH*94&,&,62 & F?&t5ş% ş< KP0K @sT㼅e%W 0 0\ X XTd ͠` \0N @(Ko|opohoȟ___%W Ap$W ~_Vt?@{Gz?~@ ԟC0 S S  -`0@P@@T0 LE <00S 000S7/f:` -LT4@P/蔢 p-L@m<P `p p-2 B 0L`@0PP 0S00#|2[c =%L -9L2@A<0P/S @P,P$2 B ?40S ,,,, 1RP @P`F ,V 0+S-S0S*P*P r+_L10S *PT1  @` P|P`T@D00SPPYPN100S 00St0Q?/ '9`9hPv8PQp<\Ģ̢0؊Т 000e 00@`T 0-L@PU0 0 GleE -|@L0p0h uG0\0L nG0D00 gG0,0 `G004LeEde\eTe -L@`0X LGP0@ FG<0( @G(0 :G0@PeEXe`eHe4 -L@$000P h4 0 0S00G0EDe@e 0  G@eE0 0G 06S000H,0 0@S200 e 0Pe 0- L0S( 4 @ 0   0)@0Q@ DLP 4vh 0T4~)0@0h=0e -0L Qp0q 0 -0LPU5 40 0@044D 0S+040P`0$44p Td$T(d,t$0@044D $ 0pQpqh(e -0Lp`PP#,0 4@0$($,T044Dt T$F P 404(0$00 4sie8 p-L@ 00sW(0@L, -4LtMP3 Q $$0R($0R,0Q00 :$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4S^,P3 3@ 40 400@000  D3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʝR4S4S 4?  0jPp@Pq4'20dtŸ q 00010*b%ph Pz'1 4D0O4D0P00/0d4t`10S% 0S+K HG'N<10S01KƪP1 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PK*0(KeH \DLP`dh 0-0LPU ,4S0C$(QP40@eP $4(D 0@$4(D0,40h0e -l@L0S{p D0,$R0,4$4(D 0@$4(D0,4e -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00e\ -LP l0 P 0R 0R Q0$4(D0,4e 0-PL@T 4 w 04P X00S Cpq 0hH0 0@ p0e\p$ 0 010#Q0S4:Ss0p 0 00  p-L 000 x 0Pd `P @ r 0 04 (0$ , `\e`d00 , (0$0 0 0 gegggg0 0 0 ggge -LMp@P `@_00C0 S%"0 .S0K0 $ K Ke p-RL@Py0` 1TUp -LM`p$ @PL0 `pe -L|@||PM$pK(`K  (0S0C(0 0$ 0b0 0R 0 000 Kgggge -LMP@p`z1   e0` p-L@LMPK@%e1`@@00S xe -LMAP@܀,pK(`K, 0(  R,00'$ (000 0S( ,0S(00$D@(`K,PK 0S#@0 S$KggH -H0L0S00@@Y$ 0@00eggg -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 %00S C$KgegggH 0-P0@LT0 0S0 <@/800 0P0s300geg -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  KgeHgg p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S "000 0SKpggH - 0L00S Lg p-PL`@/0 Rmpl00 AP@*D0P0A0Q: gpeg p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphpPgggeg -LMP.|||p`,K  ,P }@T!,0PT@:0S0 0 0 0SPgg0PPg -0LMK0 6" Kl -L#P x0pq  T0 hH00S <@ *.0Sjp.0SPKw!>P J P L>| PQ p>0S ] P =D>m PB 8^0S @T$@%PT 0S:uP>0S 0S,>(0P 5;:>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WK+P@ @K0@0SP +aGQ0+x;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSX\0L$d<84,<HTxx8d 0IRQ|80S0S L80S8  2RQ80S0Sf +0S0S0@W70S 0S0S@7U  W 0S0S0@9 A 0S0S0@)60S'0S!#0S 0S0S0@0S0SP60S6 (-6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ )7# k0S0S0@!0S0@40S0dSd0@h4\4 EQP < :{0S0@(4 P /,mQ"8 8K%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02PE'0S0S0@TP P #P %/ 0S0S210S0S0@%P 0S0S1x18K80 b0S0S0@Pdzw0@) P P k h00 1! j X0H0p0PN 00PJ 00 PPE PC MAgggg\glФԤggW̊\x 08H\gxlt,Hth Њgg0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 J!0SY,00"000SP -LMS0P`p(p (K0`!00 40 0@80 < L0 40P00S T AQ;0 S06S0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(K -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0h 0d -1LM 1P0@,0 3 00P/ 00P`+ P=pKDKUB@@P P`  0@Sd`dV000E@PE U@DDP ` ,0 S5(K,hp 0-LM@PK SP8!P  0S CP 88 -LM@R,  P @- R P`Pp 4'Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00謥 - LPhsd - LPhchإ -L hl, -Luph~ 0-L MP0S$ @K 0s0s o%dP@T L0aH0 00(0 0 0 K0g`dPY -@LPQ -LMB0PP 0S U #0,K0 K00 `P@@p00SJ<P420,0 A P8  8K8RW 0 JO FDZ f >P, 8 8K|10SP ,!P P8K8` XyPYP ,YZ$1 v10 @p 1 P0 , KP 0 0 0P@ P0 0R0 0Ul00S(8K8` Q(K̦Ȋg`dl 0-LP@A@P gP0h#0 -`LP`pW,1`V@ZP PT 0  0  0   0  0   p-L@P`P U  P V  P php -L@h P-L 0h -00L P  h$̦\ -L@)% 0r/S@ R -LpMK@XPHK 0QAK -L 0PP` - 1LBM0P$0 P2  04Apq) IOK,ԛ봀P`JK(A  w0S PP  m(1S*+ P VP`(1S:V $0 S{ Kh܊| -HHaLp@P#R %RT0TS 0S %R #RP I$PP@ R묐0ਠ`P@#R %RU0US 0S %R #R P ! dm$@ P R  0-D@L0PS0P(000P0<dt -L M`4, A$@pP@0S 0S P W @P RX Y" $@XP@ d \00T @ P  d,M@000S0(KXY -LM@pP 0S `PKhB#@#@@ZL0H P`W +@K踛\\ -(1LMP, UARɈCpP; #@#@,#&@`PZ0%S00sSZ,   #,#P@00@#T:@~T o艈 -2LM0S4 8 2@TytPP 0|S0P0@ 00 0-SP <P N#@K# @p`Y0%S 00sS  A3#@`00@*#T:+P%UV 00S h10S@  @)K P  B)[!80P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R\ @"p@`00߇0Sp(K贊̦ -L@"8 0 pS` R0S000S"`PUP@000S 00XY 0-LpMKPpP@|0: S@@zK0 p-LpM0`0SP f"@ P KEPPl00S0: S G"*@ P, GP9KpȊ,<00S,0P 00S00C@'00S| 0S00\p -Lp@P`WV 000CW`K@tPuZ X`!pWZVX (00S m`  -LMp`;p@P qV 1i 0 0-t0L0Spq p@Pq0T0U0000\ -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW dUV EUV>P@ 1P 0r@1@T@ ZZP`!hpP`qXp4q2P P AP!T 0 0S0uv 0 0S 0S0x  p 00pWZYT+00 oe 00SuDpl -LMp`P P @0P9  Ki$p@P(q&V 0AP 00S P@P  0p@Pq Kif 0 K\0PPH0PPH< P000S SP000S0H0pP0000000   -0L`Pp@P `VV'(` W  00P`p0@ 0 @ `000pW 000Hp 0-@PL tP 0T T00 00C0 R( 00C00h0Hp p-L@Pq P`pap P P@P40`0pT@Pp P P00 ( -LMpXtWr`#0S GPHC0S <#0 QPW 0u@P9P B0S @ T T "06 P P p/ `B0* Pn 000 ,0 pd0 , 0KP0K0PK`p@ !0040  6` P P=ڄA0S9x!0S5@3 00< 80  @P(!0S!0S4@ 1@M P `l 0P`@DTʵ0@0Y@XW40Kd@Pp6T00S 000K@P*(KtԊt -LMpwx 0S [P#0S t3tC 00S@_ 0SP0p , @P0p P"0 K  00 ,0 80K0K40@K00  i @0P`Pڲɯ`V* @T PXW5p@q P P`pR0gt T"@[TP`80S4!P00PUo-J  ) TPPx1@Tl0ST!0; Pp@@.41P`@ ' P?P`@"0K@PpA00S  000K@P*00SZ 0 P` D@v P P pD(Ko(Kt\Ԋt -L MP`, |P,0@cT  D dq_@P X(Ko pw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (KoO@00CT h00S ND0@@$0 0@@(K̦ph̊ p-L`@PP h P p @P$00S ph̊ -L`ppq|5,p@PqTh? 0dUT0 h x -L MKaK  K p-LP ph OP`pqP0  Bph4@  B@PQ php( -LM`pp@Pq ,P |00Sh0 W V @Pq,0 $K!K̊xDhP\0 0TSP0 H0 D0 @0 <0 80 40 00 00ᘊhgggg gh000 @00d00S X00S P~0 @P 00 000000g0 0 gg -p堀0L@PP `P PN ` `P`@t Q-L?P=0@lP60 `Cp PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@Pt p-Lpq0 !PP-p@) 崠`t T 0 l@P00CV]P a@P@P0@`@40W 00 X`@Pt -L0<0  000 $00 00 8 L( -Lp0<0  000 $00 00 D $@ Pp-LP@1 00S PP@&` Rڔ@00SGP 00S@@2P @0 R 4000S/P@pPg P-L0LPh P-L@ P0;Ph M-LMP0X20 p@ 0(KP U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4``P00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  K܊ggHt -LM0@`p P@D\0@@0@T 7P \ 0  gTH -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ !@ p,0 0l0 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `K`` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(KghggPgxH ܊ -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP PpP3V!p0x!0S0Wp!0d!ӷ0P#D! 0P(!09!P0W!0P P  P0W !P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (Khgg܊g -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3hhPgtHgg0g -82L M ,2R0P$0 `pzp20S' 11 001st TS !0S0S1 @01 00 h1  H10S D1XaL18Q @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 h8h< Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@YPE(`@0 $0`p9pq7  0@P Y0$X!6P"`@0 0`ppq 0@P U0T 0/`ph$$0S0  00ꤊ̧h 0-T@L0S0dS0 PP(000P000@D -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0c0@P3pqI  0 W0V  0U5T30@. fP'0帠@00@P Jpq R 0 U0T 0 Z 褊hD@ -L@Pv`p@Pt 0u 0 X00S L0XR@P*TU0@0 50SX, -50 S  RXa0@ S-00LA0@S0H{~ 0-L MPP @K 0 000K0 'Pp-L7 $P'.P ^P"L1L!@00 0%BP 1 !1L0 0 0  P- 0s0sph<0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 P phpH(Lx -L M@K0s0s ?00@3KX -,0L R000@Bx -,0L R000H@B0P 00P P 0 $ -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0  KYX8\ -1LM0P@ 0 ) T TVxQ@p `M "00C0 S10R!@>0,STT911 0b 00@0PK  0Sp` Tż 1` A @0T@Kap 5 @KH0`0P , LK@  0 S0[Khxh8gFt -@PL ThL0 Dj@h<f8d4b0`,^hĨ8pP P P0ꠊ 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@7808 0K10 K0 Ě P-L (0 00Sh8 -D1L$M0P0 4 " P P>04K.S( K 040 (0S0-(0S $0 0 00S000K$@K T @P0t @0S  K0 P C0K$0K00 7 0 S,tKhة -D1L$M0P0 4 " P P>04K.S( K 040 (0S0-(0S $0 0 00S000K$@K  o@P0t @0S  K0 P C0K$0K00  0 S,Kh $<xPtQ PPP0SP 0 x 0P܄$0$0S0S -LMK  K蜪 -Q0LM00SK0 d K踪 -Lp@PQ000C S @ h,,@0`0 C0 ST ;@DT  0@TU0 `0 p-L`P@0-S000C S ph!!00 C0 ST00^ap -LM 0R0*, , 0*  Ԫܪ -0Lhf܄ -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i  fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KP$0S090S V0V 0U @00SSS 0010,K0,0 lV 0 \0   000CS889099999 K0\h -`LPp&P`$T X aP$T T T-T00@f- GL 00P@T -LJ@0  ҄ -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 1[X!0Sn`z`@YPPT 4@ ,p 000CS9==\>(>\>\>\>=X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(K܄< S 0 Q $ 0S C   -LEP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TR贫DЊī -p@!`PLaPQ Y 0T 0O -LM d 0 K p-LMP`d@ 002 0@?Kp'@B -LMpTq;`6@3@@0 P`ě -LMK| -锠PLp` 0@SP0000ScTq0Sq0#S \ -L P P Pp hf -0LM0o$0 0@p@`%0K%PK   000e' @PV-00e   $0 S | Kh -LPMU@( p@tPp0)0K)`K 0V00 f0@PW-00f  (0 S G$Kh -LPMU@( p@tPp0)0K)`K 0!00 fO0@PW-00f  (0 S $KhĠ -\0\0L@S L0 PKP p 0 0 贚h 0-L L0PS00C0@00 R+0 P00 0߈ -L@0@S -1LM0pP`9K$0 +%P0 p`$ pnR sR dR @@`PP   0 `P $0 S  Kh̠ 0-0L0PS@ t00S P0@0S @00S w$00S0 O0Hh 0-L@P>u9 0 0脚 p-0L0 S P` 00S 00S[ 0@@Xt0P0S h00S ph&X?P0 @@@]c?400T,0 ph@(Hh -0LM0  l0 `0Pp `K  0T0P @Php3 -LMP @`  \Q  0R QW@X@T11: \ 40KRp3Q 4 ,0 0 0 00S0!P$K -@LP300 -0LM0@SpP  / 0P@" @h1`P 4@P2@@U耊p p p @00C000C 000C?0010@-<0  00@P4 p 0q-  + YQ 0%P#uyp@q 0Q 0r S 000 P P808 PHZ0P:j謉ț`W(0$0 0b0c0AVH@(Ě -p0p 0LS@ 0@s@3dH0H0@0<0 80b0cA6$0  H@(0&꼚 -XLyP@LuDr<o804k00,g(0謡 ,HĚ@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3蘊 (ܚ 0-L@P<0  0S0S0 R0Ț -0L  0S;p3 -L h؉-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R  00 0- LP@ R  0@ 0贉Țܚ -@LP00h$00S0 0  ȉĉ̉ -@Q 1LMPp@  PP0T0 B`Kp@&P@ Bp 000  0S : L0R  @00S 00 0 0 ̉ȉĉ 0-@LPT 0S$  0 0؉h -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d PP(K̉ܚ -L@MP`X T0 @P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K! p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH H@ L eH@D ,LD 00K@P  AP 8K00L 4@K @WP ` p\XPB H008KL 4@K@ ;P3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @L%D#QP 0 `LD@@(Kĉ܊؉Ț̉ -L4MP43@(3$H D @ < PP Z 08 40 `8 4 y8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K贉̉t -LLMvwJ 010 @0R0 , (Kod00S )[~p@Pq v, R00Sp q Q0P 00 -8 00CXZ (Ko(K (p -0L0@SPTpW"0000S ` p-@tPq %yl`00CV0pp 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S00|2 \ PTB0S v@2 V0S ;P `@P/Gp@Pq?@P"10S  S 1```/V@P 0@PLa0Z u@Pt u Z Jj@Ptu t,@ (P u(_$,K  0pP h00S00X0S  D0,K  $0P$K̉4xT -L 0 0S0 h -<L>P(h 00s030h̉ 0      ̉؉ 000 000 000 -LM0 $ KK0 0 P$ K -@PL \TL hoop -1LX@ @@ Io */g0  @`Pp 0S0S 0` 0?0080  000S iTohH -LMLp`KP p@P90[SPKT[ - L P00A -0L 券Ʌ|H -LMP@P 0S 0S1 S K R3 P 0B?SP (KP (0Sp`$K $0(RpQ |P` WQP00 -L 0KM#+V -L(M< @ 0<[ ,0 `pZP<@@PP 00@P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00 P8S0 00CS00S 00=@P333L000<(#0S 0@Sv #0Pd00< `Sx2 ` R p @  0SO ,K04 ך@T# >\24P"L"l2 0  H"<0P P R0%SQ0Ƕ  001 `80S1 RE ¶STh4 ,0K@h堶b0 , 4"4@ 000 00D(K@P 0 4t#d3:<@PLP`D_ @2@ Tp -@LMh &>oo`p20p0`W` K -LM @`, p` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@)t K@PLL 00npK`2@PΌ  0`0Vp, 0R(K'zh -P8&> Y0L\"]280` R0<2<… 0S20@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2 g0bTX2i=ST0S0@2U D _R 0S2! 0 l0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c @@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PDJ^00e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00@P 0y@<P  0, D 800$7](K XX(KoX$ X M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   PPX( -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P` o -L MX`Hp  p\`W` 2QPY.EEwOE B1 @@P@k\^WP, pH?`W` K` 0-LM PP | p0R dKfFp PY@P D0D 09Y' 8pt -LM040K00 \,K0 @夦,P\`  \(K0pP 0 厦,Q 0 [x "10 0 d[ @T1"0 0 0@1!T$[X -LQ @ [ Q8 -@L  &> 8WUD -L4M0t(K(0 [(0`S $pK0 p$$@\P  [ KW0( p $0`Sp ( r[P# 2pL`K2A@ @N P0LK000 F[X|\ -L@w -L!M(1`"( S92RS]2S\@EGP KP[/0p % 00`( 0R $KV@0[%U@vh$d 0-PL@WZ08 -L MP$K@p`0 V$0S  Z K"100!aRRl@0S`VX4VLZDZ@_ ?0Z||pD -L M`(K@0 (PpU  `xZ$K A2@ @ 1P| p-`L|P @ ;`P 4 8$0 $0p4 @`4 |4 't4 $ h4!d00 X4 P$0@D>P 08P01P ;4 3`0 pSp@HLD 3@=pP3H0c4 n@<0T4\2P)`hp墜@P 0 S 00K"P 0S0#3 5QPP  A!᯲/PU@ @R@X00SX00SL0  'H10S$"0000S "0000S 10S($B$uRp 2p` !0QP 0B`1 P !<t!Anp`d0W810S`RX 00S00S0  XDp30P @P P5PHx@u3q|ГܓD( L ԓHd̓ؓx\ȓ 00 0ထ0P$ 00C0 R0 ထV -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphp耑-0 CR 0R0 S@00 -h1L0`SPp@D@<10S T (10S ?T@00S T 00S?T@T 00Sp`?Wc80 9400S h  h?ؓF̓ -LP  -LZP # -L/P Px -L 30S: S0S6R) 20SQ b 0R20SR $Ol2 2R P"7l2DR 0R08 KPK: @2b PKR8 K-z00C020S 0S0`KX Z\ 0S00R0S QPK000`` ``` `P 0S!0S @10S5\10S d10S\@>S T`;S`08q@S@`P0SU N$a`00S0P0S NT 00S0S0Sp0X00s03Q0S 00S   S\00S50`(K\\ēH̢ԓؓPtd 0-L CPP@ 3S S S @ġ 0DzH@B PM0S 0ě -L 0onH -L 0KM#+㋮ p-PPL `P @Pp.!P 00P @T P P H0 ՕP @T ͕P.p p-`PL& 0S# nS$ 0 @@,P0PP@`00@,ѫPp40oS0 ` - 0-t0L0PS Q @Q  JP,0 r300 R00蘠 -LMp,K0 .MP1 -@,PW T^$ W@` ራP00S | , 0` wP00S | , 0(KzR( -LKMMMK@D@D0,0 `SKKP@AAPP`pP4: S  S 0<L KPP L KP_ @LKbP, 0R(KLK 㲔`Pd 2 RrbPq|LK 㢔0p03Q0S 0W $0PE% h, -LM@08K0YP@`AK:XP0: S VPP SV H`@XP$KP U @`0 R000]K@XP l1: S 8I((dEI긠8\\\ --LM0 0 deH -LM @Tp`P0S  0P P 000̠ -L,MD H &L0 0@  0 40 eP @@Pl HP W@ `0YX 4\{ V 4 Rb08  C@Vp<@ 0S00C S000C S BV0VPpU @ ᄌP0S PUYP:0 0 %0 00 ğP0P00 @TT@TQ ŢP3E@PX! 4  Y4 @0T l`VR h I @T PI@T +`V$`>SVXg 0 0(K4 Hk 妗00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yt2 0`@H, ^^  0(4Pp'%#0\/ @T3 0Q  0ݖ P 0Ж@TRf LEPa 0 ||s20 F0 80ȠXlH̠WP@H8,L -OMLM00$0 P坖EOKp(QnK`F ٿ@ dpc@T:+VPPD@K* $ghPH(] P-L <@< 8S ,,Oc0 H|Hh p-0LPP` @`P GP"H`Pp -LM0@0cSz bSz6 PK 2 0`S R  2 0 S PU 40!Vā,((0 "4^ LD 3P , -LP@@<1<媠Ppp`!-p mP \ -p0 !0@S( W VCW# _b0 `P  jP P 10 pRpp8t$XbW|Lh(T @-PR0 00@ R! 0b<,4$<, 4,$. !,00 0 0@SQ:00a0P<# P8#,8# P4("$$# 4S   8#8S ,8#  <4<("4  8,#44 -0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S8P8@<840,($ W|$, p-@L M0KP`  @:0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0 0 (ܞ0 -L M A`+QO||||||0  Qp &0S 00000@0 KP 踏 0SKt XX0  QPp <04  Q   묛Ԟp Dp -L,M$K@0 脏$P儀U`pDK( K,0K@@ 4@ 0` , PD  0aP0,<S*0 CR )00 \ 0 CR 00 \0S + \0 R \++0R P+>h+0R>h+ -pQL@ᬡ0S:`00CS`0YX0  X0xmp`@``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ l+P`U ( y@0S0C000@` VP  X U0 K+X ^+X Z+d$  p-LPL`@LDL@0  0F@$  phpԢt -LM`@ .@Q |o*Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R p?T dB0P0 L?PW 0yZ  $?X v ?Y @ l  ? @ ??!p ", R ?0;(?00 L 4?8@T700 L T?P1 R) 0 4?0! C$1 R)`00CS`0'X0  X00Sd0S`b o) )<o 㯂@`8@ U?H o8*X oK*ܞd,Th|$@ -L M0B0r0 S P Q ) 0RuK0AS??0 0CS  $1? >QN QO > ! l> 0 X>PL!0S 8`V;0 40 L @L@(`@>{0@K>(P >> >xx s x>p>hWZ``8`갛h,x8DPd -LM0@0 4 80 9xu/-aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@0S4$0 <400S0C0PP  0@Sß0 30S0C0PP  0@S0 30S0C0PP  0@SD#0 X30LS0C0PP  0@SŸ0  30S0C0PP  0@S}0  20S0C0PP  0@SmT"0  t20hS0C0PP  r0@S@g@02 R (K0@gS@ X1 RQ PR,0SlA/WLP 0SL 0R!0S|B  * ( <JA0FQ$Ba>q :6}20S,  p 0d0,   00 R==t HLܞ̜\<(ОP̞ (4<DXt -7LM@ T0 P`0gS 7#wHQpK >K0C0C@ @p> 1 R1 1R wfV`9 8  0@pVnK`F`F+(Ip@S50S pD}$ K@ @g H4:02(/h̞؞ОL8p'Xt -4L0M@PT`t4 pPEU50-S,@P3`2`2333`2`23`2`2`2`2`2p3`2`2`2`2`2`2`2`2`2h2 PU  ,K@?0o, RPEUp|3PLK 00K@L H@ 4 DP @P < 8P PPP0P P0SY Y *0 @P0 0S! @U (K2! 2 2 2 PU} yP d=0SP P20S 82  Q 0QX 0SW 0S0S 1 R00P001 001`PXP00P0 1 R0SF0 `> \E90S0C00:9,4k40 Rt (9oP) 00KLK PPqP00P\ K0-V d`9X8P L먛̞Lhx О ,hPx -PLM`P/ڗt3h#p1 T0@"S"8X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7p8X7X7X7X7X7X7X7X7X7`8X7X7P8X7X7@8X7`72 "Pp2嘢p2AP PP@g3 Pn T2 RoF <2p ,2 R!  1pv1 1 1 1 1`1 0E2SN999999999999x99999999999999999999999999999999999999900"TsT|0TTDZ T>@@pT<L4̞؞8dО(<t$0 R P"!P d0@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0LLPT;L;D;4;<; x-^𝔰1S00CS<<;;;;;;;;;;d<@<<;<<P01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $ |\̦ -LQ 0S 0S S hGh 0 \ -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@^P;0!`, 0R9(KP` P` P` P`P` P` P`P P P `4 ` Rhd\(  p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,8i0Kp <4("4!\P@ 00@U 6T!P`UU U&Ƞ& &< PP{&Ƞ &<t hPq&<X HPj&Ƞ& @&<, P@ P\d\ -LM@0DSxC<0 0XS0[  s( <24Q<a20S;00`  B LR` BX0X00K @ @1<1 R 4Q  10S `00CS`0,X0  X04P {P `10S 00 L y0 R00p0R PTX g@bMh`<pHPd̦l \d@ -RL(M0@``PD0  0CDK(K, @ 40 0 <  08P @@P}(Pj (pPz  0@@Pt(0`,W*@0@V0SU0 0 R0@VJUU@@BP 0@ 8 DP < 0@ 4@ @@p2 (P- P? p 0 @@p2 (0`,W*0PS@ 0PS r01@V t,UU@@ $K,0*S D<( | r |0000 W0700c00B02p  4000 W0700c00B -- LM 0P ^ KP 0v3 -0PLM 0 -dL @tP H tP 4 tP  ^P -pPLo$`P 0@0P p+R %R0s 0D 00s 0D jP P@ Rd  0-@LtP 0000 h͉P%T r 8000D p 0D00-0 CR 0R0 S 00 -l?LM`ϟ`?, 0\1 0  P`1 vz P" ,s ( fsP2@p  ]sP@p  TsP"@p`r ,"/cP 0S U Y T p 0  S2  0S` UT0 PB B U0P/SXQ X X1S X10ST    0&P00S2 s z\ \1S|-\P rP\1p \4 rP\1p 0 P " " W 0S  }0\/S/00LP 0S00@@P2 0S/ PP:ֈP  0S h R o*PL   "*0p  @00\:Ⳉ*  0@Sp "" V ` `At /P02 2`Kp0@s?K\,<@T X,d d1S X /B <0S; =d 0h1 l1 P h1Sh$l1S l [0h1 @0p@ dP  0L`l :R0@dp@X U/lwP t1P0`t1 t!R 0S *0S ʟ0S#d#e0`0S0S*}*`L=P t l:0S/ 90S+9R&Q$90OTS 90S9#*9#*|90S|9 h9 X9>tAT X.g)090SHhtPQ0[S ]0P 0 :SSp`  :0@P00 eK7T01 01 7e_KUoK 0ʩpp70X L@K \'P0b 0ṩP  (R TQ0SoK`1 B 00   0P,ǟ0S' ||` `1s# ` =P(0S (`1@(X0@`1  00L@K00@ 0RP PUTo`1S ?.0`6 0S|6 ;|lP`@'P@PUPp@P\e"P00  0˿@PUPP\AT 50S5\!|"R ğğ$ 0kEğğ$ 0a;ğ$ 0Y:㵆P wPPT %㫆P@8$0E#0=X 壆P0#2ß3#+X40SD4  P p@-P " ]/K%P K0Bt1 t!R  00 S S  ZP PNK K> Dwp1SPKPP 2P "0 S00`ڌ`匸"0@K]/KP 80Bt1 t!R  00S S S  oPP@oPP0 vp1"S V  oPP2| @YPh v@PT #ۅ1PP0S10 z\ ᪈`1s`X! $P ThX (Hl=8wP$FěxdptW $T@`x:3PX<\|T|wd~DPp\phl00  S X d d1S X},|00S0:d 0h1 l1 P h1Shl1S lP0h1 @0 a@ 吷 CP T0dt1 LpǏl B:"b0@Pt d p@X',lPP `P`U"0S 0S  0S#7#8P"0pÏ0S0S*Ot1Sl20S/ 20S+2R&Q$20OTS 20S2#3#(30S(3 <3 L3tQ p+.3qr t1S0S0S 30S 3y30Sh3P Q0P2 2 IP\ C `1s ``'2 P巶\嵶島屶4, 0ReF(K -ML MP70\ ,0 004 ` d$ 4@P (70S04 PL  0 S L$ PH  0SH 6C.K0 BX4 B>K0C B0Ch$ l4 04`:P 04`$t0PT4 H D mP T0 mP  Ɵ0THd$0FpZWT m@PL$R Td$6pGT4/p̓:`Ƀ@@ŃPT/ T-*P0#03V0S& L@ ᲃP@@ᭃPTT*XW T$0S04`~{ pP  P$ 0[S]㉃P P0#03V0S @T 0:S(0p0@T! :p/Pl0U0PU P:S V  R0305P1 :T:WTt`PP PW 0S V @@V 0S /N,P@@@`@,30SD3 0UD4 @t <$  0S#d3 TP1 \3 RR5V*U(4TV 0V04V0S$30S0S U UR"2 t0SU 00D Sp2l 000C00WH2 0BSpRdppU00W0S 00D SW T)T0000p 0"pQ045@404 5dW(TpU-T4$R4$1 4$ @4V`X@4p, P@?d!0SS5V4VP10SP0,S O {1圢ZD4BK c R+# A4Q 84@T S8D 8D1V0   h 0 TR 00S <0YY 0F ,0 SX A(Kh}<xLPxx p-`2LBM T2R00 0  @P 4020S(2   yy`AK@0@!P蔷10S1013AKAA 0rP%A s10S10x130l1Q K,  @10S040381K $ BK@@!P%00S0  N 04S 0K0 ANK@DP@D0S0$03+3P+PT00S$ " 0 SH[@Kpxhx8w@<' 0-PL@Qx000S\P@ TOs勡< 0 000T@0x - 0L0S g0舤 0-PPP0 L@L  \0S 0  0蔤x 0-PPL0S @@P g0 0cS0h~g0舤 --LMP@p0T0`0 P !d0 @ 0 嬿trh0 `}p3l0PSTEKxxL}p p-DL0 M0 4 0 8 0 }}P$@ 3#3Q0$0 3@T 30S 30S@@S0SP 3r5t30S \3dwr+T3 0S44rP(PP7c008 0 bP@  00 0 $4 NP`B000<24 \80P r}82 0|P 20S 20S Q0S  @T$4 PO 1Qp30S @T $4 pP 0S5 2PA0S81p30S 10S10 110,K , 2KP#00S0  m a_00Snl00SD0  2Kpxdl8<}|<'8 -LM<0 ,0 R0l1 0S 00SS   -K ⤜  ! <P x̟ p Vd̟PX G#0S S A)0<0S $<0SL0P 0O  P00CS; ;qQ ; 1S. 7{ q  1˟ 00CS|;| q^ h   P P@T +{&0˟ 00  ;P {PP3`V ? 0B S@@R@T 4KoKbK aKr/Kq?K (PF ἴ1[![[8[<04,([[ $#, `Q{PP9 0B S@@R@T 9`pGpWq  W:rKqKKoK ^KbK aK.K]?K P t p1S[t1SXx1SU j1[![[8[<04,([[  $#,00 rKqKKoK nKmKKkKjK iK$K(gK,fK0eK4K8cK<^K@bKD<aKH.K]?KH厭P (7=pp1St1Sx1S  [q[Q[ [[[A[a[q 1[![[q[X \Hhq q[1Ll[吡[@!D` dP,xq (⠁[,$<q[ 8T,4 ǟq &< q[., 01(*t$% 0 pNdz@PpXA 00CSL K LaK`1PP L6o.1[![R~[Q}1[S t 6  Ƞ,Ƞ0 4,400S 5@T tu@ş 00 "|!`'U  GP0S)l  [?KP,c!HK` ğt\|ğpd$ SXtPLD!V 0㠔0ğ0S |[?KPl40S S l  [?KP  #l ) [?KP !\C`S KP0_/K|1 3P P h3PU qG[\ \'Ē0S" Ÿ0S000 G[Z_K\ hKH[HK <@@P  h0KPP 8000S S E!0 qx@p@,28  @P` p , 00l40d10@00   @P` p$(< ! DPp0s`00 P+VD000Sl  [?K PU `x@0V0  0 L ! V ,0 S3;(Kh\tt 4<dl(tPd@xLL `^(@ -LM|Ο0 ?`ppΟ00 ϟ>@P00LΟ@P 0 , 00 (8 X` Tp L xPD D0S = 0RS 0S  R00-S 8> m0S> m=0S D0S  `= 04 S< 0@ D00S0H0 0 PMY0SMP00<0S<,80S8'<=P`P0=`*0<0  8 R|axPQ 00|SM cP>0S 0 S ( `<8< /A!@P000T  T =T/00P;0S0 S8P;0S 0 S \;0S  0S DQ,;0S  ;;0S j:P 9P.D0S :0 PcPU   PP| ]0 00S `V%(wPL:,0 :`) 00|S o@ i, ,0S  ,*P0S00:P9 Id, ,0S9t 40 90S,0,,KP0S;0 `i0 SPIة勯P0P0( P0: S 0)0S00 9  X80S O0CSL8H0S 80S,0,,\80Q (`40 S8P x8P00pxP0JSP0S,0,v,' p@0 S YPdU<W0/S' g0S 70S0S#J&0XKPo@0X0 T@ 0XKS#0S*X0S000.,f6 ,`PYPPv000 D 60S3 60S 60S+6R&Q$50OTS 60S86#$6#50S6 5 5V ` V kg%0@U{ Yrt\u0E 0S , *ePP@",Sp50S,00#30#,p3P 00 P@T@, eP0S @f040PS4`P4` 40,X TL00L0 Q N0SH#t喙X0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0 P@H0S 0S,00#3 ,IPP)0S, , 2T t T 0S,,"0@R刂尢`p0p@`20S000@0P ,20S,00@,P  L0S BL jj10S. 10S <10S&XK0S0S *h10S1#p1#410SP1 <1 ,1ۘ00S000#3 0PP 0 S j. 0@00S3,00#32X\xx|d~̦@8d\$hdPxP܋4tp,lPP @kj \m40PSl0`Pt0`40,<8@0S@ 0w0RnD0Sk RQg10S` 4 (1R\ pP V ^0` P0`K\0 pKt1PK@PH7 0i?@0 S1P 1P@ fc10S1<  #Q01@P@@40S ,0S40,00S0cwH"0S0S<481(K -4LM0P,0 l4pP` _OKT~ z@4|  U?Kx t pQ 取p!LPKWtP RtP#LK 0HtP#LK P0L0[S LK_/KU?KkP p / ld3 T1P`Q,,84,#,3TQ(SK ET10S  < P,0S2 i`P( P[0S* 0S 0S  <PD,q<@@< @`PUV1 T [\q 0TX1 @[V/KTA PB0S P  >KhPhdrw\A\mw0LQS P8^ 00S 00 hLPPLvP Hv W?K\ ,4p0X0  ,0 Sl5(Kh@ `FhpělLxptd \<x  -,0ML  0Lh5|H 0-LPn10S 0P 00SY(@Eu00@P;K000 t00S h0P \00S6(D@"u00$0 (0  LP0lxt -L"& -AMLMP64 H&H6H D&D6, ါ4&P 0S606+ 66PP6vP5eP5P55P5PPZ@P 0S rPP rP rPP ~rPPPlJh5htrP,5  P/L%P 0S450T0S 50@T ,@@P 0S PrP KrP Fr@p@3@40S'4PD4  40S4p4q'PB^KPEXt\D\PPE`TfP3  g\F E\@ 6\1 4\+A\/ C\a\/ P\f V\~c0LS~~o\E k\, i\u%m\6 n\p6s\n p\F r\hLt\\ v\c]  @3 ]"00"P$3 2 "0G|2 1 Pb0$2R0<P2 ,2 `0S`0p/ qp3|2P00$1 1 11 Pb0$ 2R  Y"00 `1A4 !p\1P1 14 1e14 P qPΡP BNK@D@D+\1@L44S 1@P 4 P3 ,0 SG3(Kh h$` |W\8@H(|L̦Hhx(@- @@00S0T0Sxxpl`P QR0ҷ0δ 0\0R0SQ  l p-0LlM`K  0$SP$$S \S0 0\@Q K1PL!l00l00S T K1$HS 0S Q 0S0K!0l0#00[Q \Q $Q~0S0 0$SO @K10B00B SG0R 0 CQ 0Ll0ST H$ 00BQ >\R( $R"00A S0Q0  CQ 010AK!l0SH$  00BQ T   @R@,RR ]RR @\S0S0S ]S012e<0,S ]S& L 00B S0R0  CQ 010B@K!l0SH$ 00BQ QP< 0S`0S0S2KplT -L@Pt00}S h00S`0`dTP40 @0R80 P$0  & 0-@PL0S 0@0PWr 0  0lxpt -Lt0t0S 00CS0 0  0  0Œ0  H -AMLM! P, 84 0P0044 @0P04 1  \ Zp8 10S) 10 R`1BK0L`Lr 0 r 0 R0 @R 00S" /04 44R Q00s384t 0@Y 3T00S  ,0 S00(KhTx0 -AMLML1@ @1BK81@@ @@, 0$ 8 4$ P  V< B^KPEp`䐟䠟䀟PE0S0 0S P c 0CKS 0 0A 4D ,t0@ P@P<% 0, 0R0@8|0(KhH08- 0 @ 0^ 0ꀤ0 0-0P0@@ TLP Q0T 0S`0hTL 0S <`0\P 0@0P04Xd Pp-LP$A /cQ!a)c P0P*cP@ ʼ0 c mP @0S0 c 0 p R 0S ph P <h~0D 0@ 0plWx8|Xd 00x -0LMK   0 0  K -LMd0@0\S0"H Kfp 1[4 SP00 0P @Kht@ -3LM 30 ,0 K" `Q0=iBb@B mB@Pႄ 2呉 0zŸ 0j+PtR@ P@ݾ 0zSVW@" <"<2Q0P$$R@R@  0^0!Kdp0SK 1WXVV  0}POژ1QK1 @PUETBP@P᏾ 0, 0' 0\`}pK;KP@Ꭸ<`ከ<lPEd@d0 婥00S0P "P@K UP ,0 ST.(Kh.Ap?W_X@0A\ @ -$7LM0pD ,0  G&6&K60S 6`V66 < 8"  d <2d 8B 0!੷|&D D?~dSpdpRq@ P 8]06$60S6PU ᠪ P@ş` @Pşş!`@`0K%0 p0K%0 50``VdէOKPxxşXşea0\%pL _K`%5;FEpP`V0U0WXOKP$0 \ Ba$@PȤt4 b0h$^8B0=ɌBJB ͌BS00` EB?T * 9 9P@@Z Thh|8W$~@p`T -L+ 0;'H -GML1M a |!@0P$4 X!Ep oP9 4!<p 0bSQ`A~K pG0pG4 P3 $$004 4 =K 0C0C P"zP -P P pWZ0$t A.Kh0 B B\T0$8M' ,Ih,Ԭ$Բ ( H -LM@pP4  PP 0S nS6 =d`P00QD @ Q? uNP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00,K   0   S _2 0   v>  0   SJ2 0   v>  0   hS`S(KoցLp`(K[| $8` -LMA0S  嵁)K0P ` @00S p00 00P9@T00P0l@叁l00S0@ c@ 00z4PU2 2040w1 @441a 1P40Se@ 4?40S p1 40 0S00`400K r410SS 1 0R00,0 0 0/0K000KC<2K0S00040 00S2 W("(04"40ࣰ40,@c [@04 48#8x0K 4 <0` 4040@  0 S8%Khd!"| "| 0-PL0 <0(00AT 0@L@00, 00000040 000h8d M-Lt0 RR R RPDKh10@ 00 00KhK," p-PL@0S ,0` 00phꌔ(0z8@00 0 00 04`ph8d -1LM0P P 0P00Q 0S@0~ 0P 00 000|0}00 0 0 H0 0@ c 00dhrL"T"d"\""H!tdl" -L]@1p0PW@p "UPUaW0P 00i41PSЀ0p = 00000}=00 0 ', 00ip`@00 00 00 04P <0(0id8 M-LM1P!1QPja10+1S|Kh/0 S@H` RCPG @T0P`PKh0pS,00,00_΁ 0 P0@ 0 P P 0000`  R`  0S`L00UKh54KhK""""d M-LM100SS S Sl0>PKhA0e0@Pl10 P0 0S100 0;S<000@2S t0?0000@2S f 0S  B!  0  0000 0S100 0000 0S100 00 00 0S1 0KhTK"d -0L L2|H" -4LM @ 91`ltlPlP cP dPqP` uP 0$$P0$0 4#p3P0eS\㻍CPN 峍3PF 嫍3P> \0S0x0t#pl. Vd3  \C*PTA os000`0(3C, PXPPPU  \L0˸z00PUŜʴHb\r@0Ph.T0 U\JLX ?L2pD8 <"`P4 4KPp$ 044LA02" "pP uC1P 2 Ap (0K* # 墯pt l嘯pd `pX  ჱp@  p,  %pz l@'▱0T0S P0 002(K|(h $0 #|# #,0#@#H#`#(ldl#H|# #<,###<#[#4#$4$@$8H$T$J -@3LM0,0 @~KpG pG+ p@P`0S P( K0U~8[S}8[ 0CS񟗠'())2 05R P PXBu T0@0 P@<@ @@K0PwR00S 0Pf0` P@ 0zPUPUDl1 05RK PEL10SA 0Y8A)<a P5R60A 0T 0CS00S* +T0T0S# 0 000S0 05R@7Xu 0@0K @K@\ \0| ,0 SD(Kh4|`$Ll$$$!$ě$ -0LM0尀p$0 P8`KP ネ@P9 (00 00@ ,P ;P <q  $0 S k Kh($%$% -LMP,K  P P pP00I ,`@0>pP @ T  Tt7 a @ X,L,   ,P ;P (" L<%T%p%$% -LM@$PKpA A?@0CS`h A@AQ 0#$QV) :P`R :Pd0P`H $P& R`8 `%%%% -CML M4`CK0@X @,0 " \4@P P0pP4DT,p1@TP p WEC.K B@@0KK B0LD `$ IP Jd4 L$AQ XQ IQ8 BQhLQF SQTlQA bQ^ fQjsQJ tQ`4+hV  #PDT᧒@0 S Z `4 s P$ y@KnP @ d@ TD n`4]e  h"@P \5D 0   $2@PD 0v  } !@PD 0g  n 1@P Pژ!pP  \$  ;TI DTp=P \=P  0 <=P ,=P\4  H4K b T$ T$ T4Q> 0 T$0AS,P4 ;P~P4Q`ịX$P@n CKAA ҐX4p ,0 SX(Kh &8&L&`&x&&&&&&& ' ' 0-LMP@K  @@PR33344444434444444443333$34443,00,07K 0P-00@JSP( R "oP8u8(8$88 880c8@. XK ;P % O8H'|p''$% -LM@w {P  $Km7pP .,0 0 , / 0s$Km }S \N d10S$KmH10` @P00 00A P X0 0  @TZP  00 p%0`@T 0 S 0  P 00 0 0 000p$K'''|d 0-LP  @@%P񟗧8d9d9d9d9d9d9d9d9H9d9d9\7,8H8888 9<9d9d9d9d9d9t79d99889777X9d9t8<20h$Bp 0 1Axpy 0 1Anpo 0 1Adpe 0 1(010h/l1@<:PA, 0h$1  10hY00000x0@Zp000h0h0h=@ 5 ;P 0h 0| ( ' 0-LM@PK 0P 0QP {P `  80s4 8}S 8H'|' ( 0-t@L d>@P XP0s S 0  V0h4T0$\ D( -qL1 < 0C  0 0K/0C ` 0` P0CP 0D!0C L0 ,00 00000 0<  0< P 0 ,00` 000 00 000 00=@P 7p q^S 0p3  p(\0 [0 000 p-0L$M0` 0 pPp <@K ̉ Pa Dቢp@,@ 0 SKph(i  -,1LLM0` 0 pPT @@K ᝉ !a ZpC 3[A0ASp0HQh@K( ᄉ a xAp 0H0 P0   0 S dKh(i (|6i( p-0L$M0P 0 ^p@ <`K G ` pP "[A0AS 0 h2KpPc_[ 0 SKph(i i  0-1LLM0:PK(K0 p@P@aHE@  L00L0EP H0S L0StP 0P0 $00 PKH0K  P_ 0 SK0h|(( -LM K*?Pv @p+0`V&POP  0S 05 000` 0D0S 㘇PP\N  `0DP@T,0D0S > R >)|0)H  -LMQ刁a刡8Kp0Sx' 0T R X@TP0S@ 9 0R0pp0c!S0/0S (0s0 (0 80  00 2K3K-p 0#S 0S 3[ R T0S (0s2[ 0S 0S p|[dL)d) )4) -LMPap~`0"K RQ 0~0"K 1KE000K0| -!0L4!4M K 0a2 -!0L4!4M K 0a$ -,<4(L"4!<M K 0! -,<4(L"4!<M K 0! -LMK 0[#@ -LMK 0[#  -LMK ߁ < 8#"  -LMK ρ < 8#"  -L@-Q  TpP 00S0xS @  @`00C S @0`SW C @S7 C/S0 C X R 0@0&&SX E0022VT T X X  X X U U U0f0fifi1U U U `!ii/$i(><>W̦h>>>> -LMRQP`00  p,KWp 600P` ]\ Q 0P ZBQ@@,A W(K?(? - LM  .0 0-LP@}PT (@T0{P@ ;PT00 P0hp0 -L M@,K h2PP``,z+ Pp@/,q+42Pv@ H/PPI P`.,\+ /PP8 PP1,K+4 Pp c;W&,>+0 :PPh P` LO;V,*+p :PP  PP ;;U/ ,+P ;P .X! Y 0R100#0E HRcDf0,05( 0@ 0 B -L 0LR RP 0R =0B |00-PPp0Ll PdP\izp@ L&DH0P 0(>,0ᆱ @BTBXB -DL@ P(0( 00000 S$ 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@0 0z00訦Ц(ܦ 0-DP@L0000@@0 0 0 0( -`LwpPe=z0 SPfu% ࠟ0S @ 9.PL=00000 ea`PV p 0@4=\Iq@P`0 @0O=pBBB1 P-L`h 1 @0Q0S 1 00N,P<\DX` Q0DQD0 Q@L00upP<00CS04@0T0, )0@0CSp0@0A0@p00 PP <\, 0O00BЦ=ܦBG-鄠儐Pp0 0S0 0 BS00R \P@`A-D0D@00  R P  p-P@0|`00t0L@l0@d0@`0@p0@0CS0 @@00 ph%pЦܦ -1q00SL-P`0L00t P<000CS0#@00 0@0CS 0`@0w0(000   Ц=ܦ -LMP@0 2>PB ,K @@P vhhhrhb`"PYm 0 P40S0`00*P, 000S SPp P=P aP =PTAZ,KPPU 1 ,0Q.0 Q@L00Mt P;H00CS0<0A004 Z100CS@ 0@00H,  z@p0P@ d P P \0P 00S Pp(KHaЦBBB=ܦ -LMP0@ T T3pP- 弐0帠S0@0+@P`P 0S  0  0dp3PPP0T@B4  -0 CR 0R0 Sm00 -@0LP` r PeX`Z !`0Vh2`c0SUJ L0SF I0S\\@U`T t<P 0\!Sb/*0S@(0@00US80800US00`zUPX*X00S\ l L  U 0@^S00\P0S$C@CC -LLrLLL`~@0S 00CS00PӤ0??PuG  Q/0 Q@L00r P :00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 WPP 90S0`00(` 0S0`00(V @V00 00 0 <0 `Ц,=ܦ 0S p>0`>PrP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PH==QP>P0 nR pR lR 0P0P00PP d<  Q <0Sw <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P( %P]PP0S!SH  M@0S, 0S @P ; ::;0SZ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S  ? T9`V 9sP`GTPPgTPWVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT#70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P| $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5'@5ZPG 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S< h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S:P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P5q 0000 10S1  1 g@P! P0 nR pR lR:0P0P020PdhDD̦$(]H(E(D400CS:0 2`2 0hQ0 QP\00] P5 0l0CPdS 0T"01@0,  2 0P0@ 0S0!`V&0 VP\00[] P$00CS080t0CPlS 0 \!0H0_01 00@ 0 0c SC R/`p0 RP\00!] PT$i00CS0@00 .0P0CS 0PP00(0 00@(KЦܦ= -LM  @$" (2 P  Ld0S  0@_K  0 B oP$" b  ," (2S  S ;#rPU0 U@L00\ P; 0ß0CS@ 0 h0MT#00ß0S 0E ,c K 0P 8"RpW$0 W@L00p\ P#00CS0U0pŸ0CS@ 0 X0 D"0u Ÿ0S 0 bK`0S 2S ,\    ?KҪPk  "向0pf 0 Q2 /hQ`0 Q@L00\ PL#<a00CS0AA009 &60@0CS 0@00W "1 $ 6p00S 0T@ {b HubQ"(K Цܦ=HFH -L M0P䑟0C0 4 , 0Q000 400pP^A SPX|0`00pP\`P UDA  LPP!00CS0:A0,02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K Цܦ4xD -L0  0%Su0 SqB 0Sr  Q.0 QP\00[ PH"]0@CT@xR00 "0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 5tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00ZpP!00CS0#@0A0 0P0CSp0XP0.0$ H0@00t0x@C d0 \0T800@ \P00 m(Kd(hdF`ЦXܦ -PpL0` Sd 0 )Y@P 0 P 0 5$q 0 5$k0 % 00D (YT@@\`X=0# RR R 0 PP PRP -/L@[P  0 ST @T 0/S 0/S @T  -L|M $呹P  ) PPP3 30CS0SB 80Se 0$ p0/S0`c04@ 0T/S/000h0 S" Ѳ  PPc0S ᴴ(K@A 廲00 嵲  p00TKp4 3ST D0 Sp * R2 0: S  R, T Rw  RV QP  0S. O@dp !P$  $ p3Sj D00* RX2 RL2 R` 0Sg ;PS!$ 0 pf0: SF1 Rc0S? D0僜: R5  R+  R1 R q3&P) 0S lD%D 0: S  00  1 R q3-P -@ q3BPv  ͳ00 0: S 00xT yL p DNPTDi fltFě`FGF -LM@Pԓ0R0 1 p0#p5 H0@*S*lXL0"巭p2`@fT"0Sa 0S !001p2`Dx2xBQ+ 1 P*^PDd 0 0!KpPw0SkVu8  *!00}1 y F1 1 q1 1j00g0p 1 b p ! ] p ! X0S 1SX0 0S0S 10 BK⨔1: S0S BK[. 0 . B0 )kp 0S ph \c P 0: SW Gt,GdGG 0-,@,PL(  ;H|GG -0 L8咆P30S t,H p-0@L :#:0$ ?RP@3c0(  ,0c?B3c 0yP`[U  PP0U* PP*0U0. LPP.p ;PP0 0S `0U<0zPP r0U`0dLzPP 0-SL0S 8([`p$U`MbtDHPH\H8H Q-L@ hPT PD0P4(4h[,ttHhH Q-L@ dPP9zPD0P4(h6tHhH -LMMpA^K PE0PE`@ 0 wp% 0K T04B0P0P 0RK`oP XLHD,hthHHHtF -LM0S  @T  tpp D Q ! GD0S>4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV ut`v`Ꮟ{0S 1 ,`t`v BKOPP$1:( SPPf@P0?8 0 x ᫏. 婚p  0T00(F@PU 2 WP/0xp8 t  00 dP0?PX 5P;0075\+I) P 3H( 5.:㹆5 'E@x 00.S.0<0K`8@8 @ g b0)0@8 0|%00Fd%BX%000.P P0(! 5Ptp@M5@XNP 4@0H(R 40TS4T 0HST 00 RÄŞ$0s 400s030 㙯P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S30C S;X  ! !! !P#! ! ! p30S٨ 㫪0S.P@  <KP ^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0SxtHI -0L0St -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #t 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P- $P Q < ^018 ,<8  Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$PphpPP0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 QP-Lp@T $PUQ (\N ,0SK 0,! `P 4P $ 0(P0,  OLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Xl0 $0 #4N4$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b N (0,00 0e0`U`1`!  NPU 4e N(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  C @0P P 00( 4UbdN(0,0e \N,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗓4=JJJJJJJJ =T>>>??=4ACDE,F(GGtHHJ(= ==< u<   ;< 0S  0 Z  0RJv`V0'MLP0S'r0$ 0S8͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p p 080P\ 0S  07s`0Z  0RJv`V 0 S0?8?d?l? 0 0T0 0+X0 00LP 0|; 000!q`F<07s` Z y 0RJv`V0˟("('8,R_`0@ 0p@0Se DQ01 S@1 @!T\  HEM@0D H0d d dD H @0Z I 0RJv` V"'5d  0 0Q\0`d 'w`FR0 0h Z ' 0RJv`Vɟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PVP< 00<0h0~T03L@ C01QZ  0RJv`P Z  0RJv`V:7q 0`ah TP  Z  0RJv`V:\`a7q, 5 00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL  0S P7 000 h0 0h P*d `0h \L y:0S" S>/΅T 0 l@L0T l0p` 0P< Hl0X P00X0` 0  0pd P0< 0 `6 03T030CL01 P0 Z , 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ D% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R004 hD Rp @D0 bSH @c 0 bR a(00b@40bRD@0 Q !0a@0 aD H 0 R0@0HSH 0= DQC @0H AD 00H 10S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f z8 QS@00<`P  \ 00R40 <P<  < <(KUI|IVIG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍCz -0L R0 R P0 |P0 |@||0S*X@` @PQT0D0L 0S 4LD|HHX,X p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 v+P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@01 0( R  0 OK,CHß00 0PSc,C3 L00 R  C 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 pC d!`2 R TV0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & hD4iHT0YN NN -LP`"D0pS000000 `S8#80 @0c 0 K)0p0 B 0-P L@ 1?P 0 00 0)0 00 -L@Ah30,qSP: !0S2 0 !: S0Q  @ fΫ0S V&0S P*P 0 RG*PA0S 00f0hd0 PHh ㄎ4r HNN ODO8O|N O -LM\%EnK`F `F 0,            d$ `$ h P0: S4X@. 4ДP4 R 0$\Qp  00p 0S#Pm)P t0S!` 0pL4 P4T4 0$KHt 6 @D40 0S   带, 0R(Ki0: SP+ )P 3 pP@{ 3 O@t M|#004KT$ Ht 5(A-(37&(0S  00̢g0S20S BKNN"1A\0A 2 0!00c000l\#0 0@Pb%H84p!0S" 2 WPk 1 PN 1 R] Za`'0X0C0W )PI  h4s `!000'000,)hp \h'0000S 5$BKNN+4K@T 00C0 , 0 S hNLO HThO||OHOO\$PXODHPtOOOOpPP\%t1R H 0 RBNKL@D@D08!4410SP8   HH<0  r 3Li!P 0\Q H8! 0@H0 00H"ؽ0 0S @0 @lHPH08(ALD hLuḨTS@SPSR XY -LM$0|S 0, $0000`6 \6\Q 00 @8F0P: S S\ S6^K 0(ŕ /R \5^E  0 RKAA` ,`8($R>Kh d 0 T5 PE 0BO`E?DE Ih\ X T8 4 @E Kh d lBNK @D@D0$P_"2\%R 0 L5O0@唜2 O @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 -k!P 0Wh0SN?hd%T P%  0\Q 00S@0@pl0 %0 L5O0 @W<00S@0 @hHTS@SPS`Y 0- L8M00 < L0 H0 D0 @0 80 40 ,0 (0 $0 0 0 KP0 LK@4p0 l0\Q \,6ubH  0@K0 6\HT8, -Lp@PST$ @0S 卛 0`@P``0 0\Q ,6%00i2rP 0p : S`0P T @ 60S xS8HTpSN, -LLMDH RS, @ ȟ 0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R \h0@S 0S 0S 0S YD 80 | | O   Q ?KP``F0`_K`P`P`B2 MP`K 0D2/R 0O? 0@l& @Ācp 0D 0H|B K2@şU0S %0 0C@0S@Q 0Mx5 R E0,P/OQ o 5 pPş@@_@P004@34 %8P|o% "2"_K`PU`P@`P`D0`ğ0S Ğx4@T 彞@T 㜁|T0S8 p岞@T \嬞@T ㋁*#0S4u0Dp i00Dp ~i00, 0R(K " (?Kp x t +sPS3P@@@@0S3 R2 (ß 0S. p, R*@0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʬrD"0PBS400q0, R|b tb@ 10*Ÿ@ ,0SDR@*@ *@0L** 2*!0S pA0S 0Sd0S兙Px KiPf 0S7 X;J3|=tmlj7 0SbXd 0S`D^]<[N @04@0 0S ⿝PE!川?< 嬝[ hTTH8]^DUx^(U VHTԬ8PVx 0!Sd 00!000|1 c 0|t1Pd<@1 T 0bqD1  80!000 1!0000z0p"IP`g I0 RIV 1P@@ 0T0PlH\^|^ (T^^rS4@  S -L`( pIP(X-t"1> R.#P 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q 1 R= × / -P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P -PP8<| 0ip 0@0@QL] P[[hV VVVWa`V -xLlM,0SPڼ0@Pt@ pP D 8OtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X|P`1> 0P@`UVW4HTLd@0pǏpX30 -=@PmP -0000-m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l 4-x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN < RJ ,< R\00S 0C1 0R' sR"QX,|@0A@ @,@0\0  |P,0 @|PK`P`Q|P x` k00H(Kp P`0@0@0A@D`ePT@ [`|0V ` *`Pa `  H;@ P0@` S0 @ `+ h d *Y [J`0\0ZE:Q :Q 000hK@ h d R0d@SlZ,j00 R:Y l@QA:$Z@c0T@? Q Q%T*pP RL:)@00pdSt)00PO/ 0\ux9@W 0T P9W 45S:  Zu I0S Z 9W 0 0BO?BQ6p3@P2 Z Z@ Z6 T1!(0p  P P0S  \X8W00S0S @8 R (80W 1100(p @8 R 7W 0ҙ  00UP@; Xg@ 0|'\Q ,0+ s(L7W_ 0S0s,7 R 7WV  垙(0 ,PN  hPV 0&\Q ,T0P&O?@0\u`6@W807pd` ,PP ,P0S 00 U0x R ! :S5WX v,P0S 0005S: P UD5\uW (uU` 00%@0T0%0 0d + DPt@P\.PPU^1!X0   0 S PUKX4W00S0S @4 R (4`W1100X < /%O( / F3W  (Ř Q \3W+  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD ~H"0 404h20 \ő\h0O0/S 82$B\h 0 l , 0S X Q!0\Q00h0 00O0@Q pq'nPw1W}0 0@#1?@|W1> 0P@`UV& d 0`\%R\ 40O0@10X 9P0 c*P 0\Q<  0 < 0SR +00 ]Ḩ8pܭT U T,_XWWpS8WTV\HWD_,h`\_(Wh_(WVW__ 0 40O0 @\=P$ Mp U)P 00 00T+h0SV g P  [ ㊳ U ㄳ -80LM, 0,   )PHp_ -1L8M11!00, P ,0K` \ X T L H D @ < 8 4 0 , R"ڸ0 @Sp`T`@ PP D@ o0`KS . @0S,  R00(KtHܭx -80LM, 0,   )PHx_ -LM(`X0,0 90䠟p,0  @,0P0T,0 0T @T 0S0S| 0T0`0T R 0R X 0@P`0,0 ,t[@-0 0 0S@TTS -MLM0,0 00CSrĿxĿ|b xPqlP} 0:0090 006 $6庈FKL0%ş Z%@%0㴕X$ 44K%50h d i0`00 0S_ S;;SV~KpG,(L%0H%\Q@5(K05$( Kɠ0%\Q 0@X5 TE  R01 0#SP $0$\Q 0(0 0p0t@  R01 0# SP R P\\$0\Q0X000@\0FKL4  AH$ Z#0P0#3Z 0@00 R 0S 0R s S{ #PMPPZ<ß40@1`8#0T0 *PP 0S P0P0@V$Ÿ, 0R(K< 0PQŸ"0\Q6 0@0 @C 0@`5 \E [BNK @D@D0` \2 R@ LB 0̠DD1 0S@ 0?044 0 R P!0\Q 0@0@ !3dP {0P00u00C0  }ZXt HA 0̠T@ 0S <寐Z(g $ P !P W PIM  e70P0CZ0:Pu墰h\XOxX||ܭHT$XX ,`ODOX`8O|XDX(XXXWVxY -LM$$ @0 @8'P|T` -LM44 0, @%'Ph,|p` -LM0 pPR0,0 `'@TM,04 KK,.1K-K0-A[Sh00@PUnʅT6(K MK@B+P 0 RH0S|, 0Ry(KQ0.S 0 0T&000QP8&94PU 0 0PT lP 0S ^00P0  0 R0,-1KP0KKl.1K4 P-1[0 00R000 P8#8D c(K 00  0 30 0C0(K &(K@@@T0ZP00 0 Pv 00C0q00S0SX$ T4 RH4 R<$OPPv @0: S00S00000CS񟗄hd3(KPMK f*00@e 0 00C0 =&@P0 0 R%Q 0.S PPP! 00S00@0S "H0X0P00C000SP"3P0S 00Sڒ^K PEPE0RNK@D @D00!1 R 嫎V bPdP 0 x0  P,@0S <,P!00o嘮 t0(K MK)XdP 8uP  00h R*A R P) R 0S0S@00T pW 0@P`0:0 @   0@pW,Q -h2L8M```"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S{ڸr a0S:ڐPTD@ 00CS5l00`K  P0S@0\!\QA  000S. `K$d P0S,0S3ڸ `K NQ R Q0S R`Kx 5A`KP 00 0S 00(K\HܭXNT[Z(Z -LM$$ @0 @#P` -MLM pTO0 KPK(J8!J,0 HK 4Q#> R K0(K8!Lqt QF ;hK8aXQK0 ŢK8$UU`~UUL~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S]0S  xK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0H͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P !P8K01S XK8QHK4  De[%0 0K8K,,KL0` P@`R`ZK8``L5HKsKD!8KP%81X?^ !PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK80#l 0 0 08S8K>C`(K8!8KK 4L! P2 RQXK4Q 2Q\01\XK4QHK4A\0KH! P KP8 P K41 XKR(K4!\0t1 daR\0H! 0 0hK4ax0 R0R0 "KP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!hLaaN8aܭ]T[aaaaTU pa `H a$a`YPU 05 D0RK4K\040?0S5K8K0品!K4PU 8K@1pWHKC0, ,0 ,0 R R2"!5(K00@ S,", P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00(m|, g8<0 0@@,@@8@଀@D ?U4RP%402,P$e<@ @ @ T 00S  0D0 00<D40A@40 0:, %0I ! Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R eY bxH]d P-L@ 00 R$hn喉 ]A - 6LM , RvfFXS$3S Pu 0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`y ?.t$0ttS} \%h4R& 0O044D $0O84 R  0S> N娇0S \ϟP>.`@P00`` `` `` @/ O ;0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`žP &R^Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@P)5P f0, 5P 0%?>T 0 5U  p5PXE T5P k|ş 5  05,5  z+Wh4 H]!   , 0R(Kx0Sß@T" 0!ßP@C0SI gFD+P, $(`SOL3-K B BGP [P S@Td 002P c\54 S0 `5S|@>xE X娄2OLß<0ង,,o%P cS  0<0 iVfV$:RFTS8*061 Rb BR0 0 0a1 R lp"0 0 0L1 R 8B ,<K0K404Q5Q@ R*0 4~V@ ` P0@_4 0K@P k4 <0K0@ h)0@@ T (Koc(K4<Kt <Koc$cx^c -LM 0@S `V 0K V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`VWXcfH -LM,00K, K00 0S3\%RX` B2 R7Br  @T T `U@ | P~ | U`Q\"\0Y00/H2 RB$0S] 1 RP ?.$10 0;0 1 R=|P 0 , '<1 R D1D!@P2!t0 !04Z 0 `84$0@4(0 H4030 3040 40000[0S\X@I0,K 0`lfH5HTl gcccc -L q, -L$Md"0POc*!0` ,p p,p 00KH 2Q}H 啍pP4 q   0KH02Qn U~Q4 Y 4 0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LP`  PT  P P@  P8  P( $ 0 \9 3 ; = = + $0  00 0( R`: 0  -@LP P  h 0-L@Z 0PP HP,P@@vP,P0`g -\0LM@(0K( 0 @ K$ K0 P K$+K -0L@P  hW --@0L M,K0,K   Kdg -`0LM00 0@0 K P @,v Kg -t0LM $0K 0  $  K K0P $0@ v Kg -0LM0S P uX@0 @00P ugg -LM  K K0K  p@u aKg 0-LM 0PS    KK0p @u0 ;K0h -L@0F0,(8h 0S00 -p-LM@0`P0 RluP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ . 00 0SK0 --LM0 0 @f9f K p-PLP`   05dpE rP@@p0S PwP@PpUP@ 0@pp`#Lhlhh - 0LP`p) 0S& 0S# ,u , @x 0 0pll 0cp\D PP@ V0(0(0$`@(@$`@褠`# -T1L 00 0(Q,p5@p 0`+P0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0bv <PP<@ 00 0Ov (@T hLh`: 0-|0L@0S(@TH0@?PP 40PP@<P Ph<0l@ `: --LM0 0 /e(e6+ K -LM@Mp`PK!  +P4 0v 0 &hhi -LM@2 0pP,K&pl PMp`dP U` (C,K 㣇P ,C`T,C0[ 1S00 0KU% ,C !t(pPs0S s0S s0S (N(C* (N(zCxC*W0`SʌU*0S o*0 $K$0 0pv0 ,N &`KHi\lii p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 pᄻphp3  -L_0@ 00 0(@T p`Pups0S P* xp0S s0 S s0 S @ T WHgil@ 0 0-L P8 0@PU 0sl `0  0 (@Twp b@0S 03 -L@$$)s'p$ p?%#i -1LM@ 000 0t(@Te^!T1?p/ 3Lp`+ P#,@K ) P (` $` ,P + +D  0$!1(`v !0;$ KRw 0 @p`P#40S 0:0DtpLr0S P) 2wp0Su< vP!nK00`Fp vp@ Tq0S (8[Sr0S 0@T(80 Sxt(#`0 \  $0 SH Kh(kXk|kkl@ k ll= 0@,0 09 I > uP = = = P y'K J= `|* P-] p J`Fp* lz -N0@&S;K K O O O K LL O O O O O O O O O O O O O \L L O L $M dM M M O O O $N O dN O N O N |O < +0 `"9S<0|:  '| LNp RQl<@0@0 X  L< 8 `) <R 1 `);R  1 `ҽ);R 8 `½)p;Rd 1 `岽)8;R, 1 `墽);R o1 `咽):R _c0 `傽):R O 0S hh*MF@\~PLL*000:8sP$:$ʟ1  h- 00) p 9S9S T 0s 0 l*  0SpAP 00l: p*BYp0SD9P (j 0e0bS |80S NK@D @Dl2P9I9 I 2 4(1 R0h: -W |pP& P! ^KPE[NKPE@D@Dh(0\(\8PpIp4(88p@p B=\70S' PP"MKe/<1 =C1 =1 7p(Kz xz J tZ 0C |K 0KK!G, ! !  1KRG6 Rx D'=K 0CPx m  K@ @ȩ,mpP#m  I PPPP ~P) u9>9 l  P ``rpWZ50S EP fP Y  0㤐* t: b  0P l  CKA A Y=Pl  |540S \:: Sl + \:: SX [hj@pPtz  P`P`0P00@ S Kt 00A Sa>@0 @@00@0h:  0 Shjtz # 0S (0@Sh*Xl:YiS xC  dp 00@@ 0 @@0@`0@@0` pR@P0S 20Stzh 0TP2`0O?   ß4;DQ#| `P`V u2 (2 R P 00C   R ʄ*(0 S;30 R 0S1  0#R ʌ101 S90!0Sh1010x10S ʀA0S l10s[00 !0S00S00#1ѣ10NK@D @Dx: *d00S  P *x/000Sx T; R;lh|8nn o(Ԯ,oDoܮ\otooخoop p0@3C 000p30SuH3 8cRT0@PTPd 4K ?_00C02P2 R @4Kd  ?M@ @4Kd  Xp?@pPUo50@0 p2P%R, 5d 4Kw ? p0O<0 8@  00PO`&,ᕃ< K  < K ` F!P,` 0OP## ?@00C0laD@00QH 4D A^X18 8 04  ` P80 $0`ï @ 04 D0$ 80p00`$00 8040`!40 040 4KoQ`0ς`0O1>Q`0P0 20D080U00@ d 0 0H4K(KU rrsԮ - L0R  PZ5,s -`2LM0, S(,0l$,@P(2(R@ d  0? 2Q)65 00C 0 БP\01 P\0?0 0! @ d 1 0; 0@4DX1 00C0p帀,0Z ! #,%5+ 0 OS d&0OP `hxv`0d 0@V@0 0P`x00S0 xP0, 0 xG0,,$000 (00(KoԮU rLs -LMK@,0 K`_0@ P A P @ P T T! 0!C Dp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d ,04 0D KA8 -LM@`pGK,P[1@ 0 A SA  )0K p P  0K S  ,K01B00@S  0K4\P L=EK0@0O4;0 dD04 0GKDKAԮH8 -:L4M` ?P L0 X @P T@ ɯ08D@`:0O0P 1H000Dş0800Z(U,08@P( 0` E!400400, 80P0` ,`\`0,0\`0?0 0 2 0 `,` $00$0,X,b0t S`0O@ @ğD 0000SH 0ST0T@@0d0#00`C0S S0dԠ ꄓXP@PdP5XßpPYd@`00P 000080"P8 0SX h!40Ÿ0@40 Q`0 Q`0?00 20 $00$0 0X40X@4ƒ0R00$b0@ TJ 嘡00 x0`p䁟Wp@ 0\5Sl@PlpGW0P0PO LX@,00 ß @d   ,a!0 g10S70܀80P)0p@_pl@`x0W0POP LX@,0 /0Od 00 06080P0x `RU(KpsU ԮsT -LM d  , V<<P O,;PK̬;0S ; 0t{Wd{d 00m4: @P0+:p   r7`;:Q: `: Sr\ mQ (:  S4Z@ ,00x J @P@PPjɟ 00T 0L59 0$: 049 0B90A  0`0UT X0PD RD:R080R0Y00 8 04 000cH0 400cL0 H00O85vvv#TTw؋ ht@00h0 h0 S:h0@2 0ȑ<0P2 0\ \2 0 0R0PT0XT0P0P0HU 00 00@v0PP40@-0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0(40S0 8<4@Pmh4 d `p8<4 00@ PQe@p4PQ`NI H5rP`8, 0t5e@  K K0K @@|PPK`VP ` Ubp` p 5尐K蠐 圠  6, 张 8d 0A@@c00@ ZḐ 崠 0Y @K$'J F%*0)Z\P-O70S~@P'B*0[\%7R7\5*0"G*0P7( 8Q0\570S( ` 7PP PT8` Kp [PP PPd80X0 h R01:0P&{ H *Û`p㐐K9)`0S-90O ,00 /@_d J)P0d PcP@c@t 0 S F  d `pP0I,0V0S F :0S :P (:0S8P HD ?>0 ?0 ;0 4 D0P  +J*0`PJTHLV0Od 00 f0 R 7000`P pV0 008P40 ?d @@h>hJrr 0-PL@0S(0h_BQP x_t d\00SP e <^J 0r_ (0hm_`xxxxy - L P_*m @y  mO -LM@/a"P0002Pp2 lR dr`XT2T"PPPfP tP  Ep2 10 bSP PP P 0@SX :㛸P*10S Ya@a,@ pQl 4  !PP `@a0<S 00K@P Y0S 1 0S0_+0S% 3KP ,K  04 P,00S h&040 8K[P @00S d) 0X)=z \(22,y0y(XDyXXyěV -0L Ez . ..MAKEDEVconsole tty memkmemPƫnullPƬzeroPƭstdinƮstdoutƯstderrưksymsƱklogPƲbpf0PƳwd0aPƴrwd0aƵwd0bPƶrwd0bƷwd0cQƸrwd0cƹwd0dQƺrwd0dƻwd0eQƼrwd0eƽwd0fQƾrwd0fƿwd0gQrwd0gwd0hQrwd0hwd0iQrwd0iơ ... . ..chown|dhclientn disklabeldmesg|fdisk|fsck| fsck_ext2fsfsck_ffsnifconfigninit|mknod|mount| mount_cd9660m mount_ext2fsm mount_ffs mount_msdos mount_nfsnewfs| newfs_msdosping|ping6|reboothalt|route|rtsol|umountsysctl . ..miscEťkeymaps . ..)termcap ... . ..chown|dhclientn disklabeldmesg|fdisk|fsck| fsck_ext2fsfsck_ffsnifconfigninit|mknod|mount| mount_cd9660m mount_ext2fsm mount_ffs mount_msdos mount_nfsnewfs| newfs_msdosping|ping6|reboothalt|route|rtsol|umountsysctlbioctl*dhclient-script|Hy -LtMp  Y6*V0/00屡@ᓡ 0P K S``Am0&p3 p 0: S/00 V P X 0: S RY0 0 (K 2P 8 -Lp` [[[t!Dp mP2 pP D!Dp81 ApP@ @`㟷 0@S 0P/S @0P/S00 R:X  rPPyP#@P #P3 UP#2PH^` 0}%>P` Wz(T -`LVP@p\Vy Vp P0S [S \S Vi 0P [RW VY nR 00P \RW 0[V 00 ^S00]S00S5 ]S0 0[S \S \* ]\0]S$@P!n\ 000.\ =\:\ 0 0S  ]R  S @L4 000$) 00 " FDzz -pRL`( P P9 ;P7 0@  ;P p0P P\ 0fWP @5  @B hP P@ @0@  p0P P00P@tz P-L`* 0a0CS" T ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( T ( ( ( ( ( ( 8 00  `Z`Z X RP P 20RP |0AT@T 0Sp -P0W 0p 000`Zz4 p-L`@eP @P# 0S0Xpp0  R P L 0PCp$ 3kz 0-LM0 9SP 0S:00 KpG@8\S d@8$S0@0 /S @P 008zz -CMLM/0X T ,0 kP@0  r @0D r 00 0S#S ;S X$000 X   04cPi 0P@0  r @0D r 00 00,S0l~`0I 0D0Sb 000Sf 0D S,^(S' P0S {0S!0 S񟗈H < l  ܳ d  0T$0R0 T0T4 0D@T0D   r P00  r 00  0 @ 0;S@0D TRd0$@0D 0\SS  3f` y@PC )\pD oPP q X<  0s 0 0  @T#  @0D 0;\ \ 0$@0D 0\SS 0yP0 N 0@@0D 0PD4 SD4P4  0`+0<4 <`@4 H @$ <0aP <4 c 0`S@ 0:HH @H<$TL ' Lt\T  R; Z@T`F ?P \000@S0PD 0U}0UP@@@@TL@a$ $`P <$ <$ 0D@T0D   r 00  r 00  0 @ 0SI x 19 PU00]0) pV0D_UF 09P@0 MT$R ,X4@P`@T&U @ 0PS0 U` Vh8 @AX8X  :',08(Q}(K0D0@T0D   r @0D r 00  0D0@T0D   r 4@0D r 00 B.K B B8 0S 0SvP P0"SP0&1p@T@T 0S0 ` EP @T0(0 000;S@0D ?0D0@T0D   r @0D r 00 0S 0V00;Sl@0D 0@T0D   r 000  r 00  0   0"0 000D0S*0D000ST0D0D@T0D   r \00  r 00  0 @ 0\S P 0D@T0D   r 00  r 00  0 @ 0SBK0JCK` JPpI44 M@P6  0fP  f 0`SP0:p0SB  0S \S @ R @ R@@ 0S0l^`00400 04@T0D   r @0D r 00 T400DX 0S T ,D4S T^@|QS 0S0 `PHq`@T0D   r 00  r 00  0  f0P@0  r |@0D r 00 Lp`x  |\T&T~\00@zh($ {0{x~~|0,(|z4~4|X|{{|H{|}L|}|D|p|{ ě(~}T}}|{|$}P~{z L$<4bH`Pd PD00D P 8D 008@P r 8 r 00  gR4 "9R.1R5*R\0 6 3p1 ,00 *r( 00 # @0D  pRa wR r8084 ;RT0@0TCKA ʟ0@s@@8@P8   r 800  r 00  8  8\ \BNK@D@D  \  B8 \0T0 ᮡ 3`V" 8~00HYT `0DB.K B B|  #p  R 08L RkIp 000 S R 00 RU0T p t00 r 00  @0D P <F89BNK@D0@D,4Kr* ,8S  P{X;rT -LM(s0 08`IP<  IPuD_`[~ [~IP`@@<@TU IP`bIPA IPg8IP$)IP$) ?AIP"IP"IP" gCAIPRn%IP.8IP.8hSAIP IPcL IP d^AIPcL IP,Cl5IP,Cl5 AIPcL IPcL IP &BIPR IPEIPE 9!IPB&2IPB&2IPB&2B1!IPB&2IPB&2IPB&2!IPB&2IPB&2IP;s7tW!IPB&2IPB&2IP8!IPB&2IPB&2IPB&2;!IPB&2IPB&2IPB&2 !IPB&2IPB&2IPB&2 3o!IPB&2IPB&2IPB&2h!IPB&2IPB&2IPB&2B3!IPsIPsIP0:`5!IPsIPsIPsPӉ/!IPsIPsIPs{ 0aIPsIPsIPMn!IPsIPsIPMΓ^aIPsIPsIPMo!IPsIPsIPMw1;aIPsIPsIPM Z!IPsIPsIPM<aIPsIPsIPMך!IPcIPcIPMY}aIPcIPcIPM5X!IPcIPcIPMv'aIPcIPcIPMHp!IPcIPcIPMqTaIPcIPcIPM8!IPcIPcIPMVaIPcIPcIPMk!IPcIPcIPM.9?\aIPZIPZIPM"E|!IPZIPZIPM~\aIPZIPZIPM 8:9!IPZIPZIPM  _ aIPZIPZIPM je!IPZIPZIPM daIPZIPZIPM N!IPZIPZIPM ykaIPZIPZIPM Zx!IPϟIPϟIPM waIPϟIPϟIPM Yjl[!IPϟIPϟIPM J1daIPϟIPϟIPM7!IPϟIPϟIPM[aIPϟIPϟIPM!IPϟIPϟIPM;M'aIPϟIPϟIPM2a!IPϟIPϟIPM`aIPϟIPϟIPMf!IP,IP,IPMo#aIP,IP,IPM!IP,IP,IPM]aIP,IP,IPMS!IP,IP,IP& Q u aIP,IP,IP& Q 'Ej!IP,IP,IP& Q .QaIP,IP,IP& Q o!IP,IP,IP& Q aIP,IP,IP& Q + oG!IP0IP0IP& Q k=aIP0IP0IP& Q n^!IP0IP0IP& Q ]aIP0IP0IP& Q 7G!IP0IP0IP& Q ĴKWaIP0IP0IP& Q m `!IP0IP0IP& Q 㚦%aIP0IP0IP& Q !IP0IP0IP& Q s*aIP`^IP`^IP& Q !IP`^IP`^IP& Q jbaIP`^IP`^IP& Q D!IP`^IP`^IP& Q naIP`^IP`^IP& Q ~!IP`^IP`^IP& Q IaIP`^IP`^IP& Q xz!IP`^IP`^IP& Q \YaIP`^IP`^IP& Q |!IP`^IP`^IP& Q ѯ.aIP[IP[IP& Q Jy!IP[IP[IP& Q uaIP[IP[IP& Q ^!IP[IP[IP& Q TvEaIP[IP[IP& Q !IP[IP[IP& Q FEBaIP[IP[IP& Q !IP[IP[IP& Q U#aIP[IP[IP& Q CJF!IPՏ IPՏ IP& Q *?aIPՏ IPՏ IP& Q |7x!IPՏ IPՏ IP& Q aIPՏ IPՏ IP& Q v!IPՏ IPՏ IP& Q SHaIPՏ IPՏ IP& Q "!IPՏ IPՏ IP& Q yaIPՏ IPՏ IP& Q Ҵ!IPՏ IPՏ IP& Q -IaIP(!IP(!IP& Q uc?/!IP(!IP(!IP& Q 0saIP(!IP(!IP& Q >!IP(!IP(!IP& Q $[FaIP(!IP(!IP& Q 0k!IP(!IP(!IP& Q t4KaIP(!IP(!IP& Q ,m!IP(!IP(!IP& Q  aIP(!IP(!IP& Q !IP(!IP(!IP& Q p{aIP!IP!IP& Q !IP!IP!IP& Q LaIP!IP!IP& Q !M!IP!IP!IP& Q  !IP!IP!IP) ;Bu!IP!IP!IPZ DBuaIP!IP!IP& Q y!IP!IP!IP& Q TLiaIP!IP!IP& Q ?eL!IPY"IPY"IP& Q .H!IPY"IPY"IPY"??!IPY"IPY"IPY"?F9aIPY"IPY"IP& Q =?C!IPY"IPY"IP& Q iaIPY"IPY"IP& Q cg!IPY"IPY"IP& Q WƟ2aIPY"IPY"IP& Q r>!IPO"IPO"IP& Q }aIPk%IPk%IP& Q p!IPɅ&IPɅ&IP& Q 1c!IPS'IPS'IPS'<k<7!IPO(IPO(IPO(=,f!IP$)IP$)IP$)"˂c!IP*IP*IP*""3!IPF{,IPF{,IPF{,4v!IP H-IP H-IP& Q f57>IP,Cl5IP+oIP+o b0IP3IPg%IP! ݣc}at# "o^%KxPMJi̇=N_1sPtk)M> S0 g 0S00 (K,KD蒟@0SG 0#3P00,  "0000S+00CS0:0 0r%\"Hb0Pd 0S# 8B40僜PP@EQ, 00S  r 5aQP1!01  aPxh<h0PPP) 0S00CS00 0r+k0P 0S0 00 S 寲 Ͳ 00e0@PΤ 0d0 U`JP0PP0S 00TP4d\ěTKoHpx -L@P NӢ  -L}@P N  -P@Lp`8 0`P 0WhW Pp-LP`{S sS PV 0wSp |P00PVp p oP 0 0 @No 08b0@}Nd 0 W ě -P` PLpW000  0 0 K ]@ -MLMxx0 S, /p``P10pS `"0 0R RdPPJK(@D@D 0*0UP0pS `ʰ0 R 6#3P , 0R0(KM0S T ,MPM$nh\d z -L\M00O?P 00dpW X/000S  R  P0OSpP0~ U 0 S RPE4/0@`P `0/ `10P%0p0 0 0   r 3R^ 0=0C>SY$ ` 8  4 ,  < @ | t   D , P-0S 00pr$0@S  R =| R <@@p] 0 0S 0S  RpMLPl0S0S<n@,T 0 p18LQ  0p'K0S R  B \P|  |P0` c Kk 0S䋟PBAD  0 0  @PPp0;T Qp;@@0s 0S(" `0Xmp  :  0 \P 0S`0 CR` bX0X00S0S`0 CR` rX0$  X00S\`00CS`0X0  X00S(*6#3P@ oL0S S Gp 0S0 :pi 0p|9` 0p{H)00PI0S,Y0S d 0S ^ ^|  N| 0|  P00C|0 pSX0S ȟ l0@0S`@*P000PUBb0@0S*l`PVl0Ϡl "000t4 q6 cPd0@00S8*<3 X0 <000 00B S2&R\RPK@ 0@ C0S^Zu qr cPd0@00S:K@ 0@ S 88/\ cxA000xHPB 87$8&Ԅ0A0Q 4NudPUXh $0!,PK8EDEPKXE`E` 0  @P0SP PU 0s U #0P 0@iHP0 C_HV0Sl  0S@k04f0@ +0@S_\$[K@ G0@ p0R P!8(K B P| |P `0  b`  rP1 \p0RX$8 00 D0 TT'p @G 0|X 7s00@P KNP4[S 0" 7U@Y?h`V<6<00$$(p @S0@G嫛 0T@Gyk00 P0-LP 0@@S0S T R0000 R000h 0cN0d 0-PLP @rT000 0-LP@P 0R0 @@0=Nꈌ -LPp 0LP`@P U@@V@hNꈌ -pLP`@ Epp lP) mP ?P`@ 5ppp0AP` @=㮥0P H+P`Q`0 ;+`Q 8 -RLM|"@p?P>@ 01p@Wk `PVk 0S0M K֏0S2 TPr 0S0PP 1S0S@T 10TMtA ppo0_? P .U?0#K"0KR0(0;0@ ;0-Q6  “- #K⽓0@ RU t3MM0+0#0K"K!pK  0a , 0<Y<7MzF8܌99 09Č 0-PPL $0$@QTmPP099 -LMPP 0-S- `pC#6op lP sP ?P`KL`Ph$M`PCP#oppV OA0' #0@| 2  0 "`Px @T3 剤P @, 0T00S&R+PppT] 01P` KqP@ pKGP=@T 0%SSP`yL`T; 01P `K0S L@T' qPw !0LSLL 2Q0 dLXL`Ew 8L```TL`O0 R @[$ R @\LTWL`0SHKV ~TpV? ~;P ՜Pp` `rQ  nQ bQ) cQ`tQ  vQkA 00C R 0B0S00C R10P~~4Pp`P 0004=4,20  1pP' prP 1p 000C1!pp0`~P8d\998X09̦ p-D1L`P8A0!fp LP PP ?P>@p@ fp`0QU Dp`0@ R V"T - PtDpd@P `jD\0pv=]4tDp%m@98p|p9(]9t -L0M8dP0D($Xfp LP PP ?P(KC#Hfp0S ADAˈL ȈH X PU 0S x*Dl3p0S\!Do@P `T @gT 3p"P  "0 @T0 D P 2 ; 80 4 c80 0x@0 < tӋ0pK@`K,K0 < ,0@P)00S "0 HkZP<j<@U CD0Sh !b<嗐 C=.t10S<<@0/S4ZBT0 ylL 㻉P  3D0S> !D7 w1P+ 0D0 P0  PHh0P DP P |nCHl<@H ㉉bCxFCl@P<@XTC98p|p99lE̦l(]0fP -hAPL`!*e`pp mP <1 8 !C0C@`P- 6@p  ep01 PR @@1ST TVp =X 1b@V =XB@0 pR@D b@8h8̑ -`L0 R" p@@ T 0P P 0 s 3T R @0 0S  @n T 0 099 -LM@PKp@b0@0  dp ?P pP :P8B 0008B@0S  ڄ`P@ PR1S0 01 0S00S 000@$KT49 -LMQ@  WϠAl  Po K`@H _Re$àLWO( lFFd $@ P7oꭋhWXh -LRMPp<K`&KmGKjP`y @@@@@@@ .`0SY DK&KNYKK0  c0Rc=9 =( (0 (0,  A, B, Q=9A =C, ( , (0 0 c0Rc=9 =0 00 4 00 A4 4 Q=9A =C4 0 4 00 \B ^b A, K0@S4 K0@K_0DKPK&KYKW 00!X 0R=9B( =C , (0 , ŀ0! 0R=9B0 =C 4 00 4 \@ 80D c<0Rc=9@ = AD @0 D ^ @D K0@D K0@t, KX0\@4 K0,Rj$KH77?BH7| -LPM@lPK`ሀ|dK 0lp 0k 0 0$K7 H -LPp@ bp fP/ vP ?P>@@ bpp01@T `jP0 [XPᬃ@T W,@Tp@8 p-LM 0S@P1  KnfP/0S"  D 1`0P @e0P0fC10C0 0S0 ,0 R$0xxx999H 0-hALM`!Peb?PA 0AT00  KmeP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0?0bP[K0@@ (0?89ԒrĒ 0-ALM Pb?P80AT KdP%  0 0 rR P0S @\ZZDP0@0d0 R R 00C8S@ 0  ?8(899 -<LM4D0P$$,0 app ?PA DSP#pap0aV #0p6 00LS001 000C0 LR\^:0-W0  =W10h0 0 +W,UP (PU n?, 0R(K6:@4:P pUv ޖP a0E`SP& `% `% `% `% `% X& `% `% `% `% `% `% `% \% `% `% `% `% `% H& PUp 幖XIP `@PU ᭖P X0E S)`& l& l& l& l& l& l& l& l& l& l& l& l& l& l& & l& l& l& l& l& l& l& & l& l& & l& l& & l& t& h& @II @`@`*C`@` @`A`p 0S>p~X9@9W" >KP`@0 0=00 0<00^L@D,00tP@T@B>FD>Ah8P9((] p-AL!``?P8 0Q@P yP# PyP@ xPp@B^ 0S `> _l[>T @pTj>pP@U 0-S0S>@p8;4@ -`L @K`?P@ hpNM0T 10 00PS<0< ^Y@w8999(8 -0L8MT0 0\0 0CPX0 PEH%`p2 rP ?P pP,Kf<PT ,>(KsP uP@PT  , K=PT , =D0$X0 _p01 `Rd40&T/=X$Tl?@ZPP 00T"P -=X0S Tp 0 40 0 540P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0SvP 0;0 0S C@kP0\0 hX0S L0 cRLK]pPp<0  cR<K]`Z4 UJ uPu U0S8V  Vp 00S 0V0 R`FV00܁0`D2 R98 cPOf0\0\U00Su U 0!0  80S 0SPr|1$ RPkTlP KH1K PE][  0fP0< fX0S@x@3uX# T uP0  D0 @ ZD0p0H L0 p` 000H4H@T;8P\d"\7999909 0-PLM @^?P0 01P@PK B0PS80S08PKBP08 p-,QLM$!@^?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0pXPxU5< XR<xx>@xP4  D<x'889ěL  p-0LM` P@,^?P 0AT K04\0\  00 0l x4<x<98X R4 5:0QH -0L` Q\p 0PS @0S 0SjP00@ST - LR@:Q0AS Q 80Fp3P000 蔂 -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3|0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @ntH\4 p-L@PY0PP` p P P` `V`p p-LP@0PP` p P P``V`p 0-L@0P 0 P 0u30 ꐔ p-LpM`PC@PT0 RKpKjGP@ : S I@@8 -LM`PP@p/ 0A#SGd= T= < < < < t< H< < ; ; 9 ; l; 8 0; ; T; : : x: `: H: : 9 4: 9 9 9 9 9 9 9 P9 9 = K`P0#5 KKGPBKGP6p 0RK GPBKGP 1R 1R$K 02P000᭑P0  ^p30  ^ᔑOp3Ip3KP05 R  K^P 0 00 KP\0S0 KP{3 RuKP04m k p3fKP`@ T[KPU0: SPKPJ0: SEKP?0: S:KP40: S/KP)0: S$K|P0: SKqP0: SK.Fp3K`p30!SPPU@(\P0 0 g1U b 0p03 0 0s30S!BKEPKEPp 0Rp ᨐPᢐp3(K 00P 0ES񟗱> > > > x> `> $ (0Rӣ$ (0R$ (0R$ (0RÑ$ (0R$ (0R`0S89@@-0S0%@0#0%*0Q00 @8 @8ě -L M@2@"P40 0 020"P,0 ( @ @ @@1S+P1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P T8$K@pK 00 RӏP @ 0, p3p3@pK 0 0  ,@0 (3 D2 ? ? tДȔ9Ԕ 0-LM@P$K $Kp  ?<7K0 Kpq7|^ܔ -@LM`vP@Q $K 0/P $P 0 07 K0C4pK4@ 0P ,@ (P  P0@T 0善$779  -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"yYp?@C "PLE HD HD HD HD HD HD HD HD E HD HD HD HD HD HD HD HD HD HD E HD HD HD HD HD HD HD HD HD HD HD HD HD TE 0SV0SR 0RQQ  RP A!6Ypp?@0!R .7``*WhA\!Yp . ?0B"SLE E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E 6W |Q @x6QQ@T  8P$80Xd0 0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`z[~T- p@PP 0`pc@W P`ҍP ̍P@W ` -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpPpO 9xU  Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd/ p-`PLP@$VP 0R  0RQ^p^p -PPL`@p 8p@@P VThO9 0-@ 0PL⏌P 0c0 -@QL.0  [00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 DP W9$ -RLM0 a PR0 00#\R00S  0R0B`C0PP0 F P  `L4`(K`14K!, 0 4 4,0Q*0 0` 40 p@W1 1SP` V' @`0 @`DA A@,@ 0 4 ˋP 0Sr`lT 0 `0K@PpW909(9  -LM0K` k kPp   XP P0xU* YP kPp  (K @`DA jAP@P9 -L,MP L T @L 0 40 0 H 740T0<0 8 p P::P8@w  YD  0< 0 bR<KS@Y R   P /00D00D0 H<0  cR<KS@PH DT 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , KWP LPQD p@< @`WT 1 00 R P80(K,0S 09 -RLM<0 / @P`4`KcH#8#000 40 , ##0@T T@T"0 !wz2P 0 0p400gCz @W `2  @WY8 @`P X`P @ 00NV 0P sP XP @  81" 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !|UIZ0 P`` VP @PA0<x 0X0@` DA A@,@ 0 4  40" 8989t8t98D$N -/L`2HPDp`@P]P@ T iWP̈ -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K(0S0S 0S0 S0S0S  P H, 0R (K40$  # ^KhD7@pH -@TLPL x0S C x  Tp0@ p0TP`[@\7(x R p0 Bx p0`[\7 -`RL@<PPT^ Tp ppTPW oU 00 S/R  0R B/S PUW10@  `1`0V0 T@j DA  1A` 0V@0T00  ohP@j DA  A 9%Z7 0-LMPK bQ@P*0SH0 R k NQ@PT[8d9 -L M0S 0 0@Q@ K0 K;P1[S S|ࠁ ࠓl 0@yP[vw1[S < 0yP [hw99pht@L 0-L@P}\ 0S0S @p00S@ @9d0 -@L! @@@ @@44iP, 303 0 h D78G X?; P@p 00  0-0LSP @P0PS0 0 <0404 00, (0 D $-l 0S ^S 0000S$ >R@0̗?R!00 0 0 \0 -tLQhd0d @pT *T0`VPUzTP@00D$ 8 - 0pL`P@0 ^000@S@0C@0000`P  r 0  @ 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP=d\@P d0 R} X0 =wK@( 408D$9 -\0LT0L0L0@DP 0540 ,0 7h8, 0D P P p-P0P`0 0LR@ 0 R R00CRphp!0DS g g g g g g g 00C000040( p-08`PLP @0U@Pp, -L - L p0    -LM`@p0Pd K"d@P `00`H0H T w ,0 (0$ 0c0AL099TX P-L@ p D 00 hK^IT?@hv0 -$0L x vD7 -Xp@LP P <`0T: 0S0UP,$ 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00< 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T: 8 -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &<CL}U{ -4LP $0 A \ -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  C9 -0L -0L -H0H 0L S 40R < -H0H 0L Q 40R `< 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@< -L -L.0 g -LD0<0< 800 00@@KD $ -L> -0L `R0 PhP0@z|0 p d@`0@TPT0T @@@Th 99T D -T0L R D0404 00 0@@9<099 - 0 0L<T -0 LAT< -0L9 -0L|9< P00( 0S P0CB0@ Q-L@!00@0@ QP =D0 @<0 40V 000<@ -LMpP` ȀȠ04 <0 8 0 00 , @@@@4 0 b00Z<08 040 00 ,0 0DJY Y (K ȋ p-0L@`0 ^P :ϠQAQ 00S 0U^@*pp< -|p|0LP R`*\@  `ֻ һ0 0 0  -L@tP嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00,D$( 0-1L @To 1 R@0S S S "S 'S0S  R0S"S 'S 0S S S S S "S 'S0S R PU "U 'U PU U U00~P0 D0T'* P P "P 'P 0CT: P P0c0 P P "P 'P 0CT:"P 'P9@< -l0l 0LS`\00000C0P 80 40 1$`\L 0-PLM T@00Cs0 0K0KPK00Cs088< p-d0LX PT@T`0PP88 1?1c"10c Qp `gfff -tpPlp@LX`d@D0 <0 40,0p p$D \ -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PQP0 0 B cRW@@T P 5U@@/T00T0 0@Pt 0S:\\(04D p-0L MP 0 K$KK a0a(@K @`PKp0 %$0 `xV P0AP᥾H HPU$Pw  p-P`L@T @00TPc@PdH@p\ p-0 LQ 0Q` 0 pl`tP0P Y`0@d0S00CP 0pPz  `` -0 0Q tt0 `L X0R 0`@RJ@d@< -LF -L -H0H 0LQ 40Q0<000 0Q 0 R @ -T0T 0L Q @@0R `=< -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 - ($K,00 (pcfVW00S@ X (0  0R/S 0!U00SQ(l(4 0,-(0 zw -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P RPe0@  LhP0 -0QLp @aT`*@DT:PPX`0@@0@^SDR(0P  T99 - MLMKK I0 , -1KZ<t`P@1p@0T-9K.yK@ ^KPEPE@T9 V~P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z 3`P, 0R*(KV Z ^Y *00hY ND fZ@h p d{ x\ -@0 PL 0px@`00Cs0 V U }PP}PPZ< -L,`p 9\ 0S  2 1C P@T@T 0U P0@T @rW0@0 P`n 00  0@@ %ꄃL  -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ ??hl 0-PLM00 @R 00   Rp0 RP0 R<0 R$0008Lp h| @a @b -h8LM \ T8  )@P 8|P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KzP H X9@a pp q t o \n \h  D Ą p t dn tt o i , tn ~ p q s $ h i x r v b n @t ln (a z  u  -0L @ 0S ,<"',h"!0 h"贖 - @R0 000  0L Pì h  -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" 낎KHH0" V^ 0S2@T@S &zPP0"1@T r@TUpAp t1@T @S zP0}@ 09P9U @8 P yP0@T @S yP0[21C 0@T @T yPP"|XP L"t@;<$"mHh(]Ė{ ܖt -3#ML M3#3#3 `3 S3#帓K@A A@`, 0P48#`0e0||#Pp@@0c00 F cDCD3  00S$C\ 3" #0l0cCP00쒟002 `-(K GP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000``dP01@T p@T PVʂKAA N PVpW@Z@W00S 0`!Q P0 0c, 0R'(KW5! R 0S  $\<gN4b0 0C0;P0J: $h9T9D\04(8,X099<P@{ | -PLpnx`P- @eT: ᛵ PR 0gXR@ @ 0gR00@  LIxP Z 0gX(00W  ܈ -LM` 1 pP[V 0U/00ń/\@0@0cS ڠ@P@P/\ / xPP 0 0 BPN 00`3T  P _ .PP 8 0.S 0S .Si 0.SEP <0 0cS \@@  0H0Y 1 !0@-PP  f00 lR0@@ d*1 `Y10I(K@0S `0Vሁ5L* ` G1` 0S KPT U0U/S0: S SBK,P1: S  0 SU0U/S 0: S SR 1: S/0 0 ᚵP 1H@` DA 9A!`@`BKs,P9 -0LM<p00 , BP@0U @PP0 8K(K8 4@ P(@ 4, `jcFa@f$K9 -L`pP@PP0U*E kPX0@` DA AP@Pd 0A0b Cah5B9 -L$MpD H0 0{S vPMP0UO*DH `0P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q8P ,  P U Q0P{S0P O }S ,,SQ 0 PD+(Koe1@` DA ^AP@P,Q, D0H0  @cj804 PBPc4 0``- D@@ m0 8<0 g 4 <c@00< 40 @pZ0 P8P ,00,0 9 -tt`0@Lp-@@PP0 P 0Ep0mP9099 -LMPHK @  w/0/S000  0S0 S 0@00 0  00 , 00 (0`K ``@   80 4 L 80  cR8K,>P0ꌫ X  Ы  X  Z   0S PD0Q D0 D >ZXP  _ Q    00 ZPY 0 0 "" "Z  R Y ZJ Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z mT H L  ` | t ` Q D@ BP ~ R0P00S Qh,0  R `Q !0J]S~< p p p p p p p p p < p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p < p < p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p R 0 B 0Z ZV PRJ  000 00 0 R 00   00 䬐 0 00  R0 S0    R0(  0  x0 t :x00| 0 R  pn0P/S@g0P/S W :S 0 cR ڀK< @ 0S 0SS|p0S +S -S AT 8U0P PX8U |tU 0S 80 cR 8Kv<0S0000STd X@ / <`` X> S`S0@P {Z @K 00 Ep Q)p |0〠 p D00 p 0 p 0 A   00#0CS                         d    |s@TQ #T  Q00  0   00  000 RQ5@T*T000 #0CS #X50S&00 R 0@T@@@  0 @PD0   0@ : 00s03S; 0-S=S ?S@ 0S 4P 0S0   Sl0S 0 400c0 P 0P0 0#0C S ػ p , `p  & P $00(   0S 0@80 cR8KC;0Tp00S) 0  `p  0 $0( 0 0S @80 cR 8K;0Tp00S)00 `p p Yp 004, ` `@enSP 0P0U*°  PZJ 1 ( 000 ``, A000  80 4  p Y[  3UzppezP 3I0S p A x0S  Q   P0UK*` ZP(K400c0 =0+0P9Wě09999dhlE8 90L40StbpP 0P0UD*p0 P dGPEP 0@` DA AP@P0 @`DA AP@PC@w  0S>0 0R900 3` 0 P40@XA    40` 40֯!0@Pc `a R0 00    00@"00@040apJqP0%S #S `V0S   0S` p   W>P6PEW0<0 ` l<#S(pp@`Ph3 `P( 0S K H`@|P  |A 2U  D` 00   p` ` &4 0 | dPK@K0 p )a0S @80 cR8K9900 R `U` `PV' 0Sr[pP 0@S*S0]S @V*Vpt5@ 0Q  0S00S T  8%00  > P  LZP?0 00 ~0 :S 0  00S     0 [HpP 0@S*S Q  =R  D]P`@ F7R 0  P@U @` @0`'Y`l0 R0@T  0S 00ST\ 00P7H`PG @ 7Q00S+P@ 0]S  #0BS  #880S$8pZ\PP@ `0 T l@g DA A`p@*`PUg0S(0@S@@lP k 000?0 0`A 0` (  `p0` 0r<PF`EWS|t*#0  R Q+R  @ (\_P#\_\;@P@q q 30S \t_P PP <0 00p`0S [\_P g u>`p(Y[(< 0@S@P R  P@V :|<AA  Ap`P Dp 0@@S000 u e0 ,W ] Z p-L Ml`0@P 0$K 0 $0 $00`0S@@FKp9 p-L M`0@Pj 0$K 0 $0  { $00`C1@@ S @ Kp@9 -L M0@S`' p< P$ ( *(0  (0 P (PK EP( 0Q*00$ 0` (0 0@K  ( $ ( $ @`DA A@ @ $ ( 9 p-LM0PS` `@\`1T@S0 7Kp7 p-LM0@SP` P`8P1V`S U T ?Ac Q0 0( $0K$@ ` 6Kpgfff7 -L@ 0 #E 0-LM@P0 EK0蜚 p-LpMPK@`"P@@PU Kp : S  S @PV 0SI -SLM@0 < @ 00@/YmP[ ᳫ1P  000 , >00T080 4 1 `:AmP4P7 X pf80@ cR8K5P@ d/00P80  cR8K5P  T4<@ P 0S4,(K` :mP4Pa4`, <@  cP 9 p-LM PK`|-M0M@P  V 0 /R 00M@PKp 98 p-L@`P0=S\ *SZ +SZ@L M 0 ` pt9 -0L@pT`T P *MPT@0t03V0S  M 0 0 9 -L`L2p/@ulPP`F  U  Q22p 0@P 2U @ |9X  l2000Y @ @ ("00P00 FY\2P 0 P 1 P  0 @B&1 ; 0 8 TP5 0S0 h LP @ 0  P PU00SP LPP 0 P 0 00 0001   /PP 0@pX>\h0P@@  0a 8L0P0{98889Dt99 -LP`000K  @0`|;X P0 00P;000 OXKv30ꤚ -x0tp00lL @`0PPC0D03 @<000087H9h98 0-@LP}K ,K@P 0h  t9Ě0PR000AS  0-PLM0( 0 , i AF/$ 0 0 R<  < 0S41  V.2@PA, R  (=- ApB K041,Qk"( 0 0$ P !0 00 =$0 P0R@@B )`0  0S A h0  -`$0@ ` 00909 9}Ԛ -0LM  00  P,0 0P, K  0 -? R:0 R< 00 0;0  0S N@PY 0 @ |0 R\ 0 RW `(X p>$Q \KP004>X #,QT X 0HS񟗡 0-S 08 KpP*0S WJ= P @0SP YQ  P1X VW 0S 00CS4( t t 0 | < < P 8 L  < R  , pWw 000 00 Sl<  0S0 00@,0,000S 0  P 0S!%M; R0(K|p}; R 0@H  VYv @t+\0KrR ` bG\K007Wt +AoPj 0Sg :Rc0 ]0 R  0&0 R 0 RKP0: Sh`0S\z sL0 R8: @@(:  A4 0 $9# R& 40 R" %VY >40 R @440 0\9` 0x>40 @R8 :40 R 40o |0 S0 0 R  G0   (\0K Q@F -^ 0X XH |(|8XX@@0 ^ 0P0 0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D *0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sj 0 h64 00T6z@P 86  O0DSLT0 t00@ 0Si 0 Re0 4 40 R 40 yP  H5Pi40040 4 0S0 0SD0 R@ 0 jP 0  a0 04 4@P 4  0DST0 0%0 0T00 0 @0 @0 R@@K <0@0  @.000 00 0S C0 0 0  @c00 0 4 00 0 @VX4 I/*04 0Snh@4`{TWPP 0S0S8S 0 0P0 @\0 8 Kݟ\2 y@P6"0S 0S>Rb0 @ 0 @@`K@PUPBP<0P0PS *8K 㪟1 00 0E _0 >m*4K\0K (!O 80!)X*V*0 00 I0 q0  @0  @!@0 0< 0< 0 0 P0 0RPPM|POd999 (8487 98 @hP}T d 888Lp'"ě0@ 0 R_ 4@80[ R`  `0`SQhSV0SPPuSVD PhSV0S PNVPP0DQU000 0@ 0 0 0  0 S00P0#Sp@8@K0;S T0 0 40 R\ 0)S40 40 T0 }0 40 RH8K 㘞(q){b[ 8< -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- N.PpP(?0pP pU H  8 R=0H0 (01@PTs H0+`< <0SX 0S <0S <0  xX<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 ;00 R   0VD R I p Q0SO 0 47@# R WDaRU;4 :@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <V S7 D 0@p|V Q0SPU <0S < 00CSY < 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00@P 850$<<#04 <00< 0< S T'  @0,(K46. XH WLD <0 `<0 R <0Y 08 ~0,0 < 0@<0 R <0 0 )PqD P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /LdP  (v 0,0 H< 02Ģ@!W`D@ B\ @0vŸ<0  @  0`, sN ,p n04M  b l2 , d X> 0,0 ]&s'<0@{bY0 , 0,0 K0`H0 <@ K<0 RS <0MY 0 ~0,0 7<0  < 000<<0 G< 00<0@  8L1@ H@ 00 0P0׾@0 0S @=E :Ey <U<0 >RkQ   0,0 , d0 &9l   8T@ 74L999@(8H X9<̛0\ 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00Tcp3P000QP ^ K K  L0S0K\ K00;%h@ -8@L ?0000 9 -LM0@00Q & `& &0BS\ P H ,    | 21Ch 0 X 0K 0 K 0K4-S0ě 8P\М -0L(S 0S     "(0!B "0!B \ -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f 1@;0<000 @ RPP '0`0`@0 [T5 0S(Q ` 1@:O&00`Pp+0 0pS T21C   KP0p`040)00`SLP`(  99\Ȕ 0-L$M@8 0 0K, 4 $@ @ 5%1@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 "R4 8QP$ [Q0C(0  %W  9 -0LS@P 00S p `QP @0u@050Q0 050p c -`Lp@T  00@@0A   P  QX @xPX @ - QL M`4 ,@!0DTPPTST] #Tq Tz&0DSpQZ(K4!T 0p0 0 "TP U 00c 0400C00 @pPDU%21C0 40RcT  , \ 0D,0 S, p RSTT T 0D0DTST U  ` P @ 0  @ 0 @ D  ` P  ,0 S(0    Pp@PDU$21C0 40RwT ,    0  ,0 ST  0S 00 00: P 00C 0 0Rö 0R 0R 0PSPUr  p0%SUv 00 0  00C 0 0S 00 00 0SH 00C 0{ ͛v q 0Rl 0Rf 0R` 0\ 0"X 0T 0RP 0L 0cH 0D 0S 0SI 0 0 OB 0S2 00 0  0p0C 0 0S# p<1p 0Zp- 00s03 0& u0p$S 0@p, 4   \x 0-L M,P0@4K4 0@ (00K00-D0D 0lCQ  /10 0099 - @L"00  -L P -LMP@, J_P00PT"QaA0 10Q*(K0100CQ*00 0!  BR 0㷹P!` pP4 ) P 0@0pP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PKy 50 r 0l$08 999  -RLM@PB `0S  U@PER      0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL6 @ ,,0  ``  998 -ML3M 3R, , 0R(Kl#00d#dSKNXP L+P -d@P sT~ 0ø܂P  0@P0 p` 0S0SZfJp J@ @0S00P :S\  P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!E5- P$ cP@f @d \T/  omP[K@t000^@0 J06S 019-P 3IKAAP$00P89h 8  990 -<@L0S (0}/ }J0 @ 9989 p-0L R PP M]P l`PdphpL0@D@@80( ,0 B @@  899 -`PLl0V ``p0`C!VQA8 0`0Qe @ᢖ9998 0-L L0L@PD P 0dCPB00P099 -LMQ@,0 ``p+ PhEQT00?@AP*Z:a@ \FP X@0fPZ :,0S 0P 0hC99 -D0D 0 LS:PS0C  099 p-LMPK`@)P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x x 99ܝȝ -$!$A0LS`: q Q0 R 0B0 ֵ00C0 V pP  \P@ 00 R0 plP@p @0 ,TP 00D99 8(]09 -:LM$ `R pp p p p I)<&pV 00@CS          < < < < <  < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < x <  < < < <  <  < < <   P[PHx(%p0XA P YW pW 0S㴀 Q Z0S0S  @TK X យ 囙7  000 , &004 080 pP ^00S  8  bRڥ#P@ O K0 Pp/P `g 0 .8KQ}yu(K6 U2^ # Z 000   7$6@  ^* p8PW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A0@ 0@ }ZPP0 d /Q00`Z  X 3R+h|dp`d\^ 00S 0Y   ZJ =q@N gb40&([@ 98̦9\@ 97(]|4p09ܞ0     8(0$0PQ0080 -0L`0V`Ppo@@P,@ p0PP z0! P 0$0  0049@9 -@@L 00 00 D0 0 7$ P0-LtP lPP 0SP@0  0,@P00P 008 -(@L0SS 008 -8@ LP0SS 008 -0@L0SS 008 -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PP0&P00S 0P0&10P0` T 0 00P0P0T0P0 ꔟd|P -LpM|KQPt0: S K --80LM R 0 0 5+ ) K$7 P-L( `@T PU pXPp0 -R  |-@T PU 0 S0HLo- 00$0$  -R  h`-09L97A --LM4@0 0 * *L)K7 --LM@HH;-0 40 *( y*3)TK 7 --<0LM R$0 0 * Kh9ԟ7 --LM0 @0S)0 0 R   p0  KUP0 R 4@,0 0 x* %*h9(87H998A --LM\0\ @0S<()0 0 S* *h9(87 P-L@ ^@P X0 S@  -LM@KWP0PR0PKK  0-LP@P0a0 S U P0-LP@ T U  0h"0\(T0h70SS   0SPS00Q00Q R 0S 0S R , -LM@K 8#00 R000  0848 0-LMPKD <00S@ @0@S 88, -L`\M0V,0  0d#@00X3 QP# Y+0x t0  0 S 0-0t0 0PUP  p R ) ) ( p' 0"20lK@ f@VR 00Sm x +Vn VG ŸR2 T l K0+p PU  R0SVa V "Q 2 0 +PUp0S +, 0Rk(K0 0@9V0@50 SS@@l K.l0[S t!Tp1 0xl K_+0p0 V0@l0K 0S/lK@@ hf@00S $ t0G+V  A+lK@ Tfz 20lK@ Lfs @Q 0@ x P@%+lK@ -@ R x+4hP  +Th,,8;p@  H\h@P$<-0SSS 0PSP^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $r,X9<T04 -LM pK` ᪍@T P 00CS0<0@T 0S 0@ d X& ㋍PT 0@  ,897Ԡ -Q@LP 0= S; 05 @`p40 0^@Q Q 0  P  0RQP tH0^0   ^  <00,h$14<@8,ܠ -@P#0L0F%T0?S[,0 / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / ,0 / / / / / ,0 / 0 / / @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 / / / / / 0 9<2P 40S 0Qk R0S Q PZT႒1`@T P0 =PUSP@TU D1P;(1 P 0R@0R P0PU p0@T `'P Wp@TPUW |0P P00Q 00Z 00Z 009, -LM,Kp`P\ <WpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@  T  (KU<0@  0$0!87,Dě 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0,999W$,4< -LM`00̂000pSp Q  Q2 R  a4P 0@`00@ 0060@00 00/ 00 R 2 R 0S Q[ 1Q;PБc 0SY 1P 0S4 !k 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$$ 0S 0S U 0S0  ZxPP 20 5x0uP0h;00< 00>xP@G 0099`9LpP@777;T -L M0K pxƊ,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  w(K q@Z@ 0S㮪PJW`A00 R ܑVQ<PY  KG 0@0 t- h!P0 -  -0@ hPPF0  @  ,0!@#k괐< 30S0n  *x $0S T0P@F 0L8 7L4|pPDě@ġ -LM$`K@p( ʉPTP  KP0 0S$ @ 㴉T0d0K0P 0 P 0S 0S 㘉@ 㒉@ ㌉ R@ $0!n@89,Dě 0-LMPK rx0P h  g}@8008, @ U880 8P p-0@LTP` `@T P @P`Tp -LM$pK` P* K@P'  R 0S eP @ KPE \@UUH   0! @8ěD0000 R 40S0 D9 -LM@K 8Ј40 R 000 È80 -LM 4@, K孈%`V00 0 0000R D0S $p0``0$ 08PP@t0#SpTn 4@ Riၨ PP@@ v T$0S Q  $4 R 4LY0$(33 T:V @,K N#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K 2A>0@g`YN2    | 8 0p00% u(" 0S DD $0@T $($@T  " @1 1l/p!)@p )^ E ,K㺇X!0S = @!0S 1d`1@!@ 1@ @@81 v$Ns 0S 0 0_$@P  ?㐧@` PD@D 0T8X0(ĭl99LpT,97887Т\آ<<8<<X; -RLQ5 0S^ܢ܂P0Br `D@D \0T0rS Bb0S Px P d2 00U P@ P8m`t 0 "S Br `D0@D2 T 0S m7! 0Aq `D@D 0T 0Sd70Sh1 R80P0Hp00度aP @20S#  /0R 6 PC MP00lvC B00P`jCx 600xy`CT ,P00K9LpX;9P@@hx>(H -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TPM 0R 0S㊦ 0SP 0S 0 R0Q`0  hT@QH0 b P p `,999p -1QL@P` @0Ǡ) #/Vpp 0S00 B%0 S0 R @` PD020@D /T0S80 R h6h{@98X>K 9HX; -LMt R `4 R 0S044 00(KtK߳,K  lPPڼpKԳ`V 0@T@T 0U0,ß Q,=A A¼ ,(p0(c(Q=9 =t ,,00$b @(( Q$  =A A$ h0 cl Q=9b @ = $ $0H ,00, 0S|0C0 0SS0000x 00S  R R 0QS4 0S 00 S000000 00CSX@Q0S2 q 0Sf 0S& 0 S" 1 R  0S 0SA RpA #  0S 00SA> 0S; 1 V ) 0,0 000,`V6H g$ p @0V 8 R 0R 00CS0rTG00V,9D?B99HԠ4<8 -!MLM$̟, l( Pp8 d ; 0 ST  @T @0Pd( `( \8 , `\b TQ `X( \ \Pr !P- @\XX00SH p8S `x R p0 Bx p0`0, XQd( d( Pp8Sl\, 0dR(K0!S@ :LPK 0*0#X@ Xd@@hpQ`(\0" XQd( d( @ P P0d8  `X8  P T8S`,`X ` `X \PPU 9 RZ!0EVSVU lT XV lT lT lT lT lT lT lT lT lT lT lT lT V V V V V V V V lT lT lT lT lT lT lT lT W hW lT lT V lT lT lT V lT lT lT lT lT lT lT lT lT lT lT U lT [ h[ lT lT lT H[ $[ [ lT lT lT Z lT lT Z tZ lT lT DZ lT ,Z lT Y lT Y lT Y lT `Y 8Y X X hX W KJJ0 8(׃p PX@  Xd@6@hp\`\(0! X8Sdd @#@ \\d(`00`X d8 X @p'`XK L' `(\0" 1!MK@D@Dh4KJJ0 &p6K J0J 0&xp p00BS00ASwKJJ0 p&eX6K J00J0a 0&Wp~KJJ v2pv @h( }eJ{@T@P@Tp!]KPEPE+hZ}TJP@!MK@D@D4+KJJ0  sh}@JpI!MK@D@D3KJJ0 ,%_p8!MK@D@D3KJJ0 $Np'%7:@!7:rPJP 7v:JPKJ~0pJL4KKK t IP  IP KJJ+ Z IP 0p0KJJ +Zp!MK@D@D3KJJ0 #pK3JJ +fZpKJ 0J pd( L4KK$K`3K JR# $ 0pJL$KK4KKJ 0J pd( L4KK$KPu PKJJo + 3ZpKJJ0 KJJ 1 .~IPKJ0 pJL4KK$K}!MK@D@D(3KKJJ0 $"plKJ0 pJL4KK$KcK0J\8 p0CJL4KZKJ\0 pJL4KK$KQKJ0pJ\8 L4KIhG69@\C69@IP+ KJJ₣KJJ +Yp.KJpJ)KJJ +Yp . 1K0J1J0  p6n9 2P0/SX6b9KJ0J0 \ Ёph\709F97 lE8ċ8ĭL98d` 0 0 0-0LMPP)@5-9X0 0 P 0  K0p00`P0840P(59089$p89(, 0-00P @L v@= 009 p-@L@`h0DSt0 P    $ < (`8 , 0 4 p<408`BM400,p p- P0@S0C0 p0LPT`` 0P0@00p( @` 0<0\09 --`LM 00CS< 00CS,@@0 0 2097 -0@=C0 0 L ⻡]9 -<L@Pk RV\b ` ` b b b b lb b d0P 0S R  p, ; bR,WP0W0PP} P0S0So ㊿0PP0@0S <4  因`0a0Q Y 3 R 0S  >Q $0 NP $0N <00$ $ $@} 00S44000 00  0R 2 <@@[2 RY0,00e  P `> 0R, SK 0 , b  nRڷ,PL 0 R %GPq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, %*,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 土 ; @099887 9d999 p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p`09\ -1LM  0(,0 ( 5,0耟0P40 0 p@`T`\TT 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `w3$K909\ -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B ۟101 ? @  p@`00`" l `L/ P\P< 4ϟ0S006 P P #P= i> $0 0$0.0S  奟Kb  P\P Ο0S00 X V V0$.01 cRKp Vk j o n n n p @o \n $n m Pm l 0S0C0  P\P ͟0S00 )P \XR `X $X 00p0= R P-!X  $01 P\P ͟0S0@0 @ TT T !TL 00D-T Stt  h 00  " PK@K T T T @-0KU l  P\P T̟0S0@0 r@TPK PL+1PUF 0 !RB 0(r0˟00; 0 0< 7}Xm |X (Xl @X*X ?X+X !X 'X \X4 "Xm000 Y 0 p`0)X |Xh (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY] `00 p'X00p1 IYQ 8 0`0 p B `X0k \X  P\P ȟ0S00$P "P3 P \00p|)X (X000 'XK0l0 0  Y D 0 p`0c0Sp p |p p Dp 'Xs @T1 IY' `@ pL"Xm \X@00@0C0(X@@@ J"X 'X|  000@t' P\P \ǟ0S00(P 000 Y[ 0p`0&(P gt 00 [[X`  -P [00 p| P\P dƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0h% P\P Pş0S0P0 P(Uz {U ܄000@ X0 0 1@ cRK @P P\P ğ0S0P0 P00  0 X  p`<$ P\P $ğ0S0@0 f@$T "T 1 cRKy pT@ 0\  p@6 0@0p- 001 IY ` p#00 p1 cRKL p PC<XPP>X V`  Af V` 00 !`ග0FbSRT@T0<"0P(RA  `{T0Su  r "@i  #@Pc 0` 0S  0TX   0TS < 0S (  @0 <0L1 ] 00 p0W S WV(X ;X |X' 1 P\PI 0S00CX\ |X&PF 000 p`0w\TA `T'0@0pm, 0R(Kh9,8l8t89999P89 `89p<909\00 Y 0@ 0  p`<00CS0ih0 P\P 0S00)P1 IYa `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRK* p X00p0P@0  $PS p(P ,0 Y 0@  ` p 0 0 0 Y  K0P0P`| @T\T 0S00 @V@{ L{ \| | { #T`6 3 0`/`, `(V&004p P\P^ P0S00X:PY %P#Pk0 Yw 0`0g#0 1 cRK P@P0$0[TKP @0S @1 cRPKm P00 R$♚4 P\P 0S00 41:P@00 P\P 0S00p%P#P ]0 Y 0`0\P `Pr\XD `XB X@ )X@@D@ \X@00  %00C0@@00 X &Xg>000& P\P 0S00 P Pd00C00S0&0 H0`00C06 P\P\ 0S00VX >P00S00 &P Z00 0|P0@00 000 0 7E` KPj 00p0S @1 cRKp00  0pS (⽙P0S pI]@00W  K]k  K  Kn$0 0 p)  K  K@  K;.p0S  6  0BD)000@9 < 1 ! 嚙1@0 1  0` pa P\P 0S0P0 PU W U p0U 1 cRK@P@` P\P0S UU  UZ 1 cRK@P@  P\P 0S0P0 P U 1 cRK@P@L; R, P\P< D0S006(P㐋 ` Q@ dx00( 0C p( B`0    K  K K0PB  KcVT  KZ/CP00  KN]  KI;XȀ |Xㆀ <&XK  XPP< " =R }R3=u (0(20@0 00 <   K  K0`!坘0 00C02 S " :2 d O.h>X00`0  Ka>X007 `00 P\P 0S00 -P0 00!!#U0000| -LpM`P`U @TD P$00 `P> K:$>pP000T\S/y| w%>@PPD0 R 00@`P NP0: Sl0 0 0 00W0P `?=@P 00$Kd89 0-LpM|P@PpP`Tl 0T  KP 0 0K0|0: S\0 0h8 p-LpMr'((!0S00cS1PU3 P K`P0: S 0 0PUKpP L0 `  `  0S h0R|8* @!,0S\ePX(`  4}*P 0 Px|dx(]ph 0-@PL 4P@T  0R @T09 -$0L@T @T9 p-l`LPU R @0@Sڂ @T0 0PU 00p9 -(@L0 01h9 -laLPp0S  0R/ R @@ T 0Q A@ T 0S 0S W 00h螖 v`V0 Re0 xP0@CTT W1HP?@0 P42 p979(89; -P`LpG㖖P@pPY P00 Q @9 P-@L 0 RP0S 02n T000e᪎PP80 R (`P@[P@99;? 0-LM( , (0$#$ R 0 0  ,0S2  $ 0S2  2m@P T$ 2  r2 R=(0< R? 0SJ(@P- 0S0SF (2 RB 00C0  R<( 001 R (0$   g10S 0S !0S001 R !(0< R\1 R( ( $0$000$0$0 0S (0S Q0SwP (0  ,P/$0 0K004J 0S T |0 R (0 R0S( 00(0d ( la $ (0 0m90999d9(8  0-00P @L@PP0h9 0-L M, 0 40  00 ( P$ Y 0 R100 0  0 00   1@P P0 30S D0  0 T3 x00S 0 0000 ,00P 0$ ( @ 0@ 0S 0 0K04E     4 R $0 R^ 09(8 -/L@P@P:P8:P (:P :p3Ĥ̤Ԥ -LM0SĘ, , 0(OK0tG/s8 (K "Kj8@-@-nl\ `L T< D(@ 88P @P8P @Pg7 0PC' )弧@000u:P'g'00  P7 0! S P @ T 0+P'8ǟ8@P0PP @+# D'P*0@/Sc &0S6T  (ݮ@-'O))' (0hFS 0S 0S0S`V\'0 0SD 8J0&06Q,f00$&0@ 0S t0P 0P 0P `Pt@0S,"R@T %PPP5 0  _PDQBK߫P1: S pPp/ 0DSxI0,2 f 0 0D 織$0( p`pP 0S 00TS@T  0lP X,00V00 0S3  |(K 0S r&)L0S  0)#Y9Pj0S)G Pa 'ҭ0P]k@T0WW`H9P wP0b@"P ᵨP[3P"20S n4"1S00} `1QS`Q0G 0@Ttd 0i+~<%Y)Pk("Rl g 0S/ ,K)^P P$P$  $ 0 00 KPBKP 1R 1Rp)07  00P  ` 0dQ0D 8P6 x`90P @ - ECL9899t8P9t98k9$~ܤ 99xp9ċ8l8Ьp8$h|((xHX(8ě -@L哓P@- ě -LM0@0cSz bSz  PK  0`S R   0S PU  40!Vā t,((0 "4P _P@nU- k,ě- ` 0T00  R000 R8 # 000 R9 -L  4<0< R808R;\0;LD<4 ,@$h9 (,P 0-0@pL@P`"s00f-s@P@ 0 0     p-0`@R0 000 LPq0Pf 00 p Pp-L phDXPXG@<`P u  phPp9 - L@v P  mP -LPp f`PZ 0#S@Pʅ@ -@QL \P PP@1*@U0S pd \0P`d  @pU p@j00 -LMxP8 < @0 @庐H14 8 xrP``HqrTXp V8ʕ `grPVPW0 ,P V @PV@PX4 80<@ , 0|  V  ] YH4(Ko@ 40 00 V0``ppѿ9T\ 0-L^ 0    0 0 S0h@P H0S C H @0 @0^ '^ Uh\PH0S C0 ^U0(eP0h9\7Ya P-L@Pp*`@U0S)Q |Q00W0S V  ,6@P`U`V* P-L`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z35P XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P  -LM@PTp p0 `V Rc @-Q@ 000#+Q0Y00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V00,0 0:S0?0` 0402 ,2 `h 0? ? (K#V )5P :P& ;P$ ,P5 #P0 `@V4 !0`W ,0@000@@ R0p00p 0 0Q  0Sp0p @@,0010 ,0 0 @T! 0 0 0`@0;P :P00 0hP0 L0 H4P 00(4P`dW 9|4 p-H`LP@@%T 1S 4Pp&@Dp̈0 > -RPLM@ D - R*D @0ZD @  ҅< @< S@ < RD Y@0 SD0SD ?SV ?[S S D <0RP (KS:SI0CSD  "P D@ 0PpBSV DP  Y, 9 Z@!':,0`C@Z!: 0P   0P *SD0 S @@@ D  0P T@:,PX< RD  P D @0R`@S DP  Z8 :p@@@Z: 0VP  0OD0P C  0V EP@Z*8PXuD  Po @p@Zk:`DP  @ 0D&PPX  0P`Z*O< RL D0 RD 000 0R40  [R w RF R Q] <0S < 00R00S 040 Q*  R [R(0:S R@@`:g3P 0S# 0S ]\X4 00R D DP0]S  0  S   R( 1pf@T P P0S @T0-S 0S$ ^0:S<0S 0P0S40  s R2[\0:S  0 @0]S  S  0]P   0TP < !R9 000 7? -LDM0QPp@$0 P$ 0R) Kq`qUPP0dP@Ud`K /2p3 0 0≌`h9 0-LM@P KL!0S  P00Q0Sp008 0-LP@P0 p-`PPLP p@M PBp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0Kḧ99 p-LMH@P4 `0T0 @ Kp9 -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R @K$ ᓌ0 :9998 -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  8$PP%U 0T0  s%U (K<@T  PS0S 1#0  VV<00t1 VGl\S@0HS LQ@%T80( AoB* PAo܂Jψ0S 00 Q0W002|1 t0-S /-P 0-SXRDŸ | b`8sPpA `AT go1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S-S+S 0SP h!0S#0D0 \ t1S Q D0! R  t1S 0S "0S  09x\ D 1  Q 01 0Sl t1SD! D  ! tD1S1 0D S H<̈ܧ9Јħ 7 ܌ ̧ 0-@QLP]0 00h0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`2QLM0< /SPw .S8 z < pW 80S40 00 ,0 * 0S:S00S,0   0S:SS Q ,  gP00<R04 0 ,  0/S4  0  000 4 ,0 Z 0SR0,0  0c0@p n P0 bR.@  l80S<0(K40@ cR4P@4 l4 0 Sp/R/00/0Cp@80 00< .S0S/S000#80 pW{8p 4p 0p ,p m0@ cRP@ l 0 S/R/00P -MLM0 c1\, @ TPA @/T@/T T9 ///P `eP V9 V:  @/00 0 0  cR@B^K pPEJlPEp P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/SW0S7m`h -LM@(m0     峈00 K 0  fP 0Q/0000 `ೈK9 -`PLP$ l@0Tp kU x0U p0hIPpT @午 kU0PPP8p998 0- L @   0 0S[ :Q0 a/ 00 0 P0  00h  $0 0\ -`L p 0SL;z ( S , 0P@aT#T 幪PP@`0S[` k` 0Q$ 0% ` 009 0`j`0i `0%` g000 0= S, Ӈ@0  d0d`0 0 `)$00p -P L`pM WP@T 0P Wd@ j0 0 dX`0 WXDp X0Q@ i@`Td#T! P`@`0S#0 ;0 00$ \WL X ~j 0 0h0 0ꄩ 0-@PLP k 0h0 p-LM @`, v  0`KS' PK+ 峩P P0S  ;0|0`$0x R 0 B `0xT8H4 a$0`0p`  갩ȩ -LQ,Ml0P ,0 @ @ L  P %P0`H0 D0 .  R 0 B 0@@ P0 @00@0 , 0@R(KP0P0 L0 P D0 L0SLP aH0 P H `PU 0ELSL` d d T d d d d d d H d <  d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d 0 d d d w0 A @0E0 P 00D@SP 0000 SH0D E  `L H D `@ `| 【 `D w `t `q `n `k `h>A0ESD0P o 0Pc0ES< x x x x x x x x x  x x x x x 0 PP  d0EP P S񟗺 0 0 0 0 0 0 0 0 0 ` 0 0 0 0 0 0 ` P0L0 `L ,pK4!000c00R0guU L R-00gg|+00ggw 00ggrgq`H V0<0 Hf< P <  = b S< @ P0P<0SV@0C00 @0T  0S@1T@  @ <0S@0 B @TP0  R@T@< @ r # 3,pK0  g \x0X0 G0GpB00g0B,pK0000g 0S000gg  V@H` ʼnک30#P0 `,pK0倐80K3P0#P0P 8pKq 30#P08PK8pKg P0pP0 1WpFi30#P0X -P+PI PG 0P 0Pa0SS 0C0 00 @`FVp@ 0xS0SB 0C0 00 @ p `F0P@ =@T 0 B P0T @ 0T  RqT @ 0T@0<<@ 0a@0 0S 0C0 00 @0p0`F0P@0 TQNh9ܩ@ --LM0 0 K 0-@LP! u  :? P  &P0 : @0 P@ 00 00 0S P0 X~0PS 0@0 0p   - L @ 0S# & -*  P ~0S0 0S0:0x6  a$00p 0+ R0 00$ 0 - L@ R 0 B 0,p R( -P L@3 T6 pD `Q!   OP 00a0S@@ fpW   0Xd0P0 `\p Q V`T`@ -P Lp! X `$R9p R V@@ f 0`d d0Vp0 V f0X ` |0 Th 0-0L@P 0P  0000   ,؂00 0- 0LS@P P Y 0P 0P 0 0- 0LS@PP BPP0  0,壂0,垂0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppEžk(0l⒂@9| --L4MD@K0B 0 0 VK -p-PQ L4M`PP 0L@K0 0 0 P6Kp蔪 -pl`LP@)# T P (0V0W< `0``0$     xdzTu jP PPp P PPpPpԪ -l`LPp@% T9 V`+0 0,0$ (` p ` P  -/ $PPP P PPH[ȁP 0\⾁00@09 -@`L#0pᨁ00 0,0< (0P }@P T00ӧ2 0 o3Q00 ϕX@,G9@- 00090   -<0@L Y  @     9 p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@,X0T0@` DA .A000 0@@P99 -RL0pS@3Q0@A0T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ΀A000 0@@P41P``(P``Q 1&`p`3)P``0  0&`p`3TEP0  0BS Q` L `P H040R@0@ `w,899  -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  P 0  QP 0x  X\ 0KT  0~8>p @8~ > @0@40 8 < .~@0l S` 䝟0P0=URMUq0KU t tt 0KlpP `p1@U@PBPU$=p}t Pt 0SS<@40T*``8 ` <@ }` t0X\*` g }tt(KEUR 7|<U 0U6^0< KX0 T Lt  t 00K00Sb 7 7P_ {P0Cd0 N0 Sh \ i d0P 87@y|`0pSr 7 (P0@@P0 '00P 6 |P  U:@f DA e|&A0P@0`PM|P T1@0@ f J|)]%0S d0S  O\Q\ hp p0\p S5  l5@f DA |A`P  %h t0K 05t P<@40PT*$ + <@ <@40T*4lp  `<@ S P0  ylpP`t E@P 8${  0 0 ,43  PwU*00P3@f DA {AP`@h3  &0U0;0g0S7<80 0c0S7`3 R@C0S!,3 P<- `X :2@g DA q{A@p`@ 00Uap0P`!Pt, <80 0c0S2 R40\C*P00< 7Hd P;Pppf0S=TBp f ,{` Q81@` DA {A @4@ @8 < (8@1@` DA {A @4@ @8 < 81 @` DA zA @4@ 8 < z&0AA  zA`P)P806`t 0Ug Ps  Pn | PBh9  p 09x  9,89|~ HP -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00Pp  0007{ 0 @Fz0@?z P0P0 :00 0p0 p@(z 0p P9099 0-0L0@  PP0S p0P0S 0 P 00,008909 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0898 R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Ly0 S@P0SL 0 0 R0S0eCA 0009  y -L\ P0L `01P@U 1pT@P4U 0S XP0 -p@L /yTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mxxgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,P(K0Szʊ xw,]@x000 @0 0P, [00C0P$R    T8 0S 0  0R 0;?T0S R 0S 0  R 0P ;? 0- L @P 0Q0   Q Q 0 00  0<  0Q0    00004 p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 yKpT$ Kx$ 0R    9@ P x= -P@L1  !R 11; 0-D@LB^T @ 0 ! T @0;1 0) 1x;8 -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0;TX@ h<8<=; 0-P LP@w0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 00008@ 9 0-t0p@l l0LB^T @ 0 0S 0S T @0d9;l9`9 - pWL` % 0S !RRP, 0@l@   p <00l0d@P]PLv  @ 0  ; 0  6(888 p- L@PT" P0@Bn0 0S T @0S UTp@80 000 0d9;l9`9p0 R l9 |0p-"L@P`T0 @ H0  0S40,  R߽`p;d9l9`9 -LM04!0`p Q 8P ZP0U) P@T WKP ZP P<P| PP L0UP KP R R0Ղ"P9;? p-L}L`P@T wPptP 0@0lPptl9 -pPLPH Pu0S P @uP0u0S P @uP0u X @T `Pzu PvuPruou@Tiui_u -L0ML`K@ B 00P S T T  h ` ` t X 8 $  S@$N(K(HP CP)=):@$5(2P -P)'K|@(@}P@$ p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S        0     VU@ PEP@p0P@SP T0TSU S 0P@SPꐬ p-L`P@et phW -LMP`0  t0 00  S 6 00R  0Sbt0@0P PP00 R00  0Sbct0@0P PP00 pW6 @TgGtPU%  , X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU  h> D> D> D> > > D> D> D> D> D> D> D> > 0, 0 0<0 , &, 0,0 0, 0,0 R +k0,T0 UK(0 b H89t9D -L@ `P   00 R 00!0U@@ TpO 1p P@ t!0 00L S ? | 0W L? 7 L?R0S''0S( -\P #\W00Z  R$Wp@0T  R  XRxR@Upgp@ 0R@ @0T  9 0-LM@ KhpP@ `00S 0 S0P?  08j800 Ui -L,Mt0 ,0 HX   0, 0RI(K(!(1 @; p0W pPP-0K-`KJ 00f K@P W 0 WBa!00#F0c 0F C`C 00f  0S-00f   <0 0O#ODLh0gfff9( -!L M i!0,4 Y, 0  , 0 `p`V JPU 0 0 S# p`VZTY400S , @1@b DA, iA@, 0@ 0001 ,0 c(Koh T@T   nP000T@T0 400S 00 p00 , \0@b DA, hA, @0 4@ !0<0 M9 -LMK @Yp  Q -LM`8 <0 P@ 0[S =SX4h  D4P R cp0e k4p e  8QZ0SZ 3!h8  Z 40SW 8)@0 , 40W0Z0S1    80 P  P <X 00 00XS0W0Z0S,0S<Rd@T P &p0e k4p  4 0Yp Z 0 %   R 40 ?S" (K1 PRj  P  P吶p s40 ?S40S4 p 4U\wT P? VP U egX P 0000s T 0 PPRF MgP  @\0`0 00   Q@099|@Ю9 0-XLT L0@T P ^ @0T 00480 -pL `T0P0@@TJP 0 P@TZ 0 `0 @ghf.0 P$P99 p-`LXg0 0Pf0@0S000 L000 L@P@U Q0 T 0Pp9P0 0 .P'@P @[P {P}P]P (P)P@-0pPP#W! 0` @@P r 00  PJ0q0 P`VPJ\L0 q 0 9 -L0LtSxP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP dP pP dP dP dP P P dP dP dP dP dP dP TP dP dP dP P dP dP dP dP dP dP dP dP dP dP TP dP dP dP dP dP dP dQ dP dP R R dP dP dP dP dP dP dP dP dP dP dP dP dP R dP dP R dP dP dP dP dP dP S dP dP dP S dP dP T R dP P dP dP dP pP dP dP dP dP dP dP dP R dP dP T dP dP dP dP R  P@R Pz@R 00hOx7 @h7@ pW0`P@T `PP T P @W0VP pPEUk V@TZR @TX 6  @TJ0s 00As 0@TZ@TPR(l 6 @ PLT X :@U0s 0@ T0s 0 @D5 P@@T@Dkpx5 aRX0 T5 @  TZXX:@0s 0 T0s 0 TC0 \0@s40 BP9|5 |4  0@-0s! 0 @TR oTR 4P @ `TX:N@ T r 0ȣ0  @^00 @D@^0 q 0 @DR4 03 @ P`TX:p 0 ' 0 0 Q3 0 | 0 @T  0 Q 0s @| 000 | 0Q0<Y ^@€Y~ \@{00S@@u1aP,\ P!.U@g X*I@Ua 0 \ ^@TZXYV@U1 Q7N0  RMF0  R->0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ ꘷&9 (0 R00PP09 P-L@ 0 p-D`L0@ PR  aC e 00b 0p p-@QLP! R `0 Q 0Q 0  dC 000pT`  0Spp0 aLC 00 0 0-hPL@T\@D P0R  P 0,0 0S0C0000& 0 0  C@/@' 0-4@4P0L  C0 0 0@'@/ `,0R- 0B&P0 0l ''9 -pPLP@`0e R0@00U0C0P 00 0b@0U00P 8 0U000U00P'' -PL84M4$< 0$4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<04 S _RR  V^00@0"0<0pWS0N 040  VP\ 0SYW00S 4 0 R 0 V0WP ڐ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b2`?ÐY 0@m 0` S PPT M0 V0 0C V0 0@p40 W!0040  V080   0R00l 8 00@1V@8 0P 0 qS 0S  ~000PU@8 0S  +@R<@ P0S x0 ~0@0004 S  ,00c0(KP @>@<'$'4'('9''8' -`0` \0@L @T ~ ~$0$  0 4'0'('''8' -,@L0S ta0000'8 -L~h  0- P@L]a0hYa8 -L0L @R TT^h~@@$hd~ F~@9 0-@P LD 0 00h p-X`@LYaPUa D0 0 p8 -LM@Pa0SW P 00|q$K(K0 @,K @xy`PJ (1 ($; $0V0 P,0AP{E yP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6PꌷY &&&'& -L MK0 K @KK @ y@P }zK -L$M@PPb0S S P 00唢U0 ,K0K4K8@K @xP U@ `EX80SF40qD`@0,0,  !{xP00SP 1T0 S/R  P4y1!1|1|!@@R(K40X``pwy1 @ 40!A< :yXpPPU U 40A+y5P40< pꌐPz CP00dQp X0P@@^P[8 4|4PꌷY &&&'& -PQL@0 U a\`V T 00@,00<,``4<P x< R 0R0Bࠡ0(K4< @6 ;+;;;" R% |[y0S8cP` 0 @c\Vty\ 0` cR@0S0C08J0 >0 :  `>Z cVH:`V@ :0*00fc@A ZWP)00@rTJ0 0 P@0S0C0c9*9)@@ >9@bl9l9X)l9V<94)`Y89@@ < 5P`FVT P9 0S0C0V) 6HXPn0 0 08! R;T8(@8L( 0S0 0008 HPIAV QB P8  q 0 QrQ8 \, 7'x7@@\ 0`l7@D7嬧4'@7 0S0DW000Q0 , {>1Z``g ? P, 0WSwS0  r 00 0 0R@s B 0d -L MTPD H P兡դ.Pՠ^0l0ŘnN cR0N 0NRlN dN`.0ZH.Z  9  90  c > B >. =-@@PxQ4  P 00 S w@t) R ] 0S 0S 0S# RP~ x  P    ~  0-0 0 @_00,QB T00^@  T  0 TPPU Q` Q < R B 0AL c0  9H< 0S P&0S S S00l000S 00OPm܃ $ T00e ˟0  @0 000D SX X˟QT;P;  @;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sh 0!0000C00 T T`` 0 *TT 0T 0T :'Q{  9@ 9 R 0  R'd9@ M0 0 0C0 TT50  R> 9 ^0 0@0$0  00bv@t 8v 6vv R8 0 R0[ 8PȟȟH |P 0S cQsQ CQ \8P'P8 pq 8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@|O= l u uJvH0 SD Q 86D 0 0 (Kl&0SDƟ00*Ɵ0 ( 0b00v P)uT@T[ H6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T (0STS %PTd $ $ $ $ $ $  $ $ $ $ $ $ $ $ $ $ $ $ Ĉ $ $ h.P' %@K# 00C0D0 R84 0@ L4 P 3ß P @ğ@$a00@P P0 pg00x3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ž320P~ @ R B0 0P0 0 з0C 0 0QH2P0" !@0S 0 ` aU71 0 f0b 00R0bP0`n"2`<0 @0K0` 0PFP @ `vPE`X@ ڰ 00 P  a7 1 0Pc 0/T PP  XPzbd.10cSsS8 CS6 2 xP cX )0  c6 00 0;'&'&&&x9 ''0'''('8$'8'@/4'<''D7PTLX9&&ȋ&x8 -"MLMŸQ p,  S P2 R P R+ PP 2 RkKAAop{ hV~8: S}BNK@D@D XPw +;P 0@(K0$S RM jBNK!@D@D0+nPP X$ ^K!PEPE0+nPZ ;`;VP +5+5Hj 5: 0p P0+5, 0R&(KɱdCRjj jj~jmmuj|rjtmpmhjj+g50cjhA\ D\  (hıx 0-L MP@P Q 0SP R:00 0 0K00+j((j %j !jj눲̲ -LD0"3 00Q@0P 00Q謷H@ -LSM✀0YOKp $ Mp `IKPK@dK 0<@.$ 0R K*mսhtd@A  -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K 6  XiS 0R KSi 唽h@,  -GMLMȑ0Pp,0 h 0S@`LS@( ,S0 0,SSBKHH j   0>pP< IKAAimp: l41` V,0@SV1S   Q RQ\ ^00\0S l1i`, 0R(KD&i 8ulWl $olihdxP0 p-L M`P 0(0P`0,P 4@0 0 0 5400 PPKph뤷ȳ -|\< 3|NhD p-0St0``QLP @3!   @儠@Q0S pQ)hz|( -LMMMNnK`F0`F@/㸀K,0 p3[K 3"K 3 3 K !0,2 0 (2 $ KPP6NK@  0 0 ONK@D0@D ,2 ( $B t t K@ 2 2  2T NK@x(, 0R(K k帻h(BHȳ8P p-LM|`0.^K@/0 2 ,K) L0 DaKPKK 0RKpj医h'B\` -MLM0PQ,0 ` H aT`  p1P +r2TpaT cTL CT hagT0#B:WCTGWC^KPEPE/R2$3$# 3( K@#(0KV0@ 吁  1 \  0<p@ JKAA C0@3S34  x  ر ȱ @ 0  $.p$0cP1 @ P`T  ,0K j7ttp0 < R#@0U U U U0 @ 0@0 0@0 a3 {#0 @P`0P D0 q3 m꘣1 0K@0 x3R_ 0da0<0 XD3P#S0#8 @P`L K30H0 G0@P`B3 >0@P`92@ P00@ S`4 . 00K@ |00S8#840 `"0 @P P `D 8"0@P`" 0@ P`8  @ ! 0@P`080 ! 0@ P`8 110@0 1 /2(KOVB 8 9V0=8VIp. $q$B D@P+0V oVPD  0@0 P4LH a|at\ ^d"dH0aXaPa`A(DA`DAB€0$ -LMd`0@V,0  pܠK?PK@ + @060#0@@T z    C  + @@D0\0#0@@T ^    ' T, 0R(KܠK I@@K   p`匴h԰ -LhMD` VZ, P@ , 0Re(K0Cs e*P  /VW 00p0 0  @x t l@ | TpK@PK|l <0 ( p@ t |x0  0pRZ h@K  0@B0D0  00#0Q Q V@1@# 1/`V |  | d +J$0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 zh -LE -0L 4|Hȹ -LM@P #sD!~pt1` fRAP !0000CH!0?A1cS @PQ.Q00A   S$K.Q 0 U0S,K,P ( LP ꜀`0`( ?Vᘠ*Ac 0VpS0C P0V0C0pS0 C RZ00W gfffA 0-,@,PL( n j㫳H|  -LM  \P: K 㓗p* 0#4 MP; K ㄗp 0#4 K߁pd@dd d0TD @,8 ,0Ꜻp4PD<<̢ -LMp D F`P= -FPr "P< @ 5R ϙ0S㘂 @P *p2DmT `  VPUa a(KH0 0(P@@D套< @ da@0SO ᏙPG00L ᳓P4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , JP aP  o ja cDP D[ Vꪑ0-SL0S K Gꛑ<@@  l0 R \9D,4r <0hDdDMblD -LnMxoKH0H`,0 p~dP%L3Q ^P03 R;$3 RAP, 0R(KI0S  6: Sl KAAHdP 6: S lPPv6: Sm n]P, ("]P KAAߤP;Kc2 [1 R |A@ga Px+a0: KP`렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {aNK@D@D P! KhaPKOPc g^VYTP|G~pJL@TPqPhlDtDpD(HHW wLhܹ8 -GML Mp2 P@, X"|p fP. iP% ,"|p 2 PbaU52IKpJQAA(P4: S X>1 11 1tBKAA +\ P: D\d -$ `0V/S /004`04 X p5 p@/ᩗPP 0PST @T 0/S 0/S @TP,0 S`WpHX  (lPpհhpDlDtDx@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -LI\뤻 -LM0@S K( ~p 0 _F -LM0@SKP g  00  -0LS@0s30 RP 0s3 -0LS@ h? =  -L@%P 0=_ 0-LP%@P P 000)_ 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XPP <0 e 0,0 00 0 0 0|DDxD 0-\PL0S S0@ S 00@0)DxD -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPR0P Sv` OQP V?KXrP 4P=@hF@( 0R$KP.@JOK <V [hDW -Lp` Q( T (@T TT$PP P T0 (ZZDĻܻ -Lp` T0 0 00b00@T TPP P ZDĻ -LM넃`p@T T T TT T$KPPc (KP^ 0D S p <  $ (0Rpprp{`$ (0Rppecn`$ (0RppXVa`$ (0pRpLJU`$ (0Rpp?=H`$ (0Rpp20;`0D S񟗯h 8 ` E `dDPpp `VDpPp`IDPpp`;D`/Dppp3`" KD p-L|`P0S @PP 0PS pD p-LT`@0S PwP 0@S pD 0-@PLTliPX0H0@ R0S(峑F뵭9W̢|DD$! -0L a㢭|H-0 CR 0R0 S|00 -PTL8Mp`@MPP NP@"xpp3&@pK0K`< , K00 @` '@P,00,0 #PPY , $0< ,0 0 @@'P \B\XK (pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PP?40[S  5[0Sl|{t `@L0VU D00S8 W ${(K(4\ -0L ݬ|Hx -0LAM @Pp  uwp sPp  kwp0` fRAT (EP㯬NKFPP W+.3PP[[h_ -LMp@# 04 4x8#Ȱ, ච @ P0P#00 0P00S 0P@T*0 "4b*4# < 0  Bf 0t@P?P; @0,K,3Kz 0$4R SR8 P 0S@P{Pw 4#0SP *`4# (83 0` 0# 0# <0#0bSJU:YU @34S00 @#RFl1@  >P1KoKK˟K0p`P 8 1@ P,K@T00L S 0r03.\0SRU   P,U0p `!PX\0 T 000  ,0  ,0 S(X(Kh0HIDHI -|1LAMt.0pd( AP"p{W@CBNK@D @D  -4[S2  -bS fS! !PP Ƞ 0(PU  @MTFW@P`V 0S@BKJ H J` (0 S$Kh8 -BML M2.0x, ?APp V@BNK@D @D  14[Sr FmbS fS`ZZ  Z0 B1!QR& p P 8 !84g!<!84_!<@lt!84U! <@DDH!84I!z PP& Ƞ 0P -@T  00P00S  V@PpW H$0S@ B>K0CCK`I 0C I`FpH4  ,0 S,<(Kh8 $<м 0-LPSR Q LP.T 0.S @PTa DA0D0D00褽 -LM @K0  0 S0 0 0 K  p-0LSP`! 0S0@00 0 @00c b0R00p000000Sp -LM0.0@|B0SllRP  XXbp<,KP 42 , (00S S0B,0 , 0BS $,0@p0#S #{Pp/0P p!P_P!YP0 0,0  pg, 0 S S R ,0R0!(1000,0 0P0 S S`` 0@P@PP `P ` S S@@  U 4 P @Rp 0S@@0  8080KL 00 1(0 @(K8\TJI0XXN$IIUN 0 00DI 0-(PLP 0@T@0谷 0-4@PLP 0P0谷\t0 -pL P` 0S  0S0 &yP @PI -`Lp0SqP @lP 0S@PP -LEMƟPp4 l 0., ?px@Qh @ !\60Sl4 p04"48Sl Ɵ & Pl 0  D `PDDP5  ep4SS00d4 H DD@$00D4 HD 0CNK şh4@D't@D`tD T$ ` \ Xt L P$  D  0ll @PDP @ T*]P P*X P*S ` Vp*.UU Xd$R, U*`4DS*xğl  t4PPtP DD`@` E$@@DD t@$4` dPUt}D$C0D4 p \UCl  t4@YPPtP t$D4xß@ cT`vtZD0L D4 p$Uv U U3 U}0DDLoPH$0%20dl  &@PD{PbT$`RD4Ÿ0 `"QW*D40` tR DD#@DD KH2DD<P L 0% x0B 0W,U <K "<0S80S40s T\DD@#@@DD D4!00SD :\4AS:P\P `\4  \4 D4`0D4 ZTD@TD XL|X  V0#03Z0STQ% P`$0``S\4`Hj#D4@ cTHD$0D4 h0  CKA AX T0`D0  ,0 S@(Kh8ITJUN0I$IPJtIX -BMLM3@0|., K=8 p  XZp0S00SS & 0S0S 0s S 0S S pX X0/00 S 00 p2 X X(BNK@D@D`,KBK@@0(("@P@O Pd0 , !EPP@`Fv, K dBNK8$@D @D  424[S B>K0C P㈑ 0C B`<4 @$ Cl bS fS93I@P4 Ƞ@ 0啾P@$ 0PP!}   0 X 8$0  0 0 p0   *P`VU<$0S ,0 S4(Kh80<XN$Id -tL M.0p`Y<p`X X   #005`/00 2 .PጽPp@00D S/0PU0 E&0S.S'  Pt2 ` ՔlB,4PbX"X<,0 @P P0 ,K("2P{.U R0t 2000D :mP 1 0:T,PU0R.S%  IlP0`0Q`A,D1L!L`P@P P@u  0D:U .U 0@K  00[S `P0K$ bS fS4@P Ƞ 0EP  0{`lT`PUV 0S(K80IXNTJ$IIUNt 0-.L0@\n;Pp0h,0  P0h08G-M  T 0 (0@,@ P 0P`p4`08@T` $0<@P<0  0(,@4g0  .,@P(8P 0 0<fP \  .,0 "f.,@ 0 @P<4( 080@ `p(0, 48D`(P,`4Lp8pHPX`P@0 @! 0@!0Q1@`P@!@0`!!LP0hH. .pI$HPD0&E$ H`D0#j0 0 0#j 0P%@@X@ @^0LP@D PpX` DHL@PPTP00 `0 00D0 00H000 000@000 PL`000$P0 00ЍȽ -LM@ D1>?  08^P0Q8 n< ?^Q@ n< <P@ < 8 <P8 < <0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0h0 -RL`? D@A1>?0( @PcXPp: @0!0@@0D@e@0!0@@0D@~@00 @@0D@@H@?X X  Pu@0!0@@0D@ 0-PPL 80P A@0@0D@0Ⱦ P$S0S -L0MpQ`N 0S SI0SSSD CA$K0P $0S("(04"48#H^0"S* 0' R@ R@@HPK 4 K0p ,@X 0S S00@ K@< -0L@ `pPP P   0 0 00000   -0L"@ iP  -L4Mp! 00`( <0 PP0C@P, 8 KNP 0R R@8 KP<   7@P <@PX0K0S<0@0 @<P 0@ (0 S G$Kh -PL M.4 080 /pP 1` _ p@ @>l1@h`QP0000,0 8 p0 0"`P(00 ػ`P0  D., 0P 0 04"48#80@T4ZYT0 Y  Y  00 ` `(K80 p-ML M0@P0`. #8p0$ AK@T@  3 PP 0@ K4P.SD@ 0pp @a PT0  AK@@J 0 S Kph80@# -LMZK0MH$ KP(@, @@ ThZ Z ZuK p04"48S- K [K K(PEPE: `4e 0@P P ZZ:K Z [K(PEPEnP 2KTTZKK K(L(NCKA 04'ăPN 4@@4 A$$0B40TKK i 0fPP P:K4P:KT@ ` PUp @ZKTUZ3V+K4ß =`PKP K KKPUU@*K$0*K4:K  0KⰔ ~ZVV Q VOV VlK DP ZKŸ%4"7V00W0S0V00W0S)V <K <0S80S40s :K4S ZK0ⰔKPV P@$*K w:K4PZKTZKK\ K0S K4K@Q j*K$0*K4:K4PCu:KT T0#03\0SK^  KP K0  =K(0C*K0C$=K(0CZK0C$S=K(0C0C H0 <0K   ,0 S(Khp@0  -!ML0Md KJKZK(@(@, @,1 K(K(N.(N0 (K0000 0000Pp[ T: 0S?0S<0S90S6075"0"S2 `V &@>0Sp(@\ 0S V Q R \S  R]K(PE(PE0s3SS S00S K(LL@^00K(pPK(LLKK](N(LJKN(LPMK(@DK$A K(LZKL`JK$ZK(PEPQ@LK$A LApPDLQ PQ @ EPP@(`F@ZKL P 0 PK R 0 R QK R 0 R Q0P@S K0S0 0SK 0S 0Y3*K$! WP9~0SN:K(PP JK0  @Pg ZK( pPK$@q Tm jK(pPbpP^ 0 K$S@0JK(!  %PPZK(!0 pF \P0 0ipK(!0 pPK$P, -0S'0@S 0S 00SS  00S SPKP0 7*K40S &PU pW:K$1S JK$A0SZK$1KK K@T =K(0C0C0SYpl8(K0ppZK400Q\_K P 0V P RR:KJK01@   Q 0G Q \CPRK0 K0 0S K 0S 0.0xN4*K(0PppZK8D KK 8 㚹$7(K0SK8  N+4P*K QbS fS?@ :K< ZK @`PƟ0P0 KP *KpFQ00ZK0Q R* R. RK0`S 00 0:KL?1 0 @?Rp0@`P@Pl@  @@P?0S@@:  eo -0L M0P@ 0 (`K  !X$@Tx ~op` 0 P Qn/B(K 0 SKh 0-PL@U !1 1 !320Q\ 0hc 0 -@LP 00U -@L*h*U -4@LP ѾPU\ 0-L@(*P0P@ P*0UU -LM8 Y< pP rsp4 2n zP!P20S002 (sPP 20S00#30#0sp3Pq Hs0k,`  P00CS00 Ӥ0 R r ,Kpx80SWS P<,Kw0,Kw@P 0K Lc00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00r04  0(KU p-LM@d`P)P@ 0  =,0@0S )TKpUU rS-@L`P"@3:rp 0P@r@rp p-LM@d`P)P@  0  ,0@0S )TKpUU rS-@L`P"@3:hrp 0P@]r@[rp 0-@LP 00]),@r.0 W) 0hsUUpNlN 0-@LP 00E),@r.0 ?) 0hUUpNlN p-LM 0`|,)0tr.@l&)PX!)\00SiP  0`P@)KpUUpNlNU 0- H KD+@0 @ 'P,@@ 'KUUYYUU -LPU  ?K0CUU>|UXPxPPE7| ;-0 <4#{<4#   0p@  0p 0p @pp8# 8# < 0`Z H?K<RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000PX   _K@PEt{T-xePEP {x{;0 <t0p@ <t0p<s0p8# 8# P,`LH(KLpW g ( $ G 8 0 Pl lPl (K0@|0@00i^K@PEPE FKDF Lv `V XF \F bKAe.K  Bm>K' 0C'cKKI7 A7嘗  B 0C⌗' '7 7I L@A BlG tW 北   ' D7 hG TG p$DGFoK46@%S@D  0PPD T `TOJl10lVJt`\&X6 R0X6 \& t |)P2jKt l' l' U]K0@ PE@7 DG p7 < -6K.6KDD @G 0IZS (i { { @Q@dB40K-0C+0S T30Ks>K0C` "00 0f7 P@s>K0C0 F2K F00LQ : dw4 KEWeW0020K000 <40K cY`' Pp0P7 ; PP 7<'QPPRp7 pp p' p7  D6S1 `> `:pp p  D6S!p@ D6S 18#X `P `p'D6  SQ`P`  S 1P` 0 P` D6S10P`P`,3L7 x0  .6KDP㊡H H   Hx3<\QH <' 'PH' `:pp p'  D6S!p7@ D6S 18#X `P `pD6  SQ`P`  S 1P` 0 P` V(L p p  D6S1 `> `:p'p7 p  D6S!p@ D6S 18#X `P `pD6  SQ`P`  S 1P` 0 P`pw 0  .K 0-6K<<Yp0̣p 0Q04 KH' I R 4K2H 5 :R3 6A0  `P`H p+ 0R000`H & 0"0 0dP`V U00 DH' 0D40KH7 Lw %2 H>&B lP`H H40KP`dU<P ڂY 0 K☐K-6KP7 H' P-6[PYS.6[Sp70x7 1@w@iTpx`*tH\&X6 R0X6 \& t |PjKt @DT0tp@\&X6 R0X6 \& t |Pj.Kt' -6[S b>Ktw0C0C000\& X6R0pX6 \& tw |PjKt .6[S b>Kt0C0C0 /&K000\&X6 R0X6 \& t |PjKt x'R1@7@iT z`*tH\&X6 R0X6 \& t |cPljKt @DT0tp@\&X6 R0X6 \& t |KPTj.Kt' P7@eTz`*tH\&X6 R0X6 \& t |1P:jKt @DT0tp@\&X6 R0X6 \& t |P"j.Kt' p7 twHP\&X6 R0pX6 \& tw ջ-hQ,Dh d'R,<6Sjtw <000\& X6R0pX6 \& tw |PjKt <Pp t'00h70\&X6 Rtw0pX6 \& tw |PjKt <6@cTlP+t(\&X6 R0X6 \& t |PjKt @DT0t'`@\&X6 0RX6 t7\& 0t7 |Pj~Ktw <<6< m@6H\G0`T@Tt\&X6 R0X6 \& t |uP~j.Kt' \w?@cTDnP*t(\&X6 R0X6 \& t |ZPcjKt @DT0t`@\&X6 R0X6 \& t |BPKj.Kt' Hw<7\S pHw p t00h' \& X6R0X6 \& t |"P+j>Kt7 @6HwK0C0CP H:0$ ,0 lS(K̷ܷh -DpL0`S@PP 0@SPQRP000S0 -LM0p (0 PPUoK0K/sKP@'L1[S  Q0P,KKL1 H1 D1 @1 <1 81 41 01 ,K[0 d: 7:K/rKP@ .( 0R$K h  -aMLM䢟0(0 P|P: p@4 [nK=K`F0C0`F+ -K$0K B B0T5 u\e E 0p 4o/K*Ps.2$ K0SPd20S.cKAA~rPb06: S"  S XH( 0R\$K}P[nK`F`Fl!l1o$0K@@uTaD[nK`F`F+^$ K@@uTaD&@Pj^0S L$ K0uC@PX dMX |MX !.X @c8~0chwd edA( -L@P p Z1W1T1T-at -LMPp^00!1 /8 儼@P +"`Y10(KyP`" +XTp` 0,@ ,0 Z,0 04 K4@ 0@ ,0 4 0 5p@-]0`0]0Sv]0S8 0p P*xb` a8Td \0p P*4P`]?00]?00\WYwd  -LM@  K K0K  @@PK 0-LP@OP P 00.S0a C00C SRQ0 -MLM, P* P@:?]?000!eN, 0Rf(KA»`P0B~KpG@DpG (K0 dABT`PH qP1 @4娻P $壻P 00+4L P*:]?00 0(N6P  H+P \0S 0x NmS\0S `H 0N 000 M$n}h$0H4\ -LM8 < @ pPP4K;  t@P1 4 D0 S 0C0 BPP) 4 `40  @#!P000S ,K( `P  㲤P@ 0 M B@PUaݽ(K @P& 00S0 KtP 0 R ;;R d @P 8P0< @00 zP@$\tp -LM< ~ 4  0 `~ 0  -^00+^   Sc P`X-^00+^  P00N.^  .^ Sp4 8 4 R;040 P 00E.U  .U SR40EQ7 Q  A1!O  4  4 P P 0O(,  p^#< [00 (KR P`800S80 o A1!O p p1  0^0 QQ \["00`_p L1  0@!100 , 0 K @ QP` /  06V4A4 ,00 R2"40`S S  0P4Z`000,0 <0   U7["00zp4 Z -L M4 0 0?O4K#$XY8  0OO$ !5BE;t  ["0 0(Kr \B 1W2\ , ~  0   @P04K 4 0 0@aQP#o` P`0OO${p' YHZ0 Rr04K@4 0 , 4 00@G ,00|03P 1 0 Z@0\A04K@4 0 ,H!4004!8 V0 r/, 40 0 8 t4cQ4K 0=4 0  8 _Y04K@ 4 0 40ds04K@ 4 0  -LMȠ0`p  (0 PPqK*P *( 0R$KUOK 3 SK3,KK3,KXK/95KP cK0*zh -LM@  K K0K  @@9PKR-A ^ QQ 0SL\* -L@ßSM 08@ p040 < @ 0@ Z0,K00<傤PP3 ,QW 0U*@@0S 0S Pa ,@0SQ  E04 SA, QP 0 ST 8 `q`3R`V2 X 00Y00S! 80S  P 8@ R 8Y=   0R Y5   R008E0 @\08(K00q@P@ 0 ,  0,08@ 0 `8eQ\,  IP,,A, \ W04@ T@0 Y@0 W 40 S Y@Q  R88@  p-LM`0`@K KKK`KTPP +0 000Kp] -0L: TP] -$0LM KUTP] -ML M␢0匒`,0 ZPplpP 0/Sg T Pk BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SIBK@@P 0T 8X@PV00SV00S040 t, 0R=(K0P H0+:_P 0SPBNK@D@D+wP 0S BNK@D@Dt+hTP೰BNK@DD@D04  P: xh]$D,lEPl P-L 3 c@pP 0S %S@ ß V *00SS@f| (Tt0%0CMSꈩ X X X X X X X X X X ` X X X X X X X X X X h X X X < X  X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X L X X X X  X X X X X X X 0 0PUUwWx 2 Q PP U W1 } PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@E]^B^tgfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7-@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EPz L"-L@Ÿ  RP`@ j QuN:R^0Cʠ &   B b< 0`C46H&0/p0/Ơ@ Q a@ p Ђ0T/`P@^0SR S PP n B2c `@0 T/ 0:56!ǠP `Uv00p   0j 0P`10 Q 0 0P` -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&1x'x )8HR@J*RJ@@bP 8#8R0PE*RPE 0U0D L H0 RLK p(KT`V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HRR[R0:4R005%0\, 0l\9c%)x'x )8HR@J*RJ@@b` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`48#8R`F:@b< h8`  )8HR@J*RJ@@b`l 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 U @ Ax@ 'x0!8H,0RS@@A@ >:@b = `)0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 FR0@-@P l^0,00 nSBS\N_0 0- L@0@PP $0F00A -@`p0 0V@TL A 0@P 07BsP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < bX%X L)8HX@*X@@h P < 8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0 0& @-/@d4xB 02d @-M)Ѝ@4=> 0 #* -L 0KM# " -LMK  KP K -LMK  KP K -QL M@ K0 0#0  90p03T0S00#0K -@@L0MP 0 0 D 03000 K( KP(KN00 881* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP2@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠ ZP2`P8@KE X`PEenh -PRL@`pP@ P00PPPPPP p- @0PSL`R p0S 00   10 0pQ)03 0 00  P    $ , 4 < D L T xtplhd`\XTPLHD@<dL0`8* M0-LM0 0 0@ P5K0\Q0@-P0@  % < ^9 ( ( ( ( ( ( T p ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@ p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T0C 000jR -LM8  Bp`4 -PK 0e@YX: yp`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 B0eS`40c(K@* -@LP 00Df p-LpMP@T ᠖ KpdK^`P P L0  0: S KO0 0J P DfL\ -AMLM0唣,0  @P |<`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 PK0DT P 0 P;04SBNK@D@D +ٹD @P PO B^KPE PE  qP 0#S   P@ P~  @1P Po BnK`F`F0 `0DT`  PZ 0 Pܙ04SQ%`P& `ݨP `רP `ѨP `˨PX `?@P00, 0R(KT` <jhDfDbXHf8gХ 0-L@P0PP 哨P0Hf 0-L@P0PP ~P0Hf -80L R PP DfHfP@- ^ 0S^@0 S 0SS00@0DP0 df -QLM@<0 zR| 6P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8 (KI0 0@< PpPp< P@`**yy*QQ*vv* 0J -0PLM 0 K0K0 P  Kk* p-L`HPPp@ @ xIP T  0RpH0S p( ;===*ii9* P-L `hJH00::(*))$* -0L MK , K0 0 0 P 0S$$$  K*SS* -LM KPwt@G-Q M 0@90P@Pe1A 00.b q($?P @RJ: 02!!b?P J$0  \0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ -LPp@Q qP <2  0=QK bKP T X W6Q@T W@W @W@ X*0f1@0 Z0 fB10# @  Z0 fB2"0 Z0 f00T| | =QQ q 0  0s 0 0SW 0S Q q D0  0q 0 0PS 0-LM4P [[@[0[ P@K0hf* 0-@PL PU0. @ 0 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P F@?00zf -L M0 0. K @b2b 90GϠF*""B*jj>*++:* - LMK0 @ @ pK..!* -p-LMP0U0  @ 0 0Q a0 `PU 0  Kp` 0Pd  ,K K$0K@( $@ P, PP 00|j|A|r77** ** p-LMP4K@1 K70! K,@ 6Fp`( P  K,0 4KOPK$K@ J ` K>;v$Kp K 0pX 000 P@ 00ӑP 00ӑ0 S000r p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` mP0S PUW kf萸 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SE ]S6 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S' @ 000 T   R: 0Sk 4 0u 40@^Zq9  0$@TfJP0` t4 ]040 4@  @00 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r dǟ00   r 00  PPg7@T ` P0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<0 㭋P  㧋P  000(K0P  000   P`0S  @  e=0 `R 6P h@P@ P) @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PP1P 0!0'P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, 0*0,S  T R# ^x p0`P  R00!S  00 R0#SP0^V 0 @R4   bB"(Kor 4 $00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S/00 0]Sp'P 000   PD u040 0@H p-LM0K KP` 0 ^00K K0C B@0K K"P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@P -`RL@PpP  0!R000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! B 0Ap -LP`@p0 S#T TW0 W000Sxhhhhhd hhhhhhhf`  f00   fB  f" 9 B a  h/@0 fy  f$  f"  B a   BpG`@  f0T  fh/@DpG`u(@D`o -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  j R *0Q0\S \) j V1 0H  S@R*0^0\S0)Sn Ti3UbLa G\NXVR #Rc [R R @0^@@R@P(@a P<@ @Q  >3S \00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XyR R RL>310>#R R "R (@@(@0>3S  S S 0>3S +R@(@7\ BK.8K K K 0R:K PPSEe -t0 LR  @T P0R000PPP<PheEQ*M*I* -QL0 M4 0 0R000(K00* 4u@PP- 0 P0S p`@!P `@ P$ pW21C0 R4Q  000W |G@PP(KY  0W0021C0 R 4 R 4 0W00L p- LP@P` x`P T,03040S000 R   R0 \00pP** -LMpxf`P 0SLXQ0LL!PmP00P00@$K(K BP (0 RP@Pʐ TH*LP0SMR kR mR gRPAx1*GR KR R P&*L(P8PK,PFWr4O@*<*uu8* 4*0* -LM Q00    K ` K  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CSQ   1 0Q:`pV`` W0S P`P```00 p-0L)S@ p010CSQ   1 0Q:P`UV P pP 00p P  Q10C 0   Q-L@pRPPX`VP V V P `0 B  d00GPP00 Q-LPpR`@@, P 0S @V000 B  e00 0-PL @D0 0-PL @90 -LR0L0@@PT@ lR0  0 R B0 0  -LXpP`@@ R0DTST0S: 0 ^P` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00j d00``p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00j d00`@000 R0pp00P  X j0@@@b00uP0PjQ0PE0Pbb* 0-LM 0@0 @Pu K0** -L8M4\( p& < R R S @-WP  l( 0R'$KR Z@K2 ^|PU`@ PU ḖPZ@K024 Z@K2 @XhFT\H99* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0As -,@LP &00s -4@LP #Ps\ - TL0S D 姀P  P q 3  00 qQ#Q cs0 0n0@S0000 0PU L P q 3  0 00 0y |P q 2  0 00 0g jP q 2  0 00 0U XP q H2  0 00 0C< FP q 2  0 00 01 4P q 1  0 00 0 "P q p1  0 0 0 0 p P =Q hPP@Um0#S+ #U) @0PS0 RP  000 0 R r 00CS0 Q#Q 0P  0 S S 0@S0+ @(srhss1 0-LP@P P0 -LKM䡟0TK(0 p@ںP4K@P/0j VXW"( 0RV$Kx l 0@PP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"66T-@P JP 0R 0GR SKIPP L1R H1R,,,,V\h 0-TLPA/H0P@ @A/kPP05@Pss0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T750 0(K4@K00K 00 B6P6 :P8 P00H S 8P p0P< 30D0 a0H@SX6x3x3x3x3x3p6x3x3x3x3x3x3x3\6x3x3x3x3x3H6Z@ =XR@0=X0 W@0 :<⌑ < `P 0e0 F pP8 0D FpH R W:<00⃁<0 `P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦86h2h2h2h2h2h2h2h2h2h2h2h2h2h24h2h2h2h2h2h2h24h2h244\44h24P4I@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < t`Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < N`PI 0e0 F pP8D H0X pH W:<00⃑ <0 3`P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,K$,0P R>0SK 3"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`@Ppc C808 =0 08Tj30 01 4!!* --LM0 0 -H0@L`P8 4T   "2T|HA\\*;;* -Hp`LP1@P 0S 0S0S $ -|pPL@P a{P 0P `X{P P@P0S $ -LMr0Sm (K }Pm ( 0 S RL0L(  S*A (0`` #RᘁP X0P`PP`ŅpP @`0 S S0 S S 0`P< 0P0t!0U 9 P@` 3P 00@T P P PPP@ 0V*@qPPąlPX00XX}P:( 0` `ttxXx0y \ -(@LP ē00 0 t$ 0-LP@LP }4 0000$$|} 0000t$ \E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0 -PLM@` 10 0$KP0K(K 00 , PPp VT(0 (`pP  0 PPp  1@1 @?* p-0LM@P0 ' 0S$ =S" 0 S =SSRPd`K P X0 ! 0S0 P xs1 00x -LM0@ =SS=S$  0=SS=SP$Pd$`K sP! q$0 A$  gP $0 1 0S0 YP 010 0p R`  0S0a`L;PP  0(pS PP@0 0 4y -L M0`S=S00, p@P 0S=SPf, KPA ,0T00@K00 (K P 00 1 0S0 P,@PdP 1 ,0Q! =Q =S 0S0=000S0ꐀ R4   0S0aC140 P @P < 0S L 0@ @4 ,  4y -L@$h@P0 @ SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00dd*KK**%*%ooz* u*zzq*R0S 0S0S0  R00ZZY*''U* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-`0P P000P R* -`LP p0W 1@PPP@U00Q R @1@S ޼ Rؼ00 -LM`qpP r 0@r   t00 ( pDW PAbRP P  0  R 0S 0禼 U@R ូ00P=  t!, Pc 0Sa 0 0 0S0 g@00/PP  dPk0 0Q 0@0A   0, 0STU Z0 0 ,P% 0S4 U, 0p 0  R=*@0p@P  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z + @m i+0 0d -ML M,  @  pT2 /T ` 0 @C@T/TPP  0 W*Plğ, 0R(KRs/T ` 0 W:/@/T W: 0@ 0  0 S00:*P/@@BNK@D@D+PA 0@ ^KPEPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+bP( 0S B^KPEPE+VP@y*P 0PZ~Pj*P0SNK@D@DD+㋙ 0@x $ Q 0P@ 2( 8 P. 0  0 S00b* .R2 Z4* @R  W.0S0T(*  @0lP  D0@ PP 0@6 $ J^KPEPE_0.S @P+P^ 0@" ,PU8: SQ0S /0 0IP! f )P0/00=h YL -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I/*K, 0b5 (K*K 08 <R 0 XT5R L50PP!U00S !U[ @DP 0 %< 0 P`].P 4!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ : P 0]SLğ0i@T 4Q:0 RR0SF @T 0 8#8000 @-S@]Q 3 00p]S@ 0#< 0 PUKLK*KA KKA(@4 0 Pa*K, QJ 0x :KK0 4 0Q"0a1 0 0P[Up`]0:S  0  nK`F*PK*KV8`@*0S /S  *K/S 0 R@ 0S00 R *P* 륷P*K0 P;P" U R^ 0*K S C  0R0S0 U L1 (KP\˿PK0P ]U@Nc< S *K, 0pb@P@ W(Q@00 \  0z 0 0P@P  00bi**?[`-]:lEi -LM0@{SD {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  0(KV `F0}S0SU0[\ 4,\ T:P[\0]SS   0]SSST0*0VU  S:0S0  uPp00{\ }\V`F` -ML Mx@,K`pPKF P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N0|S BL.0K^: X0 Q  R00   KT\@奅墅p 00 p 00  P Pp 00  p 00 p 00 p 00 p 00 p 00 p 00 p 00 p 00 DP @ 80 R00CS000=]RR*R0S0  RR B0 0Q0 0Q*__**A*//*aa*P0ȼ -$0L! 0-$@LPP$P0h p-LM$`0PK@.0}}P }P 8c,00SKp,0 -L8M$@ 0PR 0`00\pK@` 0` 0DK} *P 0 \0 *X00S$K,K,0D0 \` X0 *P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0P0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @b|zQ& .Qu,  0@,  0,0 DSP`J  0`tP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   LP 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V` -L,Mp P@6Q >3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   ᖶP 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V` -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppg@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 寵< ZP]  4D0 8?, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(K -LMp S, TQR Q0 Q Q Q Q  \>0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @zV 0 @b|zQ& .Qu,  0b@,  0Z,0 DSP`J  0`NP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9 -LM 40 \  ?R(00 Sh 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0p`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0tH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0aH E U 0 \PP 0 R HJP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VDP|<z" t u$D L0SPXf H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ᕵ ` \0  H 0XXpWDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0HeE`0DP`X M<> D L0SaP_X0@O`0DݮPpX # X D<XD@0`0 R T`0 CR` X0 X0(p0R RXH`0 CR` X0 X0p0R RX* -L$Mp0`QP 0 " @@KД0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKAbP `b8h$ -LMX0@K`P$0 p ᵔ$ 0R KC8h -MLMK@ , p p`CPB@F XN 0QMOKHHV !+ D+pP#  xV'0OPU`d@ <`@ ph, 0R%(K U  +pPL@ $HW@UVKAAp X4U0eʶW$7  h 0-@MPL 00}K0 -pa`LP @3`P` 0`*P0i>V1P Uj!0\1 X -LM ßß0 4 , =80 p\uP `hy @TT PPBT  ^PᤳPV 0Q0V0SyOPBTy3 2@ ZR00S0BSmRJ 80S R 0 0(K1 R 40:S  04S11    0:S:? RUp1 R 4 0:S XL1 ? (1 R 4 0:S  :`0 R0 R 40:S 0S 00   040C0 :R:?Q R,0 1X 000 <0 , 0L0t( -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  `uPu` P@t  00 e00b 0 000$0S0 R#, `4V ]0 4A@-QPpU4,tP @t x$0s`U h$-Up 80Sb L 01S[ -Q V :Qr 4 tPm 048 0pPF 3#0Ĭ40P -Ru44 v+Rs44 o-U30S5P(KLsL3PHu0 , @00*#@d00d00P00"0P@0̂0s02`p@P:U@30S0002 R 40:S x|p2P?P0Sv,r,"P(2u a  000 d0b01 s-U0S4rsP 8 0R0WU0S0 0;S7 :S 0S000|D00 R@!0:S 0, 0R01 !1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 x0h  Q 4 0:S010048 0P ,(W`8P -LM@@\K -LM@@QK -LM 0F K*7*7tt**$$*6*6PP**33*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -LDM\\`, 0 \ /00@, 0R(K^PK2 1PY@(00P0Qp I00A SFs@Jrg P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"P00A S  Z R r@rg P!00@ TQy 00A SP~@00/r@P00 ZPT@ 0@dK bd0S@} ^@00x0XSxS r 00 D~ V pp QP. ,q* !000D$  Qx!00ӑhAqdPG0W02p0 `VI:00p3v ! 1DW`F/Qm Q@Z t 0h1 T!V00h!( 0T 0Q 0S SS 0h1P@@8e4 80$ 0 h$8t` -LM 0wf맩H -LM0 kf뛩H -LMdOKPp` <, 'P @, 0R2(KၯY  ὁP 0S S) 0KK P00?@T00V: KK 3 %0 0 X 3 00SKKLP G@ 00S Sh| -CMLM`P@, pP, 0R(KQ#T$  Q  2 P@T$ T0S 0RU@X4 & aKII (3$C.K B B 0P L pK 0S 040. S  @P P,g P #$0:, $0 Pp0( 0 0H7T,P303 D $@ 0@0 <0 $D0 T0 P80S$$0BP> P0$0:, $0=,(Ko; P 00T0S0,0 - PᰜP T0 P X RP0 0P, 0P, ꨎ Q Q-L@PP` 00p P$0 S U U P T$0@:$080@S0 /R $0P P (pP P>: 0-0LSP@ 90T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR 80Se 4S S 0$  0R/S@/00(  HE`$0  `# 0B8S P$0 ᴿP 303Q $@O 0 0RK 3P 003P80s 0$ `8QC$0 0`S003P$0@P( H$  /KP XW @ᓧP ע(P00 00 `\P  % :$02P| `e34 $0 PX Z HP6 04N 0P k 3 03 P 0  Q 3nI0S  0zP} $0P:$0dPt $0 P 303$0`:$0+ ``' @ # @$0P:$0 0 #0 0 #0 -0LM@p`  00 00(K(㺞PP0P  0P `00$@0 0$0 P aPW jPO 080@T . AT% Ḧ P5 T@PH 2 080 $  P03VY`, @, ,@ ATVX# .P  03$0 X ၚ 00 ywu 0 *   6P$00$0W -PL0@S0( 00Cp0N L0SGh6,,`0S  -LpMpK`P 0: S < 0P0$KP@ПP P(L0@0şP  0 ( `(0@`( 0 `0`0@,``$`v pP 0-LPp" 00 R00S 0p  @P  0@ 000q@0 0-L⎽p@P  PP 00 -L,M0 P 0"pT0 4 rpP W ZH oP0@P0PC$@0P(P@Z%0`)T0PcT0P`@HQ000 00 00嗊(< , @D <D PTu*Y ,0j 0lS0P`S& HQc0X 0\0 0h@dgQ!Q H\a= 0Q0 W:WF*|`d0` 0P  P0ZH0 0 ) R@100*0 Tg`g $ 00 `0 0R*@PT0PHP HQj 0P0 `0 0R:  0gY@(K0T0Pg`g " 00 g `0S @t:0T P0H\ HQI 0\0 HQO,0D< , 00 ,, DD CHP0 0Q0 .HP D0<D 0 0 @gHQ 0Q0 4 0P0 4 0Q0 ỡ T003HQ,ł 0P0 P01 T  `00PL0 T P0i@0 T P T PL0i0c80 T PT PPT0PT PPT PP@4000 0P 0 ! 0^0 #000 0\ 0 T P`h4,0, 0Q 0 $P0 <0)) S@10*00Tg`g $ 00 `00Q*@PT PH\ HP 0P0 `00Q:  0gY@4 0P0 4 0P0 tT P\8T08PPST P(0T00`P`T P)@T0@@P@ 8T 8PP)@T @@P@ 0T 0`P`11* M0-LM0 0 0@ PJK0 p-LM`PQ @Q NP0fCKp000C S0 U -L(Mğ PK<KP0 L@ Pe/h孝`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 t .Kt 1Kt 4Kt| 7Kt hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K'P@F@0PqU``0D p 8]tdQ0@ < *@K0pH @ 5T P(1<00(K00F<.K PpH:pF @@ A@F`< ypD080#80;@ X`dl4.hlpHxtx|HXWEV 0 ᴽ@-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P 0Q @ ..0 A0 SaA\A0AW AS7 AT0XQxQ@@0 -Lp= @P@dP`d 0@:SS   P0PfdVP `d P@f IP` D`V  -Lp= G@P@d㭚P`dP 0:SSo ^S \S0@ PUPfdPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SDh\,t,,,,,,,P,,,D,8,,,,,,,,,,,,,h\,t,,,,,,,P,,,D,800U@f ᮘP`VD`0T0 00} 00z 00w:00t00q 00n00kS -8@LP d000 0DL@H 0-@PLpPP2d0@@0*LP00ܙ40P (0@ @00<8@ -MLM@d  ^, ` h8 l p( @0S`WP loPm  㩙P 0pS LH T hL(Q\(  h 7PT80T8 X 傎KHH`YP 0 S 0Z@PY+h8 P `0 SU0U@E\S 00 HX #RR l%Pp^ 0:SP P0:S0@0pGaP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@ဗP H0g gg0 0H( `pPH @ e|40(x /HDH ;Pg\P: 0g@pPPX(RhcH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL T(R@@WX\K@ 00BNK@D@D"X P)*2 R% h 0壑P l^K< PE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L LPh TT X hchy@hc@ 00TT a 80P  pT000\H H8 X Ph H*"X\!j@Zg@WWbX(R2 ]s@ 00JፖPp@Wn OkL@D00ph  0-@PQPLTP Sp 0w@00 P @PR@ 0S S*||* --LM0 0 ̌ K -L`P , !0S*0 R r 1S0C1@pT0@ `0@V 000ZPp`d x 0S f D ̓  0f ( 00S  0-L M0KK \0PS&&&&&&&&@ AK0"000@@@ 0$0%KĽ -LM< t<0D @  Pu 0-U +U 0P8 80 D@ t 3TT0U RUD0 ?4 00 8 RX 4 K 74 K `fV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cD^mR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K ޥ4 K ,   W# 8 V0& ,@^00S0040 ` `Pp X"00P`q V"00P`q W0 W0@Q RJ< <0@ 0(KP8 A0XSxSEP D 4 0 C -L@'T`p@P  @00#:k0cS:UV@ 0r`p -LxMXOP0 U80   0@D0 @@ 4 40 -SX,,,,,,,,,@/@/@/@/@/,,,,,,,,,,,,,,,,,,@/,,,,,,,,,,L/,.p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp { /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S H0SE0 RT4 | r 0@ Q  |040|0 R! |0S  P 0BSpچ0R`|PU 0 CR:ʇ!00 p0|0 04 0t0 4 0So 00Spxp 0XS xS 04 00S S`  x s4 @t@ |x 0 O 44 0+Q -Q,A    00@ S4 30P404 0P 10@S&40P@p p 4 /P 04 0@!00/PP9PpH*0aUS RaY T @l@ P 奥 Z@PD@ @P @:H A }q@Pᓥ 0 pD @ YPP` 0j@T 9 DKbqD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8QsdOs\Ms`KsXIs#"00 4 s dPⲋP`  7dPt8M `8 0WcP` d \ X  0X0 \0 `@6sPd  ! ⦐DK, K00KjsP8 tP\ P`, VPpPPg00ࠡ࠱Rb  B alR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \tP\ d 8sPP` 8r8P T8sP8 U XdtPd M VdsPd E W\sP\ = d8@sPX 7 0 0\;rPK X\b 1@PdPKYe u` l h @5 Z 0Q0jZ0S lKx%x5dP lK苢P ul h Y l0K`pk6pjDKt 0Jp 0DKnD @ P@`\050Zp 8;rd9r\7rX5r 4,pl h Ylph@@PQe_P`p 4n`p@D0SH@ 46SE 3=dPA44 pl h l`A0`p | _I0@%Shh9,,,,09,,,,,,,,,,,,,,,,,,,,,,,,,,h9,,,,09S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | y\2 l h0 BCbVD@K0@1 ` o@PVD@ @P @05&C@ ! DKzoD @ @"1 R6CR0!0 5&0C@@ D0 @ @ @4@K+aP 40 (R D @ 4@KLaP 40C44 aP40\!04 @ D0 Qt80K4K< K^0S@t 4  S S 8 RL`K L`Ka8(q0DK< a^PP\ ~\cʄ0 DKoD @ |Nx?Ap|\$T|?5?55,P9?ؽ5&HDK@PD`K@ ` p  0n 0DKpmD @ @h0 0S56@0 0pW @0 0D0 lKgZh 0lKCmY@PD0S46S !(1bPu8pdp\p`pXp!h!h1bP|!p1aP\l`hp0A;i@d 1 DK-mD @ DB[ T3`j`T` DPK`2 @ nnP`TDP @` \ @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0P'` d \ X 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0lD @ 8!pdp\p`pXpQ #0 0 K DK nD @ 3@ 0SYD0S@ 46S30kSX 0S0SXp0PX0 \oP@ ڌ`V L40kS7S8odo\o`oXoY0ц!0М `0| |0 D0l0 h@ D0@ 46SD0SPiP0Q< E DKmP e mD @ D0y jP0s%|DKL 7lD @ DKD@K0 0l @P0D@ @P P2 XL K`PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS xBBTB0BBBxB$B000 0100"000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @TP$ 0 K T00 5CS0cC*R7S0BS c020 -LM< h ?4 00 U4 K ʛ, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 U1"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL pP- @ ᇋ0 @p000CC000 R0@ <08 000B 0C B0S \cqP, 0S0K."0 0R0 R*0\SL P 00π0;0B #A03@ #0000 ,0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK  ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Koc@, _ I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T4>2":c& :460V0) Vp0pS.Z0p0GT0  AT,K 0 e, ( 0 #2>;bp.p>dl.l>b@ P]X.X>d 0b@P\ 06XP,\ࠃ|  >  'XP0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x Ps \00S ^ -01NB0H D    ̟ Pb0`p@0 T P< HKP cH D  @H K 3bX T |^ XK0< WP00Q00S ROXK; qc0X T 0L0 8 4 \X K bc; a40@S UA ;XKa 0`psVP 1WP ` \   pd \?e`0S d\\`6eh4e 0S00 p` p0 0?\0Sn ^00ӡ!  ^ `:  c 0VRP ` \ p100 d Q @ B¤ Ť0@Sggkklk8k x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCAіJ Al  4 8 Ex\@` 0tS\t0tS0ct @cc Rx0S `fP` \ hePPX hdhP 2fP\ P pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` kd@P `0  ! ہ7eP `` pd ` ` L <hcP+d Q U00S 0S X^00S \W UbL 0`R h  ePh d`\u d  ePd `  eP` LL \hdhc`\d@P 00`S cP Q  0 cc p d[0 _P00C0 x\ 4@5 (c` 0<`@ < XKZ@G[ 0XK0`0@ pP`@@K 0TP< 0` 0@KTPv4Q j`@ K U4 P 0jW` @K 04a $4@ < {a`PXZ@ [ 0_0@@@ K `PUP 08 -P0@ pP0 Za@P 0_2Z`Z 0Ma 0_000 0@PP 3 P\P  0_@P  0aUP  0P 8  w9R W8008  000800 hePh 40 820`  XKY`Z 0XKs_ 0@P~PP 400 p\00W 1`P@Y`jZ 0S_ 0P@^4P00 000 <1KT_ 0TP K 8_ 0SP0w0S 8p u408`0 \0 @nT/X T   ba 0cS0Ct @4S2+  AdP` T d \'?aCoc?`(?yPD??$@@@?p0  g`Db 0@P0 pH0 p W`@P `X@ TP p@dPh  \h0`h`h0  \0Sڈ T@d h,cPh \aP0w9S{ W p100  h\aPh  cPh UvN  \010a 0`l^,0CN@6@ccP` t @t E0SS\ cP\ \h\aPʕcP\ W\bP\ x{hbPh ms`bP` rkh0S0SU%`rd p9V00l90000fz0w0S p^ X T p`  KcP` <hbPh V \6aP `:V `?9V X1``9`4 -LVp3 -LVp3 -L0MP T 0 R` BTL X 0X@P0T 00D0 W}PPH , 0 ITP`PAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ ` P-L@ @ 0S@`P@ 0-L@PP 0S0   0S0U 03P񟗀}}}~~~(~(~(~(~(~(~(~@~@~@~@~@~@~@~X~X~X~X~X~X~X~X~X~X~X~X~p~p~p~p~p~p~p~p~p~p~p~p~~~~~~~~}41 01L P 1 1 1 0  10 10 104 10 10Hl0 \0 P0 @0 00  0 (WdT 0-@LPP[@P@0 080 0,P@P$0 00 0,40QRP000S p-`PPL . US@  0PP@ @00\ \ @UR!000p0r@T00p00pU  RR@PP @T@@-@P RS 0P 0 R! Q\00000@ P- L Q $T0 0Q 0S0S QbP0s3 -0LS 0 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S T0 0@ -L@\`0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPPPT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP W -LPp SR 0S40S1<`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:C{ 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp { 0<K <0 Yv0 dKk00 HKD0 @0 H0 婘뙤&h 0-LMtP@T K0 % K 0K  @@|p 0 S 00 0@0@h -@L2bᑑ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā{ 0P0 0    0@:vpV@@, 0R(K00 <MpW00 XhaT1( -0L@H $0㰕P H hď Q *0S00S0 Q -LMTp,@KP` 0  u  0RKh -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQ  -LtM` \, Pp *: 0 0 xtp*l: 0 p l 0 U 00\ %\z^<llllllllllllllllllllllllllllllllllllllllllDlllllllllllllllllllllhԑؓllllll<Hhtllllll@d̕ldl 0PlЖl$lؗ , 0R(K 0So$@ T@d Ϡ0l" 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQn(, -LM@P`pJ0S 0@-H01=0\J 10S1 0(- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Z0 0n(, P0 0 P P0 0 I -0~03?LQ00Ӣ?Q 1!0 @0S d0 R0 R0 R, =0(3p3 -LM|0@`l,0 ?ipP@ 0T00 VPP P:U /U .2P JP, Ke, 0R(K:UP/U 0 >Sp@ dn(6p@ P1!@,  "pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p k@Z o l b@g;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0M0 >Sl@ dn\0@`00A\ 00A[ Q -L@ P  h4d -LpP` 0S@ t@ 0V X0(0T=H00(0(0000d@P <4,d/ @ - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @' 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!N(Q"Y` -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pPe-P_0@0XZ]PpZ0^=0 @kPpDS-P00Z$000(+d -tL0Sd@0 0R  Ph,0pNcP0(/ -@Lፅh芅8 0-8Le@PA (Q0S-P2 QkPP+P0S. \0   B,{=0hE PxP 0:S  `P 0,0a=0h,bP00(d/ 0-4PL@'  @ 08 P0 0 p-8`LP@ *@p8 -@Lth8 0-LM KJ0PK@@%D0@`TK0@@@ 70@`T0C@@D@ *0@`T0 -LM K@0` -L,M@<KK -,L@, 0㬄P h@  -,L@, 0㛄P h|@$ -Lh -PLU@`Zjp@P P P@D -xpLtj0SdPd@]n`T00@XPC/00dUEO$%P00hO,lȑHZOP  2-C PbLcPp 0@`U0p(@J0e1PDX h00P00P0C/d`VX@E_Zp -L\L 0cP R@P $ 0@@h -0L R7  SZ RX@J0S0 000000D0000PH00C/gdQ<ȃ ~@P $$ 0@@@I, 0-*LdM0@0 P_ h<,$$t$TT$4DDDDXL,`4DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD"K0 @K⁏P 0 00 ,  K0K0Kep  ! ++ A/,000 = 0, (0 0 00 , !P@p K00K0K,  @0P @epD @0 0K$ K0K,  @@ep $@K0?N ?t =0 0 r.0 00 ,  * @أ #@P w t0 00 , d l@KPq@ e0 00 , p0K K0K$@0 ,@ Aep[ PX L , 0,0 -0L80 -AQ0D\ 0$0( ( $00  00  00  M-LHM@0 l p D`Ph o   p0`d8`PPhM `00X04KE0Slp 0a"PnZE04,"401(0($0\` Tpbl0p `d X0 T `` \ 8@ X0!dKq P <0P 0S`+0h0P (K 0@I 00@00h%Z@ 00600 |0|@|I 00*h00 @,@ Ӣ P! 0, K y@ 0H4~f M0-LM(0 00 PJK0`" 0-@L0PS <00S8Y0hY -LME ` , (~   0  0$H0 @08 4K@ 嬐 080P<0X0K00< P   0P  P <00 0 @X@ 0 PX^, 3唠K 0PK 0 1 x3#A!B La! HKP 0 43Q0=A0 AS  R0 0,0B, 0R(KP p$ 0S :0#S 60 0 ,04[ W *00'0SXKճL0T X RP0=)Bc -B1 ABR=)B -BQ. 00S0  PX0` QpPK 0@KIPL ,,P0 ^   0 P# A @R00S0,0| 00Q  l0 0 ,0l0,0hc,d  0P0 ,00 0S 080 ,N@pPp@ pP ,@DhMb?B$ -MLMQ0@., ~0  , 0RB(K^`[pPV P BKII 0P% 0 0 SL1 RL L0 RBKJJ c04( K0 $C,[Q 0 pq` 0Q(00 P0  rR 0S0S s 0 08 04G6($h8|\T -AMLMP`0p., ~000} pX1, BNK@D@D  0k @`P)0  0 iP0 0 P0 P" P0  , 0R(K 0,P\0 04"$ 40  0  Bh80` -MLM` P,  p0 U NK@D@D 0 `P] 0c|, 0R(KLcpP: \0W.R NK@D@D ( K0XCh0l -LMP< .0G}pp2 9 0 0 00S`@g @ .S@0SU`!*0R.S``TW l10S 08 ,0 ZT Vk 0 4 ,0Si 8q1 4QU 08 0(K0 LL0Q 0 `4 @ <0I P0=SK D!0S S40040  S @0 @0Q0T0S00S00 #P <  0(Ko <0 P| , 8 0 R\8 000   <0 Pʌ;0C 080 -pP@L.0|@e T`@)@MX E@@0  = @9 04"408#8 $#$g * @8 -pLTMP.0J|@p2 P Q``(K0`0```````````  0 $x0 $10 0 0? 0 Ux t` @% U U dR(K Bx0KP@  8@#x,PU@ -0c d 0R `  0    0S@,  @ d Rz(K Bx0K=Pq@P vsvm @80! ( -L"x@P`^ H ^ hP@-\0^ 4@3 A3200 Q0#@ -LMr0K 2R00 Sp^ll]dd" 89 0]L08 #H "@(2( 000c8 08#H4 000c8 @]a X@&^@E T!sAQ0SK ":]tA8K㢯 80 R$0) 0 0 #,!01  B`43C!00 c Ƞ,Ƞ00 !0=0  W0(K0 B'61C0b10c!X<SX40W ] 4 `T0bs4JP.U \UPn@kP 0D R0 0<? 4 X0S8 <0c\40@ QL L4=a4 #=0 p0S .S` < R(K0S 0D R0 r<0S D00L@P*00L b@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R00 <8 < 0 <0 Ƞ 40P 00<(4"4 <SQ1 S -LM@0.u0pS80 S S  `P/P K - P Q |` X1  010S0 Pl1l1 0 0l!l10S S S S 0S SS P  P0:0  P0;0 | P0;0 \ P010 < P0008l~ ~@ -H/LOM@0P.0, wt($/$0qtU 0>NK A A'p/ U $!0S000 S000 =0005< 1l100  l1h< R,PP    0 0 PP  >,E.K B0 B4 % 5 \4KP `$ R*E~KpGpGX`4(K 0@4DCx5 P@\4[S \ PV4[ S Sx 8 P7V4[ S S3Q S S0 S S SSPP h@,+ PT  P1Q$k$1RgH̟, 0R(KATIH PV4[ S Sh $ PV4[ S S\ S S0 S S SSPPw h@,+ PPh0L@SP  dR *R* S S0000 Q@0S0 00Nl1Q 0 2l1h0Sd Qh0hSLPP@T T .SP0SX`V.VPEU00P0:0O 00kU1Sf1S b kSP h@,;+h0L@SP4  dQT %>* ST  Q7* S0 S S000 0 R 0@4 0S0 00ENK@D@DqP.cP ,h+ 'SP0 0 S S 0S S PR4[ S S%R S S P P0 S S SS Q `8  q 0Q@\@K0[S\pK  (50RG.K B B@@@@@E>K@0C@ 0C | dD D ><PddddQ Vd a@|`Pl   0S @0 S S S 0R0Z0S@`  lP0P0  cP0P0 5 %0,S \Q 0 SS S S\ bRyR00 fR0! 0PT4[ S S \@ Q Q QQ ;Q PU`p |5`  ;U  u 0PU TaPp GKI0 I0 tPr D pAKP PQ;Qp` p`4`  p q 0Q;Qp00 EP 5 4t1"10%0 #$p $ t!# \x@ PpU4[ S Slvh 10   r 0R00 S 0S S00 00   R5Ud4 R U%dd % I%5,YQ0" 0000\pK (Ph8<h4\(34<\hD|XH ~,Pĸ8  0-L@PP\JZJU@0 -LM@   K0K  @@TpKE-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10S$"""!"T0SQ R<84@Z,<$!$$, T*0SL -LMKnP@ -0LMp,`K,0K@PT ;Pe 0!00P XZ@`PTZ .T00X0S Z  ,K ITx -LMdŸ0P,0 PD P w/000, 0Rx(KD@0:T<0 80 40 00 # @P L0 M-AL(MLKP 0`Pi0H0 f0 V0 P,KJ,0P pR) 0S&PQ+ V$! w, X!P UpP 0S( KA0$  0A 8( K0U p (KPUP P#0"SPx0"S WP -LM< t<0D @  Pu 0-U +U 0P8 80 D@ t 3TT0U RUD0 ?4 00 8 RX 4 K }^4 K `YV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K $^4 K , SY W# 8 V0& ,@^00S0040 ` `Pp Xc"00P`q VY"00P`q W0 W0@Q RJ< <0@ 0(KP8 A0XSxSEP D 4 0 C -@L 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK Fph K@KpK. yvp@p~@ 㤈p  {0sh P-RL@  ?  000 -- LM 0  M K -ML M@H,  P, PL, H$\4#0$@K$K0 S2d, 0R(K蚮D 0KN@N0,$P E 4HPP,Qk`p H<VF``p  @ R@ 0#EVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<V 0FP `aC0S: P 0P`pm 0j , bpPdP > PPKn@1AlA 8 4< <\ 0L d}NH^6 D 0!REPD@`P  0@,d0a0cK8< 00< @<AA 4 << d.s0!.EVF``pY 0 S0GQ D<E갭07S^KPEpPE p }00@ ~^KPEpPE<< 8L XgP 0&@P07S v8+hW HHP|X 0-LM@00 P>P8 -LM]d K -L]M@NK`Pp KC/$@ d @8 4 DVN_KPEFh0 @KX 0KO@eKQ Q D1 $0Q K hdP0p p-LMP` P P |P0l wD`0 0 Kp@4P0( @dD@, -LhH -L  h(]H 0-LM0@ K Q0!5Dp@\ Pڔ!+D|K0@\` 0S-SSSSSSS,TSSSSSSSSSS0! DpP,P{0 CpP0  Cp0 P0 R@` p01S ` CpT0< CpT,ě'SHl<H -Lrh H --LM0 0 L K p-LM PI|` 0 S 0K,0 ( $ 0 R r 1S0C1,K,0@S֜KpΜ -@L  , R-L" 0S 0S \ @`R 0S  ^00NSa00H@0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SL<0h<z{ -LDMP p2BP d.B`Pd p 0S, R00U@ @@0K/DLP` 00 X T P \@ `K~P0S ?{K<I<0d0 *0  0@P04,"408<d6<d@ P0P H0S00A0@1HP! d(K ބP rP00  0@+ 0000@ 00 00d@ 0000p 000@0v+ 000d 0^]H0 -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF l&PN l0SO `Pd RA 0A尡L0LPK0<0 8 XpKP P$P (KX0Y$7$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0$ P$0S0$0 -RLp`PU ?p@`P` 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2K᠕@K 0K{q` ᕕ4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  剽p@ P06 p$0( 2[   00天0S 0p($0ꛩ 00ꗩ 0$0( pMb -40LQ < 0( , p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @>P P,0S \\ 4btb bhb\bPbS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0 P P P  P 0h 0-LP@P 0SP0S0h0h 0-LMP@P8P 0S 08,  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ Dh@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 C 00 00 0-0@SLP*00b0 C 00 00 -LM0@S0C0K< 4("4 <0!  C 00 0 0-LM0@SP0C0  KpC <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< ^@P! M?K^@P8!\@lTK?KS N/KAwP_8!G@, 0R(K081 4A 0p 0^P>@.00<K_K<N/K81 wp 8!+A[>hP -L,Mo,0nD 0Kp0 ``0 庒KPZ`P 0@p 00< 8 4 * K0 @ P @0K P2[Sl0  00pvD0 [(K,000`hj 0-L@PP0P P  0h-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$:P $(0lH0 (0, P$8`:P, 6<P:P$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (Ko$ @08$o4 0z$4o4pH 0- @LP 0]p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %* -LIM0 P$0  0SQKO_K`ᙣNK@D @w@ gl0! Z$ 0R  KD! e@,0 MoKK_KQK@ <1 8! hH  -L@TP`pJ 0 /T #R70! W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z HW@ <"@ 0-LMP40@ L0 @K0 -LM`p@P0PP@0  pt@TPPK p-L@ P  }3 Ȣ 0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ PPe ,00i \0 , 0h5Y9 Q> Qj LQ; R00@$  ,p, W``T0U0S&a Y00 ;0S8 w 3JX00S\00Sl @(K0S @T,0S%@ QB4 @8  T 000lnPP 0@0  0` P00 R \`0p@APPE 0@10 @dP0 ` W0p 0 `0 000  "00 0`210 2!@m210@ B  0T0W0P`0 p p 3q 0@0uPP0`` 0@0j -LMNPpU 0  0@P0 L@  D 4 @p @0 -SN((((((4 @ 0S@0D@ 40 @p @T@00\40<40 ^  q D4(K 00S    /Q 9Q@`9Qʈ!000T0Cچ!000T0`C@@ /QP  EPeP9 Y0@0\uI0@%SqԫXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXԫXXXX@ >00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ J W@PP@ LP 9H A @PJ 02P L 5RYO\0Sk \\JP 09R QH } HK5@`\D9 PK@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 x PD @p \ 0g@T ,8 PK9P L 0 PK< K80KPD T 80<@cT< <8 <  0 @n0TiT @  (7  0<P| ( | P ! |0  ! 5D0P  D  ! 58P<@Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ xPx  @P @ iQڄP  WڀP  VڀP  XxPx  4 Pt  0St0@ p @x+`\`P`V 0 03 0 4  W !0@ 40 X T 倔 <\` 8+  , K00KpP{ ,QJpPt D`R, 010DPD d 0@S20@DT@ T D)PD Q <0C< %A D/PD < 0 0CSu R 80@0T80 Q6` <08 @ STQu "2  @P2XKf 1`p P 0 P[ 0@S 0XK PO40040 Q80 @cT DPD < d< 0x|t@<0 R 00SM SG S D00 @021T0D 40 * 00Q   0 b320PW vtxrtpnP tx 1@PPW 0` 0 ` p 0^0Z0S.   R 0S DN?V瞯<@A?p\$T0S0 RT@   0 @ R0 0 @ Q! R  P 0BSچ0R`Ф0PU 0 CR.ʈ!00 0@ D@T[0DPD0C< @8 PD @P4I.P` 4 P410S90P40 Z RD0SS@ 0 SK @DTʳ |2W @@"2@ P i  @P  0X T ^ ^ ^ 3P 0 00c 0 @P@@  CbVڄ3@ h d L 46 56,ʠL0 LLPKh K @C`FVP L L0# "*/B B V L pP@K0@4 ` "@PVpP@ LP XK 08P40 040 H0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@K@P 0 40 0@ 0(S@@  000 Rf 0SD40 0R  04  @040 垖"00D@@KP @0C@ zP@0@ 0 40 D0 4 }"00@`0A0.@P*U~U@d 6 PK(P L 0G CbV6@ p l L 46 56,ʠL0 LLPKp K @b`FVP L L0p' "*/B B V L pP@K07 p` @@PVD<0 < +a P@jD#PD K <0d8 < A0@PU <0P 4 "00D_  PbU+DP80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl1aJ- Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W }PD 08@10!@d@P80!08 40 W040 !0Z40 ʘ\00P0StfPt xP040 řژPv <0Db< 8 x^\ 80C 8 APi\0\K PK9\e 3P L 0PK4K 0PKD00 P0< 40 TZ!040 t4  I 4 2L0HK6H0 }@`}\|\PKL  0 1SO  @ 0CD0  !08 < 40 !D!040  R0S0 DdOQ8 eDFZ 040 qD08  -L0(0 0-@PL0 t@0 -LMIPU8 < @0  00ST @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  60S20 R 0S/ 0R@@ 0R 00s03p`00 0 00 l8`pQ  0S\P P0d1 , ,0  PR pR 4  V0G000S@Z)0g0CS  0SEP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- 롓P@"00F R0 0S 0S0 R@0Sd  0S@\W@FpT p2 02 p80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0Y000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ P000.@r`/a)PPPG / P?W 00S `P T@ 0VP @F R 000@0b@8 0< 0唒"00:1 0J 0eP #8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. H0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R:pI 0m $K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 BSPP P 0 BJ0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 LR0Sa@ R 0S0a@000-@P 00W b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 000S  0 S  -4@L,    h h -L` -LI`Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@-H h$H! Q. &.ȌV2UXP`pP1#3P1 <2pPQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  Q) -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@P p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`A-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vp;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000 -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^1@^ @T@0X0@@` Ѝ& Z Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P -LXMt p p`| x0 x&Jᄪ.J`p E媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^  ^P 0 0p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < P< Ƞ,Ƞ"h @0#H!\0 8ᑃ.\ d  D X S.D@ᑜ$&.(40D V 20gUXP,8C T0C28T0CR0CVbP0C X`SfH ZH\X 03#Z # 30d  B\H0 d X H ;#;S` N<0P0 @@.#P` $8 " q(Ƞ,ȠT@ a$8P^%L0 !$(H Q 2LV 0ch`(8C U0C2U0CZ0C2Q bP0CWxp`Sa `ZP0T 3# 3 # `0`0CV`0 `@0 0@`@ d``:ʠ5lh%p ` ^ l 0O/@0pl p 0O჏00 T030"S* ! Fpl /O p -LlM  ` 0 &J,JJJ@ 倠D `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40KY0^ <@ xP0O@K0 K<0KF0`` @<0 *6D0 D4086!#((*Ƞd |0 `  (|`"( XDpu'l0 `0*h.6#h@ F$H X0 t HP@ d@,p X\@ P@ ȠH ទ)L@ A$pH 垥*'Q2dT l P XR,8| ^,dx&"L`p 0T02T0P`h@*T蠃ࠓ`@\2XP\`T0蠃ࠓ VT%(  Y 2Y 8 S 030#p,0 Q@@0\C)*DPt`|x 0003<0S00S0 0-@PL  QXP0SL 10A00h4 (10 AR 0h| -pL0PS U AT01 0S0 00 U e102P@ @Tԇ0eD!<0 0c1S10@0`| -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP" T  0R0100@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lq P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K=PP0P  00  ! 00P 0-L@ODa TAPU/ ` @T P /@P/ `p0S @T 0S PP@ 00p0S |PU 0S \LgPP 00, 10 ePꤹqx -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`@$K pUp -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!10 0f @`0 0 00jS0 PdUPPx ~ 0 00PUb UR:,PG @ `@U0@`` 0@T:P3  00b0 @@0 >0 @0f Z0 c6P, ]  P0h0,0 8 !000PF 0 @00j 0 0e `@0  0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@Snpn p-@PL ``0S0 P0Snp}P 00nph  -PLp`PS J0SX@`PUZX 0-1L @R 0P  Q-   0 0c0 00000C  0P @0P 0P $000  8#8 0B< S /0, p-LpM@PP`0+0 KpKNP0@: S  Q;  0  SL ( 0R   p-LM0@C 00   KpK K`PP h 0 SPP P 0000C0  0|PPH -L MpP`0S=@T@0S P" 0S$K$Km 0@P0sDp x0 F@l0!0 0@S000 p 0S  -LMp`18 R P!0L!0 0 1P0  @0 @, @' Y$0 S ಐR 0SP | 0Px  p Pg  1S0C1, 0R00001p0q =W0 pU 80x03 PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 P Qq -L 0  -LHM쀟0P@$0 qs0p8`Kh R0d ` M0 \ X0 T P@ EUL H` DP  0|  9D h0 hK@0 < M*HsH0p R$ 0R K! ޓh|ȟH -P LQ @@0  BQ ?"s 0000 -0L`Cp@1 00 a 0Qᅁ  00 @0N""(30b >P0 U  ^00U#3   0 P\ p-0L@,  0$RP`@$ J2#($b!.@1QS QS 0N!QR QR\Pp80\  -L M 0`^J~^r@P p10鎠:p@PJ PL0 00 Q 1p\ ""(30b,>0A!0 S00QzMP% 01C0 0 @0 0 2#8# cN(. 0B 0S   00C 0(K $ -LPMܤ0d(0  @0P (0 U  U UXh@K? z)P$ K0DPCM0SJ @<0C>S񟗵@A@AA@AAAA@@@A@AAAH?AAAAAAAAAAA@?AAAAAAAAAAAAAAA|AAAAH?ApAAdAHAAAAA0>0L MS`4 0  (KoO24( !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#20Y1 ("(0S* px 0t0 R!p00b b0 p0x 00h0Yp (0S0C 0Q@t0S x0KP t`1( R B0 A0t0SP Pt0S P00AU00( p0S(K 0pS(0S 0 0t ,xp00p0( U S(Ko04XKPh 400a0ym40 5 04 ,C0h $x -sLP1`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S Q00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R0S *|1S1100S00@@$ 0b SP1:U xiR>0N@ TK:X>0N@4 0$ 00b00!S 0S  |i?ic Vii$  b R 0@@. @0N$@a = P 808  -L`oVp P0S0 @0T  @00S0 h0 0CR0 np <0< @80T 0S$he P\ -LMX`, 0&P,  8M>0>0S Dp(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* (0000#20P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC 0SJ ,0 e Sp00ep0<0S 0S  0|S7 0S=xtp0, 0eRp000S 0S  (1@P05pp{ !000v @  h 2A 1  Z $A h0@P05pD p000p (0RA$= |  - PL M8 P6$0:CZ*`>0N&@8 ppd 0 5PP6$Qt0PSb $ a R^*0S88:b0Qp 0S(K, 0(RC /0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q$0S 80Sa $0c f85#Ƞ@^@0000!1 B("(0,R1!Q000$$00c02!0QB !R 8p00Q00Sh Zf a# 2mp 00Ra  PxlP3$ 0000uj$  b= p4 p5 W:370#2000,0 < 0, <0 `00V00 u Q000, v0V 0a WI< !q114 4 P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0   a)$0 c:37 '8#8!1q14  slp 0044*p@ 0P03p@  0,00 P 000S0@00P@0,@0`a4*[Q0``x<`R   -LM@8 `lpD00TPPU4 @#0SJ"0S2 좟00S0 k@k4  (K 0 T,0 r$0:CVJ*`>00`  Tn`^:TYY0TP0 07pP Be$Qk0"S, ,0SU $00 c bf!, p 0dPP ` < FP<]piFPS|!U00d0k 00D1 0R0C0U k4 @ 80P0S   k 00 V!1PNPum$  b gkP 00a qP`$ 000H< , =$ -LP`:kLq0S<<.0 N. @T, D *Q#Dp(0pdS@@p <@ 8 @0 (00@S|0<0 t@ Q0Px0640 dEPt8px p080bp0x040h0TpW'  2@P TUX0 0CR0T jH(K+<j@ 00 R !0S@iX$ R @@ rP@T0 e@OP (QD P4D h,P@@<@ 1p@<XH <T. t @DP P<T R*q0S,,P@t,ia P.0Dp$PL `P L 0@R00 @ ,P@PbD a e"@ X0p@0@4L= $ -L`\ip0SP @0T * @00S0   P0 0CRP0U w00TY! Y Y K:P)Xg@00g0@0(K +P g0S @ X-0p@sg0S `@ig0S@@ P -L @P  - L@}p -lLMd 0R,0 Tq Lq0   R8,B0 0 㬀K%@ 0K K @@e0P0C `?<   c00P 0@ T0 LD@ 0 0 T0`<, 0R( (0 (K劇hj   -0@L0S0Sh -L1,<0 R00 R$ hy 0P  -L0pSP(U `@P0 000  000  eU 00CS0F0Si  -8qL0SH(!00C0p @ 00 P@0  0 0 ` @P 0  0P `0 P@0 0  Wp@@T N  P0-LP `B@T<00 - LM0, S*0 R$ p00C00 0 %P, `@0@00  Z 0`,0 ,0Ro@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@!*hf -L@\Pp`P h\bQC0S! R0 0% 0S! 00CS1ttttuutttttttttttttR<0 0 0;S < 3 0 01 00 0bd0 0p0 0d0 00 0; 0 0 00 0Ed0 0k, @-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R P0Sb22/*OO/*/* 0-LM 0 @0 @PJK0JJ/*2/*2NϠ8u/* -L` opP @H1B@A01 j P dd 020 0 0 崜8q -LBMcP< , @$ D4 y8 *|dPx BNK@D@D0" Pa*BnK`FBK `FA0A 04 .p h A/ yj  ,2R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PY@$00@_S c4R SQQC 0<8$Pp. 8\ 2bO00-b?00, 0R9(KvP@4<`%0BTD ,@ F@d : :<BK0NN@``0( K` 0T 0@@匂h88, -LMp`xQ@ 00 0 0C0``(KSL R ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6dateztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnamex̍4dy`@@,$ |@@Xconv option disabledunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valuecbsconvfilesibsifobsofskip%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainХ<ȩЩةusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s%s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainХ<ȩЩةusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSDmain@@ @h $p(p ,p 0` 8@ @ $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880lt |dT    @8:PTX\`hpx  #3#3233#@@8D@@$,4<DLT\dlt|  @@ ( 0 <DLT`lt|@@@@  $ 0 <DLT\dl@t@|  C$CC$C $ , 4<DLT@\@dlt|printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).Ffhnscmplabelduid_parsegetasciilabeledit$~\mpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor 8  @ @@ $ @0(@< %-H@8  `N@H_8@d8X H$x,4Dj<DHجPXWWWWWWWԬPWWTWTWWجWW\dxx|hlp$t|xx\s6㿂;{vtDZq{ "UN{$8;d"@g߿9~4x]u4FsUw-kUyPy=Nϓ>Or؛H Y2Ӊ~Zkӻ4:͍I*I 5er_@"xg4}JdpW4/tq,?RxNU^%Ub[{8W*Y_%:WWIF-/WßQ`)Wɫ?y2s"\a'.WIE̩¡vEE"{(ψ S>CcGuySsSyسs"$'02(%hM}iXSoSffLg:mӦJMiUT߫)4tUfIfd!ҪL6oDD/Ƭ*W1j0ޚ-UF6&ĚafɞDkaBm4MUM4VsY˫JjkJH-[ZX}n ƥ 2fB35.p'PۮUgnmfE6;M.vL׻)Y0g:nû+YmfҔ`vˍ584TT%M^xtR0 @PʪAY!q0px |r0\-Ψ*4y5 F 5pN8\Cީu4SM O+Na) 6 Zn`9˟n9Ν| 9[R{w̫rV9h *qRxA$c'YZ2u`;u {r5آU*J#?JNSzwy|@I||;Jt %_A:F65KVR`uD5-($D*3 80JHTsTCBKjQTd@ V3bckf K ϜZ,d`v7Xz6*QF (zm}-6:<"xΨPA̢p[P =jଓj}('~֚fɯBD!v/^ |Egi p{0[Uop/5D9xrE .G@6hVdv6yF3?x)&z4 u ^WySVw87AM6dF~<;,q^J^0Z,u*9 n׶h:wYҖP,"I,F`1zĤikJVײ`?:&+jEZVnW"pǬr}kb@sP^jܝ}!AO-Ei x 6¹U x@,U.XM ],,GyϩZZ]8 Qwq6(9R׹øa:E_(%oQjPx< 蓘YI4qyHBM\g@MKֿLb'BSZ{BcZ tnjۤg/%v dET>`| -@=~~ <69 ǁz8'aMVbR!ypJQ@Xȣ6[a"$c}D'f-tcX"ЁOAgiK 0UPO aF~T.bs'p?c*c}E35b%p.7aǁt0MCGOKgtaG8 Ou7%QW3 i6@gNnciW3 w\gUAyh?F-g%Og=kwȢEq;!k} ú XE,q !h p]3m-T0'xeBIЀjUM(=JpI?C{X-n5uh8W]˦EU.,=vZKڊ<Yi(Typwx9Y"(ZlL쌅Ӟ@`?4KS? ڽi\cx `b4Q ?'$YaX1 \(L0Nb8Vq?A[ hzWTDTY () 3鶫ŀ((̫O3-HJ5证0w1sY;~ڥ\d,pa`NQw^Ƿȹ4ܜ SUåt <\Zvʡy[_"lơy'4\``*nڂ4vƅ i{vx*h!唠X:gQDVw( I_E w8NQƝC]&19b}ސ X_qHە}ehq!?nFۍ)6\J9~nZ4W!ȍO#vtrJgXVB=#񩀂. `Q„n GB &10k*G6T7V֠fI`ƪ̀i҇Okʿyl>R*Q]+L;A:O2}'!Ck"J0vdX-Fl'j^b@ 4|ge8`;( vEcEa*|.Ɖuv(Ƭ\*Po`E3 g˂ WH8vx&(5(OؓSIlqLFYSY ON/F,®7*=30$%'4#&D[)4(?=`cI+rҶԗת֝"/408& x 8[e]3PdXVofK0Ȇ8xjNp^aқ TCkjܮl2Z:P=yQ^q Pe9OvzG {^."]Ĭ7))J;&=e\EܪŭFzL:%+!^c 4X)\w*.;9ªQ&8šq_G=DFʈA,TeqPmMn0Bag wv SJٮfۀVr)zؕxU\$ js ,4XLIQU;%qb-} !A. fj;\gh<ΓOp.5a1BfM)$j/,tg/c~pŤ?G&Aλ5xs+QYr<l0,#g;2o~8300Jbl’%HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!ǠHY0.$%=:X˜\CȤ`3cF쁧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R׷LJoBy sVLDAL>B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvW_lt8l}tI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=uޯ\ON2~(B."I]zviB ȤPj}pefkí]8Jȓ lw l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !'>'Q3?S:S b* >`L{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}zqIƔ}H?; 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh!p\'[$'XAs'cC Kc`op%v. .;'IYoqG"5j< wE~N LP+΄a%'MY$</XQ4+) TY<;|Z1`)Iz20rcE@;da'*HPfծyŷ ч! 5PII0^/.nܨ-J!\4w*,x7J.p,HQ(]VcW%7%#a ߭aRj5{5l<ɢ("÷5i~c'ڮ7$h..}8OtO#gؕ^Uuti|P9<"*_F>~1:kje7uD怉?_ɅpgGC+D<>q0|֙p=rz|ZWːOyb_Oݗm?z_lK7߄y~0"u.=›W+v3*̝G!hAیn6NMM9^NdTvvO1B#S錄4:Q2?|wd?I1F !K:У)]u< f/=c?8K-x {`/m~ttx+Q)Oˊj6o >`i RLr%$ye 8bWz|M~,}77cA !.Ru;q :(clmkw D^&ݺfLThgQ+&E G= o(Ev|G@p& =67}v.Tl/%FJ589?0%K#I`M]mLum/uBgd\Aҝ x-˧0ꭰL]o4-mv.ܗ| L 9Bˠ_  XZzsC*iAB4wV. *>Y>FJb~,j$BIjgٍh&[NEB a(TVz;5CͲ%wk߭a_Ŏ;2!eb(W8#*Z- 3 Vƈo_9?(A͸ǵT7{&Z 1WTH' 0M#MYRogm ~y ݨF_KUOwvF?\p3YA(Ky}SƤ n{Dg=mٍu rtɋ@hk/kW=˫o?^ MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. %lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sUnable to obtain file stats %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %swrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %ssummarypingermainusage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup$x,4Dj<DHجPXcatchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%u CONNECTED. PARENT WAS I=%u NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%uBAD STATE %d TO BLKERR cannot find inode %d bad inode number %d to nextinode Cannot allocate space for inode buffer bad inode number %d to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%uDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%u (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%uINODE I=%u HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%u (%d should be %d)UNKNOWN FILE TYPE I=%uROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUP%u: %2x BAD STATE %d FOR INODE I=%ld summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvsetifxflagssetifchansetifnwidsetifbssidin6_getaddrvlan_statusieee80211_listchansin_getaddrunsetvlandevsetvlantagsetifwpasetifflagssetvlandevinit_current_mediaieee80211_listnodessetifwpagroupciphersetifwpacipherssetifwpaakmssetifwpaprotosieee80211_statusstatussetifnwkeysetifwpakeyin6_aliasin_statuspwTT`~Td~Tl~Tt~T|~t~t~t~}~~~~~~t~t~~~@~~| pp0s؃؃hs$~|s,0X8@Lx~Tx~`x~lx~t̟txāāLLLLHLLLLLLLLL~X TT T$T,@T4T<pDP\hp|}<~xXi i@343 ~Li ix3X6  `|#Ȁ#Ѐ#؀#܀$$$$%%%%&&('0'<(D(P)X)d*l*x++,,,---.ā.Ё/؁/0000 11 2(242<3H3T3\4h4t4|5566677ȂcЂc܂dde؀e$,4<DLT\dhpt   ,8  @ H`P`\`hpx Ȅ؄G؄x($,4hmac_sha1pkcs5_pbkdf2randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELmtu %s: %sSIOCSIFMTUprefix %s: %sbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xmedia mode %smediaopt instance %d"%.*s"0x vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixlenSIOCGETVLANSIOCSETVLANvlan tag %s: %sSIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYinvalid vlan tag and device specificationSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_PRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATE%s: no such interface interface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacygrouppowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*u %*qd total %lu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain(0Dusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedmainusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d ltget_envget_termraw_modeeditcharbin_fileplinenumopt_xopt_shiftopt_jinttoalinenumtoapostoaless_printfap_linenumap_intap_pos?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmainХ<ȩЩةhltT d@D@ @Ԯusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R=kh{+AߘN 2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.bin_fileinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmainХ<ȩЩة@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%smainusage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitor؄G؄x(netname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %srouting table %ilabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %s (%s)entry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:v/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:url_getauto_fetchdataconngetreplyabort_remoteinitconnhookupmaingetitmgetptransferprogressmeterfileindirremglob2ftp_login KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainХ<ȩЩة@dusage: m@ . .. pppAfirmware|GgroupH protocolsd-KpasswdtmpIspwd.dbL servicesasswd.origJpwd.dbM fstab~N resolv.confO( hosts~A .@..B ...C . ..D tmpE dbF runemptyEhashEPtzlistD .C..E .C..F .C..ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreloadget_ifnamepriv_script_write_paramssend_requestroutehandlerparse_reject_statementparse_option_declget_rdomaininterface_statusinterface_link_forceupgot_onesend_packetif_register_bpf5pretty_print_option|~."....t.%XD... . /&</ԧ/#$/ $,/4/@>@><;Zx0Ndispatch_imsgegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %mget_ifnametoo many interfaces in group egressInterface name too long: %mInterface name too longcannot forkchdir("/")%s [priv]poll erroroption_as_string: bad code %ddhcp option too largewarning: hostname %s contains an underscore which violates RFC 952Invalid IP address in option %s: %swarning: Only 1 IP address allowed in %s option; length %d, must be 4Bogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xdaemonscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sfork: %mwait: %mexecve (%s, ...): %munexpected msg type %ureceived corrupted messageip_addressnetwork_numberbroadcast_addressserver_nameno space to %s %sprepend optionappend optionexpiryscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbin-T %dreasonlease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } dhcpoffer: no memory to record lease.Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.options do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTnew_bound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.FAILDHCPDISCOVER on %s to %s port %d interval %dEXPIREold_DHCPREQUEST on %s to %s port %dDHCPNAK with no active lease.BOUNDRENEWREBOOTREBINDbound to %s -- renewal in %d seconds.DHCPOFFERBOOTREPLY%s isn't satisfactory.packet_to_lease failed.usage: %s [-dqu] [-c file] [-l file] interface c:dl:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintf%s: no link ... sleeping got link cannot open %s: %m_dhcpno such user: _dhcpcan't open and lock %s: %mcan't open %s: %msocket(PF_ROUTE, SOCK_RAW): %msetsockopt(ROUTE_MSGFILTER): %m/var/empty/chrootsetresgidsetgroupssa == NULLinterface address deletedinterface downinterface departureroutehandler: %snew address not one we set/etc/dhclient.confexpecting IP address.no memory for reject list!expecting semicolon.expected option name.%s: unexpected option name.%s: too many options.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpecting identifier after option keyword.no option named %sexpecting string.option data buffer %soption data buffer overflowexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.semicolon expected.out of memory allocating option data.expecting interface name (in quotes).wrong interface name. Expecting '%s'.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.expecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!/sbin/dhclient-scriptget_rdomain socket: %mCan't create socketioctl(SIOCGIFFLAGS) on %s: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.getifaddrs failedno space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %msend_packet: %msocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %msetsockopt(SO_RTABLE): %m/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfcScoption %s (%d) larger than buffer.rejecting bogus offer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.Discarding packet with invalid hlen.DHCPNACK%s from %s (%s)%s from %s%s from %s rejected.DHCPACKpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %ceof in string constantnumeric token larger than internal bufferstring constant larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervalleaselink-timeoutmediumprependrebindrenewrequireretryscriptselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ %d bad IP checksums seen in %d packets%d udp packe 08`IP<  IPuD_`[~ [~IP`@@<@TU JP`bJP``AIP݇1:IP 3IP 3 1`SAIPIPIP CIPIPIP D^AIP JPI JPI ݑCIPd} IPd} IPd} ),AIPd} IPd} IPU wAIPUIPUIPU F}cIP| IP˭IP˭ r)IPӱ*IPJ+IPJ+ ~&IP'!IPT%IP$&P @ H   ( 0 8 X PۏAIP!IP%IP$& ` h p x P"IP!IP%IP$& hFIP%^-IP%^-IP%^- *iIP.IP.IP./tmp/fstab.shadowlIIPC @1IPC @1IPC @1/tmp/resolv.conf.shadowa^ IP 3IP 3IP 3/tmp/hostsOn%JPM JPJP DYH.gIckh) W/iEi|TiF& R9jqQE`:]R[ ^ )dg S}۔l_U"7|=D328i\\ ד0JC/H|a:Fdi֨K 7P qXyi܈S/Ȩ\G"ֈ0Z6~5'w ;ɹIS&' Rbmڒ0L ]- Ƨg |sU2d[)0Z8ZZ$wFQV,zi] eW>N ?$gec`s=nYo6k<M8tD+sI# p doc{y>KB ~>w$CTYNwK}cs?N1jéAe<Sr *cΐ3uB3-%l8jQ[hSVY W/R9C%į+ **XMѝq<c-g7.s>,ot tZts in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endBogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dno space for numeric aggregatenumeric aggregate too short.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.expecting a network hardware typeExpecting numeric lease timefilename must be a stringno memory for string %s.buf_read (short read): %mbuf_read: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_add: %mbuf_open: %mcorrupted message receivedreceived unknown message, code %dhandle_hupcannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? dodecompressmain$W,W0W)'4$(4W8W n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsWWWWWWWWWWusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup$x,4Dj<DHجPX @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%ubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %d to nextinode %d cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:cannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%u (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %d/%dphase 1b, inode %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %d out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),single_user  delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't get %s for controlling terminal: %mcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsmainmkfssiginfousage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %d out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %u): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pcompileflush_appends\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv, 4 8  D P T ` h p  t< x      LL c_umaskl 0 pT t|? x l  (  " T " ēp ̓`1 ԓ ܓ' X/ ) |? T C @# P t ̦-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$ؔ,ltfcdsĕlؕmnpx_modex_search_histkb_addx_bindx_emacs@a t D ,Ą @ Pp \ tȁ  h| r tt ȗi  , ؗh Us { d{ ܖ  $  0(a < Dpp Po `q to  p q h t  i Ș@b ܘ@t x  v  8 b Ha \r dn pu >= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_prinṭأdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }̜|gmatchgetoptionsac@,e4<HiTk\ldXmpCpn|fԠbupr$~!let||&&()str_val X`8 p   p|@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*ld.%02ld%s%s%*ldm%ld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $() input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devliststr2locatorbio_changepassbio_deleteraidbio_createraidbio_blinkbio_setblinkbio_getvolbynamebio_setstatebio_alarmbio_inqhmac_sha1pkcs5_pbkdf2Invalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: invalid AOE dev list: use nic,dsteaddr,shelf,slottarget not specifiedunknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCINQBIOCVOLBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostnamegetnetanswergetnetbynamegetnetbyaddrIN-ADDR.ARPAbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetanswergethostbyaddrgethostby*.getanswer: asked for "%s", got "%s"-_//etc/hosts%x.%x.ip6.arpa/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[explore_numericres_querydomainNgetanswergetaddrinfo<@<@<@gethostby*.getanswer: asked for "%s", got "%s"# SHA1TransformSHA1Pad/etc/groupgetpwnam_r/etc/spwd.db/etc/pwd.dbether_hosttonether_ntohost/etc/ethers%02x:%02x:%02x:%02x:%02x:%02xsscanf__svfscanf  __find_arguments__vfprintf0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad baselogout/var/run/utmpreadlabelfsWWWWWWWԬPWWTWTWWجWW\d/dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmp\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/%u.%u.%u.%ulx|p\ $,Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THR$~\[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL$,8HT`ht ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.db/etc/networksreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory l$0LT`t(8Phl$0LT`t(8PhHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTSHA256EndSHA256DataSHA256FileChunk0123456789abcdefunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d ip6_parsenumericgetnameinfoasprintf%h %e %T b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Padinet_ntop4inet_ntop%u.%u.%u.%u0123456789abcdefInfinityNaN^[Yy]^[Nn]yes646NONEUTF8  $(0<DLT\dpxSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p__stack_smash_handlerstack overflow in function %sasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt  $(0<DLT\dpx-0%2d%Y-%m-%d%03d%H:%M%e-%b-%Y%04d%a %b %e %T %YtzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageclntudp_callclntudp_create: out of memory __hostaliasres_queryres_querydomainHOSTALIASES%.*s.%.*s __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_res_init/&ndots:insecure1insecure2edns0/etc/resolv.confLOCALDOMAIN;#inet4lookupsearchnameserversortlistRES_OPTIONSenvinet_pton01234567890123456789ABCDEF0123456789abcdef  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/services,/(""too small ((((( AAAAAABBBBBB connectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dvsnprintf(D` (H`tRPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_sa<xdrrec_create: out of memory perrorlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANG4H\p$4Hh| 0Dh0Hd|,Pt(<Pt4H\p$@Tl|Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedl$0LT`t(8Phxdr_string: out of memory xdr_bytes: out of memory  !#&(*-/14WWWWWWWWWABCDEF7yACnF?O8M20HwZ~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryHHax<bx@<0dBx̬cx$$dxA؊LhexfxȊЭFx0gxTthxԮix004Ljx,3tJx!Kx̯Lx4mxL\lnx"xpxH\1Px\0İqx|а$rx"܊8\sx!رSx!Ԋux"D`Vx/wx"̊xвxx(-XxA Hyxhzx"x,ܳ~x! ?x,#x1,@xAĊL\xtx... (interrupt to abort) (press RETURN)H444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU0Ԫ$ȯ$dPl8tpd p$HPlt 4O@ 0AB@6C4DE$F4GDHxU@?P@`[t\\]^^__`{{| },}@~H`lF 8D`l    =  0<T`W j0jXj$lj,j4j<j  kD4kr\kLkTk0m4m@oDn`m?Wxx|$x,4Dj<DHجPXkh455RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~, $,4< D r@LTX<P   HH HHȑTZVVVlWWD`_H`P`X`@dc@gf|f0fee(feede|f0feefeslrDthvv@kt\8\|e.shstrtab.init.text.fini.rodata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PPdd!$$"V^%||pM+5:MCM$HN O$N$V,N_-dkv44#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; tun*) M tun$U c 33 $U 600 ;; systrace) M systrace c 50 0 644 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; nnpfs*) M nnpfs$U c 51 $U 600 ;; music*) M music$U c 58 $U M sequencer$U c 58 $(($U+128)) MKlist[${#MKlist[*]}]=";[ -e music ] || ln -s music$U music" MKlist[${#MKlist[*]}]=";[ -e sequencer ] || ln -s sequencer$U sequencer" ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 R usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 R sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio R diskmap vscsi0 nnpfs0 ch0 hotplug ptm local wscons uall R rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 R tuner0 radio0 music0 video0 video1 uk0 random lkm tty00 R tty01 tty02 tty03 apm crypto pf systrace wd0 wd1 wd2 wd3 std R st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: dialer:*:117: nogroup:*:32766: nobody:*:32767: . ..MAKEDEVconsole tty memkmemPƫnullPƬzeroPƭstdinƮstdoutƯstderrưksymsƱklogPƲbpf0PƳwd0aPƴrwd0aƵwd0bPƶrwd0bƷwd0cQƸrwd0cƹwd0dQƺrwd0dƻwd0eQƼrwd0eƽwd0fQƾrwd0fƿwd0gQrwd0gwd0hQrwd0hwd0iQrwd0iwd0jQrwd0jwd0kRrwd0kwd0lRrwd0lwd0mRrwd0mwd0nRrwd0nwd0oRrwd0owd0pRrwd0pwd1aRrwd1awd1bRrwd1bwd1cSrwd1cwd1dSrwd1dwd1eSrwd1ewd1fSrwd1fwd1gSrwd1gwd1hSrwd1hwd1iSrwd1iwd1jSrwd1jwd1kTrwd1kwd1lBrwd1lwd1mTrwd1mwd1nTrwd1nwd1oTrwd1owd1pTrwd1psd0aTrsd0asd0bTrsd0bsd0cUrsd0csd0dUrsd0dsd0eUrsd0esd0fUrsd0fsd0gUrsd0gsd0hUrsd0hsd0iUrsd0isd0jUrsd0jsd0kVrsd0k sd0lV rsd0l sd0mV rsd0m sd0nVrsd0nsd0oVrsd0osd0pVrsd0ptty00cua00rd0aVrrd0ard0cWrrd0cwsmousewskbd st0rst0Wnst0Wnrst0est0W erst0!enst0"enrst0#ttyC0$wskbd0% apm&apmctl' bio(diskmaproot:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: ives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete route -q $rdomain delete "$old_ip_address" 127.0.0.1 fi } ip6_delete_old_address() { if [ -n "$old_ip6_address" ]; then ifconfig $interface inet6 $old_ip6_address delete fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address route -q $rdomain add $new_ip_address 127.0.0.1 } ip6_add_new_address() { ifconfig $interface \ inet6 $new_ip6_address \ prefixlen $new_ip6_prefixlen } delete_old_routes() { route -q $rdomain -n flush -inet -iface $interface arp -dan } add_new_routes() { route -q $rdomain -n flush -inet -iface $interface for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route -q $rdomain add default -iface $router else route -q $rdomain add default $router fi break done } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } ip6_add_new_resolv_conf() { rm -f /etc/resolv.conf.std6 if [ -n "$new_dhcp6_domain_search" ]; then echo "search $new_dhcp6_domain_search" >>/etc/resolv.conf.std6 fi if [ -n "$new_dhcp6_name_servers" ]; then for nameserver in $new_dhcp6_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std6 done fi if [ -f /etc/resolv.conf.std6 ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std6 fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std6 > /etc/resolv.conf rm -f /etc/resolv.conf.std6 chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ;; PREINIT) ;; PREINIT6) ;; ARPSEND) exit 1 ;; ARPCHECK) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi add_new_resolv_conf ;; BOUND6|RENEW6|REBIND6) if [ -n "$old_ip6_address" ]; then if [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_delete_old_address fi fi if [ "$reason" = BOUND6 ] || [ -z "$old_ip6_address" ] || [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_add_new_address fi ip6_add_new_resolv_conf ;; EXPIRE|FAIL) if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; EXPIRE6|RELEASE6|STOP6) if [ -n "$old_ip6_address" ]; then ip6_delete_old_address fi ;; TIMEOUT) add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete delete_old_routes exit 1 ;; esac exit 0 Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Mald . ..arch| catdate|chmod|chgrp| cp dd df edexpr|hostnamen ksh sh ln lsmkdir| mteject| mv pax tarcpio| rmsha256sleep|stty||sync| ... . .. binmdecEsbinEţshareE . .. ftpgrep|fgrep|egrep|gzip|gunzipgzcat|less|more|\sed ... .C.. .C .. bsd base52.tgz comp52.tgz etc52.tgz man52.tgz game52.tgze8cf306ed83f148da6729f4d1a3b7bb05c809f81262d1ba913200bcfc3f2af14 #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == "none" ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi _i=${#_fsent[*]} while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent[$_i]="$_mp!$_pp" : $(( _i += 1 )) done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF `tar cvf /dev/null [A-Za-y]*` >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && \ (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp $FTPOPTS -a -o - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=`/mnt/usr/bin/encrypt -b 8 -- "$userpass"` uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward mkdir -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_rootpass"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up - $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 4afddc85589c2dc3b5497e4eac3a52e89c715344b5531118958b013dd13fcd8b 70175ff5c1809ffb025bc6fc942a533831690b10e825c5795a54e9d06f90f7ec 6732b4e2990807bc8d777f3da95244e4ccc8c9988acc364168ccc5774d843768 08`IP<  IPuD_`[~ [~IP`@@<@TU JP bJPAIP m5IP2IP2E9AIP8*IP8*IPk a OAIP;Q IP IP AIP;Q IPFIPF {]AIP6 IP6 IP6 e9AIPUIPUIPPݮ >Q{AIPK"GJPJPIAIPi#|)IPIP gAIPVJPVJPfAVJPsцJPN+JPN+'cAJP]JP.JP.BAJP3x3JPEbJPEb_AJPJP!JP!_R+lefGW3}Wp\:1N`(ޛYeA@&a]=Z')LFm3הG=y12\n*цm)4B=z3R#>4L XvUfy?>5:#!9>3Lgx.zA&%bM'Q34tqmg͛`M'W*5RaCTvRKA@!'F-+Y{0>Af{PXi>kCZqtkJ]N5˱`:aa|8BH{QB@f|.Gvj̎wk[}P#1늘>TpKՐWI-pl˵A"@Pa"h-!Vɘ*+d 1> a<)zPlcc09,9MD =KD^z>v'˟6_FDCzZLehz%fkC{W@cνmx . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi [[ -z $(cd /dev && sh MAKEDEV "$_dev" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break : $(( _vl++ )) done _vd= while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while (( (_vi += 1) < 4096 )); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && (( _vl += 1 )) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn (( nifs += 1 )) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" [[ $_haswpa == 1 ]] && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do (( nifs += 1 )) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ -z "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" local _bad_dir=/mnt/usr/X11R6/share/X11/xkb/symbols/srvr_ctrl isin xshare${VERSION}.tgz $_get_sets && [[ -d $_bad_dir ]] && rm -rf $_bad_dir for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && \ SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && \ ftp $FTPOPTS -o /mnt/tmp/xetc$VERSION.tgz \ -m "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && \ SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return set -m ( ftp $FTPOPTS -a -o - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { local _dot # XXX [[ -z $ftppid ]] && return while [[ -n $(jobs $ftppid 2>/dev/null) ]]; do echo -n . # XXX _dot=. # XXX sleep 0.2 # XXX done [[ -n $_dot ]] && echo # XXX } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp $FTPOPTS "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then package_path=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else package_path= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "Please run sysmerge(8) after rebooting to repair your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0 ]] || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp # if aperture was n, do not ask for xdm fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') [ COLUMNS -eq 0 ] && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -3f0a8e1ae932e198f62a7d27f5fe6e8260a2d24b937d62d00b7ef688da03d939 6bdbe3942e1adff79d0427113c60617586a05850c6b7f3b8412d6eb95a0c78b0 1"H7"7"V;ph`%:#h%:$p%:%x%:F"%:lF"%:@F"%:d%:E"%:?":F"%:E"%:0G":"4:X>"X&:8?"`&:"h&:"p&:hx":hx"x&:ty".:ty"&:x"&:y"&:y"&:A"&:C"&:#h%:$&:d&:Dd&:G"&:_"&::<`/d%x%|/dt%% ؕ" M:`:F:I:N:.:N:p: N:4:N::>:xn:N:l;&:Db:X:x^;+:k;$N:xn:&::,N: :8N:V;::Db:::X%%X%L%%%4%%%%Ԏ%P%%,%%&%ܗ%ttyclsttyopnttybgttyinttyout4%%%D%l%,%%%%%%%p%p%p%p%%p%p%t%l%,%%%%%%%p%p%p%p%%p%p%t%p%p%p%p%%p%p%t%p%p%p%p%%p%p%t%p%p%p%p%%p%p%t%p%p%p%p%%p%p%t%p%p%p%p%%p%p%t%p%p%p%p%%p%p%t%  $0@4T:L3dp&L3dp&L3dp&(( ((T:Tf&`&|2dL3dD&&D&0&&.&P\&`&4dO9ffsd***T**>d+t+8*d+ ++>dl4+|l++4+}+++>d +h+ + +>d*h+ + +*ج*>d+h+ + +$+>d)+h+ + +>d@k*h+ + +f*@i*h*f*>d +h+ + +h +v:Hd( dXP>dT>d\>dd>dX>d<8Q @X,>d?d?d?d4d>d>d>d>d>d>d>d>d>d>d>d>d>d}i(@AAA==(A* dd%(i @@@@@@@@@@x@dP@djjp@dT@d|@d@d@d@d$;,r3q3pq3,o3A;DH3l333 :@3$3($C;̯33d333|38x38888888`888(8P88888H888ؒ8ĕ8x88ȓ8D8T8d8t88888Ė8Ԗ8\888y2y2s2r2pq2\t2Hj2v2m2 v2tt2>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyd;i5,n5u5i5k5k5pl5w5w5 ~5y5z5955555X5<55 55X55????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 dGallant d`d&d!d4dwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp|ddddddddd ddd2d)OdaxddddoJdd  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:h;h;h;h;h;n;DW6tR6N6N6o;  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  p;`n6m6`n6 w#9Pp;xs;*ؤ6Ĥ606v;Ty;# # y;y;|;|;{{};};H777xu7y7z7o7t7|r7Pt7q7$r7~;T;TD7t7ԃ;D|77h;`7x7l7h7d7P 8| 87 70;x 8 87 7L;|887 7;887 7;8 87 7;8$878$; 8 87 74;$8%87 7|;(8 )87 7;,+8X+87 7܉;x.8.87 7;18187 7<;48487 7;58687 7;;8D;87 7;?80?87 7ċ; B88B87 70;E8F87 7x;pK8J87 7 ;X8W8dD+d86&*4(@#3x<)F%0S`d8h$r7XwQd)\l% M&8x <(\$\ V1dHd1L2,>)!L4^u#\h86P~(< /|,h],@#) 6X`k2L^'|,m&!'1.8dE/6XS\j^j*g̩1n|6w-R#X3h`Cd$p1*|! 4~ t}i 4/@)p(85d<.p30<^58KT"8[\"$g@{)4w8t,f!88S(3'8d5l4 Ha7P30),"$81d:4"hXx6X.+ $pT/80)3X2 5It4tYR*Ld#wT$P%d*d6P'$!36tE"$;"h*,2 2x#P?ܩ4Pܢ2m!H.;d4@7 _60XY'D%H" i$4Y4)34XD%;D4/L7dZ8'g$vT4\"3*+d.0+-P"6XG.H-(D#<T*H$)l3d,#(dt:6 %#p & "6*hS7<96FP16 [?deЏ7,s]7P5`*HO8@5,#dis*|uia8`8H#3T?X.dH$dT4#]60l!1z.66\5G(\($t#l0d$83Lsi|T9dk2X) j7*xCT'@N|![]"i~dv8h`kC(pi"< 8%6)|dP6  L[5T,4%d.4f,=l+dMf8Yx5,i 6tVkԳ6tl5j$`-J*T$L(J!,% si1li:#0F@iM,]S!ts0z$ p&hH$|$#85(X-`#L2T jl38"`Md/`)(L@d[x)n#|$h,X(3(2@5dTW hiziP3Tui %<3d]8$/|794|4LO3`udt>d?ds28.dB50pHkx :/d,EiT7t$\t(6(4hj0" i./d9k7dC;dM\8U"xaZkxdw$(#3Q5@.ji<7a,T7I2, 04 @)$/ )G X8X 86j !p d"< 8< d \q$ d \#H #X # ,"D X@! (4 !$!"!!54!2$C!s$J!\$V!Nd`!4*k!<&'8x!18,!t8!,&p!i!U#!3!@i*0!F#!x2<!$ei( "1 $"h6&"tS"<<"!S",(f"7q"$4z"?6"2k"#("m&"+D"#$ "4"."S""06t#$Q5%#Zk3#8F#ljN#8Y#Qdh#ph` w#j#I0#a5#x+#<5#t,7#'$#92X#,x/0$ +8$)X/$u#(?$dF$X#Q$8c$p2w$pZ+$g-p$#3$8$d>d$@4t$#6P$5$أ$%,C"%7"%*4 ,%!(5%L+dD%$HP%7ta%'%\k%/y%,4`%p64%Dh/l%`$(L%9"8%3%%T%% %&%HR$%<i& &60)&t4$x9&/D&N8W&`zi`&l!j&4u,v&D,d&"&<&8&0- &66L&2& '&/"D '2t',,'P)>'#6PU'dc'&lk'Qdt'H"l'@%' '.t'y('6'38 ',~d'Ld' h!8'd(L7`(}i(9-(r2C(L R(b8@c(q7\s(|8d(#((($6$(t/X(4*(50(h7/("+)% ),!05)85HI)uiU)!c)$.v).)x&d)Pd)<)t7,)$q18)@")#)P') )\6 )%*,d*S8)*Zk=*~/$Q*@jb*L7m*`(*x&P*Pt7\*$2T*(0* *(7`*td*$7*2 *8! +44 +3$(+ &(=+4H+%tS+ $h_+#j+"u+Lh+9`+,:#(+hl.+(d+$+4(+&+6+D{2 ,,,(7l$,$e56,Ġ8N,%0W,Tdh,"x,t#T,X.d,%3,s(X,H',ii,2,4Md,L1,H#X-<80-X*L-2'- ZkA-|;(lV-3Xg-y'Lq-2-Bd-@(X-"-?!h-4t-.x-(68-)4,.PWk .g,.Id'.A(X=.0 J.|P/,X.*de.#Xv. ., .V#.#@.@2x.lqd.R/p.xVkh.'.3/tW3/*,/8" ?/h/<V/@df/}iw/~d/|',/ /e./ /Zk/ԁ-/14wdH1lY#8O1@/TZ1/)Hq1h. 1tji16x1,0131P(131(?d1 $d26<2Md*2si12 B23S2,e2 i22@~2D62142/ 2D&2x$2902('2&3.<3d(3 A 03/H<34F3h 'Q3 3lb30#0r3!~3h%h37@3@33Md3- 34 3Qd3xBd3pZ53Pd4< 4A*0*4t&A4`[#H4tx4`^41h4,w4 %,~4@|/4||*|4k2\4P34484d4@Ad5t4@5|*/l+5h8d45p 'G5,R56lc58v5H(x~5#5#5X55qd5 ,5TT!@5d! 5L.5,&L6d6hk"6-16E"C6U V6.8c6c"\r6O3`6m66TT'<6p#6,@6L)86e.6x46D6/6&7D#7 )T&7Q"p07x30>78Q7j'd74dq7 q7\7)070)7 (7 pd70787g67!7%0 81P 8$!89 .88&d687,D8>"tV84d8dm=siw=Ա$=4'8= "0=m2= & =J*t=\m(P=0!<=@H&x=4>P% >x!$>.:>&@>8S>.,i>-x>0 >'>09 >h ><8>v2>~/p>h, >ui>#x>(M),?|6l?4l*?,&)D@?./(M?/d]?th*\m?l }?8?txi?Lei(? T?8 \?97?X'<?$`?/,?%? ?d@w&%@47`:@d-|G@|2dN@#/j@{"x@8A}@Hd@@4t@4/d@2(@3 @8@6@!@Z#@i@ؽ"l A$9 Aj&ALD7/A0d6A4EA 6pZA0 lAB*A8dA$AMdAK*XA`g.(ATy*Ap%Ao'BdBdBHd)B5\CB8JdNB$2X YB9 eBdBx+BD#pB+XB6 B7B)7Bh.BB5DBtqd`Cu, C C|Bd'C"$5C,8@Cp16RC34YC@'eCH&7sC<~#\C0)C\ 6Cs+C>dC DC9xC8"4C8M8DC'3C'HD 0"DBd*Dȡ$8D 7CDt8dOD$ 6@^DdHfD(/'|tDq#{DdD+d D="D%|D HDQdD9 D0ek`D1HD-E`  E4'8E8!E/-EH%;Ed"$CETY7lTEk5eE\&tE5(E4<E.E(hEX8E8i7E,8E$$E%E 4E/Fd7 , Fp6FԵ9 $F_16FHGdCF\6 NF3eF#xuF8 F`^6F@C8F7F@38F,]1`F\0FL#F@ *| Gh %G$%Gek42G*,>G&LKGt&7`_G6TgG,xG )dG<$G)Gt'HGT&$GiiGd GT5G|*Gl)H(9 $Hd1H16H./0CH %lRH4$`HT$lHy%uH9#H7dH4HH4)LH!H<%pHjiHf6HL%Hn"0I@7\I0dI ,I27Id4\K5hK8oK $K,#XK6 K'3pK6K$@K'K40K?dK +K.4LX'4L$?d/L*d=L48KLv*XLU#4cLC!uLw6L\WkL(3LhLH0pL`#XLX7L6L6LĿ0L-L,.*HM+*M 1"1M7<KMiWMjfMu-L qM|g-dzMpFdMsdM47M0$M|%M0'`M$%tM#M4L88MN"Mt+ lNX% %N39N)@GNȓ8WN)4TgNLe2@~N31DN$!HN8=7N-HN!N! N!N7Np`kO&O$0Olh=O!4OOx3^O|-LoOC&}OtiO0pO*dO"Oh&O'O5$,Oxl8@O,4Ot0dP82LP]1Pi1X)PdT3l8PiAP34TP<1.mP2 {Pܖ&P78 PP$ PQ9P a&<P6P0P~ TP9Q4-7QJd"Q-x/QP8*`BQ rdPQ8K' ZQ$daQX54lQ4,~Q\!8Q|M8QdQ6Q5`Qp/Q0Q3pR/#Rp8,R$r$\AR $dPR"_R5yR,R&XR $R$3|R|5dRH2R(Rhx"`R4 SUkS?,L Su#x,S.?Sx$pNS8#VS&,aStI sS4dSx'3hS.S؂+STT7dS<*4,S (SOdSd!|T@=.HTh)&TB%$+T6lW2*RWX%bW,"TnWh~W`["W 8W<4W^48W$W,z%`Wh/-hW8 <W6TW1- Xh+X0ud)X(-.d7X01FX0.WX8+daX7mXЩ1rXi5XT XL%@X4.dX(s!|X1XliX#X,xX+8Y48, YH@dY(&Y5k4Y4W(CYă$tWY `dY3{Y2kY|dY1 Yx%xY'Y| 1Y4Y+lY$B'LYf'Y!xZ^(x ZF#2Zh! CZ7hUZ-,aZk.lZ8|Z#ZY.ZDd(Zؖ*(Zw#`Z\d!8ZH7Zh8Zd@d Zly#H [7["8*[ D<[ 8xG[&DW[:"tf[HU9q['|[hx[@$[hR&[%[0,[8a'$[P![ *8 [y6$[X'@\xdd!\* ,\d5\&<\IdP\\)tg\.{\`<\/\Di\Cd$\(p\/d\H3\#\9"8\4\^5d ]Zk]ha64+]#,8]83V];(lk]P+d{]$Md]']M"D]8]#X]G#@] <]8*x]a6]A5T^Cd$^hS*<^H"8,^4q-T7^ #F^T'U^(5hc^'8p^!d|^|8^l3^#l^ L^+h^$G6$^&4^ԑ5^T)+_t`k_E" %_#@3_#E_2O_p9 e_.{_( _pj*L_#_ 3<_Ld_5_4@_~d_P>d `8*@`D'L,`Ld=`/,H`^8_`HR9g`X3P}`& `|@%t`4`t5$`S*`.`@T# `4'`/`2axn!)a(l:a 6tRa4l^a,/,ma|&xapI%Da|T%a#,a"\ada5`a5a*pbzibu#bP ,b ) AbTkPJb6lUb`1bbpO3\tb&H|b%pb7b\D,bsibp6\b4%hb (bV0bE" c0Dc8C%tcy"P1c$Cc0Lc.X]cPdhcD#wcdlT(tPd`Fi\dܟ8sddI3Td88d06dx0dp&d^"dVkd(Hd`'dddd`7HdX(dT%e$V'De4*|"eP8.eЭ h?e5PQeL)dde7dqe#dehepheDdede%Xe7ed)e )e42e?df*T|3d|2|H/ |h  }),}`7#} 3<}(D}#P}3d\} 4k}(pdr}T-}"L}pti}tti}@ }P9}<2D},, }O*,~(8d~Id)~n `4~Dd<~l5,I~|#U~, 6c~8@~~ph~hd~%~/~L&x~$v#4~$4~X ~Ho6d6k1*d(h!/4t*!Ki ST+_, phiz~dek 1@'mi \-%8 %t3\\4@, J8)t2tp!4A`!Z>3hpist%X<* $ &DL%d # Ȁ,8׀8݀ |06 8,/!-P+o1<<#DX8(P66)0JdziT{.g$!xz%HZk|x/XX5lW614e-sA!Dh6.0E*@ƅ4օ6$1; T.\$% . %L?hdHD;8U%cW6@nMdz.pTv+y%n,S.T$|džL3݆2 .L$l @ !X`n6T%X.0854*S'ZD3gd'hxhr**$|| $p78H'Ç\&ẋ̣8ۇhL, l (,51"X6@+(8Nhk`Jd$mE" 3dXU'DD gki’HH6dג3l4dd.tTd, *1XhA )8N7_ -`ld6"s(Y1} ''P82L(1D`I#`-ΓX1pvi` "d@FiL#\Z%$-(24?X1Iv4,Y8h3x2}--T@)<@x7'$ "$G*۔(+d068`6$<( d<(..ϝ 6Pܝ,1P.P5d'o7b%\%!X5>6EK(DLudXtV.e0p%`qP,8}0[+ | 8 4Xdj2?5̞n8p$D5p-ud( d+ (ȩ686I-GH{&O'_Y'@iX$pu>"Pu!l(P(\) |m6ȟ$)(%#p% R8|, (%?\"KiR6fw/l3 )!0Š-4۠/d%(d$4 9h0(!&H(#),<pq3DE20W@d\cb*lH#@y@dT#@#4"X% 5ǡ8ҡ00dX(P#\$D"z.,2$%< MK8ha4F7j7du2P]'@,F#(%l4Ţ 'ӢS7dݢIdE'4" ) d*389Ld4E7Zpl2rpt(d|#}4,/i8ģ7ԣV56dpdP\ )4=.@$d(/7`B|6XP<43]pC"n4hp=(8diik.ŤV8ڤ( %L4(p'\Hr+<)/H"C7HU$jf)x&),r"4($dd& $A!p̥05pإ h 5Lġ8d+d4%Ld44&>Ը7Hh\5U5d$\. nd2L8(tD6H̨, $!Dɦ(+ӦT@dds(h}3P_33d.D L0)35r!@=hb4hN<7HW8l .~(|"T7%X$21ͧ3dݧ3'(Ԏ%,8"L,/-!l'/ei<'HJ< Qt28^1Hbt7q\6l-l7(2,Ld10Ψp"ڨ0N"l &P`3p1@`?,L &l$Zk(ԓ2<@dH/d$TH#c 6Ts)Ȫj -*d$ʩ16کT8 86 Y4$|);ԛ&<G(8'PxtiW 9Pc$)hv(p/+H'%'$Ei%PԊ/4ɪT(lת6X,8Xyi)4L?(&$gk8th-E2 LК*l[8,fp"0Q<$r< ||4)8X}8 ȯd8ۯ/'<  486 #(2 &@<8.@T,C.Pi|B&`q!LB.<X;dDm,$d,ǰ O7|԰ 5d߰%@h+%&X ti( i"ĭ"8/̯3,=,,Kr)bȃ'Dl7y@v4<D-p4iC"!XDZ%αhkұwdT'D#h',7dA(,L5)TOdE,z*PO!0f,5ydp40؍*< ;'8udQ97˲Z'<ײ$8!0l"'`[&4 88#4X53kMtiZ4E/0pI)xP ԪjX@dd])ӳV)864, XM($%.'13@0$PG bXF54s.T+d *Y'Lh&06Ŵ45lմ73X1j,$`' s7h-*$`:dAD%pKU0j !yLdlJ,ؑ"X! pd$tõ4"4ٵ|*p)6j<.<5)<J7HVUkct]48M/ t `&7|l+tDu(¶X;#ж,ܶ#x!`k5`' V(9.,.;"hO&7dc\*0o0{| 3<Fd(`',i3LǷ+<׷<3dj!Hi34 Gd0d!$T/Xgk$;T%lJp Y|L6d(4`x8. j-\068θhָ 9 9 x8>d 8d#8D!$i-Ld96Sj&`6Tq8Ȕ(%,$'<x-/5ӹ/|D/1| d. w% $+8/`';)hS#<`+ lopE%ypO6I7j<48Dm'x[2Tƺ%к2'8ں4) Y)%!47 @HD)h_#j %<w^7 H%2Md Z0hL,dɻiۻ9Qd<+' ,9 (,<'"3.? /K8V3-dc+npE'8y| (%8R9 X5żd7ܼ/dH?"\'6H+d"9 1}4|BH5K>7dVl3dlVkp*d}m$, i 3HX%n5$. ν@d <d)H4xN;Z(|+@102 HT 8U18a(ZkuTFdP)2$Tdd3X 3$ӾXqdݾ %X@!p85 6~4L/i9p6B+$M%W(="dT7Dx9`(83dl26 b30п1TS!PhkH50("/$@@jIP2*<eo# nh|r"D 5$4&t1'4-D$2P882,-!@П8)5\8ܲ1 >LdQL:3\Կ&e̽(DmH]'@z$<<p48D@d#tĠ8 a6\hkO.r+t#TF(6 Fd3d w#+68(/0FddLZ8[\ihv7vDN!Xd4P8/`7L4^C!l6dv-<|20d'|6p ?d&@1Qd7d20ih6d'6+2$>.TL&L]T#gti4y8\,lq,5@H5$34"T% L'\ e3+()CT3M$$8Y8&$,e* p8%P7 5a0j)0t88(5` 7X4p2#8.>/DSh[,6git_2|@Y80(<(  <7'h\,d5,-8K# & "8"&+dcm$ott2L0@t%d <7P$8W5\{/LId@'@65&t 98Kx(Y58l&`tp8dD $&" 4Zko+Xp#A"$,6Tx3-X 9< a1*$c.0<X ,UA T_@k*pj8it4`Bd&x\&I8Y|Z'@f&s9 03dH9 |7P/!05,('<$i  3T3*(?<68Lh4kXL#g%xo%Dxt}d8"(4`&l$34-t1,(&lH~d!.pEi%<<,,;3J*Uh&bd4r1*drin#0<7`) (iDEiTh"c@&<y(D8d06X5 pJ01 p18dd5&&8It6kY(m'|"Pd4 hج,U"$ <(t"0 <"%\Ⱦ0 ذ.@ j0R)L7&dVc2<ex&,n$ {л)D@,#Lh7t4Wk@'7@D7TPT$0$$,(l~4>.SHdctik T#8 Tn9n22 C.0y h@gk M*pji4 %.4082d=y.8S,@`d%j9q1d "dL&84\dh40G&P{,L\Q4(gk `3,# &{i4V'D=(-G,Tx/xklziu$}#T4h;#Xd!6`6X-S&0x!И+0d{4,$ty"H3d\$8 340R9|"@Zk3@$4@d+$i`87Bğ7RX2dZz"khz!tz(8L6DX1dL!8t TR8,6'$h l 8 D 18&H&-10dA|5XLp"W'lb\u'@ody4|Fd$L;dp%@78c8`, @<|m$Pȷ&@4`D 3"4(9 5,A#X !m*t$X<817 ,8\+dз7*6x.C"5dl04(39%"R31d(%k`duQ8t+(d"0e6Ddp8*й'8l]2$d 7D"-H%X,1L5$`>|Q3Qs*X]47nм3H|3\ui\h!'V'D$7< itE(` |g10V(X%!-#BX"OTEiX$<(<h5yG'H$!X(`,m3{i1T`dUk.pDd$ `d0&#$58DD DMd5pbuip#zY'T(Ed(0n3,4E'4!L,82(E( idu4 X#*&ri3i=~dC g7L7`4%|po8$~ir6py2$^'PJd<;d4X7d@QdE" 3  /t %4P5)4N5\^pzijDDiwi5<1 7$77l9P6$d?8,4x4,j,7p,t'7`4ET-8N#p\8g.@pzi}%$3-g8Ph&, "l34 3`i2.|7`6\ )d$8%.T7<J.\`,o(`mhtW8t)p(|dT3d@20LT85Y2.D*D%t8(%L^6DZ3 r*H%&(585ki>/8/   p"0p6iP>#8DX N7^dp}4*(1" 8+T0(dd{i7(5,W'<T9 )</3, DxX5|NA&]$0l8rdr`/48/-%,n5Ѝ8܅,x%lH3t^- 4) C*p'h#.4!7wd\R|'04alF",tH7}4"7 )63/|i,`|* t 50/h(H&5 3?8#M0>#DR 6bd9 r $t(L6H,+8,$@5lh!<<.@70* )46>$"xL5t[.l@2z*H_"d7L3T8M7x/(da,*d 4&E#$#,+G" 7D(tD$n!O 3`,l,9z4%8,182<$<i&l`.J#X`k8"n6,(i%l)d7C.J&YA!l@'H~&\Q9 h", 7`42,, L.gk'%`B,(#/6',:XG"@FL2Sh(^|@dn(2~0.0,-L%'U$J7l,/@|#5<DZk/$X1 x8dV$X$ĕ870.I7T3f$rPh-$*40%y21,H+g7 H3<P*6|<*7(%l ip7"<- -894jB!Ol>7[d.LoDO!h,%6$(P%844.Ԃ-TG'28%33t(!l280.&BQ9Pz7bĤ6u8/ (3l@d\6@y"\#T7$,T\a&D$DLd v,T!"%.# ;8R50]&xn{/X.D$h1"4P2,35P8$ v2P*TB" 3| d3 `., ,!l6 -F 7',T x7Ta dj 4y #X Q9  c#D ,0 (D i 7 U1 43x 8 /4 >d hK08 m"# !3 P',? <8W Lh8tg  2'q <#,| tR6 c) @z( |$ H23 p@d L/| 2d `7P 8# 06, Dd9 Db6K <*X 84g h6`w @% 0 "< `4 . `9 hk h *" 20& @(D4 4dJ 0(W l"h dWko /8 * d$h 5"t ( \Ei  0 H' W7( h9 Ė8 % 57 Ld PV12 ,-B  w#$S .\h Q# m x.8,y =, <8 H) |'l a2 |7 t0 x'  4(td..D*;X)4O4P[ 7lt%3Hy .d-#lx)89'D d|r780  -@$tE#,0<:hkB5dO8l[T70d7Tob-t}N9P6k04, e7(5$h/P-zi $8Pd%N8H9@X'DC\2-N@d)h0n"8 !8 6DI044I+xZpdk5du@a5hP-5@3t0/65 %L# p/td&`)2"1+EXC"W ,/m}$wj7ԕ8pc8t6|"$+l5H,5)6&P5D@QdI$&S`_8i9@y20W!D$\/F%'x"6XDHd,+*G"< K4\0$8=$GU&St6\]'h(10o'|m6dQ)XU!l|C.j+X,T8(1  /|zi0d  y/)($0;9 GX (\W *-c/"0tI2\trd TM6/pjK2$5XY"T9 lg0 *#x6\w.LAܒ$I`7x[M6$eWkuغ(3pP9$..8"P$47t*+{i@"\`30,%,3Q*$@,)<S&h3zj 5865` &4<Ȳ9h20З-{,$8x)#HZk78K1 OL{!4d̴0Pmش$x{i6`,n9(jXh! 4.0<,\ t6X $d%dAd0 s%9.8Jq-p[L66Tk.|,) x%T(@|xitzi &7<4h&l(-@#',6.<92A |4(I B%<S  i^ 8f %p'D%41 PN%y5d%!s%t3D% 3%xFd%x;#%#4`%0V.D%/l%5|%̷4%d &\1p&y$,& ':&u'DE&<7XU&`uib&- p&'}&(.&и&H&d @& 6 &)L&\v)&$8&w#'. 'Ti', 6T4'|3D'%0N'"a'U7k'd 'pqd'X#' '6T'3d'H/-'\('$X'47D'*X2hR*D28d*6`x*6\*5`*d*!p*pP#*_"*%*@;.D*`v,l*LZk+i+\2d+$#+4 0+p48+v&F+&,L+)P`+O.8l+4?dw+t%5L+2,+(+Q5$+ԛ4+u6+l p+)+,dG,2P^, 3@k,4+v,,X,h,t(,3,.|,F.,d+,8((,D7 -(( -/8K/)$b/+l/\q%u/$(/d04,/P:"T/|2/,.P/X!8/8j1/-/{$(0$@ 0 i0#&05P@08Q0\'L]0"<o06|0XE5,0t90 0?20PZk03d050-|0)@1L51Hw4#1$i+8.1Ԩ%@71.@E1jW1jd12v1 0.0171)5181/h1D\'<1V#1X]8p18MdT2x725`"20k3*28P92 "C2`&(Z2@W%k2$&p2x*4252hi2M"2!02\`72Th62P5\2,d3R!3d3L51@/3~3;38,H3\@"p_3F"p3D|d>"#>.@8>T9?>t5dO>)5c>$+dl>T;#y>g#>,&\>#L>$>(>x">|.>h/>h>d?$h?\%?4d$?<49?3J?7W?0Mdf?@Fdx?3d?$?(Qd?0?C"?vi?3$?<7?-/x?D3h?6?LX5,@7D@7@(,@{&T3@.B@hiJ@(3T@p<m@|q7L@6<@8#@05P@0d@$T@A2@{d@({7@70@h3Ali Ad I0~i$I,|J 'LJ%p)J088J"HJ*RJ4$i_J7PmJ3X{J$G" J7dJ4J)(Jd,dJx0/JL7PJm6J`6kKu/< K B&p)KM9$0K@dCKJ#NK!0fKy4K3K 8Kc",Kd8K5K&$8Kp$L\7" LddLP7pLЬ,1L%-LP*]PsigP5wPiP{iPd%P`R9P`k P 1HP`yiP&P8Pj9PZ'<P4`8L Q}dQw5D#QTZk2Q.\BQ`j PQ5 gQ,f2$lQ0duQd~Q DQ8Q!QT,%tQ`kQ#Qx"PQ +XQ$R7RF"T*R|69R5tKRTn4HlR@%d|RiRĴ,Rt6HRح4R3`RviR\%0Ra!R\7dRdRR9 S8$TS/&Sh3(4S4xBShuiISȫ34\Sd8oS5|S$0SH*SH/d S2SԶ4S 0,S$dS/S}5S( So&T\ T@d-T'48T "FTdRT6k_TMdlT8TyTX8PTD(PT 8TD6hTO3lT`N2 Ti-<TsiT. T]2( UXkU;&8!U3l1U>dCU,pdKU~dQU%5\^U6 gUT,$(vU06tU\b'UviU&U#TUdU8UakU2UId Ux;/ U0 V65,VW!$BV |RV8,`Vpb8 nVZ2l{Vĭ&V5V8ViV3VA(LVD*8VI*W "4)Wh7D=WH.NW{i[W1kWDL*W,"(W W$6DWԾ34W/&Wo4W #dW$4HXw/l)X(1X)dCX*/lWX?!heX (,pX@6lX԰"PX`7Xc)X pXdX(+X"X6Y03@%Y'1Y]2LCY`6',PYH7\eY%PpY(zY5Y4[%Y<# Yd#Y4Y#dY 3$Y1Y'PYhW$Z$4 Z%<Z"L(Z35ZHdCZ2(XZ@dlZPyivZ@40Z,Z DZA/XZ-Z,P Z5Z<4ZE#Zdx [/[%x'[*6[)N[#U[*k[$t[v#$[0#`[3[%D[3[\.[4_( [/'[d[60\ 1\L7 -\h +6\ -&?\`.6O\XZk`\)$ g\6q\ԭ-}\4,X\;d\C%\h$p\\Zk\Gd\4 \@,\ #$\O9\6]t/*(]&0]wd@]X,M]t,[](7f]6s]P9]X']L ]Dud]Id ]*d](3],d]t ]S3],^$x^\O8)^64^p+@E^h9 R^`,_^%m^0 <s^Nd^ !^@7^h+4$^21^Od^ Md^.P^lFd^?",_, i#_8._u10@_ `7<P_2xY_$+g_<l_7`_4T_Px)_Xr,_8_(80_4['<_K3_d!`0`(&`z503`,A`H8J`jU` i[`L2`i`X7v`Ȳ `]%`܉5x`3`/d`O%T`!h`-H`*4a84a@! &a,54a`Zk=aD/tFav,Pa &dYa@)0pa(xa%48av((a*La8dal!aHM28a(`al#(a$hb>db@ P(b(|=b&Db8 Rb5db b3nb/d|bl#b`='b"b̵9b'b73`b|ibF#b}d bĬ.c,-|!cV1H9ctt1Hc$l8T_cL$'jcp.{c$j)c8N7c$9c(dc`%`c&c34c c)d\DidJ6d\5-d&7d}%4Bd4`Wd< 2ed8tdu,dH&didTF2d|d$dT9d%$d(d'LdH$ePK*P(ej0eckCeziTe$be"me(l7xePOde5e&e7e$ep5ez%eF- e"e9$,f"tf6f}d.fX*9fq%TAfB",Sfp&|_fdF1Tlf"f$df&fi5fD,ft1flT9fQdf3f"g7Lg5g`&(gF&5g*d ?gL8dNg"^gȐ-kgx6}g=-Hg| gFdg-'g'gig4(gl \g.Tg4`*g\R8<hR3`h@2 #hL)$,h%$4h\6Ih44Qh>ddhi.vhT)hܟ3hx +Xhl7ht* h"@hLT9h2hlEih< h2< i'iI3$iH!1i 7T=i8"lQi(R%D_i Dpi;8,|iO0<i|}ii-'tildi'i`#0i 3Hi'8TiA.pi+`j8!jd*jLS36jL2Ejt+Rj7&`j/jj,xjx;'j)#0jI&,j4v4j)ljldj4"Xj83tj\i+dj((0k3dk0#kX(4)kx5,5kDd(QkP6@fk4.<}kw,kJ#kNdk <k%k-0 kg6<kT7kxdk,%0k%hkt Pl/"l8,l D;l 5$Gld'dPl$|]l\27llr6yl/lGdl7@l6l 6 l\95lU-8lTM)4lv&m&lm 1mLd'm#$/m.'|;mv"|Hm Zm,4jm .}mwim(mp2(mt~40m`>dm,O%m7m{7DmD2n8n"n70.nP5`"og4o&xoio(" p,~3`pLa/5pi@pD8Xp*ip,up)XJv$"WvF%0`vO(tv<"Dv44vLA1hvl/vH4Dvlxd\v/ w01w)%whh.wt ;w2 Hw$<QwldZw$+/Xfw./ ww/,wphw,%Pw\t2wQ-wxdw,3Tw.wr$wDiw  x3P#x'P4xd@x$dLxt7H^x&(gx5Dwx<(`x\N(4xLq'lxd7/x5Tx x -x%xC5\x7xt.T y\iy`$%yh14,y\W60d{dܷ,iiDdP|6(!'H ΃q'܃,,d($P@d*'pm"(-858E/dR!Tc5 o4-t`rdH)4T"xudd˄3܄uisdLd4>& !ȏ2%10+,x;p% IDFiR$^<+4xD lQ!84`{5@LS.$s'|΅E5܅38u,vi`387X#(56dF/dFd(XRH$6T`/$n&ܲ.)pp(\$h †l7*؆d(0'86dy4 M)# " 5\)Kx#tZ5k(t+t$il}HAdY/%$G&<X5,ڇ1<#  *%!5d0X*<0A~dK~dR-]'0tl@r($zdZil'D\v$T]885l&0*`̈ {!@׈p)h &0"841H+Hj2>)hV'@e48xTyit(P1P\)4Tqdʼnl#X̉ek܉j"`9 , +x$4+%.(?,$8Gh25Z7.vOdx))<_7H* +7 hɊ21 Ԋ6L@4Td6\%(2/t+<p7Ga8]/7o%45 *&Xd0 TʋP!8T׋`AdW0L3d0#  8N1(13$>9-dGd<(U7fh.\ulhD"Ј-#N!\$%d8͌F88ڌ|:3p i`(Xв1 M#tH6 %y76\3H#HWpuietii(uek@ , , &@<1T"@$24Ѝ8XX6(h'="DMd/&84\G!U'clZku9(x00Q#!lŽP 8,͎O7׎(8#D#0 4gk:.l58@d'|P'[0 6p3~4`,%l/D*i 8Ǐ6ۏ) @ l-8 T,'ȉ76f*B\T9LhZ i$`sp)$~$$D5h1<1-Hǐ(u)4ݐd,Hd$ 4x"D"H5B&(<j-DHQ9 T 38a42kN!@34 !Qdв9(Ǒddґx%$ߑ4$`88/hH89#d$C!79?,^4PnLdT%$D;'42D’.ђ8#ݒv6H4- @& *P{#t!x&,%D908Ht8TTw5Hb#g'rY {84(4,04d/L%X̓TD30ٓ|&lĸ"0p+d#&617FgkdC&n A2{q-17v6\8p%Ŕd+7Ӕd<2/4 k8 j<  (H5L(,;$pdC50 Oc2pd|/td{}i%&x.dswap_onwi_set_nwkeypfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadaxe_tickuaddr_bestfit_functionslongjmpwi_usb_rx_list_initsr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockpcmcia_printarpresolvedp8390_readchange_displayparamchrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnrtlabel_unrefHMAC_SHA1_Updatene2000_write_mbufuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevsdmmc_intr_establishwi_inquire_usbdumpmagieee80211_derive_ptkttyflushsys_setsockoptcomdefaultrateieee80211_watchdogclock_gettimewihap_sta_disassocdefrouter_lookupinetswwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpxa2x0_gpio_intr_stringpmap_alias_bitsuvm_maxkaddrnsphy_cdumass_io_puticsphy_resetieee80211_getmgmtrlphyattachpxa2x0_gpio_intr_establishipmforwardingmainbusprintohci_waitintrzssp_read_max1111sys_closeusbd_do_request_flagsrtflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidieee80211_encapax88190_init_cardusbd_intr_transferzaurusmod__ashldi3vn_statunp_detachnd6_nud_hintether_ip6multicast_minusbd_submatchtcp_secretrti_find__mainaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_rebuild_threadwi_read_data_iomyip_ifpwdc_reset_channelin6_domifdetachieee80211_get_authvtagsmtx_enter_trywskbd_cndetachdb_get_variablecd9660_vgetieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatwsdisplay_burnerpxa2x0_apm_sleepohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addruaddr_free_rbtree_RB_NEXTfilt_seltruecomspeedlogvn_writechkin_ifscrubarmv4_tlb_flushIuvm_pmr_freepageqdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigroute_dstsingle_thread_clearinit_execuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablezaurus_udc_attachnamecache_rb_cache_RB_FINDsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszblf_zerokeydb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodessetjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_infowsdisplay_switchurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsrasops_cursorvndxfer_pooltcp6_mtudisc_callbackcopyoutstrpte_l2_s_prot_uieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepxammc_matchapm_suspendscoop0_set_card_poweruaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeroural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameuvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3wsemul_getnameallowpowerdownsys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetachmouse_copy_extend_linezapm_power_infoarprequesttfork_child_returnsiginitpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdsetdisklabelbio_registerdeflateknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocsr_hotspare_rebuilduvm_mapent_addr_insertroutedomainusbf_interface_numberhid_locateicmp6_errorVOP_MKDIRpool_large_freertl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddloguvm_page_physgetusbf_add_taskmsdosfs_synccheckdisklabelscoop_pcic_attachscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featureuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremque__adddi3uvm_map_inheritusbf_rem_taskapmopensys_getthridcd9660_syncin6_ifawithscopebuf_page_offsetuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingzts_pollsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdwdc_set_driveuvm_map_protectusbd_get_xfer_statuswsfont_enumpxammc_clock_stopuvm_map_setup_mdprintfpxa2x0_splraisecdce_devsrandomwritepxa2x0_cpu_suspendprelist_updatehmac_ipad_buffercrypto_drivers_numip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandomsysctl_doprockcopyzts_sync_sendwsdisplayopenext2fs_initrtfreesingle_thread_checkpxaudc_freemcuio_getptrcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdusb_needs_reattachdeflateTunezkbd_cnpollcuaddr_hint_selectsched_cost_runnablexscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohnd6_ioctlsched_chooseproczssp_ic_stoplcd_set_brightness_internalphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrsdmmc_activatewsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultibuf_nkvmsleepsdmmc_io_rw_directsdmmc_io_write_2pxa2x0_init_interrupt_masksuvm_forkdisk_lookupuid_findumass_activatend6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromttydefcharssigexitscsi_link_openhidirtypagesin6mask128bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_meta_readdb_shift_exprapm_pxaip_cabs_notimpl_bs_c_8physical_startifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyacphy_cdcrypto_getfeatsched_cost_loadsdmmc_printwsmux_attach_scusbd_pipe2device_handlecpu_do_powersaveaue_rx_list_initwsdisplay_kbdholdscreenuvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolpgrphashsys_setpgidprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tablesysctl_file2exec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listpxa2x0_lcd_suspenddb_trapip6_maxifprefixesieee80211_node_cache_timeouttcp_do_rfc3390ieee80211_req2nodesys_setresuidcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogipsec_def_compfc_lmdistancepxa2x0_intr_stringnch_poolphtree_RB_REMOVEsomaxconnsdmmc_card_intrural_readpxapcic_socket_enablescsi_xs_get_donepxaudc_ctrl_methodsipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssisd_buf_doneieee80211_get_rtsamap_initffs_flushfilesicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6statuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepether_crc32_leaue_csr_write_1rn_searchipipstatsecureleveldb_consoleurl_matcharpt_keepsavectxdb_printsympte_l2_l_cache_mode_ptbinuptimesys_seteuidpxa2x0_bs_allocwskbdpolluvm_map_checkprotmax_protohdrcdce_activatedes_is_weak_keyural_rf_writedb_access_irq_spzapm_poweroffieee80211_add_qos_capabilityieee80211_cipher_keylensdmmc_alloc_ccbsumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesusbrev_strsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_usewd_standbymi_switchcd9660_statfsrasops_rotate_fontsysctl_sensorstsleepkern_sysctlnd6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremovepxaudc_softintrigmp_fasttimobufq_disksort_queueatomic_setbits_intuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortrt_mpath_matchgatecdce_startapmioctlusbd_port_disown_to_1_1uvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstata4x_bs_r_2dma_constraintdb_break_tableuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistwsemul_vt100_output_esc_hashudav_newbufsys_umask_tr_flush_blockpow2dividesyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentcpuset_addbs_notimpl_bs_r_8pmap_alloc_specialstcp_setpersistufs_ihashlookupscsi_inquire_vpdmemmoveicmp_rediracceptapmcloseusbd_get_hub_statuswsemul_vt100_detachworkq_create_threaddb_boot_halt_cmdural_attachip_outputbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencelcd_ioctlpcmcia_card_attachuvm_pmr_addr_RB_PREVbpfreadbio_errorpxaudc_ep0_intrpool_putm_copym2buf_alloc_pagessysctl_structbufqs_stopohci_hash_rem_tdaxe_ifmedia_stssysctl_rdstringuvn_attachsdmmc_send_if_condlasttimesr_wu_putcryptoclosesysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinksr_concat_alloc_resourcespmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statussdmmc_verbosenchinitexec_mapdb_qualifysnprintfcomcngetcext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicescoop_pcic_functionsip6_forwardingsr_shutdownural_cdkue_resetarp_allocatedrasops_isgray_bus_dmamap_load_mbufwdc_print_capssdmmc_io_write_1wi_watchdog_usbifindex2ifnetcd9660_ioctlrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallmouse_copy_worduvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferwsdisplay_addscreenbuf_kva_endsr_raid1_intruvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzusbf_attachdefrouter_resetcd9660_ihashinssched_exitcheckaliasdl10019_mediachangecue_activatettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachrn_mpath_countwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzlibVersionsr_raidp_assemblezapm_enable_chargingsdclosevop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackuao_createdb_free_watchpointssensor_detachifaddr_items_RB_INSERT_COLORbuf_mapaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolpxaudc_zaurus_cacd9660_bufatoffgroupmemberuvmspace_initscsi_plug_detachether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptions__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpxagpio_reg_readspec_openpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackcrypto_initvm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamepxaip_matchdvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctluvm_pmr_addr_RB_MINMAXdb_history_prevmyip_initializedpxapcic_scoop_casys_mkdirdl10019_media_finiuao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbusbf_string_descriptorrttrashohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessys_socketohci_shutdownffs_cgreadwi_init_usbvm_map_lock_try_lnzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimeufsspec_writelxtphy_casd_read_cap_10iso_disklabelspoofpcmcia_cafdfreeuvn_detachieee80211_ccmp_set_keyuvm_km_valloc_trytty_counthidkbd_detachdeflate_globalpxaudc_intrraw_disconnectpxaudc_ctrl_closeipsec_ipcomp_default_levelsensor_task_registerusb_end_tasksip6_neighborgcthreshbufkvmKERNEL_BASE_virtpxaohci_activateremove_coproc_handleratomic_clearbits_intumass_polled_transferdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachgpio_strobe_pins_c3000msdosfs_mountfsvfs_relookupuvm_map_addr_augment_getncpusfoundwi_stopip6_sprintfzts_ioctlsync_fsyncsetstatclockratecd9660_strategyohci_allocmuserconf_parseural_tx_bcnpxaudc_intr1ip6_keepfaithext2fs_alloczapm_ac_onpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopypxapcic_event_processemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2pxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacescoop_gpio_pin_readuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updatecue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initwsemul_vt100_output_dcsglass_consoleAES_GMAC_Reinitsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmask_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipein6_addrscopebuf_getsys___threxitieee80211_ifdetachdb_searchapm_get_eventbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevinitidbs_notimpl_bs_wm_2uhidev_detachsr_crypto_hotplugttyinputscanc__stack_smash_handlerukbd_consopsbiodoneural_activatedb_set_breakpointzssp_activateicmp6_rip6_inputwi_usb_txfrmmaxslpext2fs_makeinodecue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrsr_crypto_assembleufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddr__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPip_dooptionsvn_lockcue_tick_tasktimeout_add_tsrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initwsemul_vt100_handle_csiumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocuvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusrn_matchcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoftraid_disk_attachsoreceivepxaudc_connect_intrpool_getuextralocsdmmc_discover_tasksharp_zaurus_C3000scsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefrip6_outputinflatescsibus_cdin6_get_rand_ifidndflushpxaudc_allocxcompose_tab_cmppxa2x0_lcd_start_dmaieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mul_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcessys_setrtablelcd_get_brightnessm_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_polltqphy_funcswihap_initversion_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyaxe_rx_list_initata_dmaerrieee80211_bip_set_keyuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcbs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputudav_initVOP_REVOKEconfig_deactivateSHA256Finalclallocipsec_esp_trans_default_levelbiowaitusbf_insert_transferfilt_ufsreadunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_cawsdisplaymmapccpupmap_updatepxa2x0_gpio_intr_maskgeneric_bs_sr_1hidkbd_inputsr_raidp_recreate_wufdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksupl_stopttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headwsdisplay_switchtoconsolein6_maxmtupmap_enteramphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecryptoopencomcnattachuserasymcryptodb_var_rw_inta4x_bs_w_2usbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findusbd_iface_claimedtcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolsdmmc_disablescsi_initmsdosfs_advlockdl10019_mediastatusswcr_idwdog_registerkue_attachif_indexlimusbd_free_xferdb_varssys_utimensatfalloclxtphy_cddeadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrsys_accessnsphy_statusuvm_swap_iouserconf_initkillpg1url_tx_list_initwsmouse_mux_openvputonfreelistmouse_removewdioctlext2fs_mountrootieee80211_findrateregyearurl_ioctlpage0setrunnablepool_do_putpxa2x0_pi2c_closeuvm_pmr_getpageswi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkffs_specvopscue_attachpxa2x0_stray_interruptelf32_read_fromosversionhid_is_collectionnsgphy_statuswi_usb_tx_list_initapm_power_infofind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controlieee80211_get_addba_resprlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDohci_freemm_cldropmbstatuhidev_intrttyinfodb_flush_lexusbf_transferttyinohci_root_ctrl_donegetnulldevdb_dmesg_cmdsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildzapm_pollloop_clonerttsetwatergetcieee80211_addba_requestsr_raid6_intrfilt_apmrdetachifaddr_items_RB_INSERTdb_last_addrural_update_slotmouse_copy_startuvm_pseg_lcksr_ioctl_volpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mountbpf_mtap_etherpgsignalfirstcdb_read_bytesuhub_detachusbf_set_addressieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openrasops8_putchar12wsdisplay_consinetdomainwsfont_findmemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachcue_newbufdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrreqvm_map_upgrade_lnspec_writeipsec_esp_network_default_levelkq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrsdioctlutsnameip6_setmoptionsexit2usbf_set_configaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateieee80211_send_4way_msg2tcp_update_rcvspacerddumpusbf_set_endpoint_featurecpu_setperfuaddr_rnd_poolufs_lookupufs_bmapdoasyncfreepxagpio_cdudav_miibus_readregip6_randomflowlabelttpolldegetlogpollkthread_createsdmmc_mmc_commanddb_elf_sym_initwdc_default_read_raw_multi_2logclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4pcmcia_submatchinstall_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_disksr_put_blockohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assemblesd_ioctl_cacheext2fs_checkpathsocantrcvmoreprocess_poolip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssdmmc_mem_initdes1_zerokeypipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_poolpxa2x0_rtc_getsecsuaddr_kbootstrap_destroypmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcuaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutessr_raid0_createsdmmc_set_relative_addrnsphyter_cdumass_atapi_attachwsemul_vt100_output_csiin6_are_prefix_equalin6_controlpxaudc_bulk_startuvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96swcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalpxaohci_enablerushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscoop_activatescsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initnd6_useloopbacksr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxsr_raid6_free_resourcestcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsched_choosecpu_forksrv_ipohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthlcdintruaddr_pivot_randomdb_printfuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunkssdmmc_mem_write_blockfreqmsdosfs_unmountelf32_load_psectiondb_show_all_bufsrn_mpath_nextnamecache_rb_cache_RB_MINMAXarm_pcache_unifieddb_add_symbol_tablem_tag_nextohci_intr1msdosfs_writebs_notimpl_bs_w_1zaurus_udc_detachcue_resetexec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryiophyattachzts_readposne_pcmcia_get_enaddrdisk_attach_callbackselrecordffs_validatecomstopaxe_ax88772_initffs1_compat_readrip_outputpxaudc_bulk_methodsext2fs_accessmld6_fasttimeouaddr_rnd_insertkthread_qcdcef_txeofimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdstackgap_initpipe_createsysctl_vnodend6_sysctlpxa2x0_setperfsyn_cache_putdoopenatvn_opensr_raid0_alloc_resourcesif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192in_pcbrtentryknote_dequeuesr_discipline_initwi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbpxagpio_dispatchsched_idlebio_warnwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportsys_getloginpxa2x0_gpio_intr_disestablishifaddr_items_RB_NEXTbuckstring_initicmp6_rediracceptdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4arp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallwsdisplaypollsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsyncwsemul_vt100_cnattachtcp_mss_updatefree_pagesdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufgpio_sense_pins_c3000uvm_map_pageable_wireroute_outputrti_deletesys_geteuidpxa2x0_gpio_set_functiondb_output_positionrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodip6_defmcasthlimsys_munmapsdmmc_io_write_multi_1kp_nonepxa2x0_lcd_initializefilt_solistenvsnprintfpxammc_intrwsemuldisplaydevprintarplookupuvm_map_pageableproftimer_trampolinechainallocsw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablewsemul_vt100_scrolldownwsdisplay_getc_dummyip_mloopbackbpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbufnd6_rs_inputscsi_activate_bussoabortm_free_unlockedusbf_clear_endpoint_haltcast_encryptunp_inohidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cacoredump_elf32softdep_flushworklistsys_issetugidinitclockssdmmc_decode_cidcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolunp_connectuvm_pagermapinif_detached_startpool_serialxscale_cache_flushD_SEscsi_probe_lunirq_entryaue_ioctlni6_inputvfs_mountedondb_expressioncputypert_lookupfc_lookup__bss_start__usbf_alloc_xferif_downndqbVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1wihap_deauth_requsbd_fill_di_taskieee80211_node2reqwi_usb_matchelf32_check_headerdb_historygf_logeephy_cdinphy_cdttytstampural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_seriallcd_pxaip_cawsdisplay_resume_deviceauth_hash_hmac_md5_96autoconf_attdetapm_thread_createufs_chmodsr_raidp_discipline_initcdattachuserconf_devicesr_raidp_alloc_resourcesin_localaddrsys_sigaltstackDES_versionsdmmc_cisptrsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectuvm_map_printitdb_read_variablensgphy_casoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpsr_raidp_rwuvm_pmr_pnaddrttymodemdb_lbuf_endwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionallcftablesuhub_activateAES_GMAC_Setkeysleep_queue_initax88190_mii_bitbang_opspmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSsys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctlwsdisplay_clearoncloseuvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepusbf_config_descriptoruvm_objtree_RB_FINDsw_reg_iodone_internalumass_init_insystemfrag6_deletefraghdruaddr_destroydirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEwi_usb_activateconsinituvm_pmr_isfreesdmmc_scsi_minphysurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printminidatacleanrt_timer_queue_destroysr_meta_probezkbd_syncwi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatlcd_show_screenenc_xform_3desuserconf_enableext2fs_vinitdb_endlpumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftgeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinitsr_concat_discipline_inituvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmacscsi_xsh_delscsi_plug_probesys_unmountsr_meta_native_probebootdvapmkqfilterelf32_probesin6ifa_ifpwithaddrvgonelsofreend6_dad_timeruaddr_rnd_destroyinphyattachctrl_eventcpuset_unioncomsiraddrdb_del_symbol_tabledb_add_expreephy_matchpmap_removebpf_mtap_afusbf_free_xferhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroywdccommandcdcef_ioctlpxaintc_attachmyipbpf_setfuserconf_historyuvm_page_unbusytk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfgeneric_bs_rr_4cpu_sysctlcd9660_deftstampzlibCompileFlagsip_randomidaue_tx_list_initnettxintrsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachsr_startwu_callbackcddumpdb_search_cmdpxa2x0_lcd_alloc_screenastusbd_claim_ifacetcp_disconnectuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnamedb_print_llinfodisk_closepartwsdisplay_emulbellupl_outputext2fs_bmapuvmexpenc_xform_blfbufq_donesensordev_getufs_diremptyreinsertfinishdupsleep_setup_timeoutukphy_serviceqsphy_resetdeflate_decompresspool_destroylogwakeupshutdownhook_listdl10019_mii_readreghidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsieee80211_media2ratedmapoolsbdevsw_lookupdisk_changewsemul_vt100_resetopsdmmc_create_threadamap_lookupsdoreallocblkscache_revlookupbpfread_filtopssoinituvm_mapent_isjoinableVOP_MKNODuvmpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometrysync_vopshw_uuidext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrvirttimer_trampolineip6_maxfragpacketsdb_errorax88190_media_finiprefetch_abort_handleruvm_km_threadsr_checksumscsi_probe_buslminm_leadingspacesys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodskp_zerosoconnect2knote_poolcnopenscsi_test_unit_readyural_set_bssidnmbclustural_get_rfsominconndma_freesoftraid_cdpcmcia_matchuvm_vnp_syncusbf_end_configpool_allocator_large_niusbf_add_configwsmux_set_displayieee80211_get_disassocwihap_assoc_reqarpt_downsr_concat_intrwsmoused_wakeuprdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTnumnegmii_phy_autorasops15_putchar12wsmouseduvm_pmr_addr_RB_FINDuvm_mapent_free_removemax_datalenwsfont_rotatemsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4sr_raid6_alloc_resourcespte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufmii_bitbang_writeregsys_ftruncateaes_ctr_cryptm_splitsoftintr_disestablishentropylockurl_stopzts_irqtcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedscsi_sem_enternd6_maxnudhinttcp6_inputsosetoptkp_dirtytcp_mssifa_addcache_purgeudav_stop_taskbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0comconsrateauth_hash_hmac_sha1_96pcmcia_intr_disestablishuaddr_pivot_insertfork1curpcbdb_activevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setsoftraid0pxaintc_matchsys_chmodprelist_removeuvm_objtree_RB_NFINDffs_vgetaxe_encapinitprocip6_getpmtubcstats__umoddi3arm_dcache_alignvm_map_downgrade_lnip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_reqscsi_activate_lunuvm_page_physdumpwsemul_vt100_nextlineuvm_atopgX_db_sym_initmaxprocesssyn_cache_timervt100_initchartableslcd_paramieee80211_auth_opensolisten_filtopsprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachpxa2x0_intr_disestablishrt_msg2suser_ucredsd_shutdowncom_is_consolemem_noext2fs_buf_allocdp8390_starthicleanpagesbufbackpageswihap_sta_deleteuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopskernel_mapwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powdb_not_taken_bkptm_printuvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsuvm_objwireohci_device_bulk_start__guardtcp_mss_advSHA512Update_intin_ifaddrzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDpxaudc_ctrl_startne_pcmcia_dl10019_get_enaddraes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollbadaddr_read_4bzeromii_bitbang_syncumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEdb_show_all_cmdsusbf_set_endpoint_haltscsi_devidin6_addmultirn_newpairbioszts_enable__udivdi3sys_obreaksdmmc_intr_enablepxapcic_attach_cardpxa2x0_gpio_set_intr_levelblf_setkeyusbd_set_config_noieee80211_pmksa_addlastddateuvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internaldb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitpxa27x_cpu_speed_91ieee80211_create_ibsswsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initswapmapscsi_get_linkdisk_initpxapcic_intr_establishSHA256Updateohci_bus_methodsohci_hash_rem_itdrip6_ctloutputdisk_readlabelaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutpxammc_intr_cmdusbd_bulk_transfer_cbexec_aout_prep_oldomagicwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachsysctl_dopooluhub_matchpmtu_expireuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinsa11x0_intr_establishbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvp_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackbpf_reset_dnd6_dad_stopdiskmapioctlhid_start_parseuseloopbackscoop_pcic_socket_setupinflateSyncPointuvm_waitfilt_apmreadnexecsmclpoolszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micusb_abort_tasksbs_notimpl_bs_wr_2pmap_bootstrapblf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizekmeminit_nkmempagesspeedtablesusbd_new_devicewi_pcmcia_detachuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_io_putscsi_iopool_inituvm_pmemrange_findfillinusemaprecvitbmtphy_funcsusbf_get_descriptorscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blankuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevxscale_cache_flushIDieee80211_plcp2ratert_tablesrt_ifmsgrandomread_filtopsrealitexpireipstatunix2dostimesr_raid6_recreate_wudounlinkatscsibus_caurl_newbufusbd_delay_mscrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrdl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getext2fs_reloadurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemuvn_flushurl_cdnsgphy_servicesdmmc_del_taskuvmfault_relockinferiorxscale_cache_purgeD_Eukbd_attachclusteralloccryptof_readsr_raid_syncrt_if_remove_rtdeletewskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_caudp_notifysdmmc_app_commandendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachif_detach_queuesitimerdecrieee80211_get_delbaether_outputpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0sdmmc_io_detachaxe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriteieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrpxapcic_attachcomprobe1cdsizedb_symbol_valuesumass_lookupdb_evarsupl_activatewsmouse_mux_closewakeupgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2pxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_bufferrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmap_tr_stored_blocknd6_option_initbufq_quiesceext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfilt_ufswritezts_activatert6_flushpxapcic_io_freegeneric_bs_r_4pxaudc_epN_intrmmrwffs_bufatoffieee80211_add_ds_paramswi_usb_rridrespdohooksgf_invieee80211_rssadapt_choosenprocessesukbd_activateaue_setmultiif_detached_ioctllocnamppsegswi_usb_causerconf_showip_mtudisc_timeout_qsr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridspeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandin6_if_upfilt_pipereadskip_spc_rightpxa2x0_intr_establishenc_xform_aes_gmacsoreservepidtakendb_formatconsoleuvm_mmapusb_activatepxaost_attachscsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatztsavgloadedrtalloc_nocloneether_addmultitimeout_mutexieee80211_recv_actioncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharwskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowninflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiopxagpio_camii_phy_ticksdmmc_io_function_enablecd_read_subchannelextendfilelortrequestwsdisplay_resumeicmp6_inputwsemul_vt100_outputbuf_valistuserconf_addsdmmc_io_write_4ohci_device_intr_methodswi_func_iocreatedefilt_randomreadieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrumass_attachwsdisplayioctlcryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimwdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2nameusbf_setup_default_xfersbdroprecorduvm_coredumppxaip_searchwdsizenamecache_rb_cache_RB_REMOVEsdmmc_io_scanacphy_statusip6_sysctlsuserusbf_devinfo_setupdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1pxaudc_activatetk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwritesr_warnieee80211_alloc_node_helperrootdevm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_deldumpsysicmptstampreplif_detached_watchdogsys_nnpfspioctlusbd_ar_piperip6_sysctlext2fs_fsyncdoforcesys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writeusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configcast_setkeytcp_outputnsphyattachpxammc_intr_data_bus_dmamem_mmapwsdisplay_emul_attachsdmmc_mem_read_blockupdate_ledsext2fs_updatepxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppsdmmc_enableffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTpxagpio_intrlowieee80211_eapol_key_decryptsr_raid1_free_resourcespcmcia_intr_establishuserconf_maxlocnamespool_reclaiminitdisklabelusb_quirksbpf_sysctlvflushieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymmouse_copy_extend_charbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32timeout_add_nsecuvmfault_lookupm_extfreene2000_ring_copysdmmc_set_bus_powerupl_intrural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlupl_matchno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuerasops_pmaskscsi_sem_leaveinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletepxapcic_intr_stringuvm_pageidlezerosdmmc_io_initusbf_do_requestwskbd_do_ioctl_scdead_vopsdb_symtabsieee80211_media_changeuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdmax1111_adc_value_avgastpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initsdmmc_needs_discoverifa_ifwithroutem_clinitifpscoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keydb_print_positionrtflushclonedb_radixgetblksr_raid_turmouse_pastedl10019_stop_cardmouse_copy_endxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initwskbd_repeatvtypesuvm_map_fix_spacedata_abort_handler_address__lshrdi3rtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidscsi_io_getsr_infone_pcmcia_attachkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closeeephy_activatecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsynccfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathcdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrusbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initkqread_filtopscoredump_writeusbd_setup_pipexscale_setttbxscale_cache_cleanIDaue_csr_read_1pcmcia_check_cis_quirksieee80211_beacon_allocbuf_acquiredolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocpcmcia_card_gettypeifa_print_rbpxa2x0_clkman_iohufs_ihashinszcfreein_setpeeraddrinphymatchpxa2x0_a4x_bs_tagwindow_inflatedb_readlinewsdisplay_delscreenether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatsmsdosfs_inactivecurrent_intr_depthpanicstrwsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlhw_ver__umodsi3copyincomparamural_stopudav_sendcd9660_defattrohci_device_bulk_closertalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetswcr_combineddes_set_odd_parityne2000_read_hdruaddr_pivot_selectsigacts0scoop_mmc_attachuaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushiophy_funcsusbf_create_threadlcd_matchuvm_mapent_tryjointtioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmuvm_pagealloc_multisdmmc_io_read_2hidkbd_enableffs_mountwsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsusb_desc_iter_initdp8390_mediachangeconfig_process_deferred_childrenohci_ifcdwsdisplaywriteieee80211_add_htcapsxscale_cache_purgeID_Esdmmc_decode_csdbs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootmii_bitbang_sendbitstqphyattachusbd_finishbpf_getdltlistm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockohci_root_intr_abortuaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initbuf_rb_bufs_RB_NFINDbuflowpagesswapdev_vpdp8390_resetpxa2x0_bs_mapaes_xts_cryptieee80211_deliver_datadead_readusbf_reallocpxapcic_socket_disableufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutunputcendpcmcia_verboseVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmprasops_copycharnd6_recalc_reachtm_intervalin_ifinitohci_device_ctrl_closerasops15_makestampwi_pcmcia_activatein_pcbhashlookupsys_mknodatapmread_filtopskp_dmaural_writeVOP_ABORTOPcoredump_tradsr_raidp_free_resourcesdofchownatsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_poolbackoffpagesuvm_pagerealloc_multiieee80211_wep_decryptwi_inquireuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimessdgetdisklabelsysctl_proc_cwdwi_do_hostdecryptinternal_commanduvm_map_boundarymalloc_errintvlin_losingVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchinflateBackInit_crypto_kregistervn_ioctlwi_usb_ctl_lockufsspec_readdb_show_calloutaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdip6_sendredirectscast_decryptddb_sysctlsr_get_blockukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsieee80211_node_join_11gaxe_setmultisyn_cache_countuaddr_stack_brk_createieee80211_add_xratesusbf_errstrnd6_timer_chne_pcmcia_ax88190_set_iobaseuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachwsmouse_add_muxbdevvpifa_ifwithdstaddruaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashpxaudc_read_epNrijndaelEncryptscsi_ioh_deltcp_keepintvlsr_raidp_createcdwriteufswrite_filtopsttybgconfig_searchzts_samplesphtree_RB_PREVwihap_sta_findusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocaue_tick_taskcpufunc_faultaddressdb_preveephy_funcsinphy_funcsbswap32ipsec_exp_first_usecdcef_cdrlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreepool_prime_pagesys_chownuvm_pagewirerasops_putchar_rotatedin6_joingroupsys_munlockinflateBackuvm_anfreedofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlescoopmatchvfs_getcwd_commonset_cpufuncscttyioctlsys_lstatscoop_gpio_pin_ctlieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocnullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdateudp_sysctlsys_openatax88190_mii_bitbang_readm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolnkmempages_minukbd_accessopspxapcic_io_allocusbcloseudav_matchpxauart_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtblieee80211_add_tielcd_set_brightnessetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2sdmmc_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argspipelocksr_raidp_addiovt100_selectattributeumass_scsi_setuppxammc_clock_startproc_poolaue_intrudp6_inputsys_writedb_get_valueural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedemul_flags_translatesr_uuid_print__bss_end__wsdisplay_maxscreenidxip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2db_inst_countdb_read_linewsdisplay_switch1wd_get_paramsbread_clustersys_readlinkext2fs_size__ashrdi3cpufunc_faultstatusbs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEwsdisplay_burncrc32ip6_auto_flowlabeldevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzpxammc_card_intrxscale_cache_syncIrip_sendspacecoredump_writenote_elf32xscale_cache_cleanID_rnguhidev_writeusb_generic_tasksamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadbufq_disksort_requeuesr_check_io_collisionrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcrd_casdmmc_read_cissoftclock_siwi_usb_threadsr_ccb_putzkbd_ioctlin6_pcbsetportalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnpxammc_exec_commandrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchdehashtblsocketopsscsibus_bioctlbuf_acquire_unmappedX_db_sym_numargspcmcia_activatend6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxskip_char_righta4x_bs_r_1pmap_zero_page_xscalettyread_filtopsuvm_mapusbd_bulk_transfergetinoquotascsi_do_ioctlrtable_existsdisk_lock_nointrcd_resetX_db_forallscsi_ioh_addscsi_detach_busudpstatroute_inputsetrootcsr2cd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopifmedia_addfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenieee80211_add_rsn_bodycd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupwi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttysr_concat_free_resourceswdc_pcmcia_caural_bbp_readpxammc_host_resetsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocolpmap_l2dtable_ctoruvm_mapent_forksharedm_pullupenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEnull_zerokeycrypto_freesessionwsemul_vt100_output_string_escwsdisplay_kbdholdscrpxa2x0_rtc_getalarmcnbellm_copydatagetdirentries_internalcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedicmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4wsdisplaykqfilterkue_setmultizapm_acintrmmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigsdmmc_print_cisohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlvfs_busytimecountermouse_copy_extend_afterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenwskbd_compose_valuespec_getattrip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachpxammc_card_detectpxaost_matchieee80211_ibss_mergeboot_filefilt_sordetachpsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORxscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endusb_disconnect_portieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activatebmtphy_servicesched_kthreads_createuhid_cdwskbd_cnbellbintimesr_crypto_intrvt100_decmodewi_seekfilt_soreadpmap_remove_allrtable_addzeropageipsec_def_encffs_nodealloccgsoftintr_establishpxaudc_detachuvm_pmr_removeip4_input6pdevinit__iordi3nsphytermatchuvm_pmr_findnextsegmentinetctlerrmapresetpriorityusbf_device_descriptorrasops4_putchar16enoioctlwi_usb_start_threadsigacts_poolexecsigsconfig_initip_weadvertiseicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macuvm_addr_destroyuvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesusbd_reload_device_descext2fs_advlockknote_fdcloseusbd_get_devcntif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startmouse_hidezssp_matchsyn_cache_respondif_creategrouppxa2x0_gpio_set_dirllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointsmdscsibusattachnsgphy_cdsyn_hash1ulminwihap_data_inputpxa2x0_lcd_free_screendb_last_symtabproc0paddrrn_addmaskifaddr_itemsusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_polluvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdusbf_devinfo_freetimeout_adjust_ticksxscale_cache_cleanD_Ewskbd_do_ioctluvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_match__wdccommand_startsdmmc_complete_xssysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputkmemusagezapm_suspendswcr_sesnumlf_getblockautoconf_attdet_mtxtcp_rttdfltcleanerprocieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainohci_handoverusbd_intr_transfer_cbsowrite_filtopssr_chunks_unwindstrncpycseaddrevarp_in_progressdb_disasmsdreadupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featureusb_run_tasksbpfilter_createsysctl_lockax88190_mii_writereglockfpoolwihap_disassoc_reqrasops_copycols_rotatedieee80211_find_nodecpu_switchtohtonlsched_all_cpususb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donewsdisplay_suspend_devicedeupdatzapm_get_eventSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modelarm_dcache_align_maskcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagdl10019_init_cardbmtphy_statususb_syncmemdisk_unbusysysctl_filesoisconnectedurlphydebugsdmmc_ccb_allocamap_clean_worksusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5sdmmc_delayxscale_cpwaitvattr_nullsys_getsockoptuhidev_attachfrag6_nfragpacketspxapcic_pcmcia_functionsdb_linesr_raid0_assemblepool_allocator_largein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodspxa2x0_intr_bootstrapdb_ed_stylensphyter_funcsmii_submatchuvmexp_printohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelpxa2x0_setsoftintrbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleeplcd_cddp8390_initzapm_bcintrunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportpxammc_scoop_casr_hotspareuvm_km_pgremoveex_region_plfscaleffs_alloccgblkpxaudc_disableip_optcopyvfs_registerscoop_mmc_matchieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_totimeout_todoswcr_initdb_lccpu_read_cache_configrasops8_putchar8wsemul_vt100_scrollupzkbdsleeptvsr_ioctl_createraidpanicget_pc_str_offsetL_cksumdataural_rxeofcue_rxeofmsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initsr_raid1_recreate_wupxa2x0_gpio_bootstrapwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initsdmmc_start_xspcmcia_attachpte_l2_s_cache_mode_ptdeferred_config_queuedp8390_getmcafbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautowsmux_detach_sccom_raisedtrdb_last_commandpxaudc_bus_methodsicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stolenpte_l2_s_prot_maskudav_ioctlcrypto_registercache_purgevfszaurus_udc_activatepostsigsys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdrasops_reconfigmaxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templateieee80211_notify_dtimmsdosfs_readdb_object_print_cmdsr_crypto_finish_ioohci_initcomopenusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXbcopywsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intwsemul_vt100_output_scs94cuio_applyscoop_cageneric_bs_rr_1ni6_addrsaxe_resetlcd_get_backlightdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tuneusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaiticmp6_mtudisc_cloneinflateResetmemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linezkbd_hingecomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linetickadjpool_alloc_item_headerip6_splithdruvm_map_addr_augmenttcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_listsysctl_stringsys_rebootpxammc_host_maxblklenuvm_unmap_kill_entryext2fs_specvopsbufpooldl10019_mii_bitbang_writeproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forkuaddr_kbootstrap_selectwi_write_data_ioscoop_checkdiskdb_print_ifattylistwdopenuvm_vslockdeflateResetuvmfault_update_statscast5_setkeyttyoutputkue_caexplicit_bzerousbf_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configcopyaddroutcryptodev_cbpcmcia_scan_cispxa2x0_memctl_iohclockintrcpuset_add_allrn_mkfreelistVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditsr_crypto_decryptudp_detachbufq_fifo_destroylcd_bpp16_screencluster_writernd_event_tailusbf_add_endpointhidkbd_decodeuvm_setpagesizetcp_xmit_timersr_raid1_rwin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bitsr_raidp_set_vol_statetimeout_add_tvtickmclpool_warnmsgdb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfsscoop_set_sdmmc_powercpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacea4x_bs_w_1km_allocfill_file2fdropgf_initsyn_cache_unreachuserconf_histszsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputieee80211_ba_move_windowstuck_keyscpuset_issetufs_dirremovepxagpio_reg_writeieee80211_add_timif_attachsetuppipe_writem_clsetwmssr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackpxammc_cdscsi_remove_linknd6_rtmsguvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdbufheadconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitkp_pageablesr_raid6_addiopmap_copy_page_funcpxa2x0_lcd_attach_subripsrciso_nchstatskue_txeofural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSyncsr_raidp_xor__wdccommand_donesdmmc_function_freeumass_adjust_transfersignal_initnsphyter_servicefill_drlistffs_updatedb_print_formatwsmuxclosedp8390_getunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopzaurus_udc_is_hostsdmmc_intr_disableAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimesdmmc_scsi_detachudav_activatedes3_encryptmaxdmapural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontroldevice_registerpxauart_activatesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsdmmc_scansyn_cache_resetdb_inputcharuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintcd_interpret_sensein_mask2lenural_eeprom_readpxagpio_matchscsi_iopool_destroylodirtypagessr_ioctl_disciplinefindwin95VOP_WRITEsys_nanosleepusbf_free_bufferstart_init_execifa_update_broadaddrnd6_addr_addifa_ifwithaddrsr_dumpclock_ymdhms_to_secsdb_write_cmdrootduidif_clone_attachwsmoused_releasesys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_entercomwritemouse_copy_selectionbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosecast5_zerokeysys_fchdirsr_crypto_readsdmmc_scsi_cmdgreen_onsysctl_ifqprocess0pxapcic_mem_freeieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initusbf_open_pipe_ivalfilt_ttyrdetachsdmmc_mem_send_op_condarp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswdog_timeoutwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strsusbd_sync_transfercdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallspr_rmpageffs_initsdmmc_submatchcluster_wbuildsr_crypto_createpxa2x0_gpio_clear_intrscsi_ioh_setbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featureuvm_map_addr_RB_NFINDif_free_sadldb_dotsdmmc_attachieee80211_node_joinfilt_bpfrdetachwsdisplay_emul_capxa2x0_clkman_configcompress2icmp6_initbs_notimpl_bs_rm_1rasops15_putchar16disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrpool_set_ctordtorbpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_poollastpiduvm_page_physloadreset_entryuvm_pmr_remove_1strangewdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggohci_noopusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizerijndaelKeySetupEncip6_nexthdrrtdeletemsg__bss_startrt_tab2domkue_rxeofrasops4_putchar12rijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachmemsetcuio_copydatapipe_free_kmempxa2x0_splxufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysioohci_strpcmcia_3cxem556_func0_cfe0in6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncpxauart_attachin6_unlink_ifacrypto_kdispatchicmp_mtudisc_cloneclass_cmpuvm_pmr_insert_sizesodisconnect_spllowersys_setgroupsmainaue_csr_write_2lxtphy971_funcsohci_device_bulk_doneether_crc32_le_updateusbd_initmtdphymatchtimespecfixrasops_init_devcmapsr_raid1_set_chunk_stateuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1icmp_errordb_hangmanwsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsvholdbufq_fifo_dequeueidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkm_adjmld6_stop_listeningpmap_map_chunkppsratecheckkmemlimitbuf_rb_bufs_RB_PREVamap_copybufq_drainphysical_endbio_statusuhidpollieee80211_ieee2mhzsched_wasidleieee80211_dup_bssuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofuaddr_lin_selectwsdisplay_cons_kbd_pollcdead_badoppool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closewsdisplaystoppte_l2_s_cache_modeuvn_initstrlcatifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockufs_ihashremieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspaceurl_stop_tasksdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctludav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readscoop_resumeuvm_km_doputpageufs_opencopyout_statfspmap_modify_pvm_catsplxpxa2x0_rtc_setalarmrtinittqphy_statuscluster_collectbufskp_dma_contigwi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initbuf_replacevnodeuvm_pmr_size_RB_NFINDuvm_mapent_addr_removetimeout_setrdread__subdi3wsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitkv_pagedupfdopenidgen32_initifmedia_list_addpidhashcdcef_encaprtprefpxaohci_detachxscale_context_switchuvm_totalencdebugicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratdl10019_mii_bitbang_opssdmmc_io_attachdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarescsi_ioc_ata_cmdtcp_mssdfltuvm_swap_freedata_abort_handlerusbf_setup_xferbs_notimpl_bs_r_1axe_initdb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updttycheckoutqicmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachvm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertip_forwardextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblockseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategyswi_handlerusbf_new_deviceni6_store_addrsspec_fsync__wdcwait_resetcom_pxaip_cauvm_map_deallocateicmp_reflectieee80211_parse_wpazkbd_attachmii_phy_activatescsi_xsh_iohext2fs_reclaimffs_ballocsys_getgroupsieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startsigstkinitbufq_disksort_dequeueohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8uvn_sync_lockpcmcia_function_enableaes_ctr_setkeyurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskdoclockintruvm_anon_pageinspec_closecd9660_closeuvm_map_mkentrypxaost_cauvm_map_addr_RB_REMOVEsys_shutdowncngetczkbd_cdtc_adjfreqrnd_statesuaddr_pivot_createm_gethdrconfig_rootfoundcue_cdputcieee80211_phymode_namebufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadxscale_minidata_clean_sizeschedcpuurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1wihap_sta_timeoutsoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlsr_crypto_read_key_diskusbd_interface2device_handleapm_matchipforwardingieee80211_get_cts_to_selfdb_lexohci_device_isoc_transferusbd_open_pipe_ivalicmp6_redirect_timeoutpxa2x0_wakeup_statussyn_cache_lookuparc4random_stateprtactiveksym_upcaseufs_makeinoderasops_copyrowsscsi_xs_ioip6_process_hopoptsusbd_find_edescwsdisplay_set_cons_kbdfilt_ttyreadsys_getpgidcom_common_putcswaplist_trimcache_lookuprdioctlrijndaelKeySetupDecdb_boot_crash_cmduvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1sdmmc_intr_disestablishumass_scsi_sense_cbdp8390_intrrijndael_encryptrasops_do_cursorwsemul_vt100_handle_dcsieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizesowwakeupsdmmc_io_read_multi_1ukbd_keydesctabirda_onsr_raid_inquiryextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomclosepcmcia_print_ciseephy_attachsetsigvecsys_sendmsguhidopenvn_marktextstrcmpsys_quotactluhidev_matchieee80211_get_hdrlensr_raid_startwuuaddr_pivot_destroytcp_mtudisc_increasesdmmc_card_attachulmaxin6_pcbconnectdehashkue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createdb_stack_trace_printpxaip_cdzaurus_startusbd_find_quirkuvm_swap_allocpagesuvm_aobj_pooldb_show_frame_cmdsys_adjfreqmouse_copy_extenddb_examine_cmdqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initscsi_ioh_runqueueuaddr_lin_functionsuvm_addr_entrybyspacedp8390_detachata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointspxaudc_bulk_transferttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedpxaudc_bulk_closeuaddr_hint_poolwsemul_vt100_output_stringwsscreen_attachm_pulldownbufcachepercentlcd_screen_listpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeip6_initconfig_detach_childrenrawcbukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookmii_bitbang_readregpxa2x0_cpuspeeduvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragrtable_l2setvnode_hold_listlastdosdateudav_unlock_miiscoop_timeoutbuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifouaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchifa_ifwithafural_read_eeprompcmcia_parse_cis_tuplein6_ifinitin6_leavegrouprtlabel_id2sasqphy_casddumpiminsys_chflagsget_hw_ifidKQRELEdelaysdstartdb_machine_command_tableip6_hopopts_inputddb_regsieee80211_media_initselfalsevt100_outputscsi_default_putcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultiuvn_clusterifaddr_items_RB_MINMAXcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregdb_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusdb_cmd_loop_donearptfreedb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopbs_notimpl_bs_w_2ural_set_macaddrdead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freewdstrategyttyprintfreaperprocsigcodedb_elf_search_symbolipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachamap_swap_offpool_allocator_nointrsys_sysarchBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initcryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputlcd_burnerfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchbufq_disksort_destroyrasops8_initcrc32_combinepxammc_intr_donedevid_freeieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcbioopenusbf_stall_pipeqsphy_servicein6_ifloop_requestpxaip_attachcd_patterns__cmpdi2crypto_workqsr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consolescsi_xs_errorprtrealloccheck_consoleapm_record_eventamap_freein6_domifattachwsdisplay_cnputczapm_restartusb_blk_nfreend6_prefix_lookuptc_getfrequencysync_inactivespec_printusbf_start_nextlocleanpagesext2fs_lookupmsdosfs_openext2fs_linkvop_generic_revokeohci_hash_add_itdusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagrandom_initdisk_openpartip6_dad_countuvm_pager_dropclusterfilt_generic_detachpxa2x0_lcd_mmapip6_getmoptionssensor_task_unregisterzssp_ic_sendpool_print1wdc_ioc_ata_cmdpcmcia_card_deactivatepxaudc_allocmdb_breakpoint_listwi_pcmcia_matchcd_get_parmszkbd_cngetcpmap_extractnd6_ifptomacwsmousedoioctlamap_unaddural_watchdoglcd_cnattachuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_dadrevarpwhoarewecue_txeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchrasops4_copycolsukbd_keymapdatasr_meta_validatestopprofclockdb_hangnullioctluaddr_pivot_printcryptof_closepte_l2_l_cache_modeisohashmclsizesparsediskwi_set_debugzkbd_onbcstats_printbreadieee80211_node_copyamap_lookupipctl_varswsdisplay_suspendpmap_page_removert_timer_remove_allwskbddevprintzkbd_irquhid_intrwdc_output_bytesieee80211_classifyzkbd_modstatewsdisplay_closescreenieee80211_media_statusproc_stop_sweepiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initusbf_open_pipertable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupwsemul_vt100_output_dcs_dollaramap_refdb_command_loopwdc_ioctlamphyattachapm_suspendsfdexpandtickssrandomcoredump_countsegs_elf32wdc_ata_presentmsdosfs_closerd_detachpool_do_getext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrurl_setmultiusbd_get_device_descsyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivateearly_clkmanufs_unlocktcp_ctloutputpxa2x0_turbo_modeukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setpcmcia_function_initbio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removesysctl_tc_choiceptsignalboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputcompressBoundpmap_alias_distunpst_sendspacewsemul_vt100_output_escffs_indirtruncieee80211_add_ratesrasops8_makestamppxapcic_mem_maptcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharesdmmc_intr_taskicmpv6ctl_varszaurus_udc_matchinverse_regioncdstartsdmmc_stimeoutgf_premulfilt_generic_readwriteuserconf_disablevrefin_scrubprefixusb_detachipforward_rtdb_elf_forallohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodeAES_CMAC_Finalsr_uuid_formatrasops_lmasknd6_dad_na_inputsd_cmd_rw16ghash_updatedb_set_temp_breakpointdb_buf_print_cmdinpcb_pool_initializedsys_nosysat_pollallproccdevswsr_rebuildxscale_cache_flushDne2000_attachsys_mlockallusbf_config_endpointgallant12x22uaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrstatintrgetsndiskmapopen_bus_dmamem_unmaprthreads_enableddisksortsys_fchflagsnamei_poolpxa2x0_pi2c_readrt_timer_countvfs_buf_printcryptodev_opworkq_destroyzssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putdiskmapcloseohci_device_bulk_abortudav_cain_canforwardrasops_unpack_attrremove_selectionwsdisplay_shutdownhookpxa2x0_bs_subregionifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatscdcef_do_requestrasops4_makestampvfs_getnewfsidaue_rxeofSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlpxaost_get_timecountscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcbootduidspeedup_synceraes_xts_zerokeyigmp_sendpktsched_cost_residentloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsdmmc_add_taskm_getptrukbd_cauhid_activateufsvnode_filtopsscoop_pcic_set_poweruvm_fault_unwireuserconf_common_attr_valsched_noidlesys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwip6_freemoptionssr_raid1_alloc_resourcessqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchbufhighpageswsfont_rotate_internalpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshidkbd_ioctlwsdisplay_getactivescreenvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charzkbd_pollpxagpio_intr1vfsinitupl_cacnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwipqmaxlenif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blksr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gwi_pcmcia_cadequeue_randomnessuvm_km_kmemalloc_placue_casyncer_maxdelaywsdisplay_getscreendeadprocstart_reapersys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_creatediskmapwriteuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcachepxaudc_write_epNural_write_multiuvm_pagecountcpu_initclockscue_sendwskbdioctlmii_downcdcef_attachrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delwsdisplay_switch3ttyoutdevice_lookupDebuggerwdc_pcmcia_prwi_usb_txeofcdcef_start_timeoutcdminphysschedhzurlphy_carip6_inputtcp_totbackoffvdropuserconf_baselooutputcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumppxa2x0_bs_barrierxscale_cache_clean_addrrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsdb_boot_dump_cmduvn_putscsi_add_linkxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetcrypto_newsessiongeneric_armv4_bs_r_2bufq_disksort_peekpxaic_baseenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcsdmmc_scsi_attachpxammc_bus_clockpxammc_bus_powerdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8cdcef_stopcsr1board_startupsys_socketpaircnreaddounmountuvm_swap_allockthread_create_nowwskbd_pickfreehidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcusbf_cdarm_picache_sizesr_map_rootttspeedtabkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratelxtphymatchsr_hotplug_registerpv_sizensgphymatchzkbdhalttvuvn_sync_qin_proto_cksum_outwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevpxaudc_matchupl_inputauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_cageneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthif_attachdomain1sys___get_tcbieee80211_amrr_node_initraw_recvspacesr_raidp_set_chunk_statediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printpxaudc_opendb_machine_commands_installieee80211_state_namesys_preadne_pcmcia_activatescsi_movewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachdes_ecb_encryptudp_inputnchrtoblktblihashrn_search_mresettodrusbd_ref_decrufs_readdirsys_flockpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodssdmmc_check_cis_quirksicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeupxscale_controlcd9660_quotactlicmp_sendadjtimedeltacdce_watchdogpxagpio_intrNdb_mbuf_print_cmdusbf_abort_pipewdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgcdce_intrfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuesr_raid0_free_resourcespxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4db_putstringprefetch_abort_entrymouse_copy_linesigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilterm_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolvnode_free_listtcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printit_enddes_check_keyrt_senddesyncsogetopthid_report_sizeusbf_endpoint_attributesuvm_unmaprd_matchdb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1wsemul_vt100_attachpollscandomaininitvflushbuftime_secondip6_forward_rtusbd_get_interfacewskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockpxa2x0_maxspeedieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitieee80211_add_pmkid_kdeenodevsr_raid0_discipline_initffs_mountfsin_delayed_cksumm_cltickswsemul_vt100_edicmperrppslim_lastrtstatttvtimeoutkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4zkbd_cawsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachewsemul_vt100_translatehalteephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11asr_raidp_intrkputcharbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2rasops15_putchar8wdc_pcmcia_disk_device_interfacem_trailingspacefileheadrc4_cryptusbd_alloc_xferscoop_mmc_get_ocrpxaudc_ctrl_abortnextvnodeidcttypollsr_meta_initural_startrotatedfontskp_dma_zerosensor_task_ticksys_swapctlpxaohci_matchpxammc_attachbd_reqpxa2x0_probe_sdrambs_notimpl_bs_rm_2rasops4_initcopypktoptsin_selectsrcmsgscpu_exitzapm_batt_lifeip6_initpktoptsworkq_threaduvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqusbd_nbusesfrag6_nfragsip6_log_timeeephy_statusinphy_statusrtalloc_mpathxscale_cache_purgeDusb_begin_tasksscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnlid_suspendsbflushscsi_link_closeipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachsr_copy_internal_datawihap_sta_alloccast5_decryptsdmmc_io_xchgxscale_setupnamecache_rb_cache_RB_INSERTwsfont_locktcp_timer_funcsipqent_poolpxaip_attach_criticalif_attachdomainicmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyusbf_iface_endpointuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsax88190_mii_readregusbd_get_config_descpxa2x0_gpio_set_bitsosendwi_pcmcia_resumedosetrlimitpxa2x0_pi2c_getvoltageuvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probeloopattachusb_match_devicedp8390_watchdogural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdusbd_do_request_flags_pipescsi_cmd_rw_decodechainlengthprocess_read_regssys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupallocate_copybufferuserconf_show_attrsys_execvefdallocwsdisplayreadprfindscsi_doneexec_aout_prep_oldzmagicchkvnlockhw_sysctltc_ticktockphtree_RB_MINMAXdb_siftingpxaudc_freexdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodeszkbd_activatecryptof_ioctlcomreaduvm_pagefreeext2fs_inode_allocswcr_encdecwsdisplay_switch2scoop_check_mcrbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperieee80211_add_gtk_kdecoredumpfilt_kqueuemalloc_rounduppxaudc_bulk_donepipe_readpxa2x0_bs_freeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrusbf_endpoint_addressrip_initsocreateusbd_find_idescpmap_cache_stateureadcaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadzapm_batt_voltcast5_encryptsys_exitsbtryusb_desc_iter_nextieee80211_send_4way_msg1m_applyxscale_maxspeedswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatwdc_exec_commandpxaohci_caudv_lockbufqspxaudc_bulk_abortdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getressdmmc_set_bus_widthaxe_attachsyn_cache_insertnsgphy_funcsrc4_getbytesttystats_initne_cdnd6_umaxtriesohci_device_intr_doneusbf_get_stringpcmcia_intr_stringnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_piewindow_deflatedb_delete_temp_breakpointcpu_cpuspeedcpufunc_iddefrtrlist_updateurl_csr_write_1_tr_initSHA1Transformesymusbf_schedsoftintrscoop_mmc_set_powerieee80211_defragcrypto_invokeosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasewsmux_evsrc_set_displayHMAC_MD5_Init__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdogwihap_timeoutuserconf_changewsemul_vt100_jump_scrollpxa2x0_lcd_new_screendb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initpcmcia_cis_read_1sr_raidp_openingsmouse_moverelcdst_pteuvm_growcsecreatevfinddevieee80211_node_cleanuprt_msg1apm_handle_eventether_delmultisave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleaniophy_servicerasops8_putchar16cd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctlzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolbufq_restartzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmoduvm_unmap_detachieee80211_recv_authupl_initusb_dev_quirkswskbd_srcopsuserconf_common_devvfs_mount_printpxa2x0_irq_handlerstartieee80211_needs_authwdog_cookieusbd_devinfoskip_spc_leftvn_isdisksys_selectscoop_charge_batterydeflateParamsbadaddr_read_1cryptoattachvop_generic_lookupzombprocdb_branch_takenpxammc_functionsin6addr_intfacelocal_allnodeslogreadrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixwsemul_vt100_resetvfs_unregistermii_phy_flowstatusdisk_mapvt100_setnrcselwakeupffs_reloaddb_set_watchpointsfill_kproccnwriteumass_bbb_get_max_lunzkbd_keymapdatain_ouraddrpolloutdb_show_panic_cmduipc_usrreqnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodewsmouse_activateaes_key_unwraprip6_usrreqin6mask96coldpxaudc_ctrl_donedb_clear_watchpointscdcef_startbutton_eventunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountne2000_detachffs_vopsdofutimenssys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocrevarpinputsdmmc_function_alloccd_pausecompresshashinitttstartumass_setup_transferwdwriteipsec_keep_invaliduao_detach_lockedieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimensexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfself32_load_filesys_getpeernamepxapcic_io_mapieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusageapm_threadrasops_initauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroynd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachsdmmc_cdttylclosepool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeworkq_createudav_csr_writeuhid_do_readin6_createmkludgedoclusterwritecdcef_initusbd_close_pipeusbd_deactivatewsdisplay_cfg_ioctlffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regs__wdccommand_intraes_ctr_zerokeyuvm_km_free_wakeuprootvnodeifmedia_ioctlpmap_pmap_ctorpxammc_host_ocricmperrpps_countuserconf_modifyusbf_setup_pipewi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetmii_phy_detachwskbd_add_mux__muldi3db_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_capxaudc_attachusbf_allocmembufinitskip_char_leftbootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackuvm_md_constraintsif_attach_commonlcd_set_backlightpxa2x0_pi2c_openuniqdosnamedb_recoverinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdwdc_pcmcia_activatebgetvppgrp_poolsr_concat_assemblesd_cmd_rw12uvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcsgeneric_bs_wr_1_bus_dmamap_load_uiostrlenusb_run_abort_tasksdb_machine_initsensor_task_workrasops15_putcharconfig_suspendzkbd_enablewsfont_initieee80211_parse_rsn_cipherkue_activatewsdisplayparampool_page_freewdactivatewsmouse_inputcopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysarp_rtrequestieee80211_encrypthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinepxaudc_read_ep0sys_rmdirdp8390_disablecd9660_vfsopscpuset_copycdcef_methodsspec_accesssocantsendmoreproc_zappxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffpxa2x0_read_ccntcoredump_note_elf32fs_posix_sysctlif_slowtimowd_shutdownudbtablewi_setdefwdcattachufs_printuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updateusbd_printBCDsys_statukbd_apple_mungein_baddynamicieee80211_keyrunlineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcuvm_swapout_threadsural_bbp_writeusbf_add_interfaceknote_attachmax_keylenlcd_activateieee80211_tkip_decryptdp8390_ioctl__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchnd6_dad_ns_outputin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0uvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cdpxaudc_write_ep0uvm_map_pageable_allsleep_finishipqdl10019_media_initpxa2x0_lcd_show_screenmsdosfs_strategycd9660_vopstimeout_delural_media_changem_cltickwsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrhid_clear_localbufq_disksort_createscsi_sizescsi_plug_poolusbf_host_resetuvm_pmemrange_use_cmpaes_xts_encryptuvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootieee80211_rssadapt_lower_ratesr_crypto_wu_geticmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufwsdisplay_pollcsr_wu_freeaobj_pagerrasops4_putchar8zaurus_battery_c3000uvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2uvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapieee80211_eapol_key_encryptfilt_timerattachifmedia_delete_instanceurl_caenc_xform_aes_gcmuvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepzssp_write_lz9jg18generic_bs_w_4inflateEndexec_aout_prep_oldnmagicsr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setsyn_cache_initieee80211_find_txnodecd9660_wchar2charip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevmouse_copy_extend_worduvm_init_limitsukphy_cdentropy_input_rotateusbf_softintr_establishin_pcbconnectieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLsafepripxapcic_io_unmapuhidev_ioctlpxaohci_disablewdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatewi_usb_rxfrmsdmmc_io_read_1sys_getpidnd6_defifindexuaddr_rnd_functionsipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachwsscrollbackdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenpxaip_printip6_check_rh0hdrieee80211_input_printdomkdiratremrunqueuesoo_closetcp_recvspaceuvm_meteruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimmaxthreadnd6_lookupieee80211_cache_sizeurl_openpipesukbd_countrylayoutzts_matchsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectVOP_READDIRdomainsrc4_skipsdmmc_select_cardsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharieee80211_recv_sa_query_respneedbufferwsemul_pickusbd_do_request_asyncin6_ifattachieee80211_get_addba_reqtcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneip6_multipathusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedataipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptymotion_eventuserconf_cntsr_crypto_wu_putmouse_zaxisext2fs_inode_freepxaip_capcmcia_ccr_writedb_find_variableapm_cdxscale_cache_clean_sizescsi_io_get_donebuf_objectpxaintc_cdip6_rr_prunesbcompresssr_crypto_rw2pmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolieee80211_print_essidroute_usrreqdeextendspec_vopspxapcic_event_threadieee80211_wep_encryptsr_raid6_openingsieee80211_recv_deauthsched_init_cpurasops_erasecolstcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesoftraid_cawsemul_vt100_output_scs96_percentinflateInit2_cd9660_pathconfax88190_stop_cardin_pcbrehashpool_walksyncer_delaynoin_arpinputpmodzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleepsdmmc_io_resetwsfont_unlockreassignbufip_freemoptionssr_meta_rwieee80211_release_nodesohasoutofbandddb_initbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4maxvnodesether_crc32_beinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwarerasops_cmapswcr_compdecip4_inputtcp_inputsysctl_dumpentrydkcksumwsdisplay_cnattachuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spaceusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputmii_detachsdmmc_io_send_op_condudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEnddevice_refffs_syncrd_root_imageusbf_task_threaduvm_map_submapsr_hotplug_callbackscnioctlufs_vinitsys___tforksr_ccb_getpool_primesdmmc_mem_scannsgphyattachdevid_allocpgrphashtblifmedia_matchget_crc_tablestatclockaue_activatewi_read_data_usbdvd_read_physicalrw_enter_writemaxcleanpagesuserconf_argbufpxa2x0_lcd_consoleMD5Update_intm_tag_copyinflate_tabledb_value_of_namepmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelsr_raid0_intrmsdosfs_printkernel_pmap_storewsemul_vt100_opsin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysuaddr_free_rbtree_RB_PREVeephy_initmsdosfs_readdirdead_ebadfusbd_interface_countpxaudc_enablewddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregieee80211_recv_eapol_key_reqdl10019_mii_statchgicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ablesoftclockieee80211_node_freetc_initupdate_modifierreaddir_with_callbackffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedblf_decryptswdevtdisk_lockscoop_pcic_readarc4random_uniformsbwaitufs_reclaimkv_intrsafescsi_xsh_set_tr_alignsr_meta_opt_handlersdwriteohci_device_intr_startxscale_minidata_clean_addrlcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2vmcmdset_extendsr_sensors_refreshural_caaes_key_wrap_set_key_wrap_onlyzapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodpmap_proc_iflushext2fs_mountfskill_vmcmdsuhid_attachzkbd_matchufs_mknodsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freeeephy_resetwsmux_do_openfreedorenameatwi_ioctlzts_disablelcd_attachffs_hashallocpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintnamecache_rb_cache_RB_NEXTrtl80x9_init_cardsched_cost_prioritysys_getpgrpukbd_ioctlusbf_add_config_descwsemul_vt100_console_emuldatasonewconndb_fetch_regufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1uvm_pageallocsdmmc_io_enabletcp_saveti6wdctimeoutwsemul_vt100_initHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORuvm_map_vmspace_updateqsphy_ca