Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition Ox ??C}?@B}U?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                                 ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~        !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmiopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./01jklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~stuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~klmnopqrstuvwxyz|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                                 ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~        !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmiopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./01jklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~stuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BOOT (hDMLO řhDhDhDdUENV TXT  hDhDhDhU-BOOT BIN hDhDhDr U-BOOTS VhDhDhDBSD UMG RhDhDhDo@ CHSETTINGS\00@00@00@00@00@00@00@00@xV4耀C\8C\ `)%2П@P`РOP h0 P: PO ,   F 0@P/@- @L@-@@T \  00{0J Rʔ RP  t0 R R  0S  0S  <0 ,0 /ПP-sO-p`00@0@ 0@0@8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(Kn0 0 b 0  H@-@d0/ 0@0/0@@-0@QQ0@S/,0@-0 <!"( #4-ܜ0@0@ 0  4Q /᪪H@1J@1JUU@->Z'N 0  0@@-808 0DAt&"*" S@NPN00  0Sb("(RR /@B0@@-@ 0PN@Bң0@400 ,0R $ $0 @//ܜ0@0D0@ 0@-00@@-D}A D`@000 0 0P@ꬡ0@:0@B0@ ? | @-Q@p:CbC `3440D0D 0 00P$@ܜ0@0D,t10@:0@B0@D-0pJL0P00008`pn0=#8< 0`1.80P,>000YDVꬡ0@@B<0@0 00@-0@0zP @@B[0@A- p@P`0 0 0#R0 R  T0$z|0 0 00 0V000rVA&l0@-0 `00S *T0@` 24 2 24 2l05l0o0 `@ܜ0@0@h00S,;@@HHPPPP000/ᬡ0@8@-@PPE@T0 0P B8謡0@:0D-@P`00Sp R0Z000 pWPP0Z000 PU0 P0S R\1A-0 P1R H1HA0@ 0 1D"1@ >0Y @C0`000  pT0 0A0 L`dl `0<000 0000    A6ܜ0@`D0@870@B 0t0p@- l0@_PPQH`@`` 0P00@0}20P0#0@00P0@` QPP0@0pܜ0@0D`0;`0/ 00000$00,000 |0R080h080)0000P0 P,0 P00PSQP1 3/PP) 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP CD a P0 0, 0  200 0 10p 1 3/PP&' 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC J(X$*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/D0p@-S(@ S ,0 0,0 ,0 0,0(10,0 0,0(10(1H`VP  P PP,1808,1,1<00[%X,QcP`eP((p@, ,10,1pظ0@0@< 8Q 1@- RH %H513/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p uP +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`BVUh\l0`$d4P`d h0! P \l0@.;#5"0 9000000 CP`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ ~P 0R 0R 0R  0R  XPL0pLp pW*L0$ P 0tčPPp5 tTpGp4x0p 0 4"$ t0p ##x#< x ": S(12P8* PU:Pk 0P@e  0P``  0P ( P`p: S`02P@e00 P1:H` +ݍ0@߬0@0@0@0@0@p@-@P ` 0p@dꡭ0@N-0Q`p 0 0 @T P`pZWV# 2\UT:@TP 0` pf` 0 R /0  b S @ /0 0c0\  BR00 @@ 0$ ? 0 ` 8 p p%000S@D, 0* LQ  `  lQ`  ` ZQzQ0 tQ hQ(" 0(B(0 ? P p @0S{0  aXЍĮ0@0@-@-   f @ Ѝ/@-c0@JpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOTd dH2 Phb 7 ?ñ2 Гh"R 5 C2 PhX00@(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJ   0J8J J8x0J`JhJpJxJJ@]Y$I2X }, }JJDJJJEJJJJJJJJJ  k }  }  k }  }@   @ (       k }  } { {}  } ^ ~"@x0J(J0J8J0x0JPJAJP 2 @ J J(J DJ(J J(J@J8JhJZJL^@BDFHJLN"$&(*,.0@BDF #(-27<FP'@BHERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s Clock enable failed for 0x%p idlest 0x%x DPLL locking failed for %p Scaling voltage failed for vdd_mpu from TPS Scaling voltage failed for 0x%x FREQ UPDATE procedure failed!!Bypassing DPLL failed %p SDRAM: identified size not same as expected size identified: %x expected: %x ### ERROR ### Please RESET the board ### mkimage signature not found - ih_magic = %x Assuming u-boot.bin .. U-BootSPL: Un-supported Boot Device - %d!!! Unsupported OS image.. Jumping nevertheless.. U-Boot SPL %s (%s - %s) U-Boot 2011.12Apr 02 201218:13:04Texas Instruments %s Revision detection unimplementedu-boot.imgu-boot.binspl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d spl: error reading image %s, err - %d spl: wrong MMC boot mode (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table usbmmc** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dCard did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_set_iosmmc_write_datammc_init_streammmc_read_datammc_init_setupmmc_send_cmdFAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s (((((AAAAAABBBBBB0123456789ABCDEF(null)%s:%u: %s: Assertion `%s' failed.0123456789abcdefraise: Signal # %d caught į0@į0@̯0@̯0@ԯ0@ԯ0@ܯ0@ܯ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@İ0@İ0@̰0@̰0@԰0@԰0@ܰ0@ܰ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ı0@ı0@̱0@̱0@Ա0@Ա0@ܱ0@ܱ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@IJ0@IJ0@̲0@̲0@Բ0@Բ0@ܲ0@ܲ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@` 耀@xV4llȑ  L)  HUӟ@P`РOP& |0 P:Fl\ X00 pW W !   R:lLL@ PeO     OР iHM! H4P 6 MOЍHM<" H4P ' tOР iHM" H4P  OР iHM" H4P 4OР iHM\# H4P OР iHM# H4P OР iHM$ H4P 耀0@//////0????////////@-5GP/@- @L@-@@T \  00{0JP R H RP 8 ,0 /ПP-;O-p`00@0@Y8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(KΧ0 0 b 0  H@-@d@-/D-P@` ᱧ Sp ᩧ Ppᢧp@-P@`       00000000Sp0P/4R 4/P@-Qy-d0PR e?>/ e-ꀯp@-@PPp00 p@ꈬ@-@PP0"01 R @D4!N?O?0般@-@P$00 般p@-@`P<0R0@Q  pp般@-P/@-0@QQ0@S/,0@-0 <!"( #4Ӑ脬ꀶ40S/ 0  4Q /᪪H@1J@1JUU@-,0 001s0g끦@Y@-808 0DAt&"*" S@NPN@-@8@- 0,//-0 Y @ 8v0`000 pᒤ0 0A0 `dl `0<000 00@0    S PA8ꄬ`D(870@B 0p/t0p@- l0@_PPQH`@`` 0P00@0}0P0#0@00P0@` QPP0@0p脬0DP MP//`0;`0/ 00000$00,000 |0R080h080@-  '8&@-  @-/////////  800/@-0@000 0 AD('Z4-|@뉅Cx-N(-\@ LDrP 8 g0'>P l6>]ENꀔW@-'_ꀀ@-x 00<0P @fP@7/P pW8@AID$HHL@< @bN@gDPF F @P 0`F00\]' L H04@00cD`x H0Ն 0@L耉ꀰY뀘)@@- K'l@0  0A  ah@- 0 00$lATN-P MT@`ZZp0P  Lj`'X=p `R/ pl ;dh x00 at0l;PPil ;PPclS.0 0 0 0lP P/l/tx 0l-l F 000  00 1 0W 00000  R R  吅p  60 10d R hP hp0 bP 00@0@0@@O :/P ЍAT$lAT ATBT/,~&M00000cSЍ//@-O:?@-O:?? ////8018<0C0 R S 0 / $H0'$H|'$H'$H 0 P: 0 /'$H0'$H8@-@P  PP7&@@  80/&P,0@ @T:0 8L;p'$H0'$H@ 0 /T//@-mp@-M@ ㆅ00<0,08 040@P&($ 0%00 0%0 0 0%z Z c0C0bvVVdnN%@0TT  @018 0,%ЍplꀀI5RwꀍY@-@%@x@-@%@@-@%@@-@%@@-@%@@-@%|@v@-@%s@m@-u%hdLP@-@ p% l% h% d% `%ۃP  U%R%O%L `K%4 PG%xH @C%l@ 0?%`D ;%T 7%Ѝ!)4H^gq{ꀂꀌ@-03/Rp@-@p@" P⽆`,%D @P@ %p<, <4 /@-3PꀀPP@-`@$);4/ꀀPPN-Pp@?`"0S`0 70S`U 啃 Y & 0 0p 0-}[0DiP<`@4$: 04/Ѝꀍ@- 00csV'8@-@$N8PP|u$Pl 7PXj$7He$ 7P8 4^$P(Z$P81Ri~ꀖꀱRA-@pP`80A `PPV]>N-p0,`(@4P80j7V V)T T``($`$$  8.7000$$0 }`P000 $Y I:$dL#Y 8:v3 T#P 0SiN-C p.`3|6⪀6P6 ⭀}W<3@ l@:7TP@P7P\#P㈠##9+6P#96Z #/6Pt# h#9Q P#9P/90S SS S P T0"6 @0 P0&Tc#꘡@ 0@D09S#k9 PTAT0Sx 7Pd]0\0^ @00L06D0XS(#4,Z`# *P0X00`0ZZ ZY@d00h00 06Pl00p00  0C8Pdlf0 HP Ѝ(l뀌]뀓lꀁꀖꀴ(Hkꀏꀴ/F-`4M@P0 pE P Y  E 0i PvA0 S"00^ 1YaD Y Y7 Y`@YL YT YY>X0H0\00]00,0 000bPPJX,  aDdh x00 at06PP:t rIx kB+l17lp Q7  06/PP   06/PPx   06/PP T_"Es  06/P4ЍY(l@^N-R@MP0p`<08 800:SS #S   0G  0EPxA>X0H0\00]00<0 000Pp pD0S "0Sx!p!pE8  0{p[ 8$< X a]0 @S[ P 區pP 0T )`0F3/!8^ 0AT [ `@^4^ l!7  04/7  0+@Ѝ(l}ꀷ s@-PT`_0P @B@P 000`@! 0@|F]JF-b=Pv!p@删4 4`D.I.0O0R \.0S0m!0S< f! Y M!@TB@b^ꀘ$D-p@`VP \PP0cSPp /!P`VW %!R@-0 ڂ0cN- BpM@R&999:耄P  \P  㸂P  㰂 P媂{U l 埂pJP  gl0S` :S   l僂`P   KP\@ L }P <  00 0`  0 iP iP 0 KiP Y Y 1 i P  0` ZiXil0 d ` `hT`?pЍEN$A^3cꀈꀨ]RD-@P; pIP V 0S` :S B ! `T  @d@uiP\ ?iPL 03 h@P (, hh#UꀈꀨQR@-Pʰ ( `IpP 0S :S d 媁@@kP  0^n# RD-@P@0 ㉁pnIP 0S :S @ s`` XkP  0<T ,znP@ 5#hUꀑF-RM@P@  Gp,IP>0S :S 1`` kP  0y T     0np@ 0L`_<[8 <,Ѝ#= <, <4 /8@-@PU;8nPP$ #bu0 u0Pt %00T@PP <8,888Xm뀦)G-`QP00SS0XRSM R 0C R  SRS> @ )T}@@}PTG0V`FaFp堐{ T @Ttp@FPp TD P @T<G@2"$ꀍQW&ꀺ-/y@-$0 wNЍXm6N-R0M`@p0aS-R9P 8;8 " -P T   :@PT * ] tPP t R }P2T  hZP  T`0p  0@pT * &sI sPP`o Kt U |PPT\ڔI `pPC sPW3tx =0sSTF0T0 0 0i 0,0 D<R'00p@0'`Q`1,0  ,00eS0,0,0 R @,P>Q V>Q%[R&00`@0&pxPp,,0 S SP1,0 0D  V@ U,00]S,0]QPg@,h|,|P0 U ` @,0p@xWoP@0 =rPsll CPrPlSpSUP PT T` @(g@즟uopPscT  $0/o$PpU NI$?DmD `( )m0@SZpIII耤J耸J耸J耸J耸JJ lnT0 4&P0(\$&$d @T@ B@DT:dT@3 lpmP$*s#Tl dxTL d\ $L @dT0T(pP%P#  {P TnPrT qPP rHrPPr0hSLC`YPVP0P 80I$0 C0=04{U0,sU 0 $kU0$c2Smx][h {PP }200 zP ]~ @P W~<2 0$ zPPP00pS"am@$" 0lpPHrtg000X0 0 PUWaS ~ ~81 0[p@PE!rdS8 }0kp@P5r00cSTTPPT@  x}@ s}Pl`# 0"  nzPP00$L0ЍXmWuꀤ\m=2^yZ>)>ZUꀭꀵꀓ}2">Mdzꀑꀨꀶ)wR-0K}ꀜꀶvRA-P A0iS cSsS tS```` }@PBPP LVP V VPPpP3 01&ꀬ@-$$ `0A 0m۶<, <4 /0 .R00@/R 0S//RA-@`P8 p_P  E0H 뀈Q W SPMRA-@`P8 p P  E0P`V0/,\N-@ M`=Pm P,(3 @3000cimP mP mP V`QP0S mpP pt2 Y pWX, PLnE<n PV0Si`p`3r0p 0mp 0W 0 pP   0 R QS@1 0@p0 0h0S01 (ENꀔR  @-<0Q0  0S ЍN-P8M@0 ` p$cQ bQ(sQ tQ#R aR_` @T  0o 0pRP ` Q@DT -RI B HmV@DP 4 00 i P'000 04`[0000 00`0h@P000 0 [ x @-@M@ L0 0  00ygPX PXЍ 7iPP; Q =  t -0S P P 0 0P Q HXT R  0Ѝ0w뀷-< gu뀠R@-P2@PQR@ M kPd ` @P  P5iPP P3_ , G$P pWQ* h$P& p $ Uw `0FSK`V1 D0$`Pp I$p$W뀸뀸D-R M@ ^PY  PkPTt@P PCTP@PD@P! 4h R ^ g -:S  000 0S0Pʼ0@ <"<4("$Pm`p PpfV `) T%  Ѝ<P 72lk;@S<, <4 /@-@`PP!0P|P&V P 0S @PP@p| `V @P  jh`WP PꀙV'K]m{뀋R@-A aj@@//RN-`B@KgPP@`Fp@gP ;gP 6gP 0gP V'gP YhgPAgp3DgP7gPUUW gPfp3fPfP}fPfP_|fPf렯iXfP   j  j 0`sWfP   j  jZFfP   i  iZ4fP  i iZ"LfP   i  iZ|fP  i  iZUUW P`iV A[ z3z3 OfPP !P pSLORU뀷뀶뀺$ꀫ뀲뀣뀧뀼N-RhM R REA (i@< i@ P| d i`+PP 0SP``0S4Yd0S :S F dhpp |1P  De$ e00< 0%=01D  eP  ePt D00 $0X` 07@-1@S<!a0P0 #4dP(dPHdP ( H01S |!hh!8T!HC?0B/ $#4>Khu)뀀뀟7@-@Px0ll @  0\00T0 0L0S <, Ѝ0@ Ѝ0!뀍7뀥)p@-@P` PL 80Sp(`p@Ui뀕)뀣@-0  @t00Sd S\ STTz0Hu00S0n(@k뀮뀲)G-@}`P|Gp J%1YP|`1UG?)F-@P dp4` 0(0Pp S$%R0R\ \0C\0S8 Y 0  C W 0 0p|p p0 0!60 pS  S 10 cP(cPHcP H00 (0p5S  (P `5ZQW" &6N@- M@ d l ЍRD-`p ScP  McP  |?&Py+dD=L 9c@P< 040S(   *c@Pr# c@P"V u#PP 8@ T f`Sb#PP 0S @ TlF` bPD'D bP#V`p'@P 0S W` 'h.p e'0P 0S [.V3bP$`R0S)V e e` e@ 0<'` 0 [;QpPS 0 G00R .  I$R&R0000R00$R0    0 00Z @ 0fS  ` `0    |   000ppT]P/0@  @/@/PD0  <04,0Q0@///T]u 0R00/Ḵ@- 0S 0 /Ḵ@-P 0!S\T0LLL 0VP<0<0808 0  %%M`PkMf000!1eL`PM W|`  F!@  @!D 8p  p4P H PL@ 0 08@@8 , ( P,K P rPJ@DT 4 00 @D4 , ( P,K P rPJ@DTH0pP<WL@0X 0P L`P`zM8 $GK 뀀'뀙ꀈ'뀰'뀼'H&W&'@- !  0_N-8Mp V0007IP`,37 [  0HPP! T 4 XT 4@0S@PU00 d 0P00 H 0P 4Z` @PPF8Ѝ''(''p@-@PM/ GP` 0G 0QPNKPU ` :#:A]P``^PPc0 P0KPЍpp@-@P p@KLp@-P@HPp,LH p@K'N-@M`@0_IpP~ R< 80``P Pp0Z.p``)@TPp@-Pz)0p@-SP@  R0S 000`0 0   0 pp@-0`@S Pd00egP0S `0 00pRp@-@P ,YRP \Ppp@)8@-PP 0p@$S 0?S 8P4"_W8@RP8@T88Lv뀝)N-@`p* U j `r @ QPRUp  `P`P R PV@ Q00` QPPV QA @ Q PP QPT F-!0p0[ QP@P x CQ=QP``P1@@QP @TAQPW10Sp@/ + 0S &W0S00Q@QP t0Q@p @@T@@@uP2ꀠ)Lv)p@-PP0@pIQP @TpT0` 0S Dp@`0S00p@Lv)@-    8@-@P0 P 0PP8F-頡P@pQP`V0 %  p WWpp x 0 00SD pp pppT 0S  0R3 S 0 00R00 0 000  0   F 0R00 0 pW|aF-0@SP`P0S J0S 0 {P @r0\R00S RpP+ PzP 0 q 10\R0  S R00 0R00 0S ) 080S/Lv@-LPH@PD08,883P0(8@)Lv)뀄x**p@-@PM`/ 0S, .PP 0S 4PPOO|00t0P 000 0@ @0080@ 000 0@@Ѝp)pTN-@8Mp#0 C zC 0q0 PUS7PR 0 S 00SS 0 S A87  pW 0$pppP p`pp  BR 07P0Q@pWPPU PPUPG |PG 0u0$Q  RPqP3 0 ~GpP(W{0S VZ00Yk 000 0O "  `, 04p3F& S# gOpP@k oO@p,0` O,O  #O1 0@P0S 0Z 0P00004p @ `0Y 0P 0 0 ` 00P 0 0  W W[  W0[000S #S PP 0S @ ;P Z@. Y+ O=NP M0 0 0Z A0 P 0 1Y 0 0C 0, 1   0P 0 0 Q5  P,`m`N 0ZP UNRNN0V  0S0,`N 006141;gNP0x .P0` O L1P R 0 jR "0 00 0:/0S 00iz0 0j42"0Z 042( $W R W$# WZ 0SS0 0 0PQ@@TI 8ЍLv뀷QW *C*@*N-0M@` NuP` K0S  005 080S Z 03/[ 0KS(0S [   P Z  Z(0S 0S. [ &Z #Z $Z/ "Z;Z 'Z\Z |Z 0S (0S 03/03/ Pp#( )y ( " 03/03/00 0   03/ 03/0000_P0S 0?P {P .0     03/S 0  03/ 03/}Pp}P;9 0,00S8  03/'Ppp&#0,0(00s03(0 J  D&Y 03/   9|Y 03/ T 03/p\1  (Fl1  M   P u0 S,< 1PRP$P,%u00S ) 0R 0,000S00,(0 S ,$z  U0ЍY0S 2ꀂ*Lv|耇*뀰*@-000(0000 000 lЍ|8@- 0DPp@-@MP``P | ph \ P H P 4r,e00܍p(4뀨')474@-0SS G3/@-@P P'PQp@-@Pp 0SP _|P0S00pp@@-@P`Pt dPPpP  DPQ 0 P @@ 0  'D-@P`pP 0T0 `P CP@*p@000@-@P , !P '00@  R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSSp 0pS`V ` pP~00F Sx+++,逐-,逐-$,4,D, @ ` @ ` @ ` @ ` `  @ ` @ ` @ `  RpH<,!C<#J$#J%#J<P:pP3040pP*0p400P0 40 pP sP  pP0UfP P```@/8@-pP@`4P 4@EBP PU@@8@-PP@ <5@P < xC |B8@-P (048 840408 -t0DM4 4 8 d< 2CL SB10<0$040(00000,0,0DЍ뀠%뀔逤逬逴|02#0@-P> 0*A4+! !0|00.  S00@-@C@DT 0P/   (%L0p 3/L뀟%D-0`PVrBZ! 0$4p0,Ġ1'tp@5`0 0( 0g%V 5`FSV5SE @LXS8@-@ŀC%P5PESU%0P 88|/@-p`@  iP 1U@|`1TPN- 0@S` \R B0Q10p|>0S S30 S G 01 pjB0%10&1J#&! &! %!p%J 0QB00>0  $ "$ 0S 0PE0 R;4@-h0 w`p1M4P $K/  0@P PP0wVt0p00 Vh`l` @ 0ppЍ@-$(M"(@h 08#8 0d00  0Ѝ@-@p `0P`P PLd@` 0 4 S0 0[4뀀4@-0d 0 0 00 0Ѝ0@-MA0 Q|U|#&1S0Sl*h0("(1 4 ! }/  0Ѝ04@-h 0M!!$d0  @00 0tPlpЍ@-h("(0  Č! d   !0YЍ@-4h8@M#800!0 0d00  !0@Ѝ@-48M#8@h0 00$08#8! 0d00  =0#Ѝ@-48M#8@h0 00$08#8! 0d00  0ЍN-M⸓@`pPdh0 104 0 PPUЍ@-P!h  p@P00 0P00 0P0S0S 0T   \0RS00PP2@-RSpMP`@000 Q. 0Q  0P%0S" 045 0PpG 0? S *PUPP 0P  ߍ 0q0/HLp@-< Q`T0@L 0@0%<%@%D%H%L%P%T%X%8% (>H >Q  0"Q ( 0Q H 0Qߍ8565o5뀛55 6s@-P` @P/0 00 !(%R  t P\h'0 0<0a0($E U&P  c|86N-M@PPy @ *Pr $Pl [> 040#40 />  +>0 0S   0 0S  05`P=Kp3`/hP*<ⶠᴰ n  0 S(5S _      p5Wߍp@-`P@`P =`M@ T8@0<9P p@\<p@X`H$DP6e6D-\p\@P`T@Z=0000h0 14 D P z/ !0 PHd) h0 104 = h0 104 =(ЍpN-@P ` =R02 p0SpT00t3/P XX<00R0Sp2000T000X3/dX`VhNN-PR(M` @2p :#p@PP 0 R @ TPpp㐺*0AR0P  0UPg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 <R0( 200  00  0`PS00  3/P X0Ś 0k<00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  P_pP(ЍhN6N-PR(M` @2p :#p@PP 0 R @ TPp:p㐺*0AR0P  0Pg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 ;R0* 200  00  0`PS00  3/P X0Ś 0;00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  PpP(ЍhN60"P0p 0 /hN/p@-TP2S@Ð` 87p` @2Tp,phNL70@- @0S 4MR%PhPQT ] Wh `RT {;,00}?0 04Ѝ0USBChNN-D"00M!0R3`@0 h 0倠 0h 0 0僧0 0j}_h0 14   DS !0 P8P UW h0 140UMTpWJ X m$$ `[ P,0}/0 0 @ 5S  ` 0,0U0, U V `F,0PU pW ` ` `05  Br  0Ѝs@-% 00@$0 P joP `FvP dB00 0S0SS P 10C8#8S 1 |37뀤F-`M@Ppp) 0Spa 1#40101SPW Y05,03/J P0SSF  M:R02 00 0\00`0 0[0 0SY05$ 0SP S S  V T d`W  ЍR7뀏7@-h0 14 } 0 ЍN-1 MP@᪑iP` 0h  Ġ`- ``g00T0 S p Ywp  }/ X P 059 W  P2pp}?0 0p' 05  PP d0R\0" 0 BR 0S T QS ЍUSBShND-aPV@y|p'!1Su"1S`q So4 l9`P`"1 0#1S 0 :PS x100t1,0|0 G/ T100P1LK00S00P 0ĵ 0ĥ00S00 00 %0 Q P- `V+ `V( 0S `V" QQ Q  0S % R % h  t40$5E``QxFS逐E77tEN-bp?X00@ 0 0R0ء 8R020$00T0 0S000 3/P YYxvRb2 RM L0 0- 8 A8P V8 PQPZPP  0R P `++0  X08P% 8R0200T00S000x3/P PUPPP `PV -=0%=C0hN86.8N-@ M,h8T yA堡q`p Z80H`0PVP 0 0`dpp@XAXRP? "4`㖒"P/ rG"`h0104`$    }/ 0 G40P`œ'p   !P202Z2SQ\P U<@82S Ѝ0Q>8N(H逐JhN0Sj8뀗8p@-P@<`{8@qPTlPp`p蠆@-@0P4T@-PB04S ]004P,bp0PB! 0PS SS S404j 40 4f$4p0W$4[U1X+8S0tPM p0wPS;0404 0P=  0 P4aU0P/ (4S 0|P& @ $40"S (4S  50 $ 44P  08#8RD 0 $R@(0LP 4T쀐=X>X?XP@-TH0H  P@ @  <0A T,E>bH HHpX쀠0 /pX<, <4 //@-13/p@- 0 M000P0P 8@80001  3/`P 0  12 @00S 4?`@T*T7` Ѝp@R>h>-0$M0 00 1 3/$Ѝ8 @-0\0S X쀄>N- MP`@PpO pLQLQ 0 g00 0Cp7@ 0gZ!R0C   0 (R#   0 00 1 $!3/ P1 3/ P &0010v101 3/P  pW: Ѝ>>N-0M@P`P@S wPNq [ p1Z  :W000@0 S0(p00000P,00$01  3/PP ~P0 00W00S 0000PP1  3/P Pe@ W[0 ) P@0Ѝ ?8?J?@-S4MP000@0pS0 000 ,00$0p(P1  @3/`PU 0000``1  3/P !4ЍJ?F-@R`p PP@ Qd P Z 1 0 PZ0 `p'@ ?@-@ M0 1    3/@P}0 Ѝ@-Dq$M@o70 000  1 3/PP>)0000P0 P,0 P00PSQP1 3/PP)0 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP C\0 a P0 0, 0  200 0 10p 1 3/PP&?0 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?@-@0P 00 0@-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC JX*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/< 8Q 1@- RH %H513/@-D13/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p {.P +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`tVUh\l0`$d4P`d h0! P L,4.;#5"0 9000000 *P`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ P 0R 0R 0R  0R  s-PL0pLp pW*L0  P 0tčPPpGtTpG+p4x0p 0 4"$|1t0p ##t#0Ie 00rP@A뀨a!A@-0 H0lI" hP d"@PP0TH IO00 00T@@T Z9A뀷 QA @- HBH! @=@-0@0d! H5 H) H+@-00@ @| 00  @ A 000| 000 00   A  0/0  /@-@A0 / @-C耍[@-H Pp@-@ P`A p@ A08@-P@P8@- 0@0@@-@0@D@p@-@`P0P (Up(0Sp@-0@ S S !S "S (0 0bp@-0`00@T`\Pd"@ TpZZAQؙؙ  0!//ZF-h1QUU r/㲠[/BT`0` R@@@D 00cS\㚐 8@PTpI@\P0Px000P\0S# 0R*T P"QU p\0Pz* cR !R \ P 0 0 00S6 P PPPZ[쀔\N-xjtDP@s'P` T0`DT y(`01(R$4P5'4, !< !XC !T [UN r?80 0 nu|NYT[U\ r?800"LC: s7 A @3` ]$20@2Ab$0(RV2Wb Py?,Rt_ub0 0R_"b4R(PRb8rRb"0S ($ @4P84 0S `  0 0 0 0  0T0T0SP@ P @* P@ P@80SJ<=L0% L0 P@8 P*@l P@l P@ P @" , P}@ Pw@ Pq@ Pk@G PeT"@, |P^@P PX@,pPR@ PL @(  aPRB< <@h P7 @)h MP/P  P @E @AP @ P ;@aP< pU#2PUW W U Ѝ4 K`0V00 %P0:P0< 9hx0< c< vP0< Z< m 0 '?BB뀡0BPBB 0 (/ `@-BϠ`@P0(!(pWpWX "|0D`@P0"!GoH #!I 0P00S0SEĵFĥ0 0S00G00`J0 F?R +P EPFPGPE 8@-@RP T 8DD 3'@08P 080$000(0,0,0(00088 `CC@Х\00 PP/00//bhR#/! / S/@-P@0T/0R*0 0 P//@-P@T0T0@-@P 0T 0@-@P 0T0N-(`Pp,@0 S @@ 0P (0@s/@-P @T R$0Q 0 0 0 0LLL 30 00$0 4(0 ,a/Ѝ@$ЍC뀴{ZC뀁xCP/P/ 00 0/0P P/P//@-P@@-@P QP/ 0 0/p@-PK`@PHH K?D K/!,00<00`P00p5Cp@-@Pp@PUpX0T  Q0T X0p 0T08`0P@P00CP0@@0Sp@p@-@T@HC0P@- P/3AP*xضж退逜途逜逤逸жض$(P (P (\  P0j/05A˾00 4S S SCS S S< .10*0*000* j?" 00010PP㠠꜠P0 4WpWpZW  u0505YH h#c$ H뀑ctc뀥78@-t7 POHA000001fP$TAB]` 0@1 :D10L1P1T1?0X11P1@P  : 0 400#40 0 $  "$ `@1  @  @ 0x1@!( !888 h쀐H뀫HtcH!Ϡ\@->N-!oV@ p 8P失!TP UU` pNJ pN' h!8@-@ 1問 0㐏 0㋏ 0冏P00P0 0C/@ 0<000@008 0@0 0<ӏP|0<͏Pd壽8<SL0L 0 08 08XJГJhJJ JH@J HLJii8@-㩏P0  @00៏Ptum80 0T '0D "04 ( 08@J J(IJhJГJXJ0  @ 0< /lj0   0< /lj0  0< /lj80 R $ 0S0  /ilj@-Qa0A T0 pS*pcW0SH Wp 0T pTp 0 0W0 # 30t`: S(12P8* PU:Pk 0P@e  0P``  0P 幱 P`p: S`02P@e00 P1:H奱` ݲ+ݍj k퀀L뀒L뀠Lj k!L뀹L@-ApM0S- 刱000CS@PX`hpxH |@i0eDl @P t[ K `X0XV `0k@[@MpЍjLL:::A;@LLMcM 0p@-@P `0 0p@ BM 0P/8@-0/S\S10/S\S !g R Q0A/R\R    P.Q Q\Q/Q /\\\ @.T S\\/\Q 0/\\\A  B PR0T 0R/0000"/P@ 0eQ Q\ 0\/S\SL /Q\Q/\\\ 8ccc8@-(@02PPR8cU@-h MB0tT厰/Q\Q 0i 0$ 2## 2/ۍcNMvMp@-@t Mb0vP\k/Q\Q 8F $0, 2## 8@-@ P8D-P@`pP 8@-P@@08N-`@PPp' &S  P  P 0S @ P0@S   @0TSSp@-@`P 0 p@@-@P`\pjP PV z V@-@P@Z@-@P@Rp@-P@`PV@ 'V@ @pN- p@ `P ;5 P   P  PWP``PU@-@p`P 0 p@-P p@-@ P`P T  pp@-@p`P 0 p7@-X 0P@0P  R 0( 0P  R>7(1(s@-P,`@ P 0|'F-@ PpP+0P/S `# / P``  jPp p0/S S / P`` 0ipP0Sp@-@P  p@N-@Z`PBY? `pP+SPE/Q0CJZ0 P `) 0 S 0P/00P W 0 SUPE00 p W00W0S w`w` ``ЍF-P@ P#Tp' `0S`QZ0T  P00P0Spq @- 0P p@-P@ Pp B0p@F-(`Pp P  0P 0S P  BP@ 0Asp@- @P P P  &P` pD-@0t P`P  p v P  P `f`P`UM@-Pp`g@P   p P  P@@<, <4 /D-@P'PpPP`: `PP :` V#3@-@@-@$@-@ @-@ 8@-@ P 8@-@8@-@P88@-@P88@-@P00@8D-P@p(` ( 30   v`p r   iDF-P@`UpZ W 0e0S f  e @-@P`pP $>Pej 8k@-P`"2@pP (PeRM !T40/p@-@ePPP` P $  P PV ppL-`@PLP 0P@ HD pA-P`4p@P aV@ 0AD-`P@P  `P@ #  0 p  0hP@ N- M@p0@P e 0`PP  0  0EPPG uJLPPL 0 0{  pP00 0p m0 0pP 0 p`0  n piW0`0 0PP40D APU  N P Ѝ@-Pp`@P 0r P@   0 @N-@P`P4 0P,p*p Pp @PHP 0P @40    P40p@-@`P@ 0 p@A-`P@PpP e0At@N-P@p`P\9P`*$   $ P 0S`E   P P`5h , |( W$ 0 UT1*  Q  0  @00<20UT`Ѝ p@-@0PP`$C 0"}pP4/0/ p$0`0P/ /MMM<, <4 /@- 0P/@-@ 8@-@P8D-@$`Pp ` * pgp`V$D@-@@-@8@-@P00@8@-@'Q8@-@P L404020088/L-@PP$~PPy`puVP p  @-0 D-`P\@P pkP@ 40 ~8@-PG@PYP40@8N-@ 6`P?+ (Pip  PPPj $ 00 pPg0P: @  U  @P 40  (`ЍD-@PP>PP8 40 p`$ g` "pP p p ^ P0SP  @-@05 P 0R@-00P#  S:7@-0@P0$ ~0QS>p@-`P@P  @e@30P:@p8@-P0@(ܩP P8@-@G a0@-R1@   @\T:  ` p@-0 @`\UP2P5:PPUP@T: p0 B,R/,0@- ,@ D$@@$ R,R \p@-0 0 R , 0P"!C@|`@D `a &`a &`a &`a &TU!p$00S  ,p,@-@-  u8&F-`p<@ " 0  Z Z @D 0U ЍP " 00 0@ as' Dy" o" P@P @@83T (.  ЍF(,ꀟN뀬N뀰N뀵NN-PMpPp@S@@!PU= P8  UP! `T  0! T     `V:`    .`V P 0 D CHۦPpe00WPЍꀽN2N㈨N-@0@M$00(0Pp <0`d` P 嬦00f0Pp Pp [`噦 0 c  fq p PeP @Ѝ##NNN@-\   @ Č  @T @T\: TO+O 0p@-`Q0 p0S@@PPS* Q Q 0@0 `Pppj@-@P P`T0 0p0SQO` P0VH00jD-p `@P0 0SP00P 0```p `0W:0 jF-P@pP ` 0 R  }P0```P `0U:0 jN-M   p8@yJ 0Z" Q``  P 0UP g uU # 5PQ R 0 0廦`l0 ` 00S1 Pq0 lAP U0Pi0iPU/  0 R% PQ R 0 0偦`20 ` 00S P070 20 0S0S & 0R  00! \ P0``0`P0S 0S 0P00PP0 PPЍj0@-M  0@ 09PPP0   0"0 0  000Ѝ0jN-M@0R100MPp$ ( ` ` ,@ C U  @0S90 `0 [P0  0Z `0 `0 0#R00S$ 01g 0W`  ^S \S0S 0Y $1$,@_ 0T @ T*m 0 4( PU  $ 0=\"ጧ(0PP PP PP \PQPp0S00K$POjN-PP M@`p2   P1   x  @00S 0S ` @ ` @ P P ;[@0 S S` #S `0SD SA0`S=S S S R S R =S00 `00%000 `\R R`  0 R R00@P0 0[ <季 ` 0V*0S ߤ ЍjON-\ PU d @0p` PUVX V `Q@`V@pbqAPPPaPPP S:P@LS"*`↡ 剡牑q  Z W a ! 0S :@U\01 P3QP5P5@D2 P5@"'A  %*T0Q5 5Ѝ0/0 0 0 X0\0P T0/F-@Pp`0PXP\0`0\U@T:T1 aPy Pl`y ` @ApG000 0Z@:PpU @ A0  b V A0 b !APd  lF9P50@-0 @ PPQ*T*0 S:00N-pP0 00bG p@q0P6`V0:Y ``d Z** `Y `d`d`p  P @D l  P` aV:`d`Z  V R0 pKpG[`Ѝp@-P@`P hpO0@-P0 @X \@@@DQ@@Q@3T0 S://@-P@p`lUQ`g`s@-@P `PT  TT @0S@`V % LX%|N-RQP@ 0`7ApppW: e0g  @ 0P    xs @ pPP  Ap4 jr88 ( Q  R P Pa< `岠Z`,`Ŋ `Ӻ,,`af$ ff(@$D2f 0,<0岠0(@0((0D \D` 0P`@ `  V@ PF TX 0`@ T4  P Q PaeAh `lVP` \: `e ` 8`  Z``V:`$Q` q `` `fFa`tQ 4  Pp  @2  a岐DP@   < @`PR ЍRꀯP/0S  4   S  ( , 0 8 < lPL//Rp@-@P3 1R<S00-P- 0 0S(0 $0 S0 $0 0(3/P U0Pe0E20/U0P0ES$0( 3/000$P40p@pppNꀔN0%0 @-@P  R $0S 4Q ( 3/($0 3/D-RX@p h%X 0P2U\EPE`VlF`FQ RN0pGP`W`2U\ETPEV}GV=0pG00 P `P `P `P `P `P `P `P `P `P `P `P `P `P `P @`TP``PP`D W0W 1ERpGPR`PR`P R`P R`P R`P R`P R`PR`PR`PR`PR`PR`PR`PR`PR`P`W  @0 0CP`S(}Py`N-PHM< @T   Y0S00 S 0 8`q R%&b$ PPE>f  0 0  P4 `Wc  pGePU0S` >F =C 0S&$    D`&dE`D 0P0` 0W<  pGePU 0S`0  &4D`E0&8&lF0G`D 0P0` 0W  pGePU 0S  &$ 0  D`&dE`D n0P0`0+ W pGePU @`R`<` D`&dE`D M` 0S P000 ) @ W010!S Q P  b\ b 0%0    0 0@ pc0c@0@0S0@000 +$ W 0 Q0 P @ R7 2@ 5\S:    00\pc  0S 0@000 *$ Wt 0 Q0 $P @ (R7 2@ 5\S:    00\pc Q 0S$ 00   0WE pGePU1V9*P` 0S$ ,  0  4W(  pGePU&,&4,<l040`40 00P 0S  p8`l0L00T0T00/>0l0p P5. 0h 0d `00$0uT03L0C(0 (00SW$ 0pGePPW pGePU:6cPc0hLPW pGePU:Q6cPc/  06 &aPE$PW pGePU:6c  a W pGePU:6c  ccP0$ Q3000 h R7hh$Q:0S S>l0L0 0T0/΄T0l$` $0p Pd3l0`P00X0X08$0d P$3003W[ p 8`E0C0 MH0$@lk$ . H UeUUV.V]KVjV뀈VkV'$ꀹVV ]$p1s@-Pd!0@0CSI긚P|ꀠPPꀸ<0P TPaLIP P 0 P@d;008#,#48#80@<0<0l"@ <0<0L@@0@,|kVeW뀬NVVW뀎p@-T@TP0 0S0<<zp@"0l(0Spp@~e/WWDWA-`2@ PQ R 0V R RUp0PE#$48#8Sx S S42 `@ ` r P `@V:A?U0#DDH$H1T@  @ ! ( D Q#lQ`H1 RR R  Q `  =`0 S@0 000 0C## PE `Z0 R`50U(ʇ 0#$$("(ʇ0#$48#80CSP嶇 D0 <寇AaeGW뀊OWSW]W뀙W뀱W4kWs@-thzP  \2X_zPHB  Q*,呇2/ b2PB0U02! !4!0^ Pq:0PP P- 00XA`W\H1X RP0S D10S !  0R A A*;Q 5  0*P|@0000`E00`=Y` |h<0Ѝp@WeWW뀔lkX'X뀨VXSX뀌kkX뀌X뀲X뀍]XXꀈꀎ@-YY@P>xY@P>hچYYnY>Y>iY>fY@P`Y@X@-6VY>SYY>@Y@-:] 0  -4M(Z*( +)0,- yPx4ЍY @-00 |0R KY,YP`0#( (,##  ((,(0 0! !脬0D0J0J@-DD WY 88SY400 ,0R  @HYJ 1Jꀄ`Dh@-d  HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO>"R 5 C2 PhX dH2 Phb 7 ?ñ2 ГhTdY * Zh F2@-* Zh F2* Zh F200@1JPHpHHHH2X }, }  k }  } } ^ ~" { {}   k }  }  k }  }@   @ (        P 2 @JJJJ0J8J J8x0J`JhJpJxJJ@x0J(J0J8J0x0JPJ`JJJJJJJJJDJJJEJJJJJ J J(J DJ(J J(J@J8JhJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJAJ@]Y$Iv7_outer_cache_inval_range $H !(08@HPX`gnu|ꀃꀊꀑꀘꀟꀧꀮꀶꀾ*d!d*耣$do_env_import%Kdo_env_export W  $+ 5< C U-Boot 2011.12 (Apr 02 2012 - 18:13:04)bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000set_default_envenv_importfdt_fixup_memory_banksethaddr__of_translate_addressW3b3h3n3u3|3뀀33뀏33A뀍c2p2v2|2뀀22뀄22뀓2 2뀝22뀭22뀽22222222222 o3 33 3 3-363?3E3K3Q3뀍 011*131<1D1$U1b1p1 1뀘1 1뀵1111 11)2#2*252 H2Q2뀍0뀝00뀰0000000뀍  ( w 9909@9J9V9`9뀀9L 뀀 #(-27<FP'@Bmmc_set_iosmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupH\p$$7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-EPTGMK(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     QQ뀍QQQRR#R뀍@BDFHJLN"$&(*,.0@BDFJL^ZPRTVXZ \ ^ `b dfhjlnp r tvxz|~         2468: <>HJLNPRTVXZ\^`bdfhjlnprtvx z | ~  @BDFHNPRTVX\`bdfhjZ#Y0Jusbd_rcv_completeusbd_alloc_urbusbd_device_event_irqN/A*EHCI Host Controlleru-bootext2fs_devreadeth_get_dev_by_nameERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s SDRAM: identified size not same as expected size identified: %x expected: %x I2C: %s baudrateMMC: ipaddrloadaddrbootfileNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: Starting kernel ... bootargsmachidUsing machid 0x%x from environment WARNING: Caches not enabled ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... (not set)%-12s= 0x%08lX arch_numberboot_paramsDRAM bank-> start-> size%-12s= %s ip_addr = %pI4 baudrate = %d bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsresetPerform RESET of the CPUbootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order %lxinitrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartno%lXfilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSboot default, i.e., run 'bootcmd'bootdiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)loadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationecho args to console[args..] - echo args to console; \c suppresses newlineexitexit script** No boot file defined ** ** Bad partition %d ** Loading file "%s" from %s device %d:%d (%.32s) Loading file "%s" from %s device %d ** Bad partition - %s %d:%d ** ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X ** Block device %s %d not supported ** Invalid boot device, use `dev[:part]' ** ** Error ext2fs_ls() ** ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemusage: fatinfo ** Invalid boot device ** ** Unable to use %s %d:%d for fatinfo ** usage: fatls [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected usage: fatload [bytes] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read fatloadload binary file from a dos filesystem [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystemfatlsfatinfoprint information about filesystem - print information about filesystem from 'dev' on 'interface'The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "<0x%x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandsaddr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pinhelpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'?alias for 'help'Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error reading the chip. Valid chip addresses: %02X%04x: %02x%08lx: Error reading the chip, %02lx %04lx %08lx ? Error writing the chip. Current bus is %d Setting bus to %d Failure changing bus number (%d) CRC32 for %08lx ... %08lx ==> i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32devloopmmmwnmprobereadUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'loadbload binary file over serial line (kermit mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (ymodem mode)CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same %04xmemory display[.b, .w, .l] address [# of objects]memory modify (auto-incrementing address)[.b, .w, .l] addressmemory modify (constant address)memory write (fill)[.b, .w, .l] address value [count]memory copy[.b, .w, .l] source target countcmpmemory compare[.b, .w, .l] addr1 addr2 countchecksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]baseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'infinite loop on address range[.b, .w, .l] address number_of_objectsmtestsimple RAM read/write test[start [end [pattern [iterations]]]]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)ERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! list#part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device writeerase MMC %s: dev # %d, block # %d, count %d ... %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcinfodisplay MMC info - device number of the device to dislay info of mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesping failed; host %s is not alive host %s is alive gatewayipnetmaskhostnamerootpathserveripdnsipdomainbootpboot image via network using BOOTP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocoldhcpboot image via network using DHCP/TFTP protocolpingsend ICMP ECHO_REQUEST to network hostpingAddressNot implemented yet ## Warning: defaulting to text format ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed -f## Resetting to default environment %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name"%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps andpress ENTER ... ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: environment handling commandsdefault -f - reset default environment env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env set [-f] name [arg ...] editenvedit environment variablename - edit environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'defaultdeleteeditexportimportprintLabel: %s kernel: %s append: %s initrd: %s missing environment variable: %s Expected string literal: %.*s Expected string: %.*s Expected unsigned integer: %s tftpbootfile_path too small. (%d < %d) Base path too long (%s%s) Retrieving file: %s %ppxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sMaximum nesting (%d) exceeded Expected include path: %.*s Couldn't retrieve %s Ignoring malformed menu command: %.*s Expected label name: %.*s Ignoring unknown command: %.*s localcmdrunning: %s No kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel fdt_addrpxefile_addr_rInvalid pxefile address: %s Error parsing config file Missing default: %s pxeuuidusbethaddroutbuf is too small (%d < %d) 01-%08XConfig file found Config file not found pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r getmenutitlepromptlabelkernellocalbootappendinitrdincludeBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present-o-a-z-nminimal test like /bin/sh[args..]falsedo nothing, unsuccessfullytruedo nothing, successfullybootdevice ** No boot device ** ** Device %d not available storage device not initialized. Use usb scan Rawerror reading partinfo...try to boot raw PPCBoot ** Invalid partition type "%.32s" (expect "U-Boot") Loading from USB device %d, partition %d: Name: %.32s Type: %.32s ** Bad Header Checksum ** ** Unknown image type ** Read error on %d:%d See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyString: "%s"%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Self Powered Bus Powered Remote Wakeup Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - InOut - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dms480 Mb/s1.5 Mb/s12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. tree Device Tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device usbUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'usbbootboot from USB deviceloadAddr dev:part %s gcc-4.5 (Ubuntu/Linaro 4.5.3-12ubuntu1) 4.5.3 GNU ld (GNU Binutils for Ubuntu) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded %8lxfileaddrimxtractextract a part of a multi-imageaddr part [dest] - extract from legacy image at and copy to %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Panda # In: No input devices available! Out: No output devices available! Err: No error devices available! serial*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaystatusdisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. syntax error ** Abort ERROR : memory not allocated *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variableIFS \$'";&|#Unknown command '%s' - try 'help' or use 'run' command Unknown command '%s' - try 'help' 'bootd' recursion detected ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreeKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32Invalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-boot%.*sHit any key to stop autoboot: %2d %2d prebootbootdelay%*s ** Too many args (max. %d) ** ## Command too long! Enter choice: %s not found ^C ERROR: NOT USB_CONFIG_DESC %x unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dERROR, too many USB Devices, max=%d ERROR: USB_MAX_HUB (%d) reached Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) failed to set default configuration len %d, status %lX usb_new_device:cannot locate device's port. cannot reset port %i!? No USB Device found %d USB Device(s) found USB: scanning bus for devices... Error, couldn't init Lowlevel part Device NOT ready Request Sense returned %02X %02X %02X No storage devices, perhaps not 'usb start'ed..? Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry READ_CAP ERROR scanning bus for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIDOC device %d -- Partition Type: %s DOS## Unknown partition table ** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type timed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range error waiting for i2c address ACK (status=0x%x) i2c bus not ready for transmit (status=0x%x) i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%cCard did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCBattery Current: %d mA Failed to convert battery voltage Failed to read battery voltage Battery Voltage: %d mV Failed to enable GPADC Main battery voltage too low! 000000000000genericserial#Warning: serial number %s is too long (%d > %lu) usbttycdc_acmDas U-BootU-Boot 2011.12TTY via USBBulk Data InterfaceControl Interface scanning bus for ethernet devices... usbethmax USB Ethernet Device reached: %d stopping %d Ethernet Device(s) found Error: SMSC95xx: No MAC address set - set usbethaddr Waiting for Ethernet connection... done. unable to connect. %s%dsmsERROR: %s(), %d: RECV_ERROR actual: %d buffer: %d urb_bad: %d ERROR: %s(), %d: no rcv_urb! ERROR: %s(), %d: no endpoint! ERROR: %s(), %d: F A T A L: malloc(%zu) FAILED!!!! udu %x ERROR: %s(), %d: (%p,%d) NULL device or device->bus DEVICE_UNKNOWNDEVICE_INITDEVICE_CREATEDEVICE_HUB_CONFIGUREDDEVICE_RESETDEVICE_ADDRESS_ASSIGNEDDEVICE_CONFIGUREDDEVICE_SET_INTERFACEDEVICE_SET_FEATUREDEVICE_CLEAR_FEATUREDEVICE_DE_CONFIGUREDDEVICE_BUS_INACTIVEDEVICE_BUS_ACTIVITYDEVICE_POWER_INTERRUPTIONDEVICE_HUB_RESETDEVICE_DESTROYDEVICE_FUNCTION_PRIVATESTATE_INITSTATE_CREATEDSTATE_ATTACHEDSTATE_POWEREDSTATE_DEFAULTSTATE_ADDRESSEDSTATE_CONFIGUREDSTATE_UNKNOWNGET STATUSCLEAR FEATURERESERVEDSET FEATURESET ADDRESSGET DESCRIPTORSET DESCRIPTORGET CONFIGURATIONSET CONFIGURATIONGET INTERFACESET INTERFACESYNC FRAMEDEVICECONFIGSTRINGENDPOINTDEVICE QUALIFIEROTHER SPEEDINTERFACE POWERUSBD_OPENINGUSBD_OKUSBD_SUSPENDEDUSBD_CLOSINGInvalid string index %d USB_DESCRIPTOR_TYPE_INTERFACE - error not implemented USB_DESCRIPTOR_TYPE_ENDPOINT - error not implemented USB_DESCRIPTOR_TYPE_HID - error not implemented USB_DESCRIPTOR_TYPE_REPORT - error not implemented get config %d DEVICE_SET_INTERFACE.. event? EHCI fail timeout STD_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STD_ASS reset The request port(%d) is not configured port(%d) reset error EHCI fail to reset Register %x NbrPorts %d USB EHCI %x.%02x OMAP4 EHCI error: timeout resetting TLL OMAP4 EHCI error: timeout resetting phy OMAP4 EHCI error: reset TLL timeout ERROR : Unsupport USB mode Check that mini-B USB cable is attached to the device ** ext2fs read block (indir 1) malloc failed. ** ** ext2fs read block (indir 1) failed. ** ** ext2fs read block (indir 2 1) malloc failed. ** ** ext2fs read block (indir 2 1) failed. ** ** ext2fs read block (indir 2 2) malloc failed. ** ** ext2fs read block (indir 2 2) failed. ** ** ext2fs doesn't support tripple indirect blocks. ** < ? > %10d %s ** Can not find directory. ** Failed to mount ext2 filesystem... ** %s read outside partition sector %d ** %s Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block ** %s read error - last part FAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld(null)%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d Invalid pxeuuid: %s U-boot.armv7.omap4_pandaDHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddrBUG: failure at %s:%d/%s()! eth.cBUG!eth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! Warning: failed to set MAC address ethrotateunknownautoloadnetretryoncebad length %d < %d len bad %d < %d checksum bad ICMP Host Redirect to %pI4 ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) octetblksize%c%d%cFile too largeFile has bad magic %s; starting again Retry count exceededT blksize TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4from; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *Could not request gpio %d %02X:%02X:%02X:%02X:%02X:%02XBoard: OMAP4 Panda raise: Signal # %d caught  $Dd `耠逴@耜 p T 뀍"뀍)뀍/뀍1뀍9 뀍=@뀍뀍/ DZ耍뀍Y耍뀍X耍뀍 T耍뀍W耍뀍W耍뀍 W耍뀍S耍뀍S耍뀍R耍뀍R耍뀍@耍뀍}耍뀍Љ耍뀍t耍뀍}耍뀍 Ѐ耍뀍h %逍뀍Q 耍뀍耍뀍38耍뀍T]T]\]\]d]d]l]l]t]t]|]|]뀄]뀄]뀌]뀌]뀔]뀔]뀜]뀜]뀤]뀤]뀬]뀬]뀴]뀴]뀼]뀼]]]]]]]]]]]]]]]]]^^ ^ ^^^^^$^$^,^,^4^4^<^<^D^D^L^L^T^T^\^\^d^d^l^l^t^t^|^|^뀄^뀄^뀌^뀌^뀔^뀔^뀜^뀜^뀤^뀤^뀬^뀬^뀴^뀴^뀼^뀼^^^^^^^^^^^^^^^^^__ _ _____$_$_,_,_4_4_<_<_D_D_L_L_T_T_\_\_d_d_l_l_t_t_|_|_뀄_뀄_뀌_뀌_뀔_뀔_뀜_뀜_뀤_뀤_뀬_뀬_뀴_뀴_뀼_뀼_________________`` ` `````$`$`,`,`4`4`<`<`D`D`L`L`T`T`\`\`d`d`l`l`t`t`|`|`뀄`뀄`뀌`뀌`뀔`뀔`뀜`뀜`뀤`뀤`뀬`뀬`뀴`뀴`뀼`뀼`````````````````aa a aaaaa$a$a,a,a4a4aqꀗ='J/DXP` Qeꀅ QꀍH$RL[N]Tya;,fAq,fqr耽r tr/lpPd n耇뀓n耸j<,kA] mlk3Xs^| Dx耭 뀾 t  ^ }d 뀕 } 뀕 | 뀕 ( y- T   }u뀓Љx< ЀEax xh %l뀔xjXn뀖0. Xr{ t老 |耡  K"S"h"0RȰ"뀍 $$2$* ** $(,048TH   t x      $ D  P0$,DHP,0LTX\t(\4<X\      !\!####$%%%%%&''' ''''' 'D'h'''''(H(X)\)`)d)h)l)p)t)x)|))))))))* *`**+++,,,,,,,, -......D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2224444444445|77777777788 888888899994<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<======l>p>t>x>l?p?t?x?|??@@@@@@@AAABBB BCCCCCCCCCCCCCCLIPITIXI\I`IdIhIlIOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPP PPPPP P$P(P,P0P4P8Ph>l>p>LAPATAXA\A`ALBDDDDDEHELEPETE$HJJLLMMMMXN`NPQQpStS|UUWWWWWWWYYYY[[[[[[[[[D\^^^^^aa atcccccTdtdxdde eeeee e$e(eeeeeeeeefffffffffffffffffhglgpgtgxg|ggggggghhh hhhhhiiiiiiiixj|jjjjjjjllllllll4mmm@pADEpGMM8NNSTTlYpYZZ__ _____ _$_(_,_0_4_8_<_@_D_H_L_P_T_X_\_`_d_h_l_p_t_$o(o,o0o4o8o 0R# 4  R`0?00 108KX1p80P@`PW7 W"$0#0$0QK`0X800cPK0ϊ/.Q00b\Kt!0KKX80O(K8! R8K<1SHK0APHK0Q0HK00XA$%RhK808l 0 0 08WKA`KX8XKhK Tl!P 2 RQKT2xKQ\01h!\XKTQHKTA\0gP Kp@! P KT1 DARKT \0|1R\08Kh!U0 0KTx0 R0R0 n8Kp P0 0K`Q8KT1 `0Q\0?0@0RxKTqXK\0TQ0?00SH qP#ip4 `))4 L)a %TL*)))4TU )0)p )8)(t!PU 05 D0RKTK\0T0?0S5KX(K04q!8KT1PU HK`A`VXK\QUA`0RKTxK`0Tq0?@1P`0?000S' qPPU 05 X1RKTK\0T0?0S5KXK04q!KTPU 8K\1`V xKpq2 P KKT l!800 0(b@"0\Q\ 0T0xKXqXP 0\KX\ K00B` `0XK  Ba\ad$5SAh$501l `R 00Bdd0(PlHKphKKhQlqdxKp\ P KxKX0PP 0(KT! BKX$5S0C0S$ PKH KX0$54 KH! HKXAXQ,0$EUH P 0SS Od0Sx -LM$$ @0 @9P *00 ᰝ0ᰝ0ᤝ -LP 1h Q-L@ p0P T/, h P-L 1P h 0-/LP@P 00+8w'/00,+ 9+900 p-LlM/P@P KԼP0: S Kp0`rS@9 L P0-L@P0 R 0 R 00hFFt0 R0h0l  㔀H0 R <0<808}0ꨝi --LM0 0 d --LM0 0 K --LM0 0 K -L@ᨘ h -LQMH0@K0@PP`pK<8P0: S V@@ S00S F`P"P$KDP T P`0 R000 ZK@ P h1: S 8m((Nbꤝ@L,< --LM0 0 Pd -T L@H>P4T$ W edAl -L0MpPj8@P"  Ta0B0S0 T00@ S0 00a>C"0, ,0 ,0 R Rt3tt#!2(K0 00B SH' 0# 8,@ P 00C 4, Q0 0C#4 4 4p48@ 0, 40 0C< 80 0@(#5D |,0P@@`0D@ ?:8<00夐,@@8嬀 ?5845<P%0<,D 4@< 0B$%pH /T P @DL@ X 夐 Y 00S  0I 000DL44 0B440D0<4,0P@@`0 ?:T K <@ ?:D0 S,d 0S d H\`0H P3  B  B00B11X@00@0 SY0  0040(  , 4A!4*ذd P-L@ 00 R$hEz0 - 6LM , RvfFXS$3S Pu Y40ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),` 4 ?6t$0ttS} \%h4R& 0O044D $0O84 R P 0Sl> 4Op(0S `p ϟX.p 0P`@`` pp pp }-.N x-0^St Pr mP(0--<0000P@o = RD0  TJ$N0S ^hm84P :H08<%0OQ |J 0hZH/8<%P $P 8:L]`0OU  0L/@D%)PH P 9L]`$堀Q@Pu`0\3  B‘B0"0B11 00 0@0/@P`PoU i$QPU@``0^3  Ba@5 B0  B11L 0000ȟ RP l\7xP0 0 "DCQ Q ,h\`P &RT3<Pb F0 6 00`pWU p0OO  Q^Pa `0O?0@@ c@Pe)5P e0,\)x5P 0h%?>T 0 H5HU  E),5PE =)5P <ş 5  44  O+ 4 E4w_ 务, 0R(K40Sğ@T" 0(ßP=HD0SF yCf+3P) ]% S` 3-K B BP P S@Td 000P c\54 S0 `5S@Q@=4ZE %D2` ß0+DLMPbR  0<0 iVfV$:RFTS8*06pߒl2 Rb `BdR0 0 0a<Ғ82 R ,0"0 0 0Œ2 R AQ0 0 0帒 Rf a0 0 0e嬒1 RD !0 0 0Cp埒l1 Ri hA\Q0 0 0k@哒 RF 480 0 0\0 E兒1 R @0 0 0i,,dxh+`+,4,X,|,4-T`----T-.($   LL`!h++,0p,T.|...|!Hdh+ 0,,,x%|0 Rf @P0 0 0L]`e R< `0 0 0; 0 R  0 0 0 1 R ,A(Q0 0 0HD!h t/\1\lo0,d5S/x5tp d0 pP!tx5/ W.O/0,@`0@L l3B \AQ<0P d5Ww"2墟?2 2R -BMLMp0 0 h0P0S ANK @D@DPYP 0R K};`Pt0@ 0h0 < 84 4$ 0D 0CKH0 A, A (4 $ =^*iT " - L0S* | t0 @_ 0P3T0 `q0 10pP 1$0S*h.p -L@=77@ 0-LMMpPANK@D0@D\ 0 /0 =80 7 0RK0 i` " -L@MRP`@ # W0 0  (K!0S y0S s0S  X0S l1@@ @hK/0 U,@K<0 # DP @` ,1D@K0X0 L@ HP Dp @ P fhK& 0W01 ?00i+   i-VW 0 X0 P Lp H HhKp0 XX 00 / @` -D0/ Y D:LpKX @lJ -L@ML H LK J K -0L: S  S  S  S <0P ,& S  S  S - ! @0@@L0y'P; 0 ` @ @ ``0 a,Pp&p  @0@X ` P P $S'0P0O'@P00UQ !!XPqp4 -,2L `Rc /@p@3 FvT1 RO1 RK࡟0SBT 1 R<qQ埝0ST00CS0SX0@X0FTR T00CS0.0 R0, 02P0 S  P 0S VPP 0 e`0@ PyTYT nTNT uYTyT  `0 XE@XE@000d,X  -,0L@SX P H P <0S d3`0 R T0,0 n,:P00,0,0 0  p-T0`LP@P  0,(P p nu 0.T -LMP@P4@ < 80 @@P [a<</Q80P ,` ,0`,` 0K$<QO@ 4g;@P81  > ,<K0K40<Q5夜@ R*0 4J;@ ` P0@_4 0K@P ; *<0K0@ h|0@@ T (Kot(K4<Kt <Kopxd&h -LM 0@S `V 0* V up̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V.p, -LM,00K, K00 %0S3\%RX` B2 R7Br @T T `U@ | PU`Q\"\0Y00/H2 RB0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`5 -LP`  PT  P P@  P8  P( $ 0  @ x $0 000, R0  0 4  -@LP  P $h 0-L@)l0PP HP5P@@P5P0p/ -\0LM@(0K( 0 @ K$ K0 P K$'K8  -0L@T P  hn# --@0L M,K0,K  K Kt/ -`0LM00 0@0 K P @X@ K8 / -t0LM $0K 0  $  K K0P $0@5 K8 / -0LM0S P X@0 @00P  8 // -LM  K K0K 'p@Ѹ aK/ 0-LM 0PS    KK0w'p @Ň學0 ;K00 -L@)a0a50H0 0S00 -p-LM@0`P0 RP0200  0S CKp -0-L$@KM0 0 '0P@$0 S000 @ L; 00 0SK0 --LM0 0 tumu K p-PLP`  0_tpV rP@@p0S PP@ PpUP@$0  @pp8\0|00 - 0LP`p) 0S& 0S# 00 @0'00pll 0 tp\U PP@ V0,0(0(`@,@(`@Ph\0  -T1L000,Q,p5@p 0`)'P0 ,@T"0 0R0 0Hp 0 0S 000IP 6000ϒ QPPP@000 ,@T 0 0\0 0-|0L@0S,@TH0@?PP 40PP@PP PP00  --LM0 0 ct\t3 K -LM@_p`PK! 0P4P4$0^$0 */0 1(1 -LM@\t0pP0K]/pt P_p`lP Uh ,T0!K 㤩P 0T`\0T!0[ 1S000SU% 0T@!1pP0S ޅ0S څ0S ,3,tT2 ,3,mTkTv3X W WQPLc3 0S f\30 (K(0 0Ԓ0 ,E.` KX1h|11 p-`L0S+ @P(  0P00 (0, S , , R(0(0phJp0 00 ps php0   -Lp0@000,@T 2 p`Pxp?0S P13 Lp0S/0 S+0 S @ T 0 D8P/4 1 0-0L 0R P, 0 @0 PU0st d0  0;s ,@Tp [@0S 0x 0  -L@,20p$ |ps-22 -X2L$M0  D2$ ,0 (@  $K,K0^$p0-S@1@0000Ր,@To!Pp/ ^p`+ P#8@K $P 4` 0` 8P W8 S8P p<0!$14`<,$!1l- K{ 0 @p`P#40S 0:0燐pN0S P@2 [p0S>0 S:0@ S TP0Q8@Kh/H20 D8X`E@d2\/4 1 0:0P0 K -L$M]pP*0@K 6$P ,p (p 0P 7 710aS1 @0 8 <` 4p @K ,w PK l`T!U P13 p@ 5TÃ0S  0S( MQ 0 0R0$0 $@K.V\ |p 6"4 H0xxx }pQ00 SK`2XE@2222x 3 DUd -LMCnKЁ+~K+cPÀ\PP|(K 0@K(P R tt0p ,P PX<0 ,P w<(0=u MP 00p$`K Ap@ T"0S $0[SI0S p0@T$00 S\X0,D0 @ K@V@`\3Lw333 4`4@4 -LDM@gUP ɳH DGP 0(儓o  p0P a QP [ fVP sVp QБЁqP !mp`10S@   P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@Ka " 4P 0P 8` 36 /6PPP00,w4d4P4444 5Ȭ5 l 8 200 "P: -LM@pPg ^`P 0S nS0oS` =h"PP00 @ P @Q  0U0P P00 00 X 0000X  5NU 0 Ӂ00 ,K!, ?R0S@pÁ0"S4 0N@PL/jj,jHjdj -LMp`FP@( P(K,K^P  0mP(0S_$K -000 0LS    [!i$5d5 --LM00 @MP 80 ~o }ovoni p-\0L0`SP@8 ,(P&Nphp!gd66 0-t L@h(P\PP P 000 {@P 4,N$@0< edA"!pyY؞ -MLM0@<0 8@ =!P = = = P |ˬ =t* P-] p4`Kh* dz -N0@&S:X d  \ $ d $ < < +0 `c40S<0t:  .t Lp RQ`<@0@0 L  @< 8 `54 <R 1 `%4 ;R  1 `4 ;R 8 `4 d;RX 1 `4 ,;R 1 `4 :R o1 `4 :R _c0 `4 :Rx O0S \\*TF@Pg P@ @000:,\ P*:1  o-xɟ00)<K6p 80S<0S [ 0s 0d  0Spx* P 0d h*jp0S89P ( 0e 0bS t80S \@K>PT0K\0 X@ tC 4(1 R0`: -W opP& P! ^KPEeNKPE@D@Dh(0s\(\8Pplᤌ4(88pcᛌ $N\70S- PP(OKe/r?K: 7x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  6 Rp A 00KcPp %   ,K0CpP#  ,@ PPPlP gP,  |,0?,0 d  P ``rpWZt50S EP xP| ` |  x l* c  0 Px ~崯  Ix K:NP~娯  x=40S 0: Sh 3 0: ST l`:@Pl  P`P`0P00@ Sx Sl| 00A Sa>@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0 0J# 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  p R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10s%k00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp 5L x 3L+i|n!Ԟ!6747+T7!l7"77!77Ȟ 8̞(8!H8d8О:Ğr|88tnȬ88rr8n0@3C 000t30SvL3 Q`0P0 20D080U00@ d b!0 0G4K(K ""U H:`::" - L0R  P)G: -2LM00 S8 4 N0lJ0 P2R@ d )! 0= 2P)G 00C 08P4`\\0`"1>\\0?0 80(R0! @ d !2 0; 0@4D1 00C04P ,0OT8`S8 K F0O,0 (@ 8K 00 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8Kx `?v` d 0 0@P0 0S 08Kx ?00 08Kx ?00,$000 (00$Kkh꬞ ""U H:":! -LMK@P,'0 K`0@ P A P @ P _e ) 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d 7 004 0 KA "! -LM@PpGK,`$1@ 0 A SA  9 K00` 0  0K e ) ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DK!A " ! -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@^pl@`x0W0HOH DpP,0 /0Od (00 0 080P0x `R!U(K "!!:""U (;!T -LM  0 <<P ) ,;P4Kd;0S ; 0t{Wdov 00)E: @P0=:p   H`;:Q: `: Sr\ mQ (:  S4Z@ ,0BttJ @P@PPjɟ 00T 0L59 0$: 049 0B90A  cB`0UT T0PD R@: R08R0EBY00 8 04 000cH0 400cL0 H00O85 >H>̞\>hTT> "ht@A!!>"d& Ԟ!!>>" " ȐY `400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000 `1Pg P=LV>00h0 h0 S:h0<2 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 400@|0PP40@`0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<.4P`D? 4  4d U0O?`@P$+4x K ФPp Z@p4P`m 5bP`8, 0>D @ , DK< K,0KP<KQ  P  K < 80 5,00 `d6F8< ?Đ .Q  P33 5 5  08q@ Rܠ #㑊(d&0  K@0@1K>P A0`@ @c0 0@` R pQ 0帐崠 J)F#Z **0P_70S>@P'(*0\% 8R8\5*0MG*0P$8l(t8Q0\5P80Shr d8PP 8ppD K p [P1P %PP80Y0 i R01:0 P<&~ I c*+`p㨐K:x4K`0S-p 0O ,00 /0Od )P0d PcP@c@t 0 S X4  < 0@P`p8ZXJ0P,0V0S X |:0S :Px :4K0S P  ?>0 ?0 ;0 4 D0P  =K*0`PTH4LDVlKd 00 f0 R P000`P pV`0 008P40 A @@>A@p; 008#80(K 0-LMopX0@K P0,L 0P< PX $ZpPK0 """? -0L "id8? p-LP`@T 0@T *0P/S @0P/S00@T:/っP@0.S P@Tp0S .S0S`V (0  0S0l]4"X? -1L MС`V( p1 R 0: S C<P8( 0RX$K dd\a\q0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyUto0 S7KA. [0 R@@>P>0d6 KHPn@FQPnP(僞,"i("x?d@? ? -RLM`p, $0 W @P c   ,/P `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K0S \oK3P`% P<=D1  ( Dp` K>P  03S ,3S o00@ (3S43: SK_p T2 S!3 mP D0`P KHP{= =i?4"(?? -LlM`@T PK2P 1 R n0S ;0 @TK0 Q p0S  Q 0 RP 0S x0 Rh[T0  P 0 Q9-+ "4"0"$"? -bL0Sp2 R p (dPP b@P# 0A S5   ,  0    $ WZ 0Sj P @- [1 b@P7n0SchR_0SH %P ,_0 00SB 0AS)<  <  t   t @ 0e: 0S ,P 0S:0 0 R Q AH\P 0S m0Sl0 RpyvH Pt << ","pc4"0"("@ -L@Pa0p0!Xp- P0@"S" (  ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  (  ( (  ( ( ( ( ( ( ( (  8 Xp0 bQ!@+60S 0W 0 0 0|0 t0h0 p0000(0 R0"?Ȭ("4" ","$" -000 0LS     Π4X"@d@-0 CR 0R0 Sg00 -@RLP 0S D#| 4|TH UF 0@SB 10S<p `(<#0C3@ R 0S, ,0S| @ l R @0 S0S400S(>h>h--  0-PL@0S(0h{BQP x{t d\00SP e < 0{ (0h{8@@`@|@ @@ - L ?P1;m @8"@ 3m -LM@/幟"P0002 Pp2 lR dr`X* T2T"PPPfP tP  @Wp2 10 bSP PP P 0@SX :w P:10S Ya@a,@  pQl 4  PP `@a0<S 00K@P k0S 1 0S08+0S% 3KP ,K .n 04 P,00S )8040 8K[P @00S d: 0Xz:=TX",V4n+@Ȭ@0@0@pcP -0L s6iddA -LlMp`@ V,*U&/00w@0 PsP3U @-*P qkKP0: S fk0 0 $KDP Vk @ -Lp`71u[[!HVp mP2 pP X!̂r`P y @R"2 0  劺PP@dЕ 0ld"0S 00CS00 Ӥ0叼 r@ 处000010S 00A,K߹1P0S00#3 dPP h1@d0S d凕 0H 0 , P4! 0qa00!0P 0 0S 0PP@ndV 0| 0S 00CS00 Ӥ09 r@ *l$$$0 `pc$$ -@L 000@輥 0-PL @ 0P@000踥 -LM0S`p00S; :SiP 000S S,坹"PP 0@c 0l0 00T2 0DD"P<< $"0 00001,K@P# Q000 ,0S:, , E,0  RO0#SL0nSt1 G0H00@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C败$$$`$pc$p$L$\F % -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@ns1 !Np0 00@pQ @0S@Pd0x@^P bٓ< ㆖+%%% % dFdFȬ$F --LM0@``0 s0DSL0@ D0D0堸  奸T[KdF$$F -L@Pb嘓 茆 -L'@Pb刓 茆 -P@Lp`Z8 0H,P 0?,$ -LP`p/0wS {S& sS'0 p 1P 0@ebM 0p0 pp 0P @Sb; 0(npPUpc -P` PLpK y@ W000 \ 0 0 -LM`0PPp@0S1 T 00S S@D 0@0V l0 l00 T00E0P S  0P$ h$F%%B-0 CR 0R0 S00 -L`zK((MP$pG!0 0R R0mH@P e*03 P0` P0V00S06#3 dpaPP a0S ak<  00$ 0$K$% `F$ -/LPM<K0t 0N00l 9.00l0Q0Sm l@PT 0" R 00$P RTΟ 0SH0SPL l 000> D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭S S S S S S S F S S @G G S S S S S HJ S J S S S S S S S S S S S S S S S S F F F G S S 0G xG G S S G S I S J $K \K K Q S S @R R XS S Q [k0SK0000P 0 0 0l0 0 @l @ )Sl  l L00l@000S6 ˟0S= 10S? R  B Pd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s P  P KP4[S 0y䙟䉟PD9< 0U aPVp )000 \P 0S&P" P 0S\ \t@V ;P 0iS@0PnP`0VS80S$$80S  T80S`86#3 _PP~ _0S _凐 q880S0S 8J }P 00] tPW70S0S71 0SH 7'B0S? R  B Pd  00bh@ 0 ,7d\h& 70S0S 6 xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ PP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<@ 01p@Wk `PVk 0S0N K0S2 TPr 0S0PP 1S0S@T 10TyNtA ppq0_? P .U?0#K"0KR0(0Y0@ ;0-Q6  ݕK #Kؕ0@ RU t3AN=N0+0#0K"K!pK  0| , 0<t<MzdZܥXTZ[TTXZ$T@TtT 0-PPL $0$@QoPP0XZ[ -LMPP 0-S- `pC#pp lP sP ?P`Kg`PhM`PCP#pppV OA0' #0@| 2  0 =`Px @T3 P @, 0T00S&R+PppT] 01P` KsP@ pKZgP=@T 0%S\TP`{tM`T; 01P `K0S OM@T' sPw !0LSLL 2Q0 d8MXKM`Zʋ 8BM```T6M`O0 R @[$ R @MT M`GQ 9G6G02G0.G0S0D Dp$Gh!G040 xVVZWVܥVW(WdWpW|WYZWDWPW@p@ xhp`0QU `Ep`0@ R V"T AP4Ep}f@P `*E\0pR廃44Epn@XZZWp[Z|ZW -L0M8dP0D($)hp LP PP ?P(KC#hp0S EAL H X PU 0S xDl3p0S\D@P &`#T @gT 3p"P  "0 @T0 D P 2 ; 80 4 n80 0x@0 < 坊0pK@`K,K0 < ,0@\P)00S "0 mZP<l<@HU ~DD0Sh !b R mD.t10S<<@0/S4ZBT0 MnL P  3D0S> !D7 A띍1P+ 0D0 P0 <PH厍0P DP P |.Dn<@H 㯋"DxDm@P<@XDXZZWX0X4Xp[ZlXZXX,d` ܥn`Xb|C0XKP:KfK 0p@!0TRK0K \4 0 , 0@ =9L4 0 =C,0 4 O_K`0KP`Q@P <` 8 0P=)A@` -BP@P <` 8 W A4 K0@t@ K0@`LX K0@D4 K(0,@ K0k (K0P@=9B` =C4P 0` ,0 N0P@=9B` =C@P <` 80 _0P@=9` =WXP T` P0 e0P@=9` =@P <` 80 <0P@=9` =4P 0` ,0 pDY4Y?BZY(Z0Z Z8Z@Z -LXM@tPK`ሀhK 0lpx 0r 0i 0c$KX@ -LPp@ Ndp fP/ vP ?P>@@ ?dpp01@T `P0 [P`@T W,@TpAZLZPZ p-LM 0S@P1  KgP/0S"  D 1`0P @g0P0fC10C0 0S0 ,0 R$0xmxxZXZ$[H 0-hALM`!Pc?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0*@0bPE\K0@h@ (0@ZܥZpZ-`Z 0-ALM P]c?P80AT KKfP%  0 0 rR P0S @[\dDP0@0d0 R R 00C8S@ 0  ?ZܥxYZZZ -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>AiZ]([ZZZZZGZZZ|Z p-AL!`a?P8 0Q@P `{P# PZ{P@ NzPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@pZܥ(]ZZ -`L @a?P@ hp4N0T 10 00PS<0< Z@ ZܥZXZ$[xY -0L8MT0 0\0 0CPX0 XEP%rap2 rP ?P pP,K<PT ,Q>(KsP uP@PT  , KN=PT , 9>D0$X0 ?ap01 `Rl40&Tx=`$Tn?@PP 00T7P  v=X0STp 0 40 0 40P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0S1xP 0;0 0S ClP0\0 hX0S L0 cRLK^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00厃0`D2 R98 Pg0\0\U00Su U 0!0  80S 0SPr1$ RPkT偮P LP1L PE][  0圇qgP0E=igX0S@x@3u00#T uP0  D0 @ D0p0H L0 p` 000HG5H@T<ZZWWXZ([XZZPZZ 0-PLM @ `?P0 01P@PK +C0PS80S08PKCP0Zܥ p-,QLM$!@_?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0YPx9J!{ X<xx>@xP4  <x {ZܥTYZpc p-0LM` P@_?P 0AT K0V4\0\  00 0l x4W<xO<ZZܥZZ R4 5:0Qhm -0L` Q\p 0PS @0S 0S P00@SHI - LR@:Q0AS Q 80p3P000 J -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @n\[[\[ p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30 4\ p-LlM`P@PT0 RKpK&lP@ : S I@@0Z -LM`PP@p1 0A#S꠪ t   h <  h  ث \ 0  \ 4 | p @ @ @ @ @ @ KbP0#50#0# KKkPKkP|d 0Rh 0RKkPKkP 0R 0R $K 0S2P"000^PKP|@TKP0: SKP0: SKP0: SK P0: SKP0: SKPy0: StKPn0: SiKCkp3cKp3]0!SPPU@]P0 0 3U  0p03 0 G0s3CD#<0S8KkP2K kP d0R?) h0R$p3p3KpP050#0# RO  K_P J0 00 KWPL0S0 p3KFP1 RK:P040#0# 0#  -_p30  #_[ 0Rq Lp3FP(K 0)1P 0ES񟗡꠭ t \ D , $ (0Rӓ$ (0R$ (0R$ (0RÁ$ (0R|$ (0RvtP0SwXZP\0Z-@-0S0%@0#0%*0Q00 @8 @8pc -L M@2@"P40 0 020"P,0 ( @ @ @@1SP1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RxP @ 0, p3p3@pK 0 0  ,@0 괡 Р [t\l\XZx\ 0-LM@P$K. $Kp  ?<8K0 Kpq8\ -@LM`P@Q $K 0/P $P 0 08 K0C4pK4@ 0P ,@ (P c PE@T @Eiv (7 7\([\\\ -LL0PS8H 0 S S0 0   0#  A0A0 S00p`B"Zp?@C "P( $ $ $ $ $ $ $ $ | $ $ $ $ $ $ $ $ $ $ t $ $ $ $ $ $ $ $ $ $ $ $ $ 0 0SV0SR 0RQQ  OP A!zZpp?@0!R a7``oXhA\!bZp . ?0B"S( ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ 6W |Q @x7QQ@T  8P$ %$JZ\]]4J0 X0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`>|T- p@PP 0`pc@W P`tP nP@W ]] -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpP ([t ] Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P ThZ -@QL.0  V]00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P WZ] -RLxMJaApPD0pp0G P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV ;V& @`, @`DA xA@(@ , 0 KP0 R7`T (0`0@ZZ]Z  0-@ 0PLbP 0c0 -LM0K` m mPp   ZP P0xU*oZP omPp  (K @`DA AP@PZ -L,MP L T @hL 0 40 0 H 40T0<0 8 p P:P8@w  YD  0< 0 bR<KU@Y R   P /00D00D0 H<0  cR<KT@PH T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , K~P LPQD p@ u@`WT 1 00 R P80$(K,0S 0Z -RLM<0 ; @,P`4`KH#-8#000 40 , ##0@T T@T"0 !>y|2P 0 0p400gCz @W `2  @Y8 @ ` P X`P @ 00kV 0P fP XP @  817 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !VIZ0 P`` VP @PA0L<x D0X0@` DA A@,@ 0 4  4017 8+ZZYZTY]ܥ< ! -/L`sHPDp`@PP@ T iYJHP -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@Ks0S0S 0S0 S0S0S  P H, 0R (K40$ N ' n8%iXlaDJ -@TLPL x0S C x  Tp0@ p0TP`[]@X(x R p0 Bx p0`L]X -`RL@YPPT^ Tp ppTPW o U 00 S/R  0R B/S PUjW10@  `1`0V0 T@j DA  f1A` 0V@0T00  oP@j DA  AA Z[Y 0-LMPK R@P>0SH0 R lm R@PT[8Z -L M0S 0 0@Q@ K0 KP1[S S|ࠁ ࠓl 0@d{P[,y1[S < 0W{P [yX[TZDht@A] 0-L@P}\ 0S0S @p00S@ ᷈@XZd0 -@L! @@@ @@44okP, 303 0 h X `(]X P@p 00 t 0-0LSP @P0PS0 0 5<0404 00, (0 D5x5T5L5P5X5-l 0S ^S 0000S$ >R@0̗?R!00=-0 0 L550̥ -tLQhd0d @pT *T0`VPUzTP@00x5X5T5P5l5 - 0pL`P@0 ^000@S@0C@0000`ZP  r 0  @t<% 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP>d\@P d0 R} X0 >wt@\5T5D5h5d5l5x5P5X5L5Z55 -\0LT0L0L0@DP 0540 ,0 7hl5L5D5`5T5d5x5 P P p-P0P`0 0LR@ 0 R R00CRphp!0DS 00C0000h5d5\5 p-08`PLP @0U@Pp`5 -L - L p0   P5 -LM`@p0Pd K"d@P `00`H0H T wD5P5H5L5T5,0 (0$ 0c0ALZZ55 P-L@ p D 00 hK^IT?@hvtg -$0L x vX -Xp@LP P <`0T: 0S0UP`5X5 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00L5P5tp5 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T:T5l5L5 -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &L5P5p5thCL}U{ -4LP $0 A 5L5 -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  CD5L5P5XZ -0LD5 -0LP5 -H0H 0L S 40R L5P5p5 -H0H 0L Q 40R `L5D5p5 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@L5D5tp5 -L -L.0 gL5 -LD0<0< 800 00@@KD5x5T5P5L5X5 -L> -0L `R0 PhP0@z|0 p d@`0@fTPT0T @@@Th PZZD55H5T5P5x5L5 -T0L R D0404 00 0@t5PZp5ZZ - 0 0Lp55 -0 LA5p5 -0LZ -0L|PZ< P00( 0S P0CB̥50@ Q-L@!00@0@ QP =D0 @<0 40V 000p5t55 -LMpP` ȀȠ04 <0 8 0 00 , @@@@4 0 b00Z<08 040 00 ,0 0DJY Y (KT5D5H5P5L5DS p-0L@`0 ^P :ϠQAQ 00S 0U^@*ppL5p5D5P5 -|p|0LP R`*\@  `ʥ ƥ0 0 0 P5H5L5 -L@.P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00L5`5x5X5\5 0-1L @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00zP0 D0T'* P P "P 'P 0CT: P P0_0 P P "P 'P 0CT:"P 'PZt5p5 -l0l 0LS`\00000C0P 80 40 -$555L55] 0-PLM T@00Cs0 0K0KPK 00Cs088p5 p-d0LX RT@T`0PP8f8 1?1c"10c QpL5@555gfff -tpPlp@LX`d@D0 <0 40,0p pP5D5L5X5x5T55 -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PAP0 0 B cRW@@T P 1U@@+T00T0 0@Pt0S:\5L5P5\5d5h5x5 p-0L MP 0 K$KK a0a(@K @`PKp0 !$0 `xV P0AP[H aPU$PP5L5D5X  p-P`L@T @00TPc@PdH@p5L5 p-0 LQ 0Q` 0 pl`tP0P `0@d0S00CP 0p5H | 55 ^5L5 -0 0Q tt0 `L X0R 0`@RJ@dt5D5P5p5L5 -LB -L -H0H 0LQ 40Q,P5L5p5000 0Q 0 R P5D5t5 -T0T 0L Q @@0R `9L5D5p5 -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 ) ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 vP5L5D5X -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P Pe0@ P0 -0QLp @aT`*@DT:PPX`0@@0@^SDN(0P  5PZD5Z - MLMKK I0 , -1KZ<p`P@1p@0T-9K.yK@ ^KPEPE@T9 P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z /`P, 0R*(KV Z ^Y *00hY ND bZAciĥ D5$^J -@0 PL 0px@`00Cs0 V U PP{PPVP5L5D5p5 -L,`p 9\ 0S  2 1C P@T@T 0U P0@T @ W0@0 Ps 00  0@@)&Kĥ5@50^ -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ }biJ 0-PLM00 @R 00   Rp0 RP0 R<0 R$00085 -h8LM \ 1T8  %@P 8P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KP |5@55l<XZĥ 8 , | < p P @  t P X \  8 X  ( H | p L^ -0L @ 0S (<5##,h/#0 h'#`^h^T^ - @R0 000  0L P hĥ@5 -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" }낎KHH0"V^ 0S2@T@S PP0"1@T r@TUpAp t1@T @S P0}< 09P9U @8 P P0@T @S P0[21C 0@T @T PP"|TP L`"t@_<p"m|5iK|ĥp^T ^T^J^ -3#ML M3#3#3 `3 S3#帓K@A A@`, 1P48#`0e0||#Pp@@;0c00 F cDCD3  h10S$C\ 3" #0l0cCP00쒟002 `-(K CP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000```P01@T p@T PVʂKAA PVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S  ]F=gN0b0 0C07P0J]H5T5L5X5D5iP5Z5Zx55d55h5\55l5`55ZPZp555t55ĥT ^5J -PLp)`P- @eT: K PR 0gXR@ @ 0gR00@  LP Z 0gX(00W  ʼa -LM` 1 pPM]V 0U/00ń/\@0@0cS AP@P/\ /PP 0 0hCPN 00`3T >%P _ 'PP 8 0.S0S .Si 0.SmFP 0 0cS ںA@  0H0Y 1!0@'PP s$ f00 lRA@ d*1 `Y 10I(K@0S `0Vሁ5L* ` kH1`0S KPT U0U/S0: S SKnQP1: S  0 SU0U/S 0: S SR 1: S/0 0 PP 1H@` DA A!`@`K2QPLZ -0LM<p00 , BP@0U @PP0 8K(K8 4@ P(@ 4,U `jcFa@f$KZ -L`pP@PP0U* kPX0@` DA xAP@Pd 0A0b CahCZ! -L$MpD H0 0{S qPMP0UO*DH `0P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q8P ,  P U Q0P{S0P O }S ,,SQ 0 PD+(Koe1@` DA AP@P,Q, D0H0  @cj804 PBPc4 0`` D@@ 0 8<0  4 <@00< 40 @pZ0 P8P ,00,0 Z -tt`0@Lpw.@@PP0 P 0pQ0msZZaZ -LMPHK @  /0/S000  0S0 S 0@00 0  00 , O00 (0`K ``@   80 4 L 80  cR8K?P0  x  H    Z   0S PD0Q D0 D =ZHP  _ Q    00 ZPY 0 0 "" "Z  R Y ZV Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z p$ $ $ @$ # # x#    D@T QA  Q0 R00S 0S0 `,0 R `Q !0J]S񟗀         4                   t  4                                                                R0 B 0Z Ze  RnL  000 00 0 R 00   00 䨐 0 00  R0 S0    R0(  0  x0 t x00| 0 R  pz0P/S@s0P/S W :S 0 cR ڀK> @ 0S 0SS|p0S" +S2 -S  U V0P PL8U |tQU 0S 80 cR8K=0S00 00 STd X@ , <`` X> S`S0@P {Z @K 00 Ep N)p |0〠 p A00 p 0 p 0 A   00#0CSp) ( p) ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( X*  3@Te  #T  Q00  0 9 00  000 RQI@T*T000 #0CS #450S:00 R 0@T@@@  0 @PD0   0@ U5Q00ST 0-S=S ?S@ 0S 4P 0S0   S0S 0 400c0 P 0P0 0#0C S81 * 81 * * * * * * * * * * * * * * * * * * * * * * * 1 * * p ' `p  !0P  $00(   0S @80 cR 8K<0Tp00S) 0  `p  0 $0( 0 0S @80 cR8Kv<0Tp00S)00 `p  p p Yp 004, ` `@TQ 0P0U*m  PZK 1 ( 000 ``, 000  80 4 Yc  /0S  Q   0SzczJQr0 t 3 0@  0  0 a P0UM*` ZP(KMZ$[,bpcZbbXZa([a4XLZ` T0Xܥ aaaZ 400c0 0+40S{pP 0P0Um*p0 P I@ 0@` DA SAP@P !P11 @`DA ?AP@P<@|  0S00 0R+00 %` 0` 40!0@P ac R0 00    00@"00@040jcpP0%S! ڣS S `V0S   0S` p  } ?P;PEW0 P40@XC *  0<0 ` X#Sk)pp@`R3 J`P( 0S K& J`@|P  4| 2f=  0D`     ` ` 4 0 | dPK@K0 i b0S @80 cR8K:00 R `0`PV 0S|[DP 0@S*S0]S @V*Vo@ 0Q  0S00S T  .:&00 Z?  P  0  SD V` A\P?0 00 c[P 0@S*S v  =R e ^POb@ 0 :S 0  00S     0 R  #70SS P@V @` @0'Z`0 R 0@T 0S 00SGg 00PI`PP Xp3X@ 00s03S+P@ 0 ^Pa@ 0]S  #0BS 8@pE\r^PP@ `aPU 0 T @g DA :A`p@#SRW@N`UK:0` 0>P p`@0` 0>P`EW20` (  N2p/@ PP`F  U  Q22p 0@P 2U @ -;X  t2000Y @ @ 0"00P00 Z4^ 2P 0 P 1 P  0@D&10; 0 8 Z P5 0S0 l .NP@@ 0  Z PU00SP NPP 0 P 0 00 00010  -PP 0@poZ]h0P@@  0_ 8XN0P0yXZ ZTY6LZZ]ܥZZ -LP`000iM  @0`|;X nR0 00P;000 #QXPMv30Pb -x0tp00lL @`0PPD0D05 @$>0000ZXZZZ 0-@LP M ,dM@P 0h  Zpb0PR000AS ܥ 0-PLM0( 0 , i AF/$ 0 0 R<  u 0S41  b/d@PA, R  (>. CpB K041,Q/#( 0 0% P H0 0. >$0 P0R@@!Q0  0S UC h0  .`$0@ Q 00ZZbZd9bbb -0LM  00  P,0 0P, K  0 .\? R>0 R@ 00 0;0  0S O@P 0 @ 0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥I H H G F 0-S 08 KpP<0S! WN= P @0SP  YQ  :P3X W 0S 08C80CS4lQ M ,P K M M M LM N N N `O O O `O lH L L P S Q \R < R  ,>pWw 000 00 S<  0S0 00|,0-000S 0  P 0S!N< R0(Kxpy; R 0@H  (X[M @+\0KS C\K003SWr\+BmPh 0Se 8;Ra0 [0 R  0H0 R 0 RK-CP0: S`0Sz M0 Rt: @@d:  A4 0 29# R& 40 R" W [P .@40 R @440 0\9 0@40 @Rt ;40 R| 40i x0 O0 0 R  C0  * (\0K GS@O 0X XH (8XX@@O 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  y6Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5K@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @I000 00 0S C0 A0 0  @{00 0 4 00 0 @Y4 !K++04 '0Sx|@4`UYYPP 0S0SLS 0 0P0  @nN0  8 Kwp2 @P@"0S 0SH,R{0 @% 0 @ @`K1@PVTBP<0P0PT ?8K @1 00 07 0 0g+4KR\0K ,!^Q 806*R+P+0 00 60 0  -0  @@0 0< 0< 0 0 P0 0=PPH|PJZZXZ xYbabYL $[YPhbcbd9cb B b pA `c@lc,Z4ZTYM\cܥpc@c0@ 0 Rd 4@80[ R`  `0`SQhTXX0SPPlTNXX PTAX0S P00V00SP 0DQU000 t0@ 0 0 0  0 S00P0#S\@8@K0T @V0 y0 40 RH 0T40 40 ,V0 e0 40 R48K ()e*'M LP -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- o/PpP(_1pP pU H  8 R=0H0 (01@PTs H0`< <0SX 0S <0S <0  xY<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 <00 R   0GXD R I p Q0SO 0 47@# R WDS5W4 V<@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <X 7U7 D 0@pW Q0SPU <0S < 00CSY<^ ] ] \] ] ] \] 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00@P 850$<<#04 <00< 0< S T(  @0,(KV7. XH XLD <0 `<0 R <0K 08 ~0,0 < 0@<0 R <0 0*Pq F P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /ʺP  ( 0,0 H< 02Ģ@X`D@ B\ @0vŸ<0  @  0`, s] ,p n04M  b l2 , d XM 0,0 ]'g(<0@'K0 ; 0,0 K0`H0 <@ K<0 RS <0J 0' ~0,0 7<0  < 000<<0 ]I< 00<0@  L1@ H@ 00 0P01@0 0S @F Fy <}V<0 Sk`   0,0 , d0 'XZ L |u ZY@YPhbfZZTd`d4d$[b 6cxYdc[h]xcc" 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00ҹp3P000QP ^ K K  L0S0K\ K00r 0S. 00 0  0p0C 0 0S q q Q p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   M0e@e$e 0-L M,P0@4K4 0@ (00K00H6-D0D 0lCQ  /10 00ZPZH6 - @L.00@6 -L 6PХ -LMP@- ḵP00PT"QaA0 10Q*(K90100CQ*00 0!  BR 0P!` pP4 ) P 0@0CpP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PK ឵0  0`$0LZ@6[ZPZD6T6 -RLM@PB `0S  U@PER8u u u u u |u 0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @-,0  ``  ZPZLZ -ML3M 3R, , 0R(Kh#00`#`LPTP H,I*P-u@PsT 0؂P  0@P0Sp` 0S0SZfJp J@ @0S00P :Sx py hy `y Xy Hx P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!6- P$ cP@f @d T/ n7*5*P[@t000^@0 J0_ 0%9-P 3IKAP$$400Q+P8BXZiP6T6LeL6LZ @6D6[[XeO -<@L0S (0}/ }啶0 @ PZ[LZZ p-0L R PP P l`PdphpL0@D@@880( ,0 B @@P6L6@6T6D6LZPZZ -`PLl0V ``p0`C!VQA8 Y0`0Qe @F[ZPZLZ 0-L L0L@P P 0dCPB00P0PZZ -LMQ@,0 ``pᕳ PhEQT00?@AP*Z:a@ 即P X@0fPZ :,0S WP 0hCZPZ -D0D 0 LS:PS0C  0ZPZ`e p-LMPK`@+P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x xT6ZPZe`ete -$!$A0LS`: q Q0 R 0B0 !00C0 V pP yP@ 00 R0 plP@f!@0 ,TP 00DPZZT6ԥLZ|Z -:LM$ `R pp p p p I)M'pV 00@CS0 0 0 0 0 0 0 0 0 0 ( t d < PPHx(&p0XA P YW pW 0S㰀 Q Z0S0S  @TK X  7  000 , q004 080 pP ^00S  8  bRڷ$P@ ᳯ ᯯ0 PpằP `g 0 .8KQ}yu(K6 3^ # Z 000   ᡱ$6@  q+ pPW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A|1@y1@ PP0 d k1Q00`Z  X 3R-h|dp`d\^ 00S 0Y   ZJ =㫰P 3P(00c  Z  `0P3F/P`U RoZ00 @  $10S00@Z  X 3Ro2pZ H IBWPbPP 03PP K mP`0T20 (0,0 00@ `4 8  1P08 @d\400c00b S8KV#8 @` RP _Y   aZ  @0@ 2004`#4`$@@ 41I80`@ cR8K#P@ 4, `²>q@~f@ gb40(([@ XZZenZfeetlTT6ZX U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  }(KU<0@  o0$0!,ZX`6hOpc 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0`6[XZTZhhhh -LM`00Ȃ000pSp Q  Q2 R  5P 0@`00@ 00|70@00 00/ 00 R 2 R 0S QZ 1QP̑b 0SX 1P 0S3 !f 0S0;00< S 0S, h,0\ 0P@ 0S 0S $!%/% 0S 0S U 0S0  'lPP 20 I7x0墶P0p;00D 00 lP@lT9 00XZZZ6D6laDY4YY(]i -L M0K pxH,KPP  RI Wx8@T `0S0C00$3`\# @Tz$V @HW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  (K @[@ 0SȵPW`A00 R ܑVQPY  ͠8 1@0 t- pP0 -  㯠0@ pPP80  @  ✠,0!@"$k괐D /0S0n  &x 0S T0P@w_8 0L,ZܥHiPhX6h6i(iD6i@iLiOpclapi -LM$`K@p( LPTP  KP0 0S$ @ 6T0d0K0P 0 P 0S 0S @ @  R@ $0!o@,Z[i`6Opc 0-LMPK x0P h  }@8008, @ ן8,Zd6iii p-8@LTP` `@T P @P`Tp -LM$pK` P嬟 K@P'  R 0S P @ 㗟KP{7 \@UUb  { 0! @,ZpcO0800 R <0S0 x6[ -LM@K 8R40 R 000 E,Zd6 -LM0  Pi@(K,K ,-(%`V00 0 0000S D0S $p0``0$00U:PP@0#SuTs 4@ Rnᴳ|PP@@T zd$0S Q  c44 R  4Z0$(33 ~T<Z @  ͞#pW00| 3P \5 0S0 R  + 0@ 0$@,00@D34(  , 0"0002@8`p`{   ㉞,A. @嬨`T2   | @ 0p00% o(" 0S DD H&8@T $(A&@T  *#!@}1 ,ttp}!#@l Z E 5X!0S = @!0S 1d`1@!@ 1@ @@:B3 0I$HR 0S 2 2_0@P  l @` PD@D 1T,Z6d6\6ZXZ6D6`6[@Y4j@jLZ4ZY|jljjXjp6`jh]]HO(] -RLQ5 0S^ܢ܂P0Br `D@D 1T0rS Bb0S PxP d2 00U P@ P8m&h 0 "S Br `D0@D2 T 0S m\9! |1Aq `D@D q1T 0SdP90Sh1 R80P0Hj00aP @20S#  I10R n\ P15 GP00l&5 <00P`5x 000x4T &P00KXZ6DO(]TZ6إlahak_jjjj -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TP{ 0R 0S㝱 0SP 0S 0 R0Q`0  hT@QH0u P p ``6[XZTZإD p-LMxa0S'0@KP $KP P $P T M0$aS 1 R AP#0eP&R8Kp@P QTPPI14 _A)4h WP8 4H NP/4$ E6إTZDla`k 0R, SK 0 , b  nR,,PL 0 R Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0   f@ZXZPYZYܥZtZ([Z p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p6Z6 - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `w3$KZZ6 -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 凞101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKp V4   p t P | 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKhPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0S 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  .P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`T0FXbSB(@T0"0PQA  `-T0S   x#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⵚO 00 p0W S WV奚(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;itPZ|YYYi([ZZXZP00S00 &P Z00 0|P0@00 000 0 傘7E`KPs 00p0S @1 cRKp00  0pSP(YA0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dTb00( 0C p( B`0 ! 0S    0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRKL`@`P P\P0S TT @ UC 1 cRK+@P@8  P\P P0S0P0 P U 1` cRK @`P; R P\P+ 0S00%(P( D  K0pPC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH   PP1 " h=R }R(d= |0(00 00 < ^0`!8000C02 S " :2,,tx  KP"  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,06 -LlM℁P`U @Th P~H{080 `PG K:ՓpP000T\S/% `%œ@PPD0 R ㊖00@`P P0: S 0@ 0@0W0P `?㟓@P 00d0K 0@0W0P$K6LZXZ 0-LlMP@PPpd 0T  KP 0@ 0@K00: ST0K 0@6LZ p-LlMB  | P@@PPR@ X1PUC P K`P0: S 0@ 0@PUKp@ <0 XK  0XKS `0S& * @,0SBa)XK0S0SD+P 00Pd0S666fdl|\l6 0-@PL 4P@T  0R@T0[ -$0L@T @TZ p-t`LPU R @0@8C8S @TO0 0PU 00pZ -(@L0 01h\Z -laLPp0S  0R:0 R @@ T 0Q A@+ T 0S 0S Ws 00h `V0 R 0 xP0@CTT WR%HPꎟ@0 P42 ZYXZxYTZ(] -P`LpGP@pP⿔ P00 Q @Z P-@L 0 RP0S 02n T000eИPPh0 R \0 RH 000 <ܦ -pPLDM䀟00PQ0S$ @ $ 0R) Kq`nT@P0e@@Td`K Ѹ p3 0 0Š`iZ4P 0-LM@P K0S  P00Q0Sp008 0-LP@P0Z p-`PPLP @ᆊ Pup 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0+iHPXZZKD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<66HPoXZ4eosto|oX+ XT! o 0-@QLP╈0 00h0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@c P0 bR,@ )80S<0(K40@ cR4P@4 4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , 0@ cRP@  0 S/R/00Pܥ -MLM0 c1\, @ TPA @/T@/T T9 /㊄P `eP V9 V:  @/00 0 0  cR@B^K pPE⚂PEp P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/S0Sፄ`ipQ -LM@~0     00 K 0  fP 0Q/0000 `KZ -`PL@$ SP0Up T t0T l0h耆LpP PĆ T0@P@ZZܥZLZ 0- L @ 0  0 0S[ :Q0 a/ 0ԑ0 0 P0  00h t @$0 0 q -`L p 0SL;z ( S , 0P@aT#T PP@`0S[` k`  0Q$ 0% ` 009 0~`j`0i `0` P000 0= S,  @0  d0d`0 0 `$004q -P L`pM WP@T 0P Wd@ 0 0 dX`0 WXDp X0Q@ @`Td#T! 3P`@`e0S#0 ;0\ 00$ \WL ~X ΀ 0 0h0 0Hq\q 0-@PLP  0h0 p-LM @`, v  0`KS' PK+ ܏P P0S  ;00`$0x R 0 B `0xT$H $0`0p`  tqq -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSLD C C D C C C C C C \D DD C ,D D C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C 0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T )A0G0S 0LP pc0G\L S HI E I I I I E I I I I I E E I I I I E I I E L p L L0;@L0 \\ `d0GSHF I I I I HF I I I I I H (H I I I I hF I I (H V0X0 Pu`X ,Kh  0d -d0l 0d 娃 P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d Xdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d di([Qoqq --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  q - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0q - L@ R 0 B 0,p Rq -P L@3 T6 pD `Q!   AP 00a0S@@ |pW   0Xd0P0 `\p Q V`KT`r -P Lp! X `$R9p R V@@ | 0`d d0Vp0 V f4X ` 0;r,r 0-0L@P 0P  0000   ,嵀00 0- 0LS@P >P P 0P 0P 0 0- 0LS@P'P 9PP0  0,倀0,{0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE{k(}0lo@Z@r --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0LL@K0 0 0 2P4KpXr -pl`LP@)# T P (0V0W< `0``0$     \d T NP PPp P PPpPprxr -l`LPp@% T9 V`+0 0,0$ (` p ` P   PPP P PPH[P 0\00@0Zr -@`L#0p00 0,0< (0P z@P T00ӧ2 0 o3Q00 㳨ժX@,"Z@- 00,7Z0  ,7 -<0@L 4  @     Z p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@[X0T0@` DA A000 0@@P4787ZܥZ -RL0pS@3Q0@A00T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ~A000 0@@P41P``(P``Q 1{`p`3)P``0  0{`p`3TEP0  0BS Q` L M`P H040R@0@ `w4787|YZZRhR|RRR -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  /P 0  QP 0x  X\ 0KT  0p @|= @0@40 8 < |ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@Tz`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA @z&A0P@0`P||P T1@@ f %z)]%0S d0S  O\Q\ hp p0\p Sx5 J ED5@f DA yA`P 5 %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $y  0 0 4 3  PwU*00Pp3@f DA yAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA LyA@p`@ 00Uap0P_vP|t, <80 0c0SX2 R40\?*(00< f d P;PppT;p f yd OU8h1@` DA xA @4@ @8 < ,8(1@` DA xA @4@ @8 < 80 @` DA xA @4@ 8 < 0@f DA xA`P)P806`t w0UuP} uPx |uPLrZ4787 xY X X ] ZX"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ l7tH([ (0 R00PP0XZ P-L@ 0 p-D`L0@ PR  a+ e 00b 0p7 p-@QLP! R `0 Q 0Q 0  + 000pT`  0Spp0 a+ 00 07 0-hPL@T\@D P0R  P 0,0 0S0C00004H7?7 0 0  U+7PH 0-4@4P0L H+0 0 07HP `,0R- 00+G7?P0 0ࢿdH`HZ -pPLP@`0e R0@0Q~0U0C0P 00 0b@A~0U00P 8~8 0U00.~0U00PXH\H -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  F}000PU@08 0S  +@R<@ P0S | 0 $}0@0004S  , 00c0(KP @>@H7hHxHlHXZ\HXH|H -`0` \0@L \T | |$0$  0 xHtHlH\HXH|H -,@L0S V_0000LHLZ -L|hT} 0- P@L?_0h;_LZ -L0L @R TT^|@@$h| |@XZtw 0-@P LZ 0 00h p-X`@L;_P7_ Z0 0 pLZ -LM@Pa0SW P 00|q$K(K0 @,K @w`PJ (1 ($9 $0V0 P,0AP|\ wP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P`77( @H4H8HDHH -L MK0 K @KK @qw@P {|xK -L$M@PPb0S S P 00吢U0 ,K0K4K8@K @[tp@0 P0C 0 ' D0 P[L$0P埬@H7լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0XP.X  U  U0  c> B > . >.@@LEvQ4  P 00 S 8v@t) R ] 0S 0S 0S# RPH \  L 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  "P< 0S P"0S S S00j000S 00LPm0 x  T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t }t {tu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@NT t t ttH0 SD Q  6D 0 0 (Kt&0SLƟ00*Ɵ0 ( 0A00ct P$Is\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTd`  p   b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  aU 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c 00 0;HH? X|S 0R KS| izzw -LGMđ0Pp,0 g 0S@`KS@' ,S0 0,SSBKHH j ,> 0/FpP; IKAfp: ~|41` V,0@SV1S   Q RQ\ ^00\0S l|`, 0R(KD| 8q~S~ $k~|iX{8{{${zw p-L M`P 0(0P`0,P 4@0 0 0 L400 PPKp{xt{4z p-0St0``QLP @3!   @~@Q0S pQ{i{ -LMMMNnK`F0`F@/㸀K,0 prO[K mO"K hO dO Ka=!0,2 0 (2 $ UPP6NK@  0= 0 8ONK@D0@D ,2 ( $B t t U@ 1O -O  )OT NK@x(, 0R(K}ip(B¨{t{{x p-LM`0.^K@/0 Oh0 ,K <P0 HUPKH 0RKpy}ibp'B¼{x -MLMD0PQ,0 p H  'GP +N |CTPJ cT zT0UCTUCKHH/N2"2CT(K! W`` 0( K@V0@  1 吡 W00 S[K=00 'U@ Ntg  A, 0Rb(K0[K PK`uN qN10 x1 pQ |a T@PJt1S* 0 |1 x! pq  0ZDp@8 JKAA}p6 |@4[K 1 >N0 D1 0Ch! |A x1 @! lA pq 0  *NPz||Jzt|phBz`| T|| @|i|tbp&BX|{{ |h|$x4|P|{${ -LWM 0`(0 pXpP* OK/M ,` xT@P"YnKK`F./M0$K0 ᳀ r cTP7|( 0R $KD, I| 40y(A|$yix|BbB$B¤||4x -ML M/NK0 /`q(0 M0 2 )T@P0K00S$^^KPE PE2KMP 00@S,yM0x 5 @C TP V( 0R$K({$&{ibp B"Bø|@x| p-LM@a0_K@/0 FM !0d0C Sx  h  h h h h h h h h h  h    Sy0$0 0 SP-Kr0gS 0R|| 0RKp0$0 0$0 0$0 0$0 ({$ib|p#Bl`U||Tx -\LM0OK /,0 L4&4Ɵ0 (3 vS@P 0Sw ş, 0Rv(K;K!0SjKA AI  I , L%ş0e6 9u4 (K0P)|0PGS@PO)R KLP9S (K06PK8C8sj@K 6K %YL( K0S3S4 , $    dQt $4QppA?KK $:L3s s 4 R K Kj>C^ c^ KP6KjK 0K@K p>3S b'}KpGpG`/HL#09 9 g 7 RP7S       p G 3CSL GW`3 Rt  K >L#(KH0( K<#(KFK(#K6[SW V@K :6[SI PK 9 0KχKݺ2 RK3`S)0 S) "儢 7K p"K3CS GWK@H"H2K@<840,b=a;b9b7b5a3PK 9V@K 90K@!PlKT  0P儺OK0K0@!PYKC^+p 0KKjKX!MKPPPP!P1g 3S0C9 $  0KKK6KjKR3S9 yyy ibp B(*"B8}\}}}}b}!B \~~bP}@~H~P~8~,~}$~l}d}}t}p~h~}~}D}0}}} }(}}~||`x -L`M0xpKP `(0 9:@KP @@.P8KP @|K< |\ ( 0 R$K|K< m|\< b|i~hx -MLM 0/KA A ,0 + POKℂ/J;lr 3K; TK00 PQP2Sd St ZNK@D@D/J0 5 C0@3S3& # # # # & # # # # # # & & # d& # # # # # # # # # # # # # # H& & % % # # # % % # p% P% # # # <% 0% $ $ # $ $ $4p$0cP1 @ P`T ?K P?tp0 Q"#U U U U0 @ 0@0 0@0 Iu4 {#0 @P`0# 2 q3 m1 K@"3R_ 0%u Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ C2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /x, 0RB(KbV=  SV08LcSp= 8..K0@ N@P2K1" 0`V V"h 0@0 P #U]tZt|WttTtl0 D0Ot\4 viȬp b+|xĀbbtx|Bbx4 | -LP -0L fidH -L M@PmO!ὒp1` fRp0`S.S0C  " P5 A1!O @_@P 0GP (KQ0`S.Sp0C  .S W000 4K4` 0p , [P m00CV꘠@0@* ?Tᚐ)Ac 0TPS0C Px0T0Ct0PS0 C RY  þ( ȬgfffE 0-,@,PL(  dil -LM  QP: K -p* 0#4 BP; K p 0#4 `[KUPspsd@dd d0墵TsO @,8 ,0唵ЁāTVx]$ -L$Mp L QPP= -QPv 7PD H 5b e0S㨂 <@P *ڀ2WTT p gs PY&u $u(KT000>P@Rs@LLskD H huH0SS %PKZ00X ᏑP8(40!Ϡ @0`,`?AlN3c @K@@ Q !Q0 0l0 \0 0XPCP <0 e 0,0 00 0 0 0ccb4 0-\PL0S S0@ S 00@0)cb -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPa0P Sv` .`P V?K嘆P 4P=@hF@( 0R$KP.@JOK I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯A A A t? t? t? t? t? t? t? t? XA A @ O `dOPpp`VOpPp`IOPpp`;O`/Oppp3`" Kc p-L|`P0S @PP 0PS pc p-LT`@0S PkP 0@S pwc 0-@PL+TlAPX0H0@ R0S(>:x]cc! -0L idp-0 CR 0R0 SG00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` }@@P,00,0 J9PPm , @0< ,0 0 @@b@P \noXK 3?pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPI40[S  5[0Sl|t ዯ`@L0VU D00S8 W $(K+܃  -0L $id -0LAM @Pp  Bp sPp  8p0` fRAT @SPNKPP W.i@PPnnidȬ$ -@LM `P%@ !@00 Q03*,  0,, pW00P0 U 00 @ep 0 -P02@0P5 :0-P *0@@,0 PdW p脧 0-LXM@P% @\@0P00 lK-럟`00\0P0  :]2K0)cc -LXM@%\@0P00 hK-z\00X0P0  :n82K)cc -Lp`,P3*@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9M R M R R R R R R R R @P LR dR 40S0000 0 0*$(p 0%  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K$,4, ,*K 0$880Si0 0000 0 0:K P$ Z0`<`:KdK G(pM0`04Z@` 0  0Kj P T d K:P @T`P d "p@ d0Kp @T ` 0`*K@yV@ 0SS h8+P 080(x0 0S$k $@`PO dK %,dK<K-.3[0C3K:K3[dKS3dK H. R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[Sm0`$j0V0 0000'0S<0 00S 0SU0000 0T`0 000 00S0T0 0-0 000 000 0(K0` p-PPL^@00*`,(@P L00040P0 ''@*p M -L@M` Pc= _=0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 -+P02@0P5 :*0 $+P $*0 @@00 PdW p0@ TP3 : 0S 0 0@ 0@,0qU dP"(K舧 p-LXMP@`"0 |P0P00 pK*발d00 `0P0 @@ :f@ m/T  00圜@Kp)s,s 0-LXMP@"u P@lK*|`00\ \0P PP :1@8/T (0 g@00SK0)s,s -L@"000  Ph)G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt 8tP@ t ~ 8tPp t 8t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< 7<P@ < n8 7<P8 < 7<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko: 0-PL@ 0#<00#800#400 R0 0h7 -pRLPw D@A1>0O `cWP: 5@1@ T@D SH0 0@H0L@pf.5@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P5@1 0S@D RH0 0@H0L@ \00-PLP 7@0@0D@H0L@0 -RL`? D@A1>?0( @PcXPp: =5@0!0@@0D@e`.5@0!0@@0D@T@00 @@0D@@H@?X X  P5@0!0@@0D@ D00-PLP 6@0@0D@0 -LXMP`@dp 0+PZ0 S 0U 0p xK_$d0 s000Jl00d0 KQ`0 S0$00DS$0 0!$0D -MLM`p# PP' 0V0 BNK@D@D 0PP0 Z P4 W\  9 /6`p  P#$K@s  -L0M`PpP) K.0 P 0S ٕ0"S UD@K 600 KBP(@嬁u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*KK0C*K8K8R-K( B( C:KԨبpJ( A((0B8 8PC 0 SdTKpPh rS-@L`P"@3:@p 0P@5@3p 0-@LP 00>,@r.0 > 0hsXP0, 0-@LP 00>,@r.0 > 0hXP0, p-LM 0`|>0tr.@l>PX>\00SgP  0`P@>KpXP0,T 0- 00@R@ @0hb>tp 0-0@LPW> 0 0PQ>0p p-LM⡐`  0nxPP  `0cP@ 0` 4P0S( ~ 000x蜈tl -LMT@Pp ( K0 PE$0(SA`@P0S0P0S0 @K  G CP0P@S0P0S0 P0S0$P0S0 (((0$ 0cR00  Kt -LM, `p=00S`P` 05@KVP300K ,PK50K0 0 @KP@@ < yX0PP`U4@0PY`=v3(Kptx -LMK@$@, ;P@ Kx -LM`=00SP x@K0 00 200K娻 H KD+@0 @ +P,@@ ?=Kptx -L0Mp, `)=00SP`' 0Vἀ,K,0PP@1@#TPK 10T0K@h  4K04P 0@ P`T0PU8@0P0S`<v3(Kptx -LMK@$@, ;P@ Kx000 0 000ᄋ -LnQS(0  hH00 -0LM0@` @0s 0P$pK L$ P00R0SP :R Ur 000RPU$ @t 0-LP@P 0 S Sp00@ r 0R <P  0豎000tn -L0P贎 -MLM3PP"0, 00S S0B,0 , 0R-,0(K0  CCP  .@PRnK`F`FKK,KPe00(K踈` -ML MpPP#1, 00S S0B,0 , 0R,,0(K0   C CbP ^@PBnK`F `F2K,KNP 00(K踈` -LM@`p@P0 P@ Pp-K茧Ĉ -LhMP`p@2  0 P0 S 0  0xKd0 s׍l00d0 K -LPpa`@P d000S@  S@ @p080400<0 0\0B謒 -LM@A0p8`PDH 0P' A0S#XPU H 0-0KR0,0KI00SR I0P P,KazP0,K j- -K-K -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 SP D h D D D D D D D D  $ 40P0 P 0000 SL0SRL0S 000 00S0  .V S:V` 00FV08 KPw40p@P  `p 8K pP@L뀋0 00kp 0x (00?0bS fS0S4 0R  0 :K(45<*K 0880S 0RPX:K P(t 0S<`:K(05`P0`0*K84pL*KpK )p/0`0>:K8S@ p K%P@pH KP TpH KPHK 6P`P l p@p0Kp @ T HK 3p`*K@QV@P`0S 8P 080(pw0 0S$0P04 $`B@P  pKpKHKnK`F4[0C4K4[pKS:K"r_*KpK:K8"`VR0S SL- S SG6Z:K %<*KP8*K$"2Z0*K}P**K Gp#:K ZY:K 6*K Z Y :K (*K p 4[0C4K4[S@$ T>0 000090S <L sp`+0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0'`(K` -L@`pP 0I@{ -`PL@ىP00mpPP d0T04@0 T0L0`P0 VSPpx   -LMB^KM`PE@p x0OP 0 @j@P <00+PP<4p8?@ K -L@P 0@0B -LMBKMH@`Hp 0 S񟗶  l 0D00W0 pS048 oP@ 00 00(S 000,@P. @p0S( 0S%$ 00D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p6P 0@, -0-LPM@a?KC/_K@0 Q Q (06Kp@ `@ /),0 pK\ L0 ,P l  K0 -L1M`0pPKA4 8 0 p 1S01 R rP 8 00000C00S3P0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qq OQf XQj LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ LlQ1tQ6 qQ1 sQ xQD zQ. uQ=PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C @0 w 0# t@K0lKl"K60^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP8"K @0 2  0p0p@  0p p @p p 0Oq '000 @ 003  P0S P0S P  00CS0P0 r T000U񟗶D Ь X  PT0*0PdP # 0hP P 0zP 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SP Ti (K001SSPTd 43p043 HX @ 0@ B0T0  RP 0 r U000 'P@ 0C00X0  0ScP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUɥUXPxPPE¥ ;-0 80#80#   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000wPX   _K@PEtLT-xePEP Bx?;0 8I0p@ 8a0p8%0p4# 4# 8S 0e4P4 4(Kt -DpL0`S@Ps 0@Ss蔻 -L M0`ჀpBX?0S 0@P03Lp @ d0P0!Lp@  '_@  b%$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A P<70  c`<7 p, 0R<000`< & 00 0d P`V U00D< 0DO/K<' D %2 <>&B aP`< <'O?KPbdU87L7 Z 0K⠡K)0KL7 < P)0[Lp'PS*0[H H SHH  t' ,h7H@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,hH'@bTT`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKL7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKmPKp <!` \0 0dQ,ާd `'R80S\:000`  \0R0\0 ` xdKDPK87Sp 00d`  \0R0\0 ` xdK+PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK8808 a<0<'XG0bT@T` \0 R0\0 ` xdKP[KX? @cTkP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.K<8X'P< p7 00d`  \0R0\0 ` xdKPK<0<8G0`T@T` \0 R0\0 ` xdKPK8?@cTlmPʡ(` \0 R0\0 ` xdKhPK@DT0`@` \0 0R\0 ` ҂{8'Rp7U <d01K01K>K000` \0 R0\0 ` PxdK9PPK<T'0B0` \0 0R\0 ` PxdK$PPK87T@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P <00`  \0R0\0 ` PxdKPbPKXK\` \0 R0\0 ` xdKPOKp'* h7H@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP H'hl1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdKP0`0 x'0@0l7 yp 00lw PY ĥ@P 0KP DT8 Ml(K谧 -DpL0`S@P5h f0@S/h蔻QRP000S0 -LV`P\' @ 0S\00R001S @  T0p@ 0\ (T0Wp@d 000X7'T00S <0@@ \ 0 07<) -LMGPPX 00z`10>CNKTa@D @D 0P3KHH k p* T0S \PT3 4`K XpxgK0D@K0@3[<3K03K\ Tl  (0!"(80S *y00 @3[P3<8 P@<0X0P(K  0- L@RpP  Ep  |Ep  @p x0$S x@GxP@0 p-`PLU@`cP`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@P2[  xW0 02["[[AmK0`F@`FT@D,Pd 00S  rx00 K -L0MP`XKphw0S&P l0`d 0Cpc@ pUw0SPNw600 l d0 0Rl jvp ?w=w@E9w0@05w0SZ 1w0 S-w00RL 0,1\ Yd0(0`0$0` D0 0 0A R  0$ (0 7H0S H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p (K -L@`paP 0F@W -BMLMp`MPP& 0 0<@K*00  X`\`TpmK`F,K`00S v00 2[34[<03[80(P@ <P K .S 0S0( <0R0(0 -LM`Kp&@P0S@PUP踰 -L M `p6P2B@P/P+ PP&, 00S S0L,0 ,0P4*P 0 SP ,K4K @@P {``(K\` -LMp`P(K &@PL( 00S S0B(0 (0# P @d -0LStpPB`. T@! 0PU`pPE@TU E000 L -PQL`p@P gP) 00S.S%_P 00S.S 0.S PP*L P *  P*h;L -p LP G`@CTP@@< T`h6`P@ P00CS0 -@PL @@ 0"@T 00h -Lt P =00D00H00L0(0 P00T00X00 \0 h 0-@PLP  P 0000000 000 0-MLM0P S ANK@D@D @0CP @AP000K0 -LcMXK M`\ , $@P X&KeK @ (K00C0eK S@(K0eKXK@ 0CYP X@`$PPBT0S ZT 0[SOK,]P P0:S 5P 30K F00S8#X VOKTp W1[S S04%40T0VK1`X![T00T0DPZ 0ST P\Vp 7p@P @ TP Wpy<X KQ0P @ P0b @ `P 0f@< p W8t<@Tp PP@P U@ @ X0K@ TWuP*Z00Z0SP IXKAPeP p`P= U`@PX KUPDP@ U$!0@0' EPXPKp @=P000  P , 0,K o,0SpP W0SX[T@V AP`*(KXtx̮t9`so p-LM`?P0:0/mPP JK@D***|* P11;dSPP JK@D*L*$* P11k;Kp訉̉ 0-LMP^<0SY T0ST 0S OK-P.Ph 0S @ .@P@ P TK0ԉ -AML8M0`SZ (K+8pU (@K0 PQP F @PK⤖p?  h0R d0R7 pP4 h0K@P# A K@08@ m0P0S020# p3PP6u A=K0C80C  kp9"PPpK` p-!L0@S00K `PP6 T>P~@P@0P!SMP 8p 'P i0S:P T%p  ?=PPpħ<  0-@PL\\0  0PS@T02 0000 -0L@S4 (p@TP 00  `P@@P<8P0 PP0P4P|P `Ph p-LP@q`P@ q`p -LMpPq`(K0 S00( 2K 9pq0S @P q` K0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<5(K8 -QL MPp` Q QiPc  a$ KPZ@ I$00@PP%jP @PF  f008 KP :8 KP0@  80K@ X 80[S70[0SS 70[0S SP @0(KP v(0S K p- `LV@P p 0P*(0 0p000p褊 -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX$H %X P p- `@VLP p0lS*(0 0py000pG - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0pSU 4 0 4 \ 1,0 5P1)::0S 40P3 0T U.*X104 PU%0F>S-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K谊 -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0SG ؊ 0-< LP@ P0 -0L.S@P#P*QR00)3P00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM008 ,0 0s ,0 S P R P u@0+S  -S00  ` Pp4 0 !R ZZZ Z5< I$`V^n"0I405<A$  4 0  0L.\  0 S00S< P 4 0O0S "4S 4P 0` `0` \8@4 K  V d1d0@0\ 0 R \Ap ,P0 n00<110 05`p1J W  0Vd9#Zp `p X 00045# 80 @Tm00 (Kth8 -?@p##pWL MX8 0O?   BE!5;t l@کm"0 01`V#U!42T1,0  4 0   04 0  0 T 14K1  4 0 @T0 4 00 0,0 4 20|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ 8| 3, 0r03Z cY 0zdyVUZ00@@l ,@ 08X   D , 084 `  (K@8DL p-H8`LP@Pp0Sp -LP@ R@00 00 -@L};p- 000s00 (p-"XL`  p@pp -LM   Pl@"00S0  @0  !K00 @P K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 p-LM ` Ƞ,H@PP  p 00nxx -1L`PV@7  0pA("S*)l"0 0(Q% 00P  000 `0 P*@` <$0@0    ? - 2L k0S k0#S 50 !S0S0` 0C# @U  000PP P6:@` T0L 00P00 R p LX0 Q dp  PpWU? ,0 dSf(Ki ȧ \ 0-@LP0  (0P0CPl00@000 $0 R00c 0 0 00000000 -@Lh 0- R00 0P0Lp@900C00h -L@0S - L`@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK  P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  Up@ j0S j07Sj#00Pj@ U p -900 0 SvKih -LJKM@DP* `  V@  0`000 0b0QzKpG p@ Qj0S Mj07S Hj#0 0 PAj @7 K 0- 0PQL@,j 0 0,P0 0 0 0 0-0 0SL@Pp00  0 p-0P 0SL@`p 0 {000p p- L`0PP PeP@P0 `0`p Q-L@*P T@ -L M`p<0 i 1! /8 P +@,WP@& +p@ 4PK  ,0 0,0 Z,00,0 ,1040 0@ LpP!8}i@Yt2vi0S. a8 0p]  P*@^i?00tYi0S8`l d0pE  P*8w@Fi?00< R00(K`Ďxwd \ -LpM`10@W,0   @Kl@PK rrp@K@ F  `P060#0P@U@Kk gr  cr r (  P0\0#0P@U@Kk Jr  Fr r0, 0R ї(Ki -L\M` @ V^PP, p t x a 0Cs^0l0 =PX  < hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl A 4AhKA@KA ,0 S P(Ki -L@kP p :::T6at -0LMM0 ,0 XPPWoKJ%T1[S   @P UKG,MKC RV0 d .㩋Pp 6 ,0 S(Ki -LAM0 , 4$ 84 `@ Pg?0004A<pP 0OAP g0Sdd!0U48$4PD g0S@ 40B^KPE@DPE 8(0K@tD^P?p%0 U%@P P 0+4J Pghpl 0U04$84!aP] ,0 S0n(Ki$LlJЋ -LM8 < Pg `,pKV4 D0 S `PT 4 40@#P0S> 4 PP8 $ P@ @P8 00S0 KP 0 R ;;S @P"0 JU8wP 0l Q<  0 4K'@PV a$@(K`n\8<He4RA Q:0S  -LŸMS 00 8 `0 40 < @ Y0,K00<PPU ,00SQ@00 S  P80eS\,0 @,00T:, R 00S S0B,0 ,4 QR 0E 40R P,00C,0 ,8pqp3\pW  @P8A8@ Q , ,08@  pX00V00S< 8 R9 P4 08pP@"0B 0S S 0S 0S4  S0 S S 4S S R`00 0S 008@ R8(KN -aMLM20$0 pP" ;p` ]KPE[NK@D 3+0 0K 0 E 5 U\e pT4cK╉PXGk06: S  S [NK@D+  K@@P[NK@Dp1l!v 0K@@X@9@UTSaD[NK@D`Pe0S \ K0UC`PX% y2!n/K_ PX[KAm204-4 K2SPX [KhAR\00S $0 S4j Kixwd \\edAԌ`T -LM  K K0K P K 0-L@PPP0.S 0a C00C0  SRQ00 -LM  K K0K P K -0LM0`p  $0 5PPKz4PUOK N> SKJ>,KKF>J4S.P_K33 $0 Sړ Ki p-LM`0`@K KKK`K`PP +0 000KpĒ -0L: _PĒ -$0LM K?`PĒ -ML M⌢0划`,0 0PphspP 0/Sf PlPj BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SHBK@@P 0T $d@PV00SV00S040 t, 0R=(K0P 0+`:ㅗP 0SPBNK@D@D+PP 0S BNK@D@Dt+A`PೱBNK@DD@D04  P: iĒ4T<` `, P-L 3 c@pP 0S %S@ ß V *00SS@f| Tt0%0CMST<$9$9$9$9$9x:$9$9:$9$9$9,;;$9$9$9$9$9$9$9$9$9$94<$9$9$9<$9;$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9;$9$9$9$9;$9$9$9$9;$9$9$9;0PUUwWx 2 Q PP U W1  PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@EȒҒ+D^+gfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7=@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EP++ ,"-L Ÿ  RP`@ 0 0: Q 10m Q 0 0>P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\  pQ @^00P00S PpW00Q n B2`@? T P  |0 ` 0:5 6!ƠP `ᨍ0@-QMP 000SP'0QPE0 01 #U0 @  0" "1<"( 0#! 0#$0#0# # #!,#80 "1 "4 " "0" "1<"(  0#!0#$0#0# # #!,#80 "1 "4 " "0" "1<"(   0#!0#$0#0# # #!,#80 "1 "4 " "0" "1<"(  0#!0#$0#0##$# #<̐!1 0#$0## PEU0 @jD0PE0 #$# #<̐!1 0#$0##UU @ğ 0 0 01R # 4,<4 <<#0QPE <#1:0#U0 @C 0" "1: "(0 !0#+ 0# 0#0# # #! *#8 0 1 "; "0 " "0" "1 :"(0 ! 0#+0# 0#0# # #! *#8 01 "; "0 " "0" "1 :"(0 ! 0#+0# 0#0# # #! *#8 01 "; "0 " "0" "1 :"(0  ! 0#+0# 0#0###$ #8 !0+1 ;!0!! PEUE0PE0 ##$ #8 !0+1 ;!0!!UU H 0PU <#1:0 #0#$,$#, Ѝ0訍 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&x'x )8HR@J*RJ@@bP 8#8R0PE*RPE 0U0D L H0 RLK p(KT`V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HRR[R0:4R005%0\, 0l\9c%x'x )8HR@J*RJ@@b` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`s48#8R`F:@b< h8` q] )8HR@J*RJ@@b^`J 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 3 @ x@ 'x0!8H,0RS@@A@ >:@b  `0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 F(R0@-@P l^0,00 nSBS\N_0 0- L@0@P቗P $0+0&0A -@`p0 0V@TL  0Y@P 0sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < @X%X *)8HX@*X@@h .  8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0 0&@-/@d4xB 02d @-M)Ѝ@4=> 0\ Uꨮ -L 0KM# + -LMK  KuP K -LMK  KhP K -QL M@ K0 0#0  / 0p03T0S00#0K -@@L0MP 0 0 D 03000 K( K P(K0X00+88z$* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP00@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠZP2`P8@KE X`PEKi -PRL@`pP@ m00PPPPPP p- @0PSL`R p0S 00   01 0 0pQ)03 0 00  TTL#*Pllllllmmmm m(m0m8m@mxtplhd`\XTPLHD@<̮t\@ԯpH( #* M0-LM0 0 0@ Pv>K0\Q0@-P0@  % < ^9 qoooooo@q\qxqqqqpoooooooooooooooooop^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@t p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T 0G 000jR -LM8  Bp`4 -PK 0e@YX: p`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 A0eS`40c(K@t!* -@LP /00 p-LlMP@T Ii KpdK[x`P @ <0  0: S TO0 09 P D` -AMLM0唣,0  8x@P |j`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P0DT P 0 P04SBNK@D@D +iD @P PO B^KPE PE  qP 0#S   P@ uP~  @o1P Po BnK`F`F0 `堧0DT`  PZ 0 P葧04SQ%`@P& `:P `4P `.P `(PX `iw@P00, 0R(KT` <墂inL/Dni`qe 0-L@P0PP P0 0-L@P0PP P0 -80L R PP P@- ^ 0S^@0 S 0SS00@0DP0 4 -QLM@<0 zR| P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8w (KR0 0@< PpPp< P@`* p-L`RPP$p@ @ SP T  0RpnR0S p*yy*QQ*vv* 0] 0-PLMK0@P0 K,K @ P 0 dP0@,0 (@ ,*( C ==x*iit* P-L `hP^R00c*::_*))[*$ -0L0M`p4KL K@P4@ 0P (` $p ,0 0 P80S@K@0K 0@@0 <@ 0*DEE+* -LM KPwt@LL* 0-@PL PU0. @ 0l @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P Q@?008 -L M0 0L9 K -LDM\\`, 0 \ bQ/00@, 0R(K^PK2 1PYQQ@(00P0Qp I00A SFs@g P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"P00A S  Z R r@jg P!00@ TQy 00A SPP@00/P@P00 PT@ 0@dK 菤d0S@} P@00x0XSxS r 00 D~ V pp QP. ,q* !000D$  Qx!00ӑhAdPG0W02p0 `VI:00pv ! 1DW`F/Qm Q@Z t 0h1 T!V00h!( 0T 0Q 0S SS 0h1P@@8e4 80$ 0 ḭthذ( -LM 0 <d -LM0  dx @b2b 9̧0̧ + 0-LM4P [[@[0[ P@K08""M*jjI*++E*MMA* -L$Mp0`QP 0 " @@K]0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKADP `~iر -LMX0@K`P$0 p' ۸$ 0R K~i -MLMK@ , l p`PB@F XM 0QLOKHHV !+ spP#  ីV'0OPU``O@ \O@ lh, 0R$(K U rpPHO@ DOW@UVKAp X$U eʷW$%~  iȱ 0-@MPL 00~K0 0-H+LdM0@0 PV`(    Dt< <<(|<<<<<<<<<<<<<<<<|<<<<  <<<<<<<<<<<<<<<<<<X<< <<< << <<<<<<<ĖDDL#K0 @K\ P# 0 00 ,  K0K0Kp  !" ++@K8 P@Kp QLW0 00K K0K$@0 ,@ zp P 0 00 , r.0 00 ,  0 00 , L0 0,P@p K00K0K,  @0P @KpD p! A/0 00 , d z@K P@Kp@ QpQ P: evL @% oL@P X  U S@0 0K$ K0K,  @@pM $@K0{ ?{ 9Spj 4qd 0q , i,  - LMK0 @ @ pK..t* -p-LMP0U0  @ 0 0Q a0k`PU 0  Kp` 0Pd  ,K K$0K@( $@ P, PP 00LiLЧ77+*[['* #**;*; p-LMP4K@1 K70! K,@ Lp`( P  K0 4K(TPP$K@ Z ` KC@v$Kp K 4P$@ MpX 000 P@ 00ӑP 00ӑth0 S000P p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` P0S PUW kfp 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SD ]S5 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S& @ 000 T   R: 0Sk 4 0u 40@^Zq9  0#@TfJP0` t4 ]040 4@ @0}0 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r `ǟ00   r 00  PPg7@T ` P0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<, P  P  000(K0P  000   P`0S  @  e0 `R P @P@ P @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PPP 0!0P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, /*0,S  T R" ^w p0`P  00 2 0 00QP ^V 0 @R4   bB"(Kos 4 %00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S000 0]Sq(P 000   PE v040 1tԧDL p-LM0K KP` 0 ^00K K0C B@0K K#P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@Pt -`RL@PpP  0!000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! B4 0Ap -LP`@p0 S#T TW0 W000S@PPP00000,ܭp000000hg0f0c0  f00   fA  f" 8 B a  h.@0 fw  f#  f"  B a   @pG`@  f0R  fh-@DpG`s&@D`m -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  i R *0Q0\S \) j V1 0H  R@R*0^0\S0)Sn Si3UbKa F\MXVR ;N 0 M J/  0 hb  h   h0V  h@70{S1 `R*0,Sa P 0`@QO* ^C0\S@0}S:= H  (00(000000,0XAo0)SX[  (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C S\VP ){} - LMP,  ` R*@|T T  $0D XSaꤸ̷̷̷ R*000C S  R*@*0D0?TS{T `| R :` VU RZ*0|SW0, 0R1  i00 aC80" 00 P (00(0 ,00,0  R*0D  D D@ T1 0  R*0)S ) T1 0H   R*0)S  x(00(0 00000up 0@ Gg R*00T]\g000C Sc^g+Tj 7*T  R`**0A0?QS{QN0\K000C SG A ` 0  fr  f   f0f  f?T= {T& @Q*0,S p 0s Rd:    000C S|Tp  +T   f0&  f 0  f  f  f/"  B a&  j  G 0  j 00 ,0 0}S00I0}S  \  R:, R (K0  a  i (Koo -0LMS@ `  PPa :RP  0    hP   (KiP00   | @ 0KpK H 0S0\P@40  ( , 0 < @ D P `8H@ K00C 0 0R*K  0R: K8 0A $00S0 00 ) lPP QP: (@#L D0 03 0Q  Rʠ    0S 00B\p0S?0 0S7 Q^`L0>#Re ]R R @0^@@R@P(@c P<@ @\ >3S R 0L00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XwR R RL>310>#R R "R (@@(@0>3S  S S 0>3S )R@(@5\ BK)6KK K 0R:K PP Ee -t0 LR  @T P0R000P#P P<PheE * * * -QL0 M4 0 0R000(K00* 4kPP- 0 P0S p`@P `@ |P$ pW21C0 R4Q  000W |=PP(KY  0W0021C0 R 4 R 4 0W00P p- LPy@P` x`P T,03040S000 R   R0 \00pT * * * -LMpx~`P 0SLXQ0LL!PP00P00@$K(K BP (0 RP@Pʐ T-LP0SMR kR mR gRPAx-GR KR R P-L(P8PK,PFꜹZܹ DwE-p0 @  R`&@P0 L 0@B?AsP00 R00S 0/S9ST00T0S@gfff -LP( <3aL1aa Q -LMPR, `VP `ZpA  P p WVP,0p -SL M` -=M =  , Q qT ͟0 N ,P0s 0 00  P,P r`QX=qHM <=4-0S0v>C 0C0 M000! 0v^ PW ,3`20!0UԌW 0S p ` 0 K 0 0, %Q`p ,P0S,P (KWp%0AUS@ $Hp @p@Tpp@<HHHd,~ʟP,P ~ 00 +0N, /StWU,P0p  1 0@Qp ᱕P AGp ᧕P Q0 4W2,P0p   !0h@.p ᎕P 8@$p ᄕP Q0  ,K0K8'P 0 t8v.BhH B 000 ,K;0PW,00 xPP,  ,K =0P}W,0 ,K0K50Pn,K0K 50Pf0|, W,l0,P P,P 000C SO,K 0PF,K 0P<W,0Wp  ,K0Kc0P 0010!h00 ,K 0Pz 04FC000Wp,P r ƟP,P r 00 W]%@^,P ὔP%0 SM Pp,P WG,0SA,K0K 0XP: 0d5(E B`10`c000 ),K0AP# D0000ğ, ' ,Kc0-P,K0K c0%PW,K 4P 0@DC000WB WI 0 ,,K  0P C000w겹,@ P~P ,P k#2`10!0U 1 V R`c Q P,#? 2c10!0 c;Q0 0 0A0MS, ,P0TS,P DQd00a 0C\0  1 0\00 00g, P@0@K0pp",P p0P,0 ,P"pPq 0 0Xe A0P00,P Z[ A0P00,P 00K!P00 00 0P,P 0 Q,P!000 A RPPx:Q0,P @-p ፓP 0 S S 0P0,P f@Ec{EA!/0C!b10bcd0 B!a10b cR0 0,0L CA0C0  RSP,P lxpttQ8'ĺ$Inph$|0_t*p*l*((h*G-Q M 0ࠑ@90PP@e1A 00 q$b%(?P @RJ: 02!!b?P J$0  ^0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ -LPp@Q qP l2  0=QV PbP TWAQ@T W"@W @W@ X*0f1@0Z0 fB200Z 0ÅP@Z0 fB100Z 0ÅP@Z0 f00T񟗹X=QQ q 0  0s 0 0SW X*0S Q q D0  0q 0 0PSt5*WW1*  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CS^ 00  ^:`pV`` W0S P`P```00 p-0L)S@ p010CS^ 00  ^:P`UV P pP 00p PQ 10C0 Q-L@pRPPX`VP V W P `0 B  d00HPP00 Q-LPpR`@@- P 0S @V000 B  e00 0-PL @e0 0-PL @Z0 -LR0L0@@PT@ lR0  0 R B0 0  -LXpP`@@ R0D0TST0S: 0 P` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00j d00``p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00jm d00`f@000 R0pp00P  x j0@@@b00uP0PjQ0PE0P**bb&* 0-LM 0@0 @P K0* *0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T80 0(K4@K00K 00 APA P8 P00H S 8P p0P< 30D0 a0H@SX4$$$$$$$$$$$$$$$$$Z@ =XR@0=X0 W@0 :<⌑ < `P 0e0 F pP8 0D FpH R W:<00⃁<0 `P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦ll`4lTI@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < 6`Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < `PI 0e0 F pP8D H0X pH W:<00⃑ <0 `P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,K>$,0P R>0SK v6"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`a@Pp! C808 =0 08F60 01 -L8M4\( p& < R R S @WP  O( 0R'$KR Z@K2 A|PU`@ PU hPZ@K024 Z@K2 @ditt996* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0A\ -,@LP 00` -4@LP J$P`` - TL0S D $YP  P q 3  00 qQ#Q cs0 0n0@S0000 0PU L P q 3  0 00 0y P q 2  0 00 0g P q 2  0 00 0U P q H2  0 00 0C< P q 2  0 00 01 P q 1  0 00 0 P q p1  0 0 0 0 p P =Q PP@Um0#S+ #U) @0PS0 P  000 0 R r 00CS0r Q#Q 0P  0 S S 0@S0+ @(`|tD\|bػ  ( 0-LP@P P0 -LIM0TK(0 p@P4K@P/0j V`W"( 0R^$K  0@PP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR@"4*@P -P$ 0R 0R 0GR QKWPP @1R <1R 81RD*@*<*,b\^i\<0 0-TLPA/H0iP@ @A/cPP03@Phd* +!!* --LM0 0 -H0@L`P8 4gT  塹 j!gid\\*;;* @-LP7X   (     @ R0 0" { lu Xo 93 00,c   L|\3ds* --LM00  K p-L@P3X0` PPT  44 0廒c phψidT| p-0LM@P0 ) 0S& =S$ 0 S =S00SRPd`K P X0 ! 0S0 tP x2 00xP$ -LM0@=SS00S $  0=SS00SP$Pd$`K GP! q$0 A$  ;P $0 1 0S0 -P x20 0p R`  0S0a`LiPP  0(pS PP@0 0 P$l -0L M`Pp,0 P" 0S =S 0 S =S00SR@f, KPH ,0U00PK00  "20 0(K P 00 1 0S0 PP,@P 1 ,0Q! =Q =S 0S0=000S0 ꐀ R4   0S0aC140 P PP < 0S O 0P P4 ,  P$l -L@$X~@P0 @Rt@ -pLPE@Tx` S+P00 @ƥTH R<3",/1 '@tx 0-`L! 0TPt1!@PP@T 0f1P00xp** *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/1\0` TTT  8;8 $0ېb  didT| -LM0  K ?0-Pp1@ LR` 0S P P@ 0S@D0Sp00Z0 谩 ?0-Pp1@ LR` 0S P P@ 0S@D0S00Z0 IJGG*Q  ;)<??*55*E-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10S(TdT0SQ R<84@Z,<$!$$, T*0SLt -LMKnP@0 !H -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L  K~ Kz,K v Kr Kn Kj Kf KbQX0K1   @0PC⅀K  !SPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  RPp 00C/L0l XKK, fPHK K  K K K K K K K Y=P@@!T 1S !=;T04@P!TU!X}w Q (Ÿ, 0 R(K  Kp.0SX0S  p !RK  v X K! } ?0KK1 [PXK L00L0 60[X KS060KI0@K0 1 K0 0 w Ks Ko,K k Kg Kc K_ K[ KW{.~x.0 A 0{s.0  0u e]iHth 0tĻ p-L0M`0@0 P HK@00@0 H KQ Q Q ?.00 0R Kp0$!]it,t,t,: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00 -QLM (0 $@ 0 0   0 (KKdd*KK**oo* *DD*R0S 0S0S0  R00ZZ*GϠ*''* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-D0P P000P R* -`LP p0W 1@PPP@aU]00Q R @1@S O RI00 -LM`qpP r 0@r   t00 ( pDW PAbRP P # 0  R 0S 0 U@R 00P=  t!, ;Pc 0Sa 0 0 0S0 g@00PP  dPk0 0Q 0@0A   0, 0STU ˾0 0 ,P% 0S4 U, 0l 0  R=*@0l@eP  00l _ 001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z+ @mu i+0 0d -MLM,  @  pT2 /T ` 0 @C@T/TPP  0 W*Pdğ, 0R(KRr/T ` 0 W:/@/T W: 0@ 0  0 S00:P+P/@@BNK@D@D+P@ 0@ ^KPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+cP( 0S B^KPEPE+WP@ +P 0PZP*P0SNK@D@D@+ 0@w $ Q 0P@ 2( 8 P. 0  0 S00a* .R1 Z3* @R  W-0S0T'*  @0mP  D0@ PP 0@5 %Y^KPE`0.S @P+P_ 0@" ,PV8: SR0S /0 0JPV!  k*P0/00 NiL -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I**K, 0b5 !(K*K 08 <R 0 XT5R L50PP!U00S !U[ @DP 0 %< 0 P`]0P 4!Up0:0C0Pp00-S@3 ]S> P`[U8#80@0:S0@ : P 0]SLğ0i@T 4Q:0 RR0S< ^ @]Q 3 00p]S@ 0#< 0 P_KLK*KA KKA(@4 0 Pk*K, QT 0} :KK0 4 0[#0a1 0 0P[Up`b0:S 8#80 @w 0  nK`F0F[*KV8`@*0S /S  *K/S 0 R@ 0S00 R P* _P*K0 PP" U R^ 0*K S C  0R0S0 U `1 (KPpPK0P ]U@^< S~ *K, 0pb@P@ W(Q@00 \  0 0 0P@Pᔻ  D0 0X)**?[D-]:` ) -LM0@{SB {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  (KV `F0}S0SU0[\ 7,\ T:P[\0]SS   0]SSST0*VU  S:0S0 wP  000{\ }\V`F` -ML M@,K`pP0U P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N @9R8#HA@L.0K^: X0 Q  R00   Hꬾ\@80 R00CS000KkꔻRR* -LDMp0PQ` 0  `@Km0#" 00 @\  0RKP POVi -LMX0@K`P$0 p` ۏ$ 0R K0Viľ -MLMK@ , l p`?PPB@F XM 0QLOKHHV !+ JpP#  តV'0OPU`&@ &@ lm, 0R$(K U JpP&@ &W@UVKAKp X$U eʷW$U i eiо 0-@MPL 00~K0:*:R0S0  RR B0 0Q0 0Q*__*W̼ *A*//*aa*P0ᬬ -$0L! 0-$@LP'P$$"P0h p-LM$`0PK@.08ooP nP 87,00SKp,0 -L3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0PQ>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @_ywQ& .Qr,  0@,  0},0 DSP`J  0`qP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ჍP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` Vuut -L,Mp P@6Q >3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ЋP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` Vuut -LM`< 004 (@40 0P8 Q p_0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppm@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 < ZP]  4>0 89, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(Kt -LMp S, WQU Q0 Q Q Q Q  \A0A >Q>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @wV 0 @_ywQ& .Qr,  0_@,  0W,0 DSP`J  0`KP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6 -LM 40 \  ?R(00 Sp 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0t`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0hH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0dH E U 0 \PP 0 R HMP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VDP㎬<匬" q u:D L0SPXx H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ᒹ ` \0  H 0XXpWDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0EeEt`0DP`X M<P D L0SaP_XB@O`0DPpX # X2D0<.X*D(@0`0 R T`0 CR` X0 X0({np0R RXnꔻ H`0 CR` X0 X0p0R RXsn괻u*E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0t -pa`LP @*`P` 0`!P0i5V1P Uj!0\1 X -LMßß8 < 4 =@0 `P j @Ty Pp0 ,P P2@pT&  5P'P2  0R0X0S00s0P  0 20RE P2, @pT, R 2 Rt2 ? (K<0:S  H0P 0p, 2@ YR00S5 1 R <0:S  0S 11   < 0:S:? 0R 0R RRd1 R < 0:S Pd ᰷o0BS-R @0S0 R 0 00 R0 R <0:S @0S 00   0<0C0 :R:?Q l0 R48L 10  4 0L0gȬجĬ̬4+ -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  huPu` X@t  00  e00b 0 000%0S0 R#, `4V ^0 4A@-QPpU4嗶P @t $0s`U p$-Up 80Sc T 01S\ -Q W :Qs 4tPn 048 0mpPF 3#040P -Rt44 u+Rr44 n-U30S5P(KPsP3PLu0 0 @00#@d00d00P00"0P@0Ђ0s02`p@P:U@30S0002 R 40:S |t2P?P0Su0r0"P,2u a  000 d0b01 r-U0S4ܵP 8 0R0WU0S0 0;S7 :S 0S000|H00 R@!0:S 0, 0R0 1! 1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 |0l  Q 4 0:S010048 0yP Ȭܬ++ԬЬج wĬ̬ -LM@@ZK -LM@@OK -LM 0D K9*75*7CC0*,*$$(*6$*6PP**33*##*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -`L pPIwPܴP 0Q @Q ϴPX ȴP @TP k@ - L0 0P̽+ -pL P@ 8`P0SX 噴P @TP k@ - L0 0Pܽ+ 0-PLP {k00@צ@@Ӧ @@0+ -LM0PS ,Ki@P ,Q 0#S S 0i@P $K0 S RA,  #xwP0d,0 ,ت`P , U,0pp&*P @p0 S S0 S S *`P 00(K (0S ?R0SP("(04"48@#80 @PB `8)P7 @00T2 P.@)P( 00@T# P P P@ 0@!0SqP 000  b `llhP0^q0 0n PK@.G @_기\L` -L70P+ 0-0LS@P ' 00 00h 00 00L`+ 0-LM@KPIdPPPQ R 0S0S *.d@@8(dP@@8 --L]MqPM?KC/`KK `1 4Q 0Q @0 K 0KQP   0 K|1 1 8 Mp@ 1P復P 0RKP u01 00@ 00AiB` --LM00  K 0-@0@LP 00\hT  喘  0h^hid -LM0`0  P@t 0-T^ +T0@,0 ,  v 3V00S 0TS R0㼯p㨯00D S t, (!000& W070 cV \Q00R00S!! ("00@0T  ㈯ pt `,0\00S00aS \0E(K@ , 0XSxS@P `rt0P0A0\A -LM0  pA p-LM @K`P0 ܟKpl --LM0 0 K -L M@KPT KKK 0-L@Pp Pp T U 0㓺0X ᶼp@ -*'T0H@*{{*0(0 -0LP0 0@-Q@ Q QPP000P0P0 0-@L0PS T00SP0h -LHMP p៩P h㛩`Ph p 0S, R00U@ @@4K돭PPd 04 \ X T `@ YdKTYP0S ᴣᲣ0h0 *0  U@P04,"40ᡣh埣h@ T0T L0S00A0@C$1HXP! h(K 9ZP P00  0@Zp 0000@ 0000d@ 0000p 000@0=p 00}0h 00dl,x -LXMt \ x |0 Q d `0 40h P`0 d K  00Sp 0p0 @l@ ( P 00C,̠Č 0("ČT@L # P_ T0\KPX t0  0PO |x@PH pz!PP pP d `0 h@TB 0A嬡P0LPK0<0 8 "XpKP XP(P (KX0Y(X(P( l00Csl0 t@  0 P(d@`@h  R p (0S0(0-!(0(00(0t 0P0 (0,  H0S 0P0vX( P(0S0(0\, -RLp`PU `p@`P` 0(0,  -RL,MT P T(K0 @1<K0/L#b00 0@2K 0KhL HK<0SI 8 R P PA$0L00c 2< R{0@8PS B< tpP R $0 00  40 4 0< ph 00X$0J;, P0 $$0 :, $0c ?00$00L00 04>0S 040. S  @PI P,] P0 $$0 :, $0; Pp0( 0 0LiyT ,P 404) D $@ @ < $D T P <0S$$0BP> P 04$0 :, $0=,(Ko: P 00T R0,0 - P὞P0 P0P X0SP 04 P 0, 0,0 P0 $lJ -`Q00 V@@TLP 00p @$0 D T T P V$0@:$0<0S0 /R $0` P ǶpPP0,L 0-0LSP@ 00T@1S00 -`LVp$0*-0Q4X Q$( R> 0`VR "<0Se 4S S 0$  0R/S@/00(  Lvx`$0  `$ 0B8S P$0 SP 404Q $@O 4 0RK 4P %04P͝<0s 0$ `<QC$0 0`S004P$0@wP( L$  x/7>P XW @ካP x(P04 00 `\P  % :$00P| `e44 $0 ;PX L =P6 04N 0P 4 04 P 0  Q %nM0S  0tP} $0P:$0Pt $0 ᒵP 404$0`:$0!U ``Q @ M @$0P:$0F 0 $0@ 0 $0LlJ -0LM@p` / 00 00(K(ʠPP0P  0P `00$@0 0$0 P 08xvS <  vS x vS x@@<@TU wSrwS?A vS]\vS]vS]h DHpAvS;zvS;zvSCtycAvSj"vS>~vS>~X fnAvS(vSrQ3vSvKy:{K(VAvS*,vSvS| AvS¶2vS+}7vSvKy:}wAvS~vS~vSg~-vSq2vS&vS&` Z u!vSmvSmvSm2!vSmvSmvSmN#9f!vSIxvSIxvS]z:v!vSIxvSIxvS,!vSIxvSIxvSIxi*!vSIxvSIxvSIx W-B!vSvSvSo!vSvSvSg~\w!vSvSvSA!vS,vS,vSn }r!vS,vS,vS,U!vS,vS,vS,pavS,vS,vS+K!vSAvSAvS+avSAvSAvS+6}!vSAvSAvS+AavSvSvS+wo!vSvSvS++~avSvSvS+ǐ!vSvSvS+&}avSzsvSzsvS+2!vSzsvSzsvS+( avSzsvSzsvS+˭U!vSzsvSzsvS+VavSG vSG vS+r=!vSG vSG vS+awavSG vSG vS+!vSXzvSXzvS+@avSXzvSXzvS+;M!vSXzvSXzvS+$avS5=vS5=vS+ k!vS5=vS5=vS+ HavS5=vS5=vS+ Ce~e!vS5=vS5=vS+ Q)avSvSvS+ E!vSvSvS+ 0^avSvSvSA#, !vSvSvSA#, ]avS5nvS5nvSA#, !vS5nvS5nvSA#, ravS5nvS5nvSA#,U!vS5nvS5nvSA#,CavS2yvS2yvSA#,!vS2yvS2yvSA#,DavS2yvS2yvSA#,e!vS2yvS2yvSA#,6EavSvSvSA#,^!vSvSvSA#,&vavSvSvSA#,'!vS7 vS7 vSA#,oavS7 vS7 vSA#,Y6D!vS7 vS7 vSA#,avS7 vS7 vSA#,,!vS% vS% vSA#,ÖǖavS% vS% vSA#,0'!!vS% vS% vSA#,0avS% vS% vSA#,=N!vSvfi!vSvfi!vSA#,avSvfi!vSvfi!vSA#,R\!vSvfi!vSvfi!vSA#,]avS"vS"vSA#,tt!vS"vS"vSA#,avS"vS"vSA#,Q˒!vS"vS"vSA#,KE3avSe"vSe"vSA#,x!vSe"vSe"vSA#,y皴avSe"vSe"vSA#,)KH!vS5!3#vS5!3#vS,\avS5!3#vS5!3#vS,.!vS5!3#vS5!3#vS,avS5!3#vS5!3#vS,8!vSQe#vSQe#vS,<avSQe#vSQe#vS,[b9#!vSQe#vSQe#vS,\JavSQe#vSQe#vS,I!vS d$vS d$vS,avS d$vS d$vS,!vS d$vS d$vS,DavS d$vS d$vS,"L!vSd$vSd$vS,ˀETavSd$vSd$vS,E!vSd$vSd$vS,qB[avS %vS %vS,!vS %vS %vS,xavS %vS %vS,~!vS %vS %vS, avS`-&vS`-&vS, !vS`-&vS`-&vS,+avS`-&vS`-&vS,!vS`-&vS`-&vS,fK]avS&vS&vS,@!vS&vS&vS,bfavS&vS&vS,r {/!vS^'vS^'vS,*JavS^'vS^'vS, !%!!vS^'vS^'vS, &uavS^'vS^'vS, <!vS'vS'vS, ߴ:)avS'vS'vSjAT- (!vS'vS'vSjAT- #?avSpQ(vSpQ(vSjAT- DN!vSpQ(vSpQ(vSjAT- ȏ¼avSpQ(vSpQ(vSjAT- d!vSpQ(vSpQ(vSjAT- D&avSX()vSX()vSjAT-UV!vSX()vSX()vSjAT-:mavSX()vSX()vSjAT-r!vSX()vSX()vSjAT-r_4!vSP)vSP)vSmB !iBu!vSP)vSP)vS&m ԤBuavSP)vSP)vSjAT-5m!vSP)vSP)vSjAT-JnavS. Z*vS. Z*vSjAT-!vS. Z*vS. Z*vSjAT-!vS. Z*vS. Z*vS. Z*?uʣ!vSKP*vSKP*vSKP*?:avSKP*vSKP*vSjAT-?"&!vSKP*vSKP*vSjAT-"avSKP*vSKP*vSjAT-&@!vS +vS +vSjAT- ֎navS +vS +vSjAT-#|!vS +vS +vSjAT-7avSZT-vSZT-vSjAT-@i!vS-vS-vSjAT-X|ݓ!vS-vS-vS-<e!vS-vS-vS-=!vS<.vS<.vS<."&!vSO0vSO0vSO0"m# !vSO0vSO0vSO04hr!vSӂ1vSӂ1vSjAT-föQ!vSD;2vSD;2vSD;2(!vSD;2vSD;2vSD;2(suj!vSD;2vSD;2vSD;2(Zg !vS2vS2vS2(,l+$y(\xIK^zvNg`NF Cs- qcչXoB1@[Ɖ;M {|KzGN&QJQ "q A˽sp(s-k[uܬBy\nu XM]n'D)tV1@D1oA}M}X<v̹AYɤ(9QY/LQWny)!_gـ>_ FHHaD-iEDh?$ PFTXo^que? KGo${%X<&Q=zaeT{4u2,Wu=#jLKȥD^YYtȇ"TZ E^!;*O . ..MAKEDEVconsole  tty  mem kmem`o null`o zero`ostdinostdoutstderrksymsoklog`obpf0`owd0a`orwd0aowd0b`orwd0bowd0caorwd0cowd0daorwd0dowd0eaorwd0eowd0faorwd0fo wd0gao!rwd0go"wd0hao#rwd0ho$wd0iao%rwd0io ... . ..chowndhclientm disklabeldmesgfdiskfsckn fsck_ext2fsfsck_ffsmifconfigminitnmknodmount mount_cd9660K mount_ext2fsK mount_ffs mount_msdos mount_nfsnewfs newfs_msdos newfs_ext2fsKpingnping6reboothaltnroutertsol . .. binmdecsbinshare . .. ftpgrepnfgrepegrepgzipngunzipgzcatlessnmoren sedPsignify . ..misckeymaps ...aPW _PO 0<0@T . AT% ᯪ P5 I@PL 2 0<0 $  P04VY`, @, ,@ ATVX# #P  04$0 X ፜ 00 ᅜ僜ၜ 0 *   մP$00$0L -PL0@S 0` 0]0SXh-0` 0N0S p0S ꔻ p-LlMK@`P 0: S f 0P0KpP P Pl00@0աP  @0@`0@``P 0-L@pP  00R00SPP 0㧷 0 P 00 0-LCp@P PP 00 -L,M, P ,"pT0 0 rpP W ZD oP,@P0PC$@,P(P@Z%,`)T0PcT0P`@DQ,0, 00 ,,嗊(8 H @@ 8@ PTu*Y H,j 0lS0P`S& DQc,X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*`d,` ,P  P0ZD0 , ) R@100*, Tg`g $ 00 `, 0R*@PT0PDP DQj 0P0 `, 0R:  0gY@(K,T0Pg`g " 00 g `0S @t:,T P0D\ DQI 0\0 DQOH0@8 H 00 HH @@ CDP,Ř 0P0 .DP @08@ 0 0 @gDQ 0Q0 0 0P0 0 0Q0 9 T0,3DQHł 0P0 P,1 T  `,0PL0 T P0i<0 T P T PL0i0c40 T PT PPT0PT PPT PP@0,0, 0P 0 ! 0^0 #,0, 0\ 0 T P`h0H0H 0Q 0 $P, 80)) S@10*,0Tg`g $ 00 `,0Q*@PT PD\ DP 0P0 `,0Q:  0gY@0 0P0 0 0P0 tT P\4T04PPST P(,T0,`P`T P)<T0<@P@ 4T 4PP)<T <@P@ ,T ,`P` p-00` LP0\00\ P! " @!R 000lR  0  00@pf 00p 0-LM.00La L Q A0LRW0LQ70LT0X\x\@@0 -Lp= @P@d㴜P`d 0@:SS   P0Pfd#P `d P@f P` D`V ϖ -Lp= E@P@dzP`dP 0:SSo ^S \S0@ PUPfdPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SDܺкĺܺкĺ00U@f {P`VD`0T0 00} 00z 00w:00t00q 00n00k -8@LP Z000 0蜿 0-@PLpPPd0@@0ޣLP00⩛40P (0@ @墡00蔿 -MLM@d  ^, ` h8 l p( @0S`WP lmPm  vP 0pS LH T hL(Q\(  h =T80T8 X 傎KHH`YP 0 S 0Z@PY+h8SYP `0 SU0U@E\S 00 HX #RR l#Pp^ 0:SP P0:S0@0pP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@MP H0g gg0 0H( `pPH @ ejo40(fo HDH ;Pg)P: 0g@pPPX(RhYH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL ᷔT(R@@WX\K@ 00BNK@D@D"ˡ P)*2 R% h 0rP l^K< uPE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L @WPh TT X hYhV@hX@ 00TT a 0P  p000\H H8 X Ph Hf0X\!3@Z0@WW+X(R2 &Z@ 00JZPp@Wn k@D Q? `P0`?SP``L0@p go@pb@ {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K *%i  0-LP@ 1  !1P\ 0hG<<d*- 0BSR0S񟗹t?Q00 000000\Q0000 0AlS񟗠P`````````````````````````P````````````````````````````````````````````p```t```\```````D```,`-Q00f ^Q,00` 000Y0A0S0Е 100ࠓࠃ00 K0A0 S 0Еࠃ10ࠓ0?00;007003\0 0 -0 0 '0 0 !0 A0 0000 0 0  0 0 0 0  0 0 0 0 0 0 0 0 0 0 -LM pK00'`P@T  0P 00P@PT 0PPh@ -0LRM 0 `pC CP)K0K@T  0PW0#3#0%(KU)0[505PW)0[0Ņ@PT  0wP U0h0ŕW)0[0ŅPcc*( *=*=UU* 0Q0   -RLMPpkܑ0SaVU0 P @0P 0000 R r0 11@```CNX@' ,K0 KUW@,p. Z, ,0WKX@0@p0  g00 p0S&4V(K,0W`'0C0 0 00S ZဌP` Z@徆HH?R0S` pf`ꔻ\-  S 0S@nhh*$%%* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SK`K pP 0S [xD Tx( @00 ꔻ̿ p-LM, 0( rSwS@T l0@0Kp  0S $K⩜P2 RRpPB P#1@T 0@T 1 R T, 0rSU $P[(0!3d1 R6, 0rS8 , K@$0(a@ P0S00  0 R$ @хu Pq  000Q0 g d a $`K@  @$T $z埅iꔻ̿@Eĺ -0L IP$ -BML Mß0P,0 T$  0S 00ß, 0R(K/PP0P4 L 04  T$L 00C=S h     R  1!S  b-1A L401!0>T$忾BNK@D@DP  p0 SP&1KH4 1D A  @d < 84 4 廟X^I`P 0SDa ɒBNK@D@DPQ 00UBNK@D@D (0K@/04L  (K 04BP0S<8Α0@P@ᛒ00 c-!!R0$ 0  BKA@@DAPT L 4 00iE@DPHeLLw\3$0 P$ -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0x ~ 00i, --LM@0 S       0S0! b-1! 00   0S0   0S000 Ľ 0RK1 7 00i4 -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0 | 0RK0 00iP$<0m --LM0  0 v K  0-LM@Pq;PK0 J=P ;P   ;P $@ 0@P -LRp` @PU  PP@ -L@pP:P `V0S p VU Vp @0pP00@V00S P0S-00@T TpV ׈PP  } 0Ppdd` `      P0 p-LMP` P P |P0l `0 0 Kp@ 4P0( @@l,п -Lhd -L  hE|d 0-LM0@ K Q0!ŏp@\ Pڔ!廏|K0@\` 0S-       8           0!噏pP, P 0 ሏpP0  {p0 P0 R@` p01S ` gpT0< ^pTпpc0$|LX -Lrhd p-LM P|` 0 S 0K,0 ( $ 0 R r 1S0C1,K'O0@SKpꔻ -LIM0 P$0  0SQKO_K`NK@D y @ gl0! 螜$ 0R  KD! 寏,0 MoKK_KQK@ <1 8! iT@-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$фP $(0lH0 (0, P$8`P, 6<PP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoK @08Ko~ 0K~o~꼭Hd 0- @LP 0㘚p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %*P 00 -(0LSP< 0S2L0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0q 00`p0ꔻ -LQz W00 p - L@<0 R0`00^00X00蔻 0-HPL0@S0`0000`00 R 0hꔻ -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0LPK0@p 0P @0P }0000 0@8 0@0S E0S0 0(KK0  P` 0S  0bO`p0K0@0 @ @/08CJK0P0: S0@ ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P (}0@0@Y 00Ÿ0Sd  j00/`VpP <0 O`Vpr XKⰹP&PK K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04g# S@ 0` c00 P @0P |000 0D0 R Kq0S @ Pa_7 00   a0@ P0 Bq_ 0@p`pq AP T0 d00 S0 00xU0/`P  0S SL ߵ* -2MLMx$@0TP,0  |<S   0/Sk @P B.K B B, + w X030#` V0#ScVH < VD / 嬉P< PP#@aTQ~KpGpG ɇ(K0YC`d   mV,@B0 /S (3X5/00,8[S 剉P 儉PP0XP /o,0VbPX A0/S/0C0@0@0S^\, 0 Rz(K?00,R,  {0<  +TrPK AìPPh<: S Qk®KJJ  ἖pP( K`\F,<[/SD XP /P0aY 00qiLlJh 0-@P00QPLTP x p 0K@00 ɀP @P{@*||* --LM0 0 b K 0-L M0KK 0PSH(P(@(8((P(H(,(@ AK0 "000@@@ 0$0%K -LM< |<0D @  Pu 0-U +U 0P8 80 D@ t 3T00S 0U RUD0 ?4 00 8 RX 4 K 4 K `V0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K g4 K , 㖇 W# 8 V0& ,@^00S0040 ` `Pp XH"00P`q V>"00P`q W0 W0@Q RJ< <0@ 0(KP8 ?0XSxSEP D 4 0 Ct -L@)T`p@P  @00#:k0cS:UV@ 0'p`p -LxM`OP0 U80   0@D0 @@ 4 40 -SX.d.d.d.d.d.d.d.d.00000d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.0d.d.d.d.d.d.d.d.d.d.0d.D0p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S J0SG0 RT4 | t 0@ Q  |040|0 R" |0S  P 0BSpچ0R`|PU 0A R;ʇ!00 p0|0 04 0t0 4 0Sn 00Spxp 0XS xS 04 00S S_  x r4 @t@ |x 0 N 44 0+Q -Q,A    00@ S4 20P404 0P 10@S%40P@p p 4 /P 04 0@!00/PP9PpL*0aUS RaY T @l@ P - Z@PD@ @P D:H A n@P 03mD @ YQP` 0j@T 9 DKnD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8W'dU'\S'`Q'XO'M"00 4 s%P}P`  fsPx8L d8 0R$P` d \ X  X \ ` <'Pd `0  ! ▃DK, K00Ko'P8 (P\ P@, TP`PPf00ࠡ࠱Rbp t B gR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \(P\ c 8(PP_ 8&8P T8'P8 T Xd(Pd L Vd'Pd D W\'P\ < d8E'PX 6 0 0\@&PK X\# 1@P%PKYe u` l h @5 Z 0Q0jZ0S lKx%x5u%P lKP l h Y l0K`pk6pjDKt 0m 0DKlD @ P@`\050Zp 8@&d>&\<&X:& 4cml h Ylph@@PQ\ P`p 4k`p@D0SH@ 46SE 3%PA44 7ml h l`A0`p | ]I0@%Sf:....:..........................:....:S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | w\2 l h0 BCbVD@K0@1 ` l@PVD@ @P @05&C@ ! DKlD @ @"1 R6CR0!0 5&0C@@ D0 @ @ ?4@K#"P 40 (R D @ 4@KL"P 40C44 "P40\!04 @ D0 Qt80K4K< K0S@t 4  S S 8 RL`K L`K!8-%0DK< XPP\ ~\cʄ0 DKFlD @ N?A|0 |?5?55tP9?5&HDK@PD`K@ ` p  0l 0DKjD @ @h0 0S56@0 0pW @0 0D0 lKdje 0lKljY@PD0S46S !(1#Pu8$d$\$`$X$h!h1#P|!p1"P\l`hp0A;h@d 1 DKVjD @ DBZ T30j0T0 DPK`2 @ kP`TDP @` `V @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0a P&p`p dp \p Xp 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0iD @ 8&$d$$\"$` $X$Q #0 0 K DKAkD @ 3@ 0S}YD0S@ 46S30kSX 0S0SX$0PX0 \#P@ ڌ`V L40kS7S8#d#\#`#X#Y0ц!0М `0| |0 տD0l0 h@ D0@ 46SD0SPiP0Q; E DKjP e jD @ D0y jP0s$|DKL `iD @ DKD@K0} 0/i @P0D@ @P P2 XL K!PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS CDCC|CDCC000 0100."000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @P$ 0 K  T00 5CS0cC*R7S0BS c020 -LM< p ?4 00 ڃ4 K O, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 UX"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL vpP- @ u~0 @p000CC000 R0@ <08 000B 0C B0S %@P, 0S0$0 0R0 R*0\SL ,xP 00π0;0B #A03@ #000000@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK} ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (KoQ{@, M{ I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;8#8?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT,K 1c, ( 0 #2>;8#8Hat.t>bp.p>Ta@ P7\\.\>b 0Ha@Pw[ 0P-\ࠃ|  >  P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x !Ps \00S ^$-01NB0H D    ̟ `0`p@0 T P< HKP PbH D  @H K `X T |^ XK4< P00Q00S ROXK; )b0X T 0L0 8 4  K b; `40@S UA ;XK` 0`pP 1P ` \   pd \`0S d\\`h 0S00 p` p00S  0?o \00Ӏ!  \ `: a 0P ` \ p100 d Q @ B¤ Ť0@Sbbg gff x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCA~J Al  4 8 Dx\@` 0tS\t0tS0ct @cc Rx0S ` P` [ hQPPW hhP P\ O pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` @P `0  ! KvP `` pd ` ` L <haP Q U00S 0S X^00S \W UbL 0`R h  HPh d`\u d  =Pd `  6P` LL \hdh `\@P 00`S gP Q  0 cc p Y0 _P00C0 x\ 4@5 ( _ 0^@ < XK$Y@Y 0XK^0@ pP`@@K 0(P< 0^ 0@KPv4Q i^@ K %4 P 0jW_ @K 049` $4@ < 2``PX@Y 0^0@@@ K `PP 08 ,P0@ pP0 `@P 0^X`uY 0` 0t^000 0@PP 3 P\P  0p^@P  0P  0P 8  w9R W8008  000800 hPh 40 820_  XKgX`Y 0XK^ 0@P~PP 400 p\00W 1_P@GX`X 0] 0P@^4P00 000 <1K] 0TP K ] 07P0w0S 8p t408`0 \0 @nT/X T   ` 0cS0Ct @4S2+  P` S d '?aCoc?`(?yPD??$@@@?0  _Db 0@P0 pH0 p _@P `X@ TP p@Ph  \h0`h`h0  \0Sڈ T@d hPh \_P0w9S{ W p100  h\NPh  QPh UvN  \010! 0`l^,0CN@6@c+P` t @t E0SS\ %P\ \h\PʔUP\ W\TP\ xzhLPh mr`DP` rjh0S0SU%`qd o9V00k90000ez0w0S p] X T p`  P` ;h Ph U \P `:V `>9V X1``8`3 -LCUp3 -L0S@  ?0< B<R0LA0 0!88S@  ::S T0 0@ -L@\`n0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPP8PT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP  -LPp SR 0S40S1`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  n0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:o 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp zo 0<K <0 i0 dKl0 HKD0 @0 H0 帄yi -@Lt 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK pph K@KpK^ Ηp@pD@ "p  0siP( P-RL@  ?  000 -- LM 0  L K -ML M@H,  P, PL, H$\4#0$@K$K0 S2`, 0R(KDD 0KN@N0($P -p4HPP,Qk`p H<VF``p  @ R@ 0# pVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<4V 0FP `aC0S: P 0'P`pm 0j ( zpPdP > pPPKn@1AlA 8 4< <\ 0L 9}?NH^6 D 0!oPD@`P  0@,`0a0cK8< 00< @<AA 4 << }ꊔ0!doVF``pY 0 S0GQ D<SoZ07SNK@Dp@D p 00@ ~NK@Dp@DgP 0&PP907S w8+i\``(iD8 0-LM@00 P?P8 -@L w -L@TP`pJ 0 T0#03/70! "]W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z \W@ <"@ 0-LMP40@ L0 @K0P -LM`p@P0PP@0  pt@~TPPK萻P p-L@ P  c3a d 0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ bp W@PP@ LP 9H A R@PPp 0hQP L 5RYO\0So \\NP 89R QH  HK 5@`\L9 PKR@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 { PD @p \ 0g@T 48 PK}RP L 0 PK< K80K PD W 80<@cT< <8 <  0 @n0TlT @  07  0CP| + |2 P $ |0  ! gD0% P  D  ! g8P<@ Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ x Px   @P  @ iQڄ P  Wڀ P  Vڀ P  Xx Px  F Pt  0St0@ p @x= P00\``V 0 03 0 4  W !0@ 40 X T 倔 <\` 8,  , K00K pP| ,QZ pPu D`R, 010 D PD e 0@S20@DT@ T D9 PD R <0C< 5 A 0 D? PD = 0 0CSv R 80@0T80   Q6` <08 @ STQu "2 ,Q @P2XKO 1`p P 0P[ 0@O 0XKPO40040 Q80 @cT D PD < d< 0  x | t @<0 R 00SO SI S D 00 @021T0D 40 * 00Q   0 b320PW   x t lP tx 1@P~PW 0` 0 ` p 0^0Z0S0   R 0S N?V瞯<A?00S0 RT@   0 @ R0 0 @ Q" R  P 0BSچ0R`Ф0PU 0C R.ʈ!00 0@ D@Tj0DPD0C< @8 PD =Pgb_P` g UPg20S60P40 Y RD0SR@ 0 SJ @DTʳ 2OW @@"2@ P H 6I@P  06NX T ^ ^ ^ 3P 0 00c 0 I@P@@  CbVڈ3@ h d L 46 56,ʠL0 LLPKh K @O`FVP L L0# "*/B B V L pP@K0D4 ` cO@PVpP@ LP XK 0$P40 040 G0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@KDP 0 40 0@ 0(S@@  000 Rc 0SD40 0R  04  @040 "00D@@KP @0C@ |P@0@ 0 40 D0 4 "00@`-A0=@P9U}R@d 6 PK[MP L 0D CbV6@ p l L 46 56,ʠL0 LLPKp K @N`FVP L L0t' "*/B B V L pP@K07 p` N@PVD<0 < *a P@jD2PD K <0d8 < A0@PU <ZD0P 4 "00D\  PbU,D P80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl.aN* Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W {PD 08@100@ @d@P80!08 40 W040 !0Z40 ʘ\00P0SttPt x"P040 ŗژPv <0Db< 8 w^\ 80C 8 ?Pi\0\K PKyM\e sMP L 0PK4K 0PKD00 P0< 40 RZ!040 s4  4 4 1L0HK6H0 @`y\|\PKL K 0 1SN  @ 0CD0  !08 < 40 D!040  R0S0 DdRQ8 eDIZ |040 qD08  -L0<0ጽ 0-@PL0 D@0 -LMIPU8 < @0  00SU @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  70S30 R 0S0 0R@@ 0R 00s03p`00 0 00 p8`pQ  0S\P P0`10c , ,0  PR pR 4  V0G000S@Z)0g0CS  0SRP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- P@"00F R0 0S 0S0 R@0Sc  0S@[W@FpT p2 02 p 80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0C000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ %P000.@r`bxZPPPF b PP>W 00S `P T@ 0VP @F R 000@0b@8 0< 0"00:1 0W 0eP %8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. ,0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R0b::p  0H$K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 B_PP P 0 BV0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 ᘻ$0-@P 00@ b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 00,0S  0 S  -4@L,    h,$| -L?` -Lw?` -0 `R0`LP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  @P  ! ]  0"1008#8S"("$"""!   88S00000P 00-0 S 10 0 B\AP: Sࠓ -0L100`p@PC 0` P0 `6<W05#3̠10W#55 P 256U b>003<0S00S0 0-@PL  QXP0SL 10A00hP4[(10 AR 0hQꔻT -pL0PS U AT01 0S0 003 U e10E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lp P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K<PP0P  00  ! Z0 0P 0-L@ODa TAPU/ ` @T P /@P/ `p0S S@T 0S LPP@ 00p0S |9PU 0S \2LgPP 00, 10 eP|q -tpLpBi0S \h=iTPT@]n`00@XPC/00[UEO000\lL -X1L R/ HiDQ SZ RX@J0S i00 D0 HC/[PUhS`P@0@7~ 0PPlX Y00P100X@C/_[TV h$ 0``@0Gȼ - L,M`o<0N00Kp 0 @rK @tPP 0@ < 8 4p * K@0 @0K P2[Sh0  00p〉00[(K,000l,040 -0L@0 -A0Q (0 (0  0 0  M-LDM@ 0SPl r   p0`lRPPlP h00`08K㈥0S  0FP*MH04,"401(000@0 (0,@0 d`\pV`0h `0 \ X d` @@ `0+hKP D0X 0S`+0l0P (K 0@ 0000lL@ 00 00 |0|@| 00l00 @,@ ~ P0, K `@ 0ؼdl,~f M0-LM@,PP0 PDK0`" 0-@L0PS D00S@L0hL[ -LME Pp , 0  | 0  ' (0 @P @ DKH0 P 0@0XD0`0K00D P 0  0P  @P D0P P ` 0fP 0S6 @KD4@ PTKP jO$$ QNa HK P&$00K3 P0= @@ @Q Y0ʗ 0S 040\S, 0R(KP p$ <`Kh@@PK0@0 d 0C`P_PF0S 0#S 0 8 404[ n 000S`K`PK`T0KXL PU`QQJd2 K P0= @@ @Q6 Y0  0S  uX0Po`0h QjxPK 0@KPP[ 44P? Q 0  0 P2 @@D@  RPP00Xe0c0=@P` ꄸ 00 RR@P00R0 0 t0 8 40N040Ja4FK 0P0 408 0S 0@0K40@xPx@ xP 4@&i\,Mb?B -40LQ < 0(   p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @NP P \,0S \\ 4dS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0aP <P WP  RP 0hL 0-LP@&P 0S>P0S0h0h0 0-LMP@)P8P 0S 0*8  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ @@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 .U 00 00 0-0@SLP*00b0 U 00 00 -LM0@S0C0K< 4("4 <0!  T 00 0 0-LM0@SP0C0  KT <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< c@P! M?Kc@P8!N@TK?KS N/K⺄P8!9@, 0R(K081 4A 0p 0cP@.00<K_K<N/K81 劄p 8!+A[ Vi 0-L@PrP0kP fP  0h` -0LM $0 $K K 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 - LR *0R0 - LR *0R0 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T 80K0S00! 80KP 00S0088 0R0-L@ P0PeS S S00P U00 P U  0, 00 0 0d -Lp@`PP \ 0S 0S \0S 0  -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LM0@Sp`P S  KP R `V *V U  T F00 U 00 KPP  0d -L@P`pP @T PU * iU 0SW E00T WKPp 0 d ; -L M⠠P@8K0`px ( 0RP00P0#S  A( 0R$KͲ00i@( -L`M`\,  0 \ /00$ß, 0R(K 0|0 x0 t0 p0 l0 h0 d0 `0 /0 (K!0 0a T0c1\Tp q R |K1S q w Yp Rq w Ypw YpZKZK`,K 0S VX `V00P0#S w VV. @TB*:0V0) |KPdT!10RP5U3`V00P0#Sw 0S7 0S"*0n@Q@'*00f@WY Yh 0R  dPS R00J R*:00ZK #@= R*:00 i4G-P 0@Spp` R= $Q Q*.000W ^*0`0S%J.\ \\00W\00^: \Z0h0? 4 3 #^ #R0fY0Zh P *0S  0 Q0 SPlSPl0p4 00 P 00th -SL,M H L0 < @0 D0 80  L RL 8 D @  L0S@ D  L D D0SD @ 0S Hp8 R @0L IS, 0 00,`040  XT 0BP + SE Q D 0AS00D .W Z<0SappW .WQ \WpW0l SWw 0B>SlW a `P00bS:P.U \UPT q@nP T 0@ R0 08? 4 X0S4 80cQ<0S?#<  cAH0!c  p0S .S` 8Q (K0S 0@ R0 o|@ 00H< P*00H b80S @00@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R0  0 <8 < 0 <0 Ƞ 40P 00h! ( -L"x@P`QM H JM hP -LM4K@`0IQ00 d  K00L ,P #RX  BX yd0@@`@ F@ -0LMp,`K,0K@PT MPe 0!00P XZ@`PTZ .T00X0S Z  ,K K` -LMpŸ0P,0 P@ P /00<, 0R|(K@@0:T<0 80 40 00 ' 2a -`S00LMV00Sp@ Vg$!V00/0 (! 1$1P 0S] \4 V (!0 R 0(1 R  0sCP  R$1 !0$1(! (!0R $1 0 \$1(!$Q(0U  0S (0PS(! : 0?CP (0U$Q0$100,1(1 8#0PS  0 P 1S 000^ P 00c0 !000 0 c -L M@  @4 < 0 D0 0 BP8 u 0 00尀X8p 8pP` 4 0bSE `XPڲ@TT 0 BpPU 0`㲀 XP<0LS8 @ D0ePq8 00014 00 `Pv9(Kp!  P9 ,  0BpP8@00004 fP<Q#D`DHDD8000(K  D0^ P 8 @0008 000,p9  ] P8 0008 000 K P @ D0P 8000 0SD00 00b0 -RL@1  0h͠00,1Ǡ00,1 0-LS00\00SP@ 1 \ 00hꩠ00,10裠00,1 -SL0@ hꑠ00,1Q  0RG G(G0G8G@GHGtF0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`=@$KlUdꔻ -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!1>0 0f @`0 0 00jS0 PdUPPx s 0 00PUb UR:,PG @ `@U0@`` 0@T:U6P3  00b0 @@0 =0 @0f Z0 c6P, ]  P0h0,0 8 =000PF 0 @00j =0 0e `@0  =0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@S!pꔻ p-@PL ``0S0 P0S p諞P 00phꔻM -PLp`PS J0SX@`PUZX輼 0-1L @R P Q. 0 0 0c0 0000  0 P @0P &10 P$000 08#8("(00B< S 0 0 p-LlM0@8CP`Z0+0 KpKmP00: S  Q;  0  SL ( 0R  xU p-LM0@C 00   KpK K`6PP h 0 SPP P 0000C0  0iPP\ -L MpP`0S9쀟@T@0S >P 0S$K$Km> 0@P0dp h0 F00!0C 0@000 p >0S >ꔻ0 -LMpP!8 0H!08!X0 P 21CPU@ J 0S W 0S `D@PUZX W00C0 (K `D 4K;8 0,E>P Z 4@ 8 7>Z4@S00P @85xT 0080 -L MUP`@@0!0SG$q@T 0 0S6 0@P0, P , 0`00 00C8#Ƞ -LMPႠ ` `("HQ% 0 Rp#p4`P) P 0 0`8#H0S0S 0P  dp  X0,  pP,  -LpP@` 0S"0Q00 0w4W@pT? V  R 0B8S`R 00  0R0S00ڲ00000 B! 00C0C0 0 00T00 PWW800C80C800C80R B 0\R! B@-Q1P  00P  -LlM@f3?P0S10@T.0`dY**0VXS'p0WXSpGY:0gSV P@>x/00TZ! Z Z KiVP$X@00z0@0(K *QP n0S @ H-=p@a0S \0S@@@T -L @P  - L@p0 S0 Rp-0SP`P` D4%LP`\pP 0P0 Q0Y` R00B,R S-R+R0S0 C,S R-S+S0SS0SSP0@-P@000L S0!00 00C^00L ST0 0-LMPK@ 0P $"B20b0 :R 8: B;0P  31C 0:S0 P0 00 0-0L-S@P +SPP U00c00 -0LJS@3 MS 00C S00 [?P 0/S 00K0C0  0zP 0.S )0CpP 0.S (0Cfh~J0C0 0[ mG-Mp _" 2e10!0\( 0S1 S; SP` $0/O0@Ѝ43Cc" a*B-BPoP`Y ;\(2@P`3e20!0\0S0$#Bb20aPoP` PEQ 3! 2C 0$#Bb20aOpP`1 !/ b21CUc01 ``L&"!B Ϡl   B 100/0cN!bS  \@! A!0 BA`10aR0BSB\ 2p 1C01 SS Q 43Cc" aPoP`YQQ4*gfff$I -LP( <3aL1aa Q R 10bSP001bSP00 -L(MRP0 L  21C9H0 ^J 0BT Bʌ V 21CL' 0080 4 8GP4 0, R0D` @ < !< Z,0&Ϡ2l10!0X03l20!0X00&1O Ttf!6 p6h&ϠD @0nC(lF8Ld0l`pQZpjmVpG6VjF6mFVpW1,PK,5Ϡ2l10!@ 3l#20X0Xp%1pZKP P P(KSp^hZ040 80 t,pd0%Ϡ2l10!0X03l20!0X00$1W^0$Ϡ82l10!0X03l20!0X00@ğ,KAP  Sd$$0 /Po0@0S@T SUQPRZ ,00K00 P0p,S0O/Q 5GE$Y@H@`_Y,p W^30S80  4 21C" 0080  N21C 80H Q4 ^2C P H)H 0@Q0 SLH 0R9H04  0S0 0R L4Q4 0L@RP0cPPpK,@PDG{ND@D/0C!bb@ae B!a10b cP0R P0H!0Ϡ0l $ "Bb$1a `34 1CcP0, 2n10!0P3n20!0P P 000S Ppc 1 SP0 0 L$@P@QQ,?E.Qnm$Ių4d R 10bSP001bSP00 -PLU`p@ +0c0h+ 0R 0R 0R 0R 0R 0c -L@M0hK0  ! 0SdPK dPK < P`pK< P (K\K PXTP\(0T(cP??0cc(pK2'1C0cq X0 sPnP\\0fP XP,7U“2g10\!0؀ 0 3g#20 `\0` \ T7p؀!\\ XP,,7`\` )7U“2n10!p 3n#200P P &P1 0c\0 Pw\XP,h6ᓎ2g10!00 3g#20^0 ^  21C0!0 R b S\ X0 {XP\PDh ,0;R T0 v>% 0Sh oP`P ` 0`K0`p?S` p `p` p 0/ P/`_P `  a pKKpPK`EK 0 !  0b p ȀgppVp Ȁ P* -RLXM`@0<S t@ @dl@ 0S(K@>0 >S dt@ l _(6P01t@ l0 @, p pP00PUa <Uy p@ d0S,Sn,0>C00 0q03W0Sj;Q,Qg QX5%0  00@T 50%  00Q ^ Xpş @0M͆0@l0, 0P(5 a %0` B00 P Y00 P 0 0 St t ^Y m l  pTd;S 0KP\DK PV 0,SSXKPN pWKğ @0M͆0@=\0 30 h0 3l, b 0#P0l0 B3P ppp\ \ d ` (@h  0dK0ph dKX0KXʲ p \ 00B00B0h0h"Ϡ12l10!h0Q0 3l20!0h R001$#Bb20a/0 dK 0S| x0 NRL\0KS\ @Eh , |Kh d ` 0!0Ta !0!100QP0P`0Xq"10 d1  PR,00jO  1 0RcX,K@Pz͆@ ,0la  pP  P0 P@>%0 >Sp@ dU}WJ \ 00B0C0BI%L*@H*P*\*`*Q,X* -L@ qP  h -LpP`3 0S@ t|3@ 0V X0(0T=H00(0(0000f@P ph`B t - @L -L M<0 8@ L4@ D Y<0K,0 (@ 0S 08@S2 0S&\- 0 S 0QM@  D0,K @'D 0 #0 1D ($K81 0 R< K 4 00 Qsp 0<KN$0@40 0@ /0<S+*X0<S0<SN"1)<0S{70< S0Sx*- ,0R Q \|Y`X% -<1<`8!VL C 0S͆]P !0"100 !0S X @pP$P_0@0XZ]PpZ0=0 @$PpD$P00Z$000\|%H>  -tL0Sd@0 0R  Ph,0Pd\B -@L1h1l 0-8L#@PA (Q0SW$P2 $PP+P0S. \0   B,0hE KPxP 0:S  P 0,00h,UPZdd\P*L*B p-<`L@@1  @P81pl P0 0 p-8`LP@&1 @1pl -@L1rh1l -LM8 4 8K8 K @_@P(K0* 8`K0@0S@W!C T9 0@K00@P 0@ ,P 8`K0@0S@T* S1 00K@V0@K0@ P 0@ ,P 8`K0@0S@W S 0KP  0K(KSVTTS 0-LM  K00[TK0 -L,M@<K^ K -,L@, 00P h%tT -,L@, 0q0P h;tX -Lhj Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@- HXH$H%X!! a. $.ȌT2Vh`@pP1#3P1 <2TPQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  ꐽ -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@Pꌽ p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`ꌽA-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vp落;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000 -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^4@^ @T@0X0@@`" Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P  -LXMt p p`| x0 x&Jᄪ.J`pDE媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^ ^P 0 0(p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < @< @0"HXH%X$H\0 #Ƞ 88#8! Ƞᑃ.,Ƞ\d  D X c.D ᑕ,$.( 40T 2VD0gh`.8C \0C2 8\0CR0CTbP0CX`SdH ZHX \@ 0 3 #Z0#033#d` `FH d` JX H ;#;S` T<h)XX&h@%X (,8 ("( 8ᐂ.#8T Ƞ,ȠL r.L0P ᐖ$".H`LR20cWxp,8C T0C2T0CRZ0C2 aP0C X@S b`ZPT03#030# 3 #```F@ `` J `00` d`:%5ʠlhp` ^ l 0O/@0pl p 0O჏00 T030"S  pl /O p -LlM  ` 0 &J,JJJ@ 倠HD `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40K20^ <@ xP0O@K0 K<0K0`` 40@6|0 8<0 6*(|x("('x*D0 ,XX%X8`h0 D0l |`#Ƞd@ H Ƞh`.,Ƞl& `0 ld0!$Hខ(P` <#``X0 a&8H0 \` H` j&t p` X`P h(T` `g&T\唗)L xHp(Q2Pt.!8l@|T!LP\ 0V02PPhV0*(d`X^ 2\H@` V\`XP\xp*T3#0 Y2 Y 8 S030#p p,0Q0WC)*D@tP|`x 0<@ @P 4` (K%V! 0! 00 x  0O/0X@? ς^p x 0O/ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā= 0P0 0    0@npV@@, 0R(Kju00 <bupW00 UiLN]T -0L@H $0"P H h Q *0S00S0 Q -LMTp,@KP` 0    0RK i -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQH -LMp \, ` *: 0 0 tpl*h: 0 | x 0 V 00\ %\z^,P \h4T h,dpDdh,Dt$0P`(, 0R(K 0So$@ T@d Ϡ0lP0 U  ^00U#3   0 P[h p-0L@0  0$RP`@) I2#8# c .@1QS P00S 0N!QR P00S\Pp80\ -L M 0`^K~`r@P x10鎠7p@PJ XT0 00Q 1p\ ,&("(30b,>0A!0 S00QuKP& 01C0 0 @0 0 (68#8# cN(. 0B 0S   00C 0(K  -LPM0d(0  @0P ,0 U U  UXh@K?  P$ K0DPCM0SJ @<0C>S񟗶t     h     X L @  4        h  \   P        D     4 (                   0$0t 0SPU$0SD3  c P0 Pp 3P6P@    t *@< 00 2P6P0   R@0x0 0Z $%Z: U0 @0 |( 0R$K0000:(00 0000,00,0,00 S,01,, 1 20$00 0~0 0{ @0( ,0 t00q00n00k00h0(0e0 00a00^0 0[0 0X0* 0( ,0P00M00J0PPUJr;PD|s00l0 R 0So 008`,i $0` ->0>0L MS`4 0  (Ko?24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0IP t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04JIPh 400a0ym40 -04 @0  -sLP"`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S A00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S *l1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i/ic  Vii(  b R 0@@. @0N(@a 5P 80|T4pd -L`/mVp P0S0 @0T  @00S0 h0 0CR0mp<0< @80T 0S$hU ꔻ -LMX`0 0&P,  8=>0>0S 4p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P03pp{ !000v 8  x h > )  j Z > h0@P0T3pD p000p ,0RA$r=  - PL M8 P6(0:CZ*`>0N&@8 ppe Ɵ0 +PP6(Q|0PSb ( a R^*0S98:b0\p 0S(KƟ0 0(RC 0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q0S 80Sb (0c f 058#Ƞ@^@0000!1 B("(0,R1!Q0000$ğ0c02!0QB !R 8p00Q00Sg Ze i `d # 1,kp 00Qa  PxpTß0( 00/di(  bE < p4 p4 W:370#2000< ,0 , < `00V00 u Q000,  0V 0a WI,!!q4004 P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a (0 c:37 '8#8!1q14jp 00 44*p@ 0P01p@  0,00P  0 00S000R0, 0``4*YQ0``v<0`Q|p   -LM@8 `7jDppTPPU4 @#0SG#0S2 m 00S0 j@j4  (K$0 T,0 R(0:CV**`>00`  Tn`>:W<0TQP0 0.pP4Bj(Qp0"S ,0S8 (00 c b  i 001 0R0C0U i4 @ 80P 0S i 00x  V!1PdP(  b , pP 0dX p`DP.PgDP$ X0P0d0iP 00 iP 00a e P`( 000H<,ꔻ`0 p -LP`TiLq0S<<.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 RCPt8px p080bp0x040h0TpW'  .@P TUX 0 0CR0T 0hH(K <(h@ 00 R !0S@iXl( R @@ ^P@T0 e2@OP (QD P4D h,P@@<@ 1p@<XH <T. t @BP P(T R*q0S,,P@tia P.0Dp(PL `P L 0@R00 @ P@PbD a e@ X0p@.@4Lꔻh` d4p -L`vgp0SP @0T * @00S0 $ L0 0CRP0U VgFX0 R TIg 009PPP ꔻx` -LM PK 00%0 @# 0ST  @0S0S Q 000100M3*2G-@0 084 0<0   0 0 8M4   0 < R00 P ` p@  l0 P ` p08 40< 0 0(0$ ,$ 0 84 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ 4 0 0-8 40<80 (0 $ ,<  -LMlIS@1 08 ,0 < 9 P8$Q `8! a p81q 8A 8Q 8a    $ ! (00 ,@@ 0PP 4`` 8q88p p < @?\\lK lK<00@ R < 0!@0 0 @ 1 $0 Q! BK@p0 0041 ( 40@,001 0#1 1 c81 `0*dH,a n`0lȠp (q p,(1P,&4 #'a01 ` 0eZ0 0 ( @#1b*,1 c̠1 c<1 ,1*00 (1n00 1dLp0'P#0  #0\00 0,00 10(1 0`#0&@#1nc81 `0dH00 000 0 &#0` P#0eZ00 0 00 b*1 *lȠ0(1 p0'a#0 @# *1l̠c<p`p 1 p0` ndL`p0& #0P'#p0,0Sp0  \U00 0 $ 1 t x 倀1  1|   !P `pP  ` `p Pp Pp @ P p @ tx |0!",#<  D H! L1 @P`p娀嬠 0$L%\&l'|(*,̠. !",#0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0`Вi -L@MTqH`K@L0K %(PTK L P TP @@m0S!P,(Kc0+0H0 D0 @0 <0 80 40 00 ,0 (0 $0  0R0KPx ;Z 00#0@(T0,@D4D4 ,?0 si  H$H jL$h  p-LM,a0SF(Q1 R!A0SP 0 cK a0 0A0^00=x 0P@0A00SpPhPl ;0,P3 @( V?0ꔻL$  H$H H$  P0-LP `k@Te00 -XL0@SPN(<U*01 R<$!U3 p ;0,( ?U0 0`S U@1@!c R `  0Pd0dS0p U0S0 0P0e0oꔻL$  H$H  h H$@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@hm+-*+@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R#@-PP@p0`V 010P T \ 0 S  ^ 0^\0=S P0fC10P$ -LM0 S=S  0S=S` K -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 >]+* 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P   0AV0P -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0P |0Px  p0 Pg  (1S0C1, 0R00001p0q =W0 pU 80x03 |PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 nP Q[ -L,Usage: %s ..., where is one of: instbin%s: %s not compiled in newfs_ext2fsmount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodmkubootreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnamemain%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file mke2fsilog2SSSWTWTbrdfsfsinitinit_resizeinoallociputwtfsioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.verbosefragment sizebytes per inodefree space %number of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:qs:t:v:can't open file %scan't fstat opened %s%sr%s/dev/%s: open for read%s: open for write%s: getmntinfo%s is mounted on %sLinux Ext2Unable to determine file system sizecan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing image%s: %u is not a power of 2 %s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode %s: no free inode %llu in block group %u %s: inode %llu already in use %s: inode value out of range (%llu). %s: inconsistent bitmap block size must be a power of 2, not %u fragment size must be a power of 2, not %u fragment size %u is too small, minimum is %u block size %u is too small, minimum is %u block size %u is too large, maximum is %u block size (%u) can't be different from fragment size (%u) GOOD_OLD_REV file system format doesn't support %d byte inode Filesystem size %lld < minimum size of %lld Volume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O buffer Preposterous size %lld super-block backups (for fsck_ext2fs -b #) at: %*llu, ...%s: large_file rocompat feature is required to enable resize feature for this filesystem %s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemff@fh@@f4fffȺ @@f`f ffunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainiieiiii:iij jusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s ("%s") = %s %s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainiieiiii:iij jusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmv7armOpenBSDmain}@@}@h }p}p }p }` }@ } $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorssectors/trackwarning: %s is not a character device%s: unknown standard format%s: can't figure out partition info%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 $_(oH08< DL fT \ r`؈dl: (0 8 @#H3P#X3`2h3p3x#@@, @@Ĉ̈Ԉ܈  $ ,@4@<DLT\dlt|ȉ Љ ܉ $,4<DP\hpx@@@@  Ċ Њ ܊ @@$, 4 PC$<CDC$LCT`lxċ ̋ ԋ܋@@ $,printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeleditEĺmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor @ 8 @ @H P@@ \ @h(@t %(@@  `NH@_@@d@ L|<DP\dl|ذ2n$4nHpinذ $(,4q$(\s6㿂;{vc'9O8'm:="! 5Ei[HZqv8E>}N.{7{iXiz^T ]Z|ת"4.yw'篒W;}&167M*Qd *OUwit{Uvj_ɿEr>yϒ3y?'0,&in_2YfӫJʫ\%/)*y.LJ(}qUJt3[_5Ƈ?7(>S‹dDy|H>\SCf .gTSͼY#j{^g!a:x&Q?I-7nOt{UJ^N>-=;UQTw;?h+  8)Jf_ZtúV=LU*x\\%ޟ]%')JG?x$x > aO bC{d%rsV:[ ɚZkb {W%n$9l܀!dhIuj*{IZD2 11˵j]RR hgN jW20Ȁ pqf](#SYgW~gQAWO 9MH:_c(̠IfQV-M5pag5;m ?kMQJaqVJ!sӐq/fzwnE"ӳKw;8zuz[SW ZjrfryZ<`b" #o\4Ut+Nj2;,&}C0_¸aP}؝ȫ5J=n: a?8F5͈V̈U2f`HACڼ$w&P*)f•tu&=<9;#0 :MmA*&x"PTp'okm7 Q@*U=kQh%w(DVG٠HA_ㆁ}hSEaP3Ay:_rB"2Obbg%9A#) M6Es 4/[2NiJ Yҷj.dйmЭ/mP;rqt}%_0Jb蟄4Zy)bJ! (F!0"c "6<owًH? X4 [='jW$cKb<jC>j .)hTB=Ƀ|Q͝)kԈvN8a6X7 7B:=-Am$a'>ݔ0"D]4![ 8ź}\, pUoqqo>%yC F'.!ApekK"("bܣa6$uδPslU 9&AVْ7 psXjD*%# a^H֡]_w9/Uij-[~k+sd˥IP>8fqChB03N{r,M0"ksem,LdD5daYx#64pYJv0:[8Xm%Q"lX6`qW:_PcRf5l(ۮ~fRDxx2<hS y(֠Amdirm… Z9EFy!G *S vzPpsB:&LIV9nҍpiE+o]u×<|Rsyj L"~`0RQCDSbEɖZP7`F'~uMV74܉<:FͪZwNwS|UxC*`}!#,Cqm6nLTʩuӢAn|*yT:IJl<O,u{Ќz&t9<z^0! YV=ٷ5H3Vmd]N+}>|>_Pu0c_U\5U]ay|yZ8 qZQ#j7b;+ 1|DH-moM. T1 p16NG1fJY<ހ|+m8[e*Db>!93q@Aqh|j-ŞJZdܝcz4ʚ2rTxvR1*ח`vQ陁%)95'J9EOZ;/VT\xɥi4Q;YQ'v/cX؀Z'cdz6[UA6,ӾVȘp$ ``'0u_#GXUv%dێGׁ2덂K:w.~3=bxܻv\$f=`&vHIQRܱ49 .(V-n5½c*I5x@(Y BL wfX `O:/Pqa޹W YV69x)L? rx4UF d3jkr뼇Q ;X(g:D7wWv5ӈK`4+Ʈ "YP]-f`Jz߉-k t2ƻF? A F_*W*TͧBwW`4"*}<ka̬egﺮ0x ;BTzi_}Vo3WqQ^5S7\=CxD kQzD y{<*Mi@̂B8ɶn0, \B-_0żdmgQœP &CO C2u}|:B93MR6W$p9֙Q'P`roolT3sWNizr0*Ldܰ*21y6xi%ejsL[1%і8M1.ȴt\%KK'7>5{O,ȲE1oT)? J>E2gğ\w0')y'2E&3b6dܼW e\יoHiUWg<ܵB G 9'HF5Q&P.Uj\M{~ ƿ; SY43eJCX"nQ[&KA; iT~Q%]l$68"k<>5g.PCqsSYJy9E#e3f ͹ 7ӋKl@"MӰSOvο&v 㲅01\IB&b4* gka7^gI)JIZ##C-K8i)wG`l10E};]bc9C †6>9: -M~oրDh͞H 716yrIr$>}=6M?7eWb1yA/z bQת3pW$(GQ?~ty\>,+L%0\]5L6KyJ0ʕ02x#x]\}y6VOn`ǎ B\vNt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(]/[rDA?>-)/>zV;(҇TҨqiᆳ\@T0||JXH>s6,?PAM+M%%&AajLWsb~H~*׋Kwx7-/ҕi `F_Mkf&uÿhwꆚUzyϟ<2ڽC-Rusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu Size of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup<DP\dl|ذ2n$4catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv1((9(9(9(9(9999,::::4 :4(:0:8:<:D:@L:,X:нh:xt: |: T.(:(.ܡ:T.l:::ԯ:(:T:::: /</,:X:;;(;4;H<;D;L;T;\;h;p;t;l9|;(;(; (;(;@(;(;ļ;;Dܻ;;;(|;4i i@/@/t9$i i/d2 ; ;`< <<<$<i0<$f#8<#@<#H<#L<$T<$\<$d<$h<%p<%x<%<%<&<&<'<'<(<(<)<)<*<*<+<+<,=,=,=-=-(=-,=.4=.@=/H=/T=0\=0h=0p=0|=1=1=2=2=2=3=3=3=4=4=4=5=5>6 >6>6 >7,>78>c@>cL>dP>d\>eH<e`>h>l>p>t>x>>>>>>>>>>>>>>>>>>? ???$?0?X?d? h? t?x?????? P? ? ?`?`?????? ?@@@$@8@H@GT@H@`@P?P?P?h@h@h@ذTp@@@@@@randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%b %e %H:%M:%S %Y%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_upget_rdomainlladdropt_fillinterface_statusinterface_upget_llflagget_rdomaindefrouter_probedefrouter_probe:sendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacessetting rdomain %ufailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedget_rdomain socket: %ssysctl(ICMPV6CTL_ND6_DRLIST): %smalloc: %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmainZRZ$Z,Z usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmainiieiiii:iijHq jTtttot o@$t,too0t 8t@@tpp$p0pusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[s۸~EWflO)Ŗ,aO9vr:I=gv*5%C$$qL&9ɤξb+Fw 7W׷:fWWvkrU:;0tU|.{xws1E  'VYQȕ\'* \g"SNV.~qQ|~_Zh<(D?I 9Tl"h*BOE6FR,d dž>c "SMC݊_ǜE;G&/*!:+qiavbw>`$2_jOR%LqI(A^dtUɾLRYjkTY(@b\6~ou-9R2R 4۝։[5WCbi)hOF{-5Sq3b*>Lŕy_r,85@2l]<~M/I%C#2J6(#ϬEtv2նa7a) kx舃Y+ ?P_L,CƉ ϖfti ֖;_z->p0ȟ2ic5.f) حqRG"ЭZWdvC-?5~O@K|މkq})./;NWxq#n~7 JHB,i]_oϦe&QNg[{'ߞp0zѨ7>gp4OQn|\z~W(:-Y}^#׈}%}.[y+_Hw#q|xp9{x~+{%~AHH~cs28;þC%g#SZQnv}ۯѸ5 p5t:狱@_G'vvnFOg'g!L‮5sqEó?_Nh(:t_Ɨmoiloߩ(9RL4b6>% h4UCwhdFp S"k+ _ _- )>&֎Bq;c>OVхR {]#!EYy.@d~N^Vo/j|㺐n |cx,Q%[",S*bdaU E2&ף-0̨/ڝbFbp=AəB2,UB1E{dvyڗR8J4"<[EtӦgwNV 7R^n rE-ٟx ?nܼ:oo}McD<`}NfedI|x=P_*k|=Jf&oK3*P]HX6(I҄rT|K0V#tQ+Qy[HR"x&[r}ZD4̃8kϼH]FYg*Nޛ)#8av @]0sy{y{ݩFA+ys%~W/ƣwOQOd<VǥHl*{.+{&dNgHXKqy#nދć+@AS{ #܆ yN(ٷiK*=_)b \8uyj46Se7/wi&ˆs}JjQcq:F4ӼC.dz TK R.GL=(gec^ណ]jiN01%.#rC[ңv6xfKzt[je _WTVGoSյ(uU!) _`",K,568SHj- 8X;M+b kEk߶U0:^3O6&sѮ7JPH Q<\9^SZk(d"g ߹ȩ5WAɍLer^!QNS [QK7vEQZmh=kXt`A5\QUS-$?.&(ocUħ{E@rAgH f>l7\դu-LI 0>|?C|@_./ܘzm:ٳD6ʇ(NJ/El.*2'2۝T3ZspjI2_'HTbjr[ExKY>[NرR 4i &Cqy!mFFJZӄQ}Getns]UT <"Xq* G(6-pTWW{u5K̿k+ xd߁oy`xt~|:0vw8=RG&[(4v9dg/eaԋ~:sƥVLR':IAyL+C߁fkK OjS݈ l\1-] {1jh"3/+y >s̀ !A<حD*`93j,ﲳA{BVo7ԊI<)j@Tf͙ƲHŶ(Uja?|@$m>Yq_/>Ն'gW*wЈuw&fHa9V4]􍇧̃<4 h1o;ΞsQXџ!~*=]R x,ɩZi[,byudLtJ<\=9g w⮜[ SneX.tjў!99)8$u rF\2g翍? ,`w3;\ p6ᧃd2`*6qC[%ˑyOG+5U2@30usage: %s [-eiuy] [-l blocks] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [1..%u].ieuf:c:h:s:l:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.(invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmainiieiiii:iij jr@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after b64 in %sinvalid b64 encoding in %sEdunsupported file %sdup failedcan't open %s for %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message CGISVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longneed message and pubkeyfstat on %s%s must be a regular filemsg too large in %sverification failed: checked against wrong keysignature verification failedwrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorH@GT@H@`@P?P?P?h@h@h@ذTp@netname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstencapexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:Extra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:mno:pP:r:S:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. t $ , 4 <tDLiXusage: %s [-a arch] [-e entry] [-l loadaddr] [-n name] [-o os] [-t type] infile outfile arch is one of:os is one of:%s: invalid elf, not 32 or 64 bita:e:l:n:o:t:unknown arch '%s' unknown OS '%s' unknown type '%s' alphaamd64i386m68kmipsmips64powerpcsparcsparc64superhLinuxstandalonescript%s unable to seek to section header%s: read section headersunexpected segment type %#xesymval and vaddr mismatch %lx %lx mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainiieiiii:iijr@T j(Hqrusage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload59d"l|L ' GX &;o#U$L , 4 @!LPT0``nFlplllllllln]n n,08nDnTd]]0(@Pd0n l,l8<Tlllnll004PTnd]|n<<<nl n n0lHlTl`lllxlllln<<<< <$<0<<lH<X<d<p<|<<<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<<<<<n(<4<@<L<X<dl<<<<<<<<<<<<<<(<4<@<L<X<d<p<|<<<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<<<<<< <,<8<D<P<\<h<t<<<<<<<<<<<<<<<(<4<@<L<X<d<p<|<<<<<<<<<<<< <4<@<Ln`<l<x8/etc/resolv.confCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zd)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)warning: hostname %s contains an underscore which violates RFC 952write_file: path too long (%zu)write_file: imsg_composev: %swrite_fileInvalid option name: '%s'fcntl F_GETF: %sfcntl F_SETFL: %sUnable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longoption_as_string: bad code %udhcp option too largedaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sCould not unlink '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %huNo acceptable DHCPOFFERS received.Trying recorded lease %sbound: renewal in %lld seconds.bound: immediate renewal.No working leases in persistent database - sleeping.DHCPDISCOVER on %s to %s port %hu interval %lldDHCPREQUEST on %s to %s port %hudhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.Unsatisfactory %susage: %s [-dqu] [-c file] [-i options] [-L file] [-l file] interface No memory for rtmmsg%s sa == NULL%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintfsetting routing table to %u: '%s'/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tail%s: no link ... sleeping got link cannot open %s: %s_dhcpno such user: _dhcpsocketpair: %sno memory for unpriv_ibufcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedinterface %s already has the offered subnet!Can't create socketinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)receive_packet failed on %s: %sInterface %s no longer appears valid.no space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to bpf device %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%s/%uUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressdelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sroutes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %ucannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? <LԖ8hؕTX\      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScshxVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup<DP\dl|ذ2n$4 @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvXb XX} X|u u Xh X XV X_ XY X` 8u X{ Xh Yh YXa Y4q Y^ $Y^ U (Y0Yc_umask[ [ [L [ [ ([ 4[x <[L D[ L[ T[ `[ h[ p[ x[L [ [$ [L [ [ [ [̌ U [ 4en-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$0o|\04,e]t,]f<]cP]d`]sp]l]m]npx_modex_search_histkb_addx_bindx_emacs  ^ ^< ^| ^ _ _@ 8_ L_ `_ l_ t_@ 0\ l{ _h  _T _ ^X _ _ _ _ _| _ _, `8 `P 0`t <`P L` \`p d` t` ` `8 `X ` ` ` ` a| a( a d7 ,aH ^ Da Ta `a pa ap a adbteste_isaxd++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printܥkkkdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }lmxdLwhmdcgmatchgetoptionsoaoocoopepppi(pk0pl8pX?mDpCrnPpfXp`phbhpupp|pppcrE0 sph4\vnpppppxdo_phys_pathshf_vfprintffsssss s Ts (< s ss$t^rs{]}0ssssss\` RRRRR]]<>!let||&&()str_valA ]wLw w4Le 0w $  \l?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextracealnumblankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfsnHpin%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmptgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfalongjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdefp|^Ȳ,̲Բܲ< (0Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THREĺ[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL(0<LXdlx ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksкԺغܺ  %m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrglob2SHA512EndSHA512DataSHA512FileChunk0123456789abcdefauthunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory plt$0<Tht,@Tlplt$0<Tht,@TlHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T clnttcp_create: out of memory `b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory 8Tp8Xp $RPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)perrorxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Pad0123456789abcdefInfinityNaNР^[Yy]^[Nn]yes646NONEUTF8 $(,048<@DHLT`h,pxĺSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y__stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG0D\t@]0Tdt$<Lp$8Xp $DTl Dh|$8Pt8Pd$@Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedplt$0<Tht,@Tlvsnprintf !#&(*-/14LABCDEF7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdefT""too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt $(,048<@DHLT`h,pxĺZ-0%2d%03d%e-%b-%Y%04d%a %b %e %T %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():chacha_encrypt_bytes_rs_stirexpand 32-byte kexpand 16-byte ksnprintf|Tt4TpTTTTTTTTTTH9TLYT_UU1LULU8U0$U,U4UBUCUdU`xU`xU`xU,V,V,VPԣ Vt $V  (VL ,VL 4V 0Z > C @B>@|4?@ԆB@ȇ@ЇdBԇA܇?lADA@/tmp/EdDk.aXXXXXXXXXXذ $(,4<DP\dl|ذ2n$4 U(jjhX|P(ľHLTX|d8.? ɚ;0  ...$<i@?D?H?L?P?/P/p/`//t222P@z.BdBdBd(Bd4BdDB.dA"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory~~aЄ܅fffbЄ@>g gBЄ@ghgcЄgggdЄAȅgheЄth8hLhfЄlhhFЄ|hhgЄhiiiijЄAj jJЄ!0jPjKЄЅhjjLЄjjmЄjjknЄ"k,k@kpЄH@PЄ?`kqЄllkkkrЄ"̅kklsЄ!\ltlSЄ!ąlluЄ"lllVЄL>wЄ"m8mlmxЄ(<mmXЄA؅mmyЄnnzЄԅ@nXn"Є;xn~Є!nn?Є;#Єh@nnЄAnnЄo4oЄXo|oo... (interrupt to abort) (press RETURN)[[D\444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUbđ0<ؑ40ؽ8xdH j,̒(<ļt88\(d< @Dw( @4ܜbAB\C`gD$E4FDGTHUd7Vadb@cpefxhiLlnĝq̝qԝrsvwxurrTXdl9txi d    D?T@d[x\\]^^̷_ط_`{{|$}0}D~LGMTܻ,8Ddp  Լ  ` ,8\hpdppppq@8hq:qq..0/.?Ȃlذ $(,4<DP\dl|ذ2n$4HPP @fkh455RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Tpppppq8q :@qqdxz${X||,{|~t}d}l \Lp|pU VxUU- pU VxUU. dpU VxUU/̼̼|t0H$xTt$$X\$XXL(F P$T$S.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppS$T$%ii9iiS?IN=W=(\=Ƚc=нj=spxTT . ..chowndhclientm disklabeldmesgfdiskfsckn fsck_ext2fsfsck_ffsmifconfigminitnmknodmount mount_cd9660K mount_ext2fsK mount_ffs mount_msdos mount_nfsnewfs newfs_msdos newfs_ext2fsKpingnping6reboothaltnroutertsolumountsysctlbioctln6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 urio0 usb0 R usb1 usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 gpio8 R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 diskmap R vscsi0 ch0 fuse pppx hotplug ptm local wscons pci0 pci1 pci2 R pci3 uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 R rmidi7 tuner0 radio0 video0 video1 uk0 random lkm tty00 R tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 tty09 tty0a R tty0b apm crypto pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; gpio*) M gpio$U c 13 $U 600 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R uge . ..MAKEDEVconsole  tty  mem kmem`o null`o zero`ostdinostdoutstderrksymsoklog`obpf0`owd0a`orwd0aowd0b`orwd0bowd0caorwd0cowd0daorwd0dowd0eaorwd0eowd0faorwd0fo wd0gao!rwd0go"wd0hao#rwd0ho$wd0iao%rwd0io&wd0jao'rwd0jo(wd0kbo)rwd0ko*wd0lbo+rwd0lo,wd0mbo-rwd0mo.wd0nbo/rwd0no0wd0obo1rwd0oo2wd0pbo3rwd0po4wd1abo5rwd1ao6wd1bbo7rwd1bo8wd1cco9rwd1co:wd1dco;rwd1do<wd1eco=rwd1eo>wd1fco?rwd1fo@wd1gcoArwd1goBwd1hcoCrwd1hoDwd1icoErwd1ioFwd1jcoGrwd1joHwd1kdoIrwd1koJwd1ldoKrwd1loLwd1mdoMrwd1moNwd1ndoOrwd1noPwd1odoQrwd1ooRwd1pdoSrwd1poTsd0adoUrsd0aoVsd0bdoWrsd0boXsd0ceoYrsd0coZsd0deo[rsd0do\sd0eeo]rsd0eo^sd0feo_rsd0fo`sd0geoarsd0gobsd0heocrsd0hodsd0ieoersd0iofsd0jeogrsd0johsd0kfoirsd0kojsd0lfokrsd0lolsd0mfomrsd0monsd0nfoorsd0nopsd0ofoqrsd0oorsd0pfosrsd0pottty00oucua00ovrd0afowrrd0aoxrd0cgoyrrd0cozwsmouse{wskbdo| st0}rst0go~nst0gonrst0oπest0goρerst0oςenst0oσenrst0τttyC0oυwskbd0 apmapmctlЈ biodiskmaprandomЋsrandomurandomarandomition on the disk. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } dmesg | grep "^omap0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=OMAP LOADADDR=0x82800000 fi dmesg | grep "^imx0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=IMX LOADADDR=0x18800000 fi dmesg | grep "^sunxi0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=SUNXI LOADADDR=0x40200000 fi MDSETS="bsd.${MDPLAT} bsd.rd.${MDPLAT} bsd.${MDPLAT}.umg bsd.rd.${MDPLAT}.umg" SANESETS="bsd.${MDPLAT}" DEFAULTSETS=${MDSETS} NEWFSARGS_msdos="-F 16 -L boot" NEWFSARGS_ext2fs="-v boot" md_installboot() { local _disk=$1 mount /dev/${_disk}i /mnt/mnt BEAGLE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBoard\).*/s//\1/p') BEAGLEBONE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBone\).*/s//\1/p') PANDA=$(scan_dmesg '/^omap0 at mainbus0: \(PandaBoard\)/s//\1/p') IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') SUNXI=$(scan_dmesg '/^sunxi0 at mainbus0: \(A.*\)/s//SUNXI/p') if [[ -f /mnt/bsd.${MDPLAT} ]]; then mv /mnt/bsd.${MDPLAT} /mnt/bsd fi if [[ -f /mnt/bsd.${MDPLAT}.umg ]]; then mv /mnt/bsd.${MDPLAT}.umg /mnt/mnt/bsd.umg fi if [[ -f /mnt/bsd.mp.${MDPLAT} ]]; then mv /mnt/bsd.mp.${MDPLAT} /mnt/bsd.mp fi if [[ -f /mnt/bsd.rd.${MDPLAT} ]]; then mv /mnt/bsd.rd.${MDPLAT} /mnt/bsd.rd fi if [[ -f /mnt/bsd.rd.${MDPLAT}.umg ]]; then mv /mnt/bsd.rd.${MDPLAT}.umg /mnt/mnt/bsdrd.umg fi tar -C /mnt/ -xf /usr/mdec/u-boots.tgz if [[ ${MDPLAT} == "OMAP" ]]; then if [[ -n $BEAGLE ]]; then cp /mnt/usr/mdec/beagle/{mlo,u-boot.bin} /mnt/mnt/ elif [[ -n $BEAGLEBONE ]]; then cp /mnt/usr/mdec/am335x/{mlo,u-boot.img} /mnt/mnt/ elif [[ -n $PANDA ]]; then cp /mnt/usr/mdec/panda/{mlo,u-boot.bin} /mnt/mnt/ fi cat > /mnt/mnt/uenv.txt<<__EOT bootcmd=mmc rescan ; setenv loadaddr ${LOADADDR}; setenv bootargs sd0i:/bsd.umg ; fatload mmc \${mmcdev} \${loadaddr} bsd.umg ; bootm \${loadaddr} ; uenvcmd=boot __EOT elif [[ ${MDPLAT} == "IMX" ]]; then cat > /tmp/6x_bootscript.scr<<__EOT ; setenv loadaddr ${LOADADDR} ; setenv bootargs sd0i:/bsd.umg ; for dtype in sata mmc ; do for disk in 0 1 ; do \${dtype} dev \${disk} ; for fs in fat ext2 ; do if \${fs}load \${dtype} \${disk}:1 \${loadaddr} bsd.umg ; then bootm \${loadaddr} ; fi ; done; done; done; echo; echo failed to load bsd.umg __EOT mkuboot -t script -a arm -o linux /tmp/6x_bootscript.scr /mnt/mnt/6x_bootscript elif [[ ${MDPLAT} == "SUNXI" ]]; then cat > /mnt/mnt/uenv.txt<<__EOT bootargs=sd0i:/bsd mmcboot=mmc rescan ; fatload mmc 0 ${LOADADDR} bsd.umg && bootm ${LOADADDR}; uenvcmd=run mmcboot; __EOT cp /mnt/usr/mdec/sunxi/{sunxi-spl,u-boot}.bin /mnt/mnt/ fi } md_prep_fdisk() { local _disk=$1 _q _d local bootparttype="C" local bootfstype="msdos" local newfs_args=${NEWFSARGS_msdos} IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') if [[ -n $IMX ]]; then bootparttype="83" bootfstype="ext2fs" newfs_args=${NEWFSARGS_ext2fs} fi while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Creating a ${bootfstype} partition and an OpenBSD partition for rest of $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit e 0 ${bootparttype} n 64 32768 f 0 e 3 A6 n 32832 write quit __EOT echo "done." disklabel $_disk 2>/dev/null | grep -q "^ i:" || disklabel -w -d $_disk newfs -t ${bootfstype} ${newfs_args} ${_disk}i return ;; e*|E*) cat <<__EOT You will now create one MBR partition to contain your OpenBSD data and one MBR partition on which kernels are located which are loaded by U-Boot. Neither partition will overlap any other partition. The OpenBSD MBR partition will have an id of 'A6' and the boot MBR partition will have an id of '${bootparttype}' (${bootfstype}). The boot partition will be at least 16MB and be the first 'MSDOS' part#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up nt $_ifdev _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' \ $_lf) _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" if [[ -z $_server ]]; then echo "Could not determine next-server." elif [[ -z $_mode ]]; then echo "Could not determine auto mode." else for _f in {$_mac-,}$_mode; do ftp -o "/$_mode.conf" "http://$_server/$_f.conf" && action=$_mode && return 0 done fi return 1 } if ! $auto; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $respfile ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /$action.conf 2>&1 >$_lf chmod 600 $_lf _lf=${_lf#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $respfile /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $auto && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } auto=false respfile= while getopts "af:" opt; do case $opt in a) auto=true;; f) respfile=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -n 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $auto; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $respfile ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $auto; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else /mnt/usr/bin/encrypt -b 8 -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $auto && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $auto && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $auto && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $auto && [[ -n $respfile ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS local _comp=comp${VERSION}.tgz _xbase=xbase${VERSION}.tgz let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done if isin $_xbase $_selected && ! isin $_comp $_selected && isin $_comp $_avail; then _selected=$(addel $_comp $_selected) echo "The xbase set requires the comp set, so adding it back in." fi done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs; then echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol."; return; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create) >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal _size for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $auto && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _size=$( ( [[ $_src == file://* ]] && ls -lT "${_src#file://}" || ftp -V -o - "$_src/index.txt" 2>/dev/null ) | ( sum=0 while read x x x x s x x x f2 f && : ${f:=$f2}; do isin $f $_get_sets && let sum+=s done; echo $sum ) ) _size=$((${_size:-536870912} / 1024)) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > _size + 10240)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > _size * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } encode_for_url() { echo "$1" | sed " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr >$SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC feed_random ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL >$SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp."; continue; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]]; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]]; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -n '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" || return done } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -n '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && method=cd;; d*|D*) install_disk && method=disk;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp;; h*|H*) isin http $_locs && install_url http && method=http;; n*|N*) isin nfs $_locs && install_nfs && method=nfs;; t*|T*) isin tape $_locs && install_tape && method=tape;; esac $auto && break done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } upgrade_to64time_t() { /mnt/usr/sbin/pwd_mkdb -d /mnt/etc master.passwd >/mnt/var/log/lastlog >/mnt/var/run/utmp } feed_random() { { (dmesg; cat $SERVERLISTALL /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 } >/dev/null 2>&1 } store_random() { { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } >/dev/null 2>&1 } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware upgrade_to64time_t store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ "$MODE" == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $auto && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _f _ifdev _mac _mode _server _lf [[ -x /sbin/dhclient ]] || return _ifdev=$(get_ifdevs netboot) if [[ -z $_ifdev ]]; then set -- $(get_ifdevs) (($#)) || return if (($# == 1)); then _ifdev=$1 else while :; do ask_which "network interface" \ "should be used for the initial DHCP request" \ "$*" isin "$resp" $* && _ifdev=$resp && break done fi fi [[ -n $_ifdev ]] || return dhclie@ CHSETTINGS\00@00@00@00@00@00@00@00@xV4耀C\8C\ `)%2П@P`РOP h0 P: PO ,   F 0@P/@- @L@-@@T \  00{0J Rʔ RP  t0 R R  0S  0S  <0 ,0 /ПP-sO-p`00@0@ 0@0@8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(Kn0 0 b 0  H@-@d0/ 0@0/0@@-0@QQ0@S/,0@-0 <!"( #4-ܜ0@0@ 0  4Q /᪪H@1J@1JUU@->Z'N 0  0@@-808 0DAt&"*" S@NPN00  0Sb("(RR /@B0@@-@ 0PN@Bң0@400 ,0R $ $0 @//ܜ0@0D0@ 0@-00@@-D}A D`@000 0 0P@ꬡ0@:0@B0@ ? | @-Q@p:CbC `3440D0D 0 00P$@ܜ0@0D,t10@:0@B0@D-0pJL0P00008`pn0=#8< 0`1.80P,>000YDVꬡ0@@B<0@0 00@-0@0zP @@B[0@A- p@P`0 0 0#R0 R  T0$z|0 0 00 0V000rVA&l0@-0 `00S *T0@` 24 2 24 2l05l0o0 `@ܜ0@0@h00S,;@@HHPPPP000/ᬡ0@8@-@PPE@T0 0P B8謡0@:0D-@P`00Sp R0Z000 pWPP0Z000 PU0 P0S R\1A-0 P1R H1HA0@ 0 1D"1@ >0Y @C0`000  pT0 0A0 L`dl `0<000 0000    A6ܜ0@`D0@870@B 0t0p@- l0@_PPQH`@`` 0P00@0}20P0#0@00P0@` QPP0@0pܜ0@0D`0;`0/ 00000$00,000 |0R080h080)0000P0 P,0 P00PSQP1 3/PP) 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP CD a P0 0, 0  200 0 10p 1 3/PP&' 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC J(X$*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/D0p@-S(@ S ,0 0,0 ,0 0,0(10,0 0,0(10(1H`VP  P PP,1808,1,1<00[%X,QcP`eP((p@, ,10,1pظ0@0@< 8Q 1@- RH %H513/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p uP +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`BVUh\l0`$d4P`d h0! P \l0@.;#5"0 9000000 CP`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ ~P 0R 0R 0R  0R  XPL0pLp pW*L0$ P 0tčPPp5 tTpGp4x0p 0 4"$ t0p ##x#< x ": S(12P8* PU:Pk 0P@e  0P``  0P ( P`p: S`02P@e00 P1:H` +ݍ0@߬0@0@0@0@0@p@-@P ` 0p@dꡭ0@N-0Q`p 0 0 @T P`pZWV# 2\UT:@TP 0` pf` 0 R /0  b S @ /0 0c0\  BR00 @@ 0$ ? 0 ` 8 p p%000S@D, 0* LQ  `  lQ`  ` ZQzQ0 tQ hQ(" 0(B(0 ? P p @0S{0  aXЍĮ0@0@-@-   f @ Ѝ/@-c0@JpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOTd dH2 Phb 7 ?ñ2 Гh"R 5 C2 PhX00@(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJ   0J8J J8x0J`JhJpJxJJ@]Y$I2X }, }JJDJJJEJJJJJJJJJ  k }  }  k }  }@   @ (       k }  } { {}  } ^ ~"@x0J(J0J8J0x0JPJAJP 2 @ J J(J DJ(J J(J@J8JhJZJL^@BDFHJLN"$&(*,.0@BDF #(-27<FP'@BHERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s Clock enable failed for 0x%p idlest 0x%x DPLL locking failed for %p Scaling voltage failed for vdd_mpu from TPS Scaling voltage failed for 0x%x FREQ UPDATE procedure failed!!Bypassing DPLL failed %p SDRAM: identified size not same as expected size identified: %x expected: %x ### ERROR ### Please RESET the board ### mkimage signature not found - ih_magic = %x Assuming u-boot.bin .. U-BootSPL: Un-supported Boot Device - %d!!! Unsupported OS image.. Jumping nevertheless.. U-Boot SPL %s (%s - %s) U-Boot 2011.12Apr 02 201218:13:04Texas Instruments %s Revision detection unimplementedu-boot.imgu-boot.binspl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d spl: error reading image %s, err - %d spl: wrong MMC boot mode (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table usbmmc** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dCard did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_set_iosmmc_write_datammc_init_streammmc_read_datammc_init_setupmmc_send_cmdFAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s (((((AAAAAABBBBBB0123456789ABCDEF(null)%s:%u: %s: Assertion `%s' failed.0123456789abcdefraise: Signal # %d caught į0@į0@̯0@̯0@ԯ0@ԯ0@ܯ0@ܯ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@İ0@İ0@̰0@̰0@԰0@԰0@ܰ0@ܰ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ı0@ı0@̱0@̱0@Ա0@Ա0@ܱ0@ܱ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@IJ0@IJ0@̲0@̲0@Բ0@Բ0@ܲ0@ܲ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 08xvS <  vS x vS x@@<@TU wS0(wSAvSvSvvSvxPK6AvS vS vSuHyngAvSvS6vS6zFAvS6,wS}wS}{ݫ GAvSb/vSMvSM|b+AvS,5vS {vS {}AvS+vS+vSk~΋9zvS]MvSvS!h2hvS6vS8vS8!+vS6+mvS$vSE",P0sAvS6 vSx+vSx+ Pw{gvS* vSx+vSE",)vS?8vS}>ivS}>i4lvSKovS *_vS *_hstvS# vS# vS# /tmp/fstab.shadows,vScFvScFvScF/tmp/resolv.conf.shadow- vSvvSvvSv/tmp/hostsHvS {wSs(wSs((RwS}wSΤwSΤ08@HPX`hpxxYJ56<_Lkٜ.}Py݄}6#Ԍ_mDY P+,)9 Rmҗ8v5\$t>SB|JPSD'0-oZ995AsW8AhyF9 ~osHI:/ZNv]<hn]c n9M_BXrmhwʫ _ij!BC[R3(]zSKDE[_vX+5gECLd7ȓ܎a*yQJm6k=#kGSk_]hMm_edȪls{Kːj.SoآdKI/WO8Eif aآLKz.qv>v>RzPysUɍQP-8~\yPwG<q0;t*36h G;Z5p!jfk2U^g!8 GCG,9y^VOnaz6jnF_@:F1];W5 kJ"K1ϩ-G{K;TIghL1X9%v:4ŷU»z&Zm0!! U+EdR$NwZX `0RCɒP}w+R3gvX=\@~'N*WuSox71W"8il"f r0D Es%l[ƏeJzReʯN)A}V`&t@WhMk lrԝ\IGoY `)pꂈ:Qsjzgw . .. pppfirmwaresignifygroup  protocols=dK passwdtmp spwd.db  services@=asswd.orig pwd.db fstab resolv.conf hosts ... . ..openbsd-55-base.pub . .. u-boots.tgz . ..mkuboot . ..termcap ...untrusted comment: openbsd 5.5 base public key RWRGy8gxk9N9314J0gh9U02lA7s8i6ITajJiNgxQOndvXvM5ZPX+nQ9h wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: usr/mdec004075500000000000000000000000001227010433600114015ustar00rootwheelusr/mdec/am335x004075500000000000000000000000001220553173000124215ustar00rootwheelusr/mdec/am335x/u-boot.img010075500000000000000000013440241220553173000144130ustar00rootwheel'Vp4Qr64ԀjXU-Boot 2013.04-dirty for am335x ` xV4lElEi 1)  X`OV! d0 P:l\ X00 pW W !   R:/lE$$ //    TOР iHM|! H4P  MOЍHM! H4P  OР iHM<" H4P  tOР iHM" H4P  OР iHM" H4P  4OР iHM\# H4P  OР iHM# H4P  0 /D0P/D/ 00@P/  00@/ @-P@`p00000000 0 0000Vlp@`0t}p@vp@-2\@00  <0 00 P 0PxPb#`0p@lE % 0S \0 +1 D     01    /(%  801     $  (  ,  T /(%000, 01 , /(% L00 (  ,  P \ $ ` ( 4 8 /(%\0 0( 4@Xl pRR/(%0 DH/D@-@P8  800/0P(&'  '(&/D0P &'  ' &/D@-@@ 0sP @0s/@-$@$ 0P $@G@GP/3 8 0s/00@-  @@ P PPP 4P  9904@@000040 0$0  (  ( R/4p@- , @@@l$ @ T\40,000$4 Q  hP @ ```#\` V99;0P@ @h00@000t3\Q  @@@<#p@ T99900002pQ |  R0`  2` Rd  d0S 0 p2 R  0SH 1 42 !R  2 R       R0  1 R R00  p10 R@  @0SH <0 41< R  0S  0 0 R  0S 0 0 R  0S H0 0H R   \0 L  D0L R   R0   Rp&p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pppE,0    0 /pE$0     /pE 0 HpEN-000P :"  BR$@0``v @@  P b@V@T*Q* P@^@T*Q*_0S@-pB@P`  LL@D3@0f@  ,$ 30fP6O@T:YYZ0????////@-@/@-@@-0?????//0 0 "0b0>?0S:0?@-0?????/8@-P@?00 0#0?8@/@-bP/@-"@B@-@@T \ ПP-`0@@ R 8 RP ( 0 /O-p`@0@0@0 //D 0?2/D8@-,0@@@+ P8 <@8H@-;4 <0< S0b0000PH@-,0<  b H@-@d@-/D-`P@ vp S n Ppgp@-P@`       00000000SplПM DИ堀H H4,, P 52:++4`0@lEiIP//@-1pe18Z脀@-  1&@Z@-  @(GZ/////////  800//@-@0   0  lDt@2lp1pdm1m8O:@2>D 4($(\1ALPtE$PZXZ`ZiZ@-N1qZD- (00<0@P p(P@5/P PU8@)  A@b$HH@< @bN@(D B`BpB@` 00P01@ 80 04@Dp@cH@D LZZ@07@-@0`P`0'P  D1K40Gp0Sl 00 5/>ZZZ0 A 0  a/p@-@ M'p0S. Pl 0Idh x00 at0MIPl IPPl;l0PP 0  00<l)=lt0x V;K40MP$P0 0010 0` R R 00 Ps0 10 0 dQ hP Xa 00,@ 00 ЍpZZATxE ATATBTp@-0P@@` nP =pf8pp@-$,0\ $00(00,00(o[0@  /T//@-h;[0@-M@ 00<8 0,0@P0400($ 000 00 00  000z Z c0C0vVUnN/@0TP  @0 1400/Ѝ0d%N[[[[\^ـ'\@-@ /F\@-@ /]\@-@ /q\@-@ /\@-@ /\@-@ /}\@-@ /zu\@-/P l"]//]M00000cSЍ///0//3@?6CD- zP!j@ @T:D@-P`qA$J@ 10# T:@-O:?@-O:?P/@-O@T@ T0?0?O@OO0?@-O@+OP/0 /^@-MP@q `P  .T  +@%P  ..%.|.xp4hH`@XDЍ^^+^7^A^J^R^e^o^w^^^^^^^^^^@-03/Rp@-P@  `8.E @@.@p_;_8@-@/EPE 28@8@-@.]FPPxth. l02/RdEPT EHY.&EP8 4R.8O.8``#`V':`O`g```@-@4% I` @-`@C.\H4/` @-`@6.OH4/`R@-`p@P80@ PP@U$N-0?"0pS p 0 D 0S YP@@; TP/`@ 0PV0@0`% V0@D$@PPP`@4-G 04/ЍZـ)aF-p0,`(@4P0 EZ Z-TT`-- 8 `D000-- 0P -80S G0`00x -dDs-G& T#2P 0Sraa`aaaN-`lC. p5P3V<3@ @mG>ETP@P*EP\E- 22/戰R .-#TGCP$-JGD[ -CPt#- h-8GQ P-1G.G 2R RR R P T0C @ P 2/T ,ꘑ@ 0@D0G P,kGTAT0S|B DPh<0@]0 \  ^ 1L1XDQ S0`#PX`SS SR@d00 h000DP l0 0p0 00EP |, l 0 HP PЍE!b$(bV'=`R`g```Zbybbbbc$cIc/N-R(MP0p`0  00:SS #S  *P{ @T  F0M3 RRO,i ^ T#q? T! T0 T@TF TN T8LSHX00\00]00$0 000^@PX$  aRx0dh 0t0 aD@Pt"x~BlDlp D@ 7/@Pu  \27/@Phj@ 827/@Pc D+m 27/X@z  0oPrAJX0H0\00]000 000Pp pD0S "0S+|+pE  0pY }2A X a]0SY n"P @P0T!(`0F3?3/@!E^ 0[ Y Ph@^B^ x+E  0;/E  0@(ЍEmc%cccccdHddddds@-PT`5"P<a@P000`@B+ 0|dd$d@-&+eD-MPp.`@U00p0 pp P.0 p ct0 0x000BP |000 00ODP T*|It 0  0Fݍ$$cIcF-I딠`*@4 4pD|Pt.I.0O0R .0S0* 0S< *P U *@TSff$󪄀R@-`@*ڴ!P*$ pP jZPV `PZL *P37Z+:gD&Ggug䄀N-hMP )`DU)Dy*DUD @+pyDUp  0VP+0,PjD $0l0 D00 0F*0 `0QB V[R)`p@0`L0'tʟt: R R`!   D  0@ m0 V ]R0]Q jy@``3000Vp@00@hY PJ0@ aP>\ BgSU00@?U0sS옟 p@P)0nS sS9U7Y` D"P0nS` ` S0@nS T@8  P  P@0S0sSg 0$@T`B00vSPP%T4 4.FP T40 pPU \laS4P  sSy04 |4ylS q lSpSRp pU U @ئ@f PPT  0PU`  &@t&F 0@SYEFHFFFFFF> T0 %P0d%\ %@T?%2PDU@7d%U@0  P1x 0PP.T$<d%T$d% b%d%TTP P}P~%4U y@Pq|@Pjd0hSBCL0P1r%045_1 k%01f%0  1a%01\%Y%01T%U01M%U 0 1F%U0$1?%29%|7%t U@P 200 8FpP  @P 02 0|1O .pPO00pS"APp`$$ (0@Px3,0lP$ 0(00 0$UHaS  @P,1 0@P4dS *0@P$$,0cSUU@@UP   P @\`/ 0>/@  @P0R1`ЍFIrgrrr"s%sXsssNFssـ tt-t8 Iꄀt0rZ Lt0䄀Tt[ pt2tvt}tzttt.[sttttuu0uGuUuluuuuuuuuv;vUvtv|s@-@-OR@-@0iS cS9sS tS4```` @P&yWP $V/WWP VP VPWPpP34W 0 $\Wyyy@-$$  `0 0"0 .R00@/R 0S/R@-P@pB, `2"P  0{D{y$\RF-@M8  pPPp  @ E` "0 0 0V PP@(` 0eST $u""ЍJ{{\RF-p@   ` {PP ЍF  zp `f@ @ 0WP ,:"  Q0 Ѝi{RF-`M@,  pCPP  P1#VO  @y` 0uVP !Ѝ {RN- `1@ pP`!  @U  ppPPP`!@ 0@VP ! T1! T!!b<PYP  %T  T0 3?0|0Z @ 0VP T!YPZ0 pP`ЍJ{{{{{{QzR@-V@H! @,~!V@P w!{{{//᠆ 0P/᠆R@-@H`! @,W!@P P!||9|@-@ *R T T T  A0N-p@P`f렑] BPV[ZRVp(0*S u@0*S mPWAYYYYYYp3P P"@W$ Z0Z 2$2000#,  0(2* 0P $ @0, 0@ 0 0P  U UgPtT:d \J,,2SeP p $P 0 UpPȤ0,2"0 $ [ 0 Pd0=Q5  00P0,`00 Pfpn pW 2 R R 0 S3P*'     G P3  L$$0PS D P{ RB` P 0 ``PPPT0 S@P PU0 LC #8,  XuP LO10a 000"  P,PU) 0 p  P W 1W) 0P PPS 8Q0 R RX,000 013@ P @ @0@'P 000 0 @P $ P:  P)%Pp S 0SCލ@KЋ9׋9VvlMҌ=RD-P`M@`P x u r A*`P:g 6$4P Ud@$ Y0 R Rxp d0}\{P 0 H000 0oPU@TS0ScCP P 00 R ßR  3 0EB@<|=x,0*l(0ESlT PP  0P2  RP P PURp OppKppp`Pv`>P`v`?V{tŸQ 0 ` %  Pt@Tq 0` PP 1 Q PP@U@@JPUPPCUP@ 0P:P@`VP5*1 U ` P P  0 0R0  B ` 0 0000V0C0 8 XP |x`ЍaЋi9󍄀@K?[r̎؎掄񎄀#ـCO0@-M@PP"TʈG 0pPd0  00 R <R80 ,0*Ѝ0Ώ@K鏄8@-@PH0 R<80PP8 @82F%N- MP@.p@,`P \ P LP <P 04   `0 0&0`0@vYP 6++7+)P9+) 093?@00+ @@  0UYP 8+P@9:+00 @@K Ѝ軐ŐȐ琄h$RD-MP@4R ``0S 00S& P# 0P000S bLU>ʁ4 0   d!!!  Q4PEs+U%Th,d3P `*P P`p  P` p4H+"5D+U5>+6:+ PHP 0SD67*+0  00Ѝ2F)4K8@-@00$|PdQh \"%PH@80,8@2FhmБݑN- `@P@\ 0p|p3W pYP)  0P"00 R|  0 L 0## UT:0@RP0 @@Ѝ쑄2FF-PMP`0@4p  0 0 ## "p 0P.Y   @0S 00S \ RhFXPD 0## QP06 @Ѝ2F2ZeqN-M `P:Y`0L0P@  @V@<0P (*P  : 0S @vpPY L0S  XLL0Sy 0S (|Pp PL@ 0% x4 1/P < %% 0%%SR: PY `p P l`p`3ppp30 \0 D p P0 TP0 <P300Y-`0 0 jh0L 0X0P7@L p2$ ?%@`'&匰'D0SWO2yPJ- P tE@pU\7\P@TH@ dPY  /pX\ KV6F&p @p p `@VPP 0吰  0c p0` P00L000 01/P 8MK@Kp@'r"Y  0    $ (,0@Zt@4p媡p 0 @ W@@$ PYL P  尰 `4pp@p3Wd ;3.2&@P. PP*h0 0X `0PY T 0S T00S  &R0P P`0I0 h0 0X0P`0TPP0W%P@MP 0HP  CP Upp"U-P@ 00WP0@嬠0P%L1/4U. Eᐰ' I 000W  00L00P1/P  0< < 0 @ PY  1WP! \<10P< <@@-@+hϿPY_ pP@ |0` 1/P  @  Y 孿P@@00<Ѝ荒%Ї2F=ǒђגݒ蒄ޒM (GY㒄Lmܔ2Őᔄ&&9AlF-p$Ml`P@7P  H2U U U PzY1  1 O@@'fP='PPP@6'\Q3'|1P h`1P LD0S 84 R ($1P 1P 0P 0P  R UQ@& <0R&k@PRT&$Ѝ`Z$ AIAI񕄀AI8`I_I @I^AI|`Ix`I$X`I+GDA>R@-@@0P P  0iI2U@-@`0@DfQ`QT\ pP  -Q  (}PP@DTP ,$0@-@P,M0 0 0(0000@ 090SP `9 P@ @0@4兺PP { P& ,Ѝ0,$R@-@  -Q  aR@D0T pP`PP HPD  P(P `V×䗄R@-P@pB, `H P  0 j [ 1dP g 6 d` 0U<  ӽ00S`3 00S/ P $0+SPpp$ R0! RW  RB b00x  QA  nU U68@fdT :T+PEWU`ȀhȀpȀxȀȀȀ @>T t5:PTd`HL8@,ߡGchnwȢ}⢄բ󢄀BF-@PSp` 0(0 PpS$&R 0(P (P0CP0SDY0  C,$W 000` p|pp00p!!0S S  1`0P H00 (0(PHPt6S` (P `6VAYa+ Q@-M ?@0 0K 0P\:% PS DO@M G0S B=p&a` `  /00S S S!000SLp 0W1Z$ЍNxUGـb죄tq鄀ݢ%/=7@-@!P=10s#4 !P ( H0(PHP1S x!Md!P!DC?0B/ s #4>LivǤRD-P M@= µPP"%P  嵵P %,4$ 娵`P4"40S|  p噵`Pd@c$PP $Q : K@ T `P0U@#PP 1S]@ T P᪹pA#@P 0S P Ut41S: @HPm* $@P$U@PW*`P 0S U@  .P iD*0Pz 0S .mTk P&@b0SlgU K p F PA @0* 0`UwL$8@-@QP PP 0/P8`0UA U8\ ,\0(  8\  \ $ \0 88S݀-@-"M/( 夷@c"ލ@Ѝ/P@-01,03/SP@-01(03/SP@- 1 03/SP@- 1$03/S-0@-"M#.@, iP"ލ0@ Ѝ/P/0 cP/0 c R/0 c @-R0 00$03/@|cS-@-"M@T /( *@"ލ@Ѝ/@-0@"M T @"ލ8@-@P@T 80S P P8M 0 /M0/M0  /M-Ѝ/@-@P0 @-@P T P @@-`P@pᨱP 壱P t坱P T :T 4u0j  /@-Q0@QxJpUhDQX?DJD9(0Q0@2@=īS̫髄񫄀p@-n@P0 44 C UP T@TU0ST {xU s4P@0`@ T   p$SX0Pp@- P`@ bDZ $0T: T@ppN 岱Np@-@0```^P^PZE U00Pep 0 cR  a4 p0`e``0 Pe Pp Np@-@Pp0D R `QP 0a   0 4Rp814p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p NrF-5 R0SP @T@~T*@!x51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0    P tPPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~xcQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   0!` 0dSbʬ1 4p4pszpp~p pPK P*h1VFX1 UT!  0 ppp2 pTi  00cPp0g~p~ppp' 0e  0ppVPp Z0  0 J 0Z00 0  ` 08S80< SD <0@00000dS$ 0@@0N @-p0`PWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   L@ D-@QTDIT @Z @pP PGQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000  N-@Q@%TN pPWD`ppVd$0S      S   \4 g00pp\ `0 0 0PS Pel S80[e 0 0  F$RR 00R00@ 00 0$R0 0@00000@0 0      ᫮"0 g @000pp[- 0 0 0 0  F$RR0R00@ 0 0$R 0 0@0000@0000000q `(Y* 0 0  F$RR0R00@ 0 0$R 0 0@0000@0000000 `7B(PP" 0 E00R00`(  F$RR0 0R 0000 0$R  0 0 0000000  @h0g S  p 0p    W  ` 000@ P/0 @/@/P0$ <0  404$0Q0@// NF-PP6 ,`P P. @P P0ᠬ'pV# @P  ᝬ佪PẪpP 9/PP PVP P@:PPF-pR`PU PU 0S- @ậ0P) @ᴬ0 s R @0 S T ,R:S,S: S8 0S ᚭP ᗬT" !* @@T0 S :SP0@0 R \忬PPdwP (g'00/8@-P(@(( GD8\,$4D-(M0(0@0`@@0 @0S V 6P `P` ePʡPP @ TpEW  0 (Ѝ,$85pN-R0@2 Q`P@Z  0KS{dL0  00( 0 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 0\- W  .RR&pW)p0 0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T m ၩP 8 0 (`Ѝـ85 `}  $ /"'N-M⠰@Pp`V018#00xh 1/0P  P2   D1/P0P@U T:UЍ2F@-M|M ȍ(x0`wP &(0"0@?Ppp `0@@WP0 000 Ꮱ|x2=P h&@P PH|Ѝ؍,$X5Ү:Iݮ2FN-@ MT#T018#p0`| P0xd 1/0P     4J>P0`p8 VW:V Ѝ2F@-M@M&?@?@P +b@Ѝ؍ //@-p@]4!4\\0 (!\0 !\0 !\0 !\0 !\0 1\ 0\ 0\ \ $\ (\ ,\ 0\ 4\ 8\ <\ @\ D\ H\ L\ P\ T\ X0\ \0\ `0\ d0\ h0\ l0倀܀݀8݀`݀݀ ݀0Դ0𷃀h(,N-@Pp`P9 @\*0`p ``<Ͽ `0S*0 00ؠ3? R*[Z :`p[Z* PЍ@-PRp`@ 0P 做P003?0T0 tP003?0, @-0fP 0PF-(@ P 0p`P1@0S* ! p `pZ $0J'('D LP@AJ6o ap@-P`@iPp 0%P 0pG-`P $pU@PW  0G 0P@N-` MP8@P:pVVZpp@P  0!SRნp Wp 0f 0TP @"+ 0řP P p6o`'`t 0`呜P @T `@ 0: 停@P  Ѝ8@PcD-Pၗ`Pϝ.ę@P  @P`pP t 0qP P @ 0>`PЯ89௄Z7@-P@*P  0 Ѝ0@ Ѝ0,@-3Ͽ0#ЍN-P@`p(40Y 00  0,0  0P p 0"p@-$>, ( ЍN-`Pp(,Z  0˛ 0P Yp@@-3Ͽ0#ЍN-SpM@`(,  0Pw곖PP mP !NPPc^00!|1偛PPp lNh.`p)0G1 00@1$0000P((1g  0  0L kR, $0 0 0 0C kR0PZ0od 00`2PPP@ ,pЍU`51[e۰簄,@- a  0cN-8Mp (|00040eP8`0 ⮪  0PP T  ϩpT  @0S@PU00 d 0P0P0 D 0 (4`(PF,@P8Ѝw5 .(D-`PM, p 0@ 0UTup W V0 AM1@2/@@N @@c4?00@09PЍ 2/ k8@-P@P8Mޗ 8@ N-PM`pPᚘ@Pd, 00@TpD-@2oP`$0P0 pᐙPP  0 `凙Ѝb\p@-P`ᰖ@P@ Pך ppj0@-@QMP4R-8\ 0 0L@xd h0 T0 0(@Ѝ0脱p@-@`Pၖ 0p@N-0`C9pP"nP  p ` 0&PLx   UT  0jЍ跱󱄀#s@-0d `PP 0S@4O @8 0 P !V|UD-p@W 堧 P囧8 ћ  B`40)W ㈧`脲 000R0/0 R0/0/0/@ 0S/LNꩲRN-`p@P-0A P @"@T|0 PT P[y( @PULN䗄@-Pò@-    N-P@`10 P @\ \ ` `P PpP0p0 00Wp``@TЍ@-DPjò0p@-SP@  R0S 000`0 0   0 p8@-@P0 PP 0P8F-P0@pS0S0S $g0S 0W0 ` V:\R00S`P RPP a 0 !0\R0  Spp 0So R]Hc 0PsT$P/@0     0_S = Sr//NF-@0S`L000pS|| pt0010 pPqp0Zq S(q1S-)p S ܠ yv  P* q 0 ! 0 q 1q0S 1  !`lP``P YP 000S PP 00ᲄQXOLNp@-` @R Pd e PA0S  `0 00ppR8@-@P8@ P \P 8겄8@-PP80`@$SA0 ?S8<4#8͠P8@TLNJ䄀F-0!0U `@P |K=ʠ`1Ppp@AᥠPC @T:Z00S + 0S {&Z0S00Ѡ@̠P0 @ @@TP@@ @ )PP\P NﲄLN2N-@ P` Z pkP  @` V : PpP P000-SP =S P  +SP00 P /P R  5P  0-P X 0 5 1Y P PW:00U 0S pp pU R@   ᢟ᚟`P00 ޟPtU P0 @P ʟPT ЍHp@-`Pp0AសP @Tp\p@}P0S00p@0Q 0S LN2p@-@PM`/ 0S, ㏟P 0S ᕟP7D|00p0P 000 0@ @0@ 000000 0@@Ѝp虳`DN-00MP$ R| `R v  @T<7AQ  R RR  R 6 !`0S0 ,0p0`00$0 0 000CS *PQP@ TppW p @pWpT0q0T p ,Q00Skpqp3jTppWuT~0S Q[00ZU 000 0$$00(0 :g, S) ͞0Pi ՞0 0( m y  သ $!p  00S0 R P 0 0$ 000  00Z $0  @p0 P 0 0  T TQ T 0R000S #SaP [ qPZ2 Wp0p=`=PX0`S00V Kp0P`v >00Z 0 0C 03p p0 Q0P R@ 400P 0R p `(   (0HW`p 婝 ᥝ0Y( pYߝ0  1414c ;ÝP 0 < 1`v 00f`43. 0,043 RT#,  T  V 0SS 0S @ @p @0 @p`0SPPUZ`0ЍLN)}NY[PON-8M@ x pP4$P`Pz(P0P,PLV $< ,P8 $68300` 80 S 0050S[ U` 03/`[ 0KS0S E[PA U[  U0S(0S3&U "U U#U $U,;U 'Us\U |U 0S 0S 03/03/ Pp# v   03/03/`p00 0  03/p0P0_P?P {P$0  ol if 03/]_0  03/U 03/}Pp}PE000S C 03/'Pp20000s030/&V" 03/ |V 03/000Sl  03/Ppq_ 03/pP^1 !O p @w 9 D1`R`'4pw1a,0S 0&0S00 000u  p 03/#,`V,0 P!P,0S 8ЍNLNlӳ@-,00$0000 000 AЍl8@-  ڝp051P0 0 W#S 0 *㬘 *㴘0SG m l L 8mH6UUU갶ض`@-pMPʼn@P` 0ӊP!,  @TЍN-`@P៉P@@<pZP  _0s TS* 6`P >* 0(`$}5?? 0 }? p  ,P PUD@@PƾP9LUη`@-Q p$`@K  @|P P:5;P IP |u0Sp 0Sd@PP L D0 3?TU2/@ ST15:@r^L*W DP( "0S $L 0P @@׈P 02/Rl0@3?0000g`=Y`n踄D9D-p0QP@ S`A00C00 Sʀ0P S0000UU0: 00C000C088/D-@PM0P`0 `@`p0 S S S4 S <S  S7S S2&0@0eJ00F 00C00S0@00S ` 0@0S0 S0S ` 0r@0 Spp Wh0p0000 0 p 0dp000SЍ88 ~Q@-@ 0 S S S !@0S S S001G@T0qp@-`@ vP (00p@PPpD-P@  ̛@Pt`) T Ps@DβPP P@z ²PX0%T00S U T&15`?bR@-`P@pPP4 eP@T䗄@-0M!  AA @ A\PAp`P`V" P@   RL: B q QaA a `W p@ P Q\ B:\:Ѝ@-q( s 0⾄ 7@-P@P , 0=P0/S   0/Pd 0   0$P 80   d >$$P U P e,00}? 006S  0)06,U ,U \L , PUZ0 0 00S 0 0Ѝ-8s@-0% @0`$0S  jS PU0S `SP 0S0SS 1S1S S|„N-MpMGP@?P`` @ 0S  R  p !LMQPZ06,0 3/R 0S0SSJ ό000 儠20@00 00 R0  0 z 0S06 B0S$R"S S W L@ M\d Q p V L@ MK„5Ä@- `@`@Ppz0@002A00D0000 00003/p%N-RMPp` 1p`p@6)/PV 1 \R Ep0㓶&QQ; Q9 <0 0 8< 4 00 8< 4 000 0CS$,4<< a 0 ,0 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKȄȄGɄNɄUɄ^ɄgɄ H- 0` ?0?0@0M?@?@0F0p@-PP P P p@.`@ ?P0?p<ু/00?p px>F.81˄@-\MXP@p,pT%H`᪀P 0p 8<(0:t唀P0 `厀P0003D冀P)0p ̈́ `ƄPpP P bP  0L%080 0<00@0 ?00SS  囄 D唄HL0P0D0T0@0X0000\ЍY˄˄钄˄˄ 9˄dL-$M`@DQ@0p0< أ@P@P$ 0 R0^ pWp"\p  0pP  0pPX P @@H p0R 0c0$Ѝ%2F ̄9Lm㒄"̄0@-P@@ +91˄0@-P@@ A91˄@-DM@P0@,04%XIT`pP000  D@  88@%̄̄@-@PX0"01 R 4!@DO?0N?@%@-@P <0"01 R4!@D4A@%D-`Px0R`@q1 RZ e?>& < 8 1R4!f4a@%̄̄@-oP/@-,@02s0S 2$8@-P O0"0 X0p  pPT @T*0qs80 "8$̄p@-O``0p<0SP PὝPJPP40Q0A0:s0  0 P *0 !0)o䠟*D 0@9s0`V0`j0 uP+0[0wp[0z0)*0 "uU0 "0i00A00蠆@3̈́;̈́ $[̈́p@-`Q0:s0P@7DP0@I0j `0*^P  0 *r  0*(0s0S X0 0" @b@0 0 "p$RN-`p00Sr@j`y`0 0S$ PM Pzh1 jX   PP1  P\ 0  j P    P  q" t0P 0"\  U D @@00TЍÿ́̈́$̈́RF-p`!4@(P0:\ 3tP0q 00j@d00`P   T0ק0ֵ 90@`⸒P@T@7 0 0"@̈́̈́$&΄T΄P@-L@0@  P8 8  @T eu΄$HHD0/$ 0@-R@ 0P0S 3/P@-@0S 3/P 0 R 0S000N-0M 0 0P0@M0p`S( PE \ 0, 0M $ 0 W}00  P  RrP0$S 0^ 0$Ss R , )}U\` 0S PPQ`P 00 \ R^&0 $ ,0 0  R  R0, \$\: B R | r      P8& P  R  Z( ɷ ႑ P  R    R(ɷ PPU 0 Z (RP  R   0 SQPPj Kl9|90@-@T P@@€ 0 000 /7@-P @R|PcP PX0P P*6 40PPa 0P>9%g%@-@P @(:j{PP@-13/@-@`P  |1 3/Ѝp@-@ M|   @P}| Ѝ-4M,0  100000 004Ѝp@- M 0`000PP0O 88 0 P  < S T D00S 8PUJf|@T* Ѝp@΄΄@- M$ 0@000P Ѝ/@-@P 1S 3//4 @-0SP .F΄N-(Mp@PPW P QQF 0 e00$ 0C<0e Y!@0S0B 0 00Q #  $!(`P  0`P   &001000`P HGV  P?P PU:P(Ѝ΄:τN-8Mp@PpQ0 !  $0P`$Q VP1 Z U 001@0 SP0 0 0$0000P P0 U ! $PDPP0`V ᓐ)8ЍLτxττN-PR0M`M @P Q PB0 !   0~Pp$ W1[ 001@0S`00000000bP[ 0100TP <  \0 pW `*0ЍLττ@-@0P 0 0 @@-@P1S 3/8< Q! QH%H5N-ZMMP0hIZ  0 00T0\ X0 PPG p`BzP +Z΍0 T088\00X0PP200`0#888Z T 0X0 8 8\0P U0`d ^h0l`d h0lQ^ |\dlt($ A0A RH@0P D@@Q@ ? #88 R #!  ⯘ T$1#)<00P  S<0+ 000000YO@?@ T7Z΍ 0X0T88\0rP A SB: P0S0 84 0 < *&!:S R00CS`ÁhÁpÁÁxÁÁ864606,6(6000Sh00S%20 9000S 0000P  +0L0Z70p00 0#ptpPZ`?`30tp0px p$ 0$`0,0(0P pW03?X0S Q2/\  $:Q$ $$0 0 L0<L04RH op`Ⱔ?`Z.0 4`0004 40@0@00<080PO03? 03?%pWP00S4Z΍  00D 3D`0@0P00L0H0P*03?4SL0"  L A S:o `?`P  pP  P0S L000L0PPP L000 L0o0`?`0'  bZ΍70 T0 8@X@8\0SPZ0T X@0 0\0FP0 D0@-`@PpP $ 01/@-@4` Pp>ApBJ߄e߄@1 @-@ 0, "` + R!0S   Rե0P0 P00|`0( P: SP00P0d0L0]rd0   1?C0<000800400000,004FlEv߄L=H4>ApB>@-$@` Tp P0000 P T 0 0 0 Ѝ@ Ѝ@-0000@- l 00Ѝ@-@-P@p` 0 00P= @-@MPpQ` 7X 0p0$8 0 $4 00 00 @ЍD-MPp` l00 0+ @Pr@ 0! P0 00 0 0@@ rP:@Ѝ 0D-`p@ovQ0 jvQ+ PP( W 0'0 0 $8 0$400@e@0P0  hP P T:PP PЍN- M @P 0g `P> v p%v 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:``  Ѝ@-M @0P  0 a P}YЍs@-PP@N3 P 0`P%  P@P:7&!  @X)L N@ NQ0S|߄߄߄ )ـD-P`p@P  V(000p00 0dHJI@-@@?@- 0h0 @\ 0 S< 0:0080$0PCP0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p V@T:00Sp0XQd@j P` V@T*@m0Pp4F@-`0P d@p rV@T:00SX1Qd@j`T0 P` _V@T :00S֢ Ӣ4FN-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P姢0@ @P0 ##U 00 00 4F7@-<@ oi 5\P 0P>0D-p0P<@ 00 Sod`P `V :p 0 P$Sm  04FD-M`p@P p0 (0`0# 030 RPUP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ=F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\STH0p".d &.0h  l0SH0, =x SH0p.d .0h  l0SH0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(PUЍ2Tv"3_I ᄀD-p`@%PP{  @P PP^|1 T040Dp@0 00L000H000P00* 0  Z0tR000<@ 00,00$00(0ep/0p`S0,0000Wj`  0@00< ; ;S s04 000M?M @ @ @ @  40,ᄀ@-@p `PP  ᄀ@-00S 3/@-00S 3/@-@-0 0S 3/@-@04 ,?<100rl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`I0`FV 0##0ޚ !"(     "8 \ 0 1#(00 0P1!4P1#000v-㄀N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0僚# py)(  S py)4y)0 p圗)8 0S f-㄀N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Y-㄀㄀p@-@`P9Q" 0!",` !!4!#000f9p4 0 1!41#000p``@@ Pp@fV 0p@T  0p@p///N-p@Pԑ @Dg0Sj``g 0eSc0-S  V0$R0s0) V3!-KP V V0sS J0bSsSE K0P0 C R RnStS5@S/Q,: S'  Q# 000C S O0000S 00V1@S@0000 0R@ @ @D4F0 0C 0 0C R0 /4FRD-p`B@ PU L`e@QgSR@-@  B P P 00000<<0Q@-@ 00000#40P0SC PUP0" P  0`#V? P&`V?#0`r V? pP "$ Qq R00pJ`~Pp1~p# `K0W00 S0r0Q #$0 0CQ1  0 0C \/ 0p@-P(@`4@D$0S 3/<`4@4@D 04 (0R0 0p0@-@@ 0\ P\ S0S0/@-@ 0S 000S3/4F8@-@ 0S(P \000S ,0S 3/4P 04PE4 (0R3/00084F8@-l0@00S 3/ 0S(P 000800S 3/4P 04PE4 (0R4F1S0101/@-@ 003/ 0@ 8@-hrP@0 0S 3/000018 8@-hrP@0 0S 3/000018@-D0D00@-00S 3/x0N-(`&Pedp`=f+? Z18 ?[ paJW0@000@000[ [ 0 0 DJZ 000000 0 0 0 @e+ P Y 000W0@0@0s00#$ 9$0Dp@-@PT `&n/A!Q4S\CpQQ \  V`#tA`Dp@7 p^p@T T䄀䄀D@-@0S00[ Y@V@-`P@p1S"@P3 T0S䁂䁂TܖLHD000@S@00&4F/䄀,䄀2䄀5䄀@-P`p@@0S PPF-pP `V! #0崖M D 0 0`S` 4A3/ Q 0 0`S` 3/0$@Th000S 3/0S ؗ0 03/ї 000}8䄀8D4Fp@-P8ř@PB $0P@$0(0003/P`0 @0 R(  0 @:0`0,000S 3/0 03/`PX0 00S0`0010 `m `p|4FN-`崠Pp@z 00 0 70:00`0`  BR񟗎|ЊDS$$B\ 񟗁괅D䅂DlW@@ "H@ 001000000000R0 0 W@1 @#r0 t@$[| S+[F[1 > T;` 000000000<<00S00 R @Pi>d0? ([  R  l@PU0d44I4 R @fTt00H@D I R@W@1@!(D8 ,AH000P $@ @DP 0(P 0044J4 R @ @D 0S00S RS p40P0$` 0&  0[P&P(@  0NPP4@4@D  0@P 40 S ` `F 0Sp@W@1S 0S T0$7 R J R@-@ 0 4P!  R A \  !<"<  R 01S; qpp+Rp 0 $ Q 0S D/@0SQU 0 UY#P P  0SeXn/\ P0 R1SP 1S01TP1SO !L L! T 090D@ PR? s,200@00) g@Q ,:Q0TP 000P 0;D0@ ! !hT 0001PeQ Ѝ@-@p !@RAPP @` >@00@Q0p@-@`@`YPpP PpD00PP D00TP 0000P 嵌 pp(6F-@MpP婎`Pu 1P010110`R 000 1SL@PSt@ A@(㎎P @I0t0000103/@T#@T 0$4+ H@(Ox@ 4@ P<@P @0T@(0 \@݌P@ HP?0$$!$1*B wq@0t0019 7@51 0` `012/110X `#@P 0 D`0x00t00p00l0(0h00d0$0@)PP  PЍ(64F}䄀ـ䄀a䄀䄀䄀䄀D7T@\~~8@-@0T,0Pᚊ@<P8@B$<P8@+8䄀䄀䄀0/4F8@-@<P tPt\<i<`$Q@P H<P  88@c, ^8䄀4FVD(6儀 儀_D$儀L70L  BR L P    L / 0L 0$0/@- R R@L@@- R R 0L0@-Q 0L0@-@0S S 0L00T0 0L0@- Q Q Q 0L0P 0L0I /H0S0H0/ @- P`@`Pp  0S"$!RV|P P <L `01 0h|5F_I4Ek愀儀@-`T@0S 40S < L400)0I5F_I愀儀>EN-P $0`岠p  R˂˂̂̂̂̂Ȃ̂(˂(ʂD˂0S*0KS,ɂdɂʂ̂̂DɂdɂWx@@ Wd@ @ 80{Hz SP0r0-![0#Z*RZS0S 2 CT02,,0@Pťz @Pt@W@10S0Z :Z@000\P@ Z 00Sc d3/`2@0@0S 3/00C S!1!X010! 0 @㝄C0S0   T RQ RN SL  S 00@@) !R> ;  WZ8S6 1@0 R/ , Z*S( @P#  V700 @TT@0 Vq3 0 0 0003/@P0 0^@@Ѝ 8878T89愀DVz愀愀TE係$@-`Ppd6U@ PPE"P1 700Pp@-,)+  zP z zP z dlA56P \A)8 P )6P 0E)(1<P P402000000S 3/zP Oz (:KPQ` ݃P [)HzQP @0 @4@ppC愀儀愀5F 焀5F焀5F*焀f焀dE8焀焀F-PMx5h5P  ( XQ <4 8,! O$DC`P 4 0>$`-pP p P 0000001#100S30d8t#3/T3 dC-!B6!#!`p5!  / &  0800000 58 6 N0 L:P2 "08 h<0003/P ^ \20X20 P 003/PO@00 0 03/FA 0P001000 0ق8 0͂ 0‚|P^00<08 P/P P墂,9 00噂;!@0` (10 )1%0$10%1]0&1[0'192 TQ00x, 08u ЍM䄀75FqE焀儀&脀5FR脀k脀M6F 脀脀脀脀<‚脀脀鄀TE&鄀-鄀8@- <@<P'001(01$0 1 0$1G85Fb鄀<͂|ȂƂ8@-P@P80000$0< @5#8 8400 87F8@-0<0:08 @T=  00c  @T5 00c 0b' 0S0#' @T0% @T0 @T p2 0S   @320,2 @T 400 @}82@,2S@@ @2@ 0 000000!00S 3/VP[ 0`P B  `` ` ` ``daQ \!QL!B@($ ,   Q/P$ 0!@@ @ P 0"! ($ @ @, < 00S0S: H0 7F E0 R0/7FP0< Ӓ0 00/7FQS P 00$ 0//7FR P0(, //7FP 0 /7F8@-, @P20 0 , 0 $ 0 0 0 0 P8< \0p@-`4P4@ 0S@Pp7FQ <0\0440 \   /0 S//7F@-@P 40< 4#   P7F@- ( $  ,R @ HD @ L@T  ($   ,}2@J@$0  4 4 8 /7F/1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00F8@-A`0= 00s000 0 _00=0-=`0Rs0P RP0S=0=00S 3/`P80@-@ 0S 3/00S3/1D-@`` !v`R  - - !-  r  w?  8 '1PpzP  Zw B C PpUw?`Ppv`P  Vw PpUN-`PMp } PI@Pw >11n?1 1=11= >C= 0]1101 0S{0 X'5}50B0@ Sq 0=0= 0=0!00S: 3/PP71S+ 0 0S 3/R0q<`00P`4uP/ </= 0==03= </=0= <l|/=0= <Pt/<0HH y}0V0=0,T=0 =l}Tg?$| \0  \%40 00V}/@00 0010ĭ= Z =PU`$3r R邀肀肀肀肀肀`LS `8S `0S`(S` SS`r/ } #0㼰 0 STI!~0 {PI= PyY1Z- 0 0l 0C"   | Ա`Q&0!1S# P# C" Y{/ , ̠ p OPP!0s0- RP1  pB# q=R1Q01=0CS0=ą]kPP=0Cs0S 1 T100|P00S 3/P}|}@PЍ}鄀EF鄀鄀鄀鄀鄀鄀鄀WFsƄꄀـƺ*ꄀ2ꄀt9999:9Pꄀ>;hꄀꄀF鄀ꄀꄀ-1 (8 !< //8@-@Q!1+! R 0S 3/$0 1&1 $88킀@-10S 3/p@-!Q0@T88#80w/t000@4`  Va4`S1, @@P@TVp0$0pPQF-4P$ (@U,p0nPP-P` VP> ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH -V<0{,`(P$p.<0@0 0S Z00|0 tD2V   @01P00MZ111400=-^P P0 oń/ـꄀFlF@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp`$0p$p`|@-@@~P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/pFWF/@-0P$30@0P00@7 @ @b///1@-@`  ` 0==S 0S 7 3/=0=8@-@Q-`0Rs0 0`00- 00==0=0 --= ="-8///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# vq00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S@ @ 0SP 0P00 00[u@T @TNRu%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$shSU S  S% S5,0( c Z 1 { QJ0305,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#}sS 1S0 0 0`0(0S B0 !001 00F0T0TG섀*G1섀N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wpjrpp (0 js0 S J , \, ^0s000S 0ss0 \x0305qs0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 L섀>GN-P`0Mp=S =  0 Z  0 `0 000 p0 %002 % &R ( \ - 00'0 00 S4"0 2 R0 R@00\ 0 \0  00S0S030S0#!0=$ 0$6S 0#01 0 0S0S0 $$6S(P 0s0S#$00S rr  R(0 B( \q>{t -?,  9Q $Z2 S/ Q㺢岱k[ Z$ڼ(b#Q lh{? Q $y\YY{ : Z  0, Rp\`9Q=& n?["  R  ! 000` {\@)  K%`$`"4Ct@P S02) \ 0r 0 0Y` 0 #r0Ѝ 0&!&, &/N-@ңP`pB07Fhp@-@h T`PP?SLppP 13/ 06SPUPPp7F{섀@-00 @0 0$6S0X00Ѝ@7F@-@0 0Ѝ@@-0000 0 0|Ѝ8@-@\P8p\0A?3` 0S8` @  X \ T 800Cc00 P  0 P 0 1 >3 0S  00eB1C R@ p  0S0Ps(3 p c0W Nn#@0000}p0 \ pb`0 P 2 0PG `0:0db 0S@0Zp0 [ T2$2 p b0W n1@  =p  0 S 0 p +>Aa00 P 0 uP0 1:0lQDA[ @p  `WV` 1 p `0W @m0@ @ @o =[ p =@`   R >0  .P 0 1 >(00 HAlm8Fw턀h;턀턀턀QJ@-@P Q }00P om0 @P gm00 0`0 T@ P \m0 0 040 (@PQm00 00 8Fh;N-MP, 00 S ` 4P $0KAPy [Rs 0( ~?M 0 3Peڌ@Vo @T\ 0 $00[ 0[S S pSpS pP& 000: S S  Spp0 ,0RS Z P&0 p@& R  $ P4 l W W Wxplhqk` mkl((2[`0Vy:KN-MP@(0 0 P $0 M / 0@ /R R 00 @/fpP0  Cp0 /R $0S |m K$0K`2#Pe pc $0SR! 00 0S dF 0S  @ , n, @T BP@ <R, 0 H0P,0 2l,0@0  1T 0/S)t0`` K$0KqlYW 0S 0( 0$00K8F@-@00X0 P 0LP TPT0S8F0@-  Q   0P  0S 0< 0  P08F8@-WP@mW/@6T&  08P #S?RL0 S50 0P@TXQ P 00@8$Ajk0888F8@-@80P  4000}DP88FN-@ PM`PPE0T U:j^PtQUx Z??  ` 01 HP  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  Q @9F`9Fp@-@P1,``PP p@ePP <0 S" S/08`PPp1\!M 0@Qp8G@8H9N-*Mp P` $ D {P P` 9Rl`T  T D R*h900* R H0P9H@H9p0$,X0k00d,9P@v``m00C#X0 rC)q06X0\0gP@ D0 S*.8(P _ P@@ *>@02DiX0*.PcH86<(*08 0@((^P dL`V| ~ w @u Y'`0 V!#rV> Rj`F v`[:L'@PD0 S?2P@dT 7 '*7 '0@PG7 S 0 R@`Fv`V C`F `F SV K JP0@ 0*.0 !C1S! S01V@ 6*&f0 Fo0@d@5 @0cS0S4 R~P yP 5* @%0 bRd FT!L45*.*0(%PH:$@?P 5@A4P2D0 S$ ?P!+D0@⺡ Sp 1 `P ` aP@;P  { [@-`P$4*$0,D `@\@ @C0@ 00 Q -  0RP $  Q0 Q 0 Q 0q3#  `A`AR  B `A`AR B `A`ARQ { @08b 0B<** i0Re$2 K @D@{0k0@! @!1[@!1** c10RL@@P@`TWc8@ @`P pMc.\1 @D0 SA$8p1 0 0,1@ @0*@P`5c@W`P 0* *0@,`P cP@ldVP@g@dY: c`@ 0@P*ލ8G8F9H9G? @9F`9F@8H_t񄀍񄀦 xH-? ? @@ M0?P?P0P  ;Ph `P 006D PR( P `Kx8F򄀽ȄȄx0 0@-TM P @὎P T H b 0@ @00,@L@0 TЍ08FN-M@(D d ,0P"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  fb@{ S`Gx`  0`G3` x`@0|0eP`  0/S\S@@ '1Sʝ\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8fPH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ʝ\0V0 S! d/ aS H 0aP P\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  _a@kP 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%~P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  D`RW P @ + 4W 0 `4/ `40S 4 0` 4P P @ \( $$$D3(#$0 \:`'PP(`d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 P E`@Q`d@g 3VI `PP@d0 S?2P:* p0@SP/d0 S2 0P)* pPW`:  0oP@`  0fP`@`gP_d0 S2 0P* p`@a pލ8F/ـ9Hbt򄀂9G @9F@-0 04@-pMA0S- _000CS^^^^^__^ t@_0_0 @P l_  P& @+@_pЍ8FDŽ DŽТDŽDŽDŽdфՄ0 @-@`Pp j_00 00 8@- Pp@ P_8/p@-@P`E_ p@8 0P/XGp@-0/S\S10/S\S !f RC 0A/R\R   ``P .Q Q \Q/Q /Q\Q @.T S\Q/Q\  0L/Q\Q  B PR 0T R/    / @ 0Q dQ00Q\ 0\/S\SL /Q\Q/\\\ ps;u;t;8@-0$@2PPR8t;0䄀l 0@-MBtT^/Q\Q 4 0 $"" 2/ۍt;DlLGp@-Pt M0`Bt\^/P\P < 0( ,"" 03?/@-@P`pP03?@„2 3?2/ 0 3?2/ @-1 @b\s@-P4`@ P 0 | D-`@T pPP,0p/S# /; P dP  @P0/S S / $  P@@0jPP0S P8@-P@  8@N-pjPPB[P`@-P:@gr/PJZ@D   PP(  P @/  @ V RT0@D0 ` V  V RvvP PPЍF-p@P#T ` P&0SPQZ0T  Q00Q0Sqq @- 0P p@-P@ Pp B0p@F-Pp(`@P   0P R@0S  N PP0Asp@-P`@P P  -P@@pD-p0t @PP 6 `  P  A P PeP@PT@-Pp`s@P  p P  P@@03?'S0<Ͽ\ : 03? S: 2/00R#3//D-@P(p(1`  3 10  172/p6o$`: 0 3?,#,8$#4 0p@-R @ 4O<Ͽ @ T `PbP6oU a bv pppp@-@P`Pp$ 0e2/ 2/$ 2/03? 0pp@-P`"2@Pp0Pe `R3?6o0P3?5_0 PpN-@:`P@ pl 7 p1y PPg  <Ͽ 01 PP  0 P  3? 0Pg3? 0 U`0( 01` 0 `P( 5_;0$P p@-@PP`6oV $ 2/PV40 P PpN-P(,p P ` 06o`Bo P;9: 7p A-@p`7PP oV 0AOPD-p`P@P `P@     00 @P q F-M`p0P@P&  0 @P  0  0@P05/  t00  0@T  > ЍF-MPp0@O`P'  0P   0 0`P0:  00  0`P  Ѝ@-Pp`@P0 0P@ 0 0 @N-P@`P2 0P*q)p P @Ppp; 0 mP4 0@ p  40p@-P`@  0p@p@-P@ P  P d01p@9pN-Pp@+7`P^V 2/R2$ 2/ `)  0G0 P R`E 0 0P  `P640 0:3?$0. (2/ Z& U*pT*  Qp  0 S P0:0402003?,#,8$#40`Ѝ 8@-@;PP$03? "u 02/3?03?08P p ,0`$0P////dG) 02/R//$0 3?@-<Ͽ @2/ b4O d* Q01$'Q8@-@P  805_P04 P02020088/F-@` $pP$03?S0<ϿP3?U 6o9: 7`5_p P@-0 @-p`P@P P $  ~ @8@-P@PP@408N-@ ppP9 `<Ͽ 6o P fPPi0$ PfPc02/1 Q*  0A 003? 0U  HP 45_0 P7?0 * @-@/PP92P2 40p 01$`2/3?b6o`( 6? 0 P 03?p 0p3? 2/03?0p P0SP 03?`06o`0P @-@0 P 0R@-0^0P # S:7@-@0P0$ 0QS>p@-`P@P  @el3@0P:@p04@- @ #D$@@4$s0RGp@- R 0 R!q ! P`A"!@ 1 p01 #p01 #p01 #p01 #\ 1U0p$P 0S "r ! "pI@-0@-@   0!E 0,Q/M@-  @U&@ZN-`p< &@P0 0 0S 0  KY 0U( &P0` 0 Kcq'& & P` `@@ UV 0T( ЍNTЍO N-XM`xP@@S@3&PUR-&PMX TUp1p! 0T ! T  r  r   T00S  0T0 0 S:PEW0:.  0SX`g DBT0T0TP ꄰ0 0VXЍ{YNN-`@PW 303 :% 0 `V p@PZUT# 2\WV:`Vp 0Pd@` UVN-P0@M`p$00 `(0<0d@P )T0`0d0p Pp  YdT  0rcpd `f`@Ѝ茌%+N@-\    @ Č @T @T\: Sl 0p@-@P`UU 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS: %Q %Q0@0Vpp:I@-@Pd0    `0STTPPp0UT00:ID-P@p`0 0S P 0@@@0 0zPP@0U:0 :IF-@p`g@P0 0S  <P0PPP@P0T:0 :IN- M DP H@p :0 0S*m$0Q `V v  V9P4@\+W) \  L0 Q 0 7@$ pW   0=\C0#{T$Pp Ip Qp R \R Q  R0`S00KT:IN-8MPPp`A 00M080 2   @ R@P2     W 8 0S X0S ` @<` @ P @P R`@0 S S #S `0S`^ S`0S=S S R S S R=S000W0 =8 P7 00 ` 0\R R`  R W ` R0( 000K K,@ (@ Z00@S 8 @ @P | OP<0V*0S `Q8@ P  ^P$$9P`VK:I B@-P`@p  0S@6/P 0T@-@@0/PP@-P@p!`!UQ`g`00  /N@-@(P 0@80S *000C NN-@T PU 0p c` PUVQ V `Q`UpbqPPPaPPPSP`DS*qp⇑qpp pY. p Z )    \0:`'U$T01 3 Q5`F25 5`"'a  %*V0@@Q5 5 !0 pp10/0 0 0 X0\0P T0/0PN-PPp @ ` @cp@H`D@@UV \  \' V`{ `Tp{ pXI     Z:PVPPW T0 bT P0 ecTN>P:0@-0 @ PPQ *T: S0 S1#00N-pP `PGp iq1@T+:S@ Z&* @T@e@e  00P PE i  P@ AT:@e@ Z  T RKpG[Ѝp@-P@`P Nps0@-0P X \@Q:  BQ0 S//s@-@P `PT  TpT @0S@`V5|RQN-P.A@@@T: p``d0 0 ;/ 0Pp W: QV*e@PSR@-0 dP@`0\ S \ pp | 0s0\@R cN 0 R 0/0S/\0/ 0S\0/R@-@@0S0R00@T@0 lR0|/@-0@lT0 S|qR 0R0/0 0Q`/8@-@PuP00C R8T80S `/0\8@-PP@sO@P w8@-0\ @T\  A0@- S@T0SAp@-@P`h0@TP 0P@@S0P P 0S00p:I8@-P@T P  8P/0S 0 CCSQ/0 SR//@- Ąq@00S0@cT  00S00S/Q@-00 0c\0 0@@0SQ/P00S/0b0 R*/0@-0P@0 T0S0 0S/P/D-Pp`P @ @DP T PdP q0\/P/@-}_@H@` p(V  P @B p@-@`TP1P!@Tp耖@-@@DT@-QQb!6 @ @ q$!@ Ua0PQe0PP  l10Q1c0000wN-` fР0! S R: : @P0  n! [[+&0 0+ 0 ᓾk0傱   j 0!a0 b00  ~蟆p@-Q`@`P60  PE0R00SR P0`RpN-XM@Pxp@|` W P R r0`F-`F+`F Y W`F`F 000 W WG r|  A 0 >k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍON-PMpP}%S:@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʚ@ 0 0MS ISo iS mSj@@(0 ,@:0[ R R00F@@06S$ (0 @: 0[, , R R004S@@"($   b00S*[.00[00@@@( 0 v0 @!@` @H 04Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S~ 0bPЍONp@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:PpN@-00@pP`P 0S R 0d0V R@--\`@@-@0 KR GRMR kR iR BR000N-00Q x\@ D 'R $R 【`pꐢ +  @PDS0D D7D{7K_ @UT:N@-@0 KR GRMR kR    iR BR000-@-  @ Ѝ/-@-H H3 0꠆@-p@-0D@P0@@ `0F PPp :IImJN-HM0@ C :S000C0 0,@ 0a8@,BT@0C B D$ @D( <@X@, 0PD4`@D4LpFP8< @@,@ P@0`pD@RP@DB @ @ ꔓP$P@  $@'  PPr%<UP EL8(P  ( k$r , \(0 Ō `0 Ǽ0  k"9j@a@ DajA!H jJ*L0DH,LQ@  C" RB $P Br $@R SV (000S8 R [PPkA`Q <\Q |P P:QpaAl[ 8P PQ,@09[,P PC Q PA Pw@Y㰠0 10pЍM0?`0P0`0 0[ K0ePU 0Sv  &$ 0  < <`&d=`P0`00+ [ K ePU @`R`<` < <`&d=`` 0S P000 % @ [ p1p!W 0S P 0 bQ  b $0    @0 gpg@p@0S0@0000+" [ p pR Q @0 S702@05\ W:0    \ g z 0S 0@0000*" [n p pR $Q @0( S702@05\ W:0    j\ g M 0S$ 00   0[A K0ePU1V:%P` 0S$,  0  ?4[$ K0ePU&,&4,<l0d`4``P 00 0Sp0 p8`l0pL0 0T0T00/>0l0P7*0h000`pd0 p0(0xTpL wpG0S[! 0K ePP[ K ePU:6cPc0hOP [ K ePU:Q6cPc1 0  &a6PE&P [ K ePU:6c  a[ K ePU:6c  cc0P(pQ (5000 hh7 R*h( Q:0S lp/΄S>l0pL0 0 T0T00P4`l08P00X0X00d PX4{00p1[W p $8`mPO!= Sh\l pL@00p0V0S 07[] K0ePU$p0 g0R0000 0S b Y40S&4&,<004 S 1p00$p0WP`$000S 0S 0[ K0ePU0V 10007P`0000pp(0pS p8`00 8@@I8:IAIAIAI@-\@0SI T&3 bRX60X6 S f>0X6@\T@8:IRN-M@` a>k0?s0Sf0?s0 SapW^PU[t0SW   =0 RN0?s0S SG (`u,  0@ 0#      0 H'0 pR"  P0UP  G0 `PP0S "2L0 hp N< `;< R R RYЍ@IcScAI=@IAI@I_I@I AI3N- MaP㨑 P%<@%q+x30@0P 0 a P!p $ ( , P! 0 P! 4 P! 08    0B0 8< p0tp  P0 pC D0PND <0 0 Ѝ@IAIH@I= AIx郀@-,00 S ;@@z@I\v/@-L2H @Q P(PP@^1@Is@-@`PT  pT @0S@PU|@-@[20  0 0 0 0  @-M@ &1Ѝ@-@8Q4 M0    Ѝp@-`P` \\09;XwT0@TP@ DP 4@0Tp}Y@I,0 0R 8Q 40S0/@I00S8/@I@-,M@`P  %P `l P   P <:4:0 :  0  0 0 0 0  00S-0U 1P0  0 0 0 0  d0Up\ 0C8:003/,ЍY%8@-@TP R0@@04Q4@040080008@I@-00S   4Q Q4S4P S 40S00 $0R @I@-@t1@  eTUX+1P L %D1D!S  P0 (!R P ,:`@TP:?>T.P1pA7T80S ::W &P@9 9P 9x8 P h94@P0TN 9@I AI UvB@- @P,03/0  @I,0 @-@P $T`0 @@ 0S$0 T h  \ p@Pp`I[@It=D@ @-l00l0S(2@2}@2`I\Ds@-0AQh010P0p0X00S10S( #, s S4XX2 :`P  PXXx(AXXP`0XPQ0@A 2P 20S 00S  0R n20@X` h2Q b20 40X2}|,0 l\ /T  lЍp@`I AIAI@I)AIAIh_Iـ$DT_I@-O 0 @ID-P`@"2j 0 +0@0 @ppl; 0 c000` a?a1 TD0p@0,0DG0iIAI<:IAI@ID:I@I@IF-p0@`S S,   0 0R0  + P PP P FPQ 0iI@I@Id1s@-PX!00C@SF<<<0PavPoPk  0 P@d;08#$40@<|0<0H@ <\0<0?@@0@0|AI8iI8@-T@TP0 00S<<q08@Z0^0(0S88@8iI=xs@-|A'P  d2`8'TBP  Q*4G0$2/ $R$2$B`0V02 0S( #, s S4h `)0:W`P ` 00lQdAl0h0d 0\0S P1 R 00 S ,/(A /  /Q  /0!4 @/0`P//00 00E0`0E `<0Ѝp@= AIAI8iI@IAIAIh_ID>P00* H 04 RU%H 4 R/PDs@-+cPcP @PPP 0cP pZ/h`0S P 0cPQ 4X/0G/0(  0|蠆T8>U30@-MLP @-4 @ %  %@%Ѝ08>+61s@-`0&46S0S #=yG 焀 @-.// Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/P[Q @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/ 0R b0A1Q A1/ 0R b0AQQ AQ/ 0R bAQ0A/@-mLM DG DGD%pDHHH\\\] ]]]]&]-]4]<]D]L]T]\]d]l]s]z]]]]]]]]]]]]]<%($p$do_dfu}r},}}!}$}(}+}.}2}5}9}raw_accessdo_env_importdo_env_exportU-Boot 2013.04-dirty (Apr 20 2013 - 08:30:43), bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxloadaddr=0x80200000kloadaddr=0x80007fc0fdtaddr=0x80F80000fdt_high=0xffffffffrdaddr=0x81000000bootdir=/bootbootfile=uImagefdtfile=am335x-boneblack.dtbconsole=ttyO0,115200n8optargs=mtdids=nand0=omap2-nand.0mtdparts=mtdparts=omap2-nand.0:128k(SPL),128k(SPL.backup1),128k(SPL.backup2),128k(SPL.backup3),1920k(u-boot),128k(u-boot-env),5m(kernel),-(rootfs)dfu_alt_info_mmc=boot part 0 1;rootfs part 0 2;MLO fat 0 1;MLO.raw mmc 100 100;u-boot.img.raw mmc 300 3C0;u-boot.img fat 0 1;uEnv.txt fat 0 1dfu_alt_info_emmc=rawemmc mmc 0 3751936dfu_alt_info_nand=SPL part 0 1;SPL.backup1 part 0 2;SPL.backup2 part 0 3;SPL.backup3 part 0 4;u-boot part 0 5;kernel part 0 7;rootfs part 0 8mmcdev=0mmcroot=/dev/mmcblk0p2 rommcrootfstype=ext4 rootwaitbootpart=0:2nandroot=ubi0:rootfs rw ubi.mtd=7,2048nandrootfstype=ubifs rootwait=1nandsrcaddr=0x280000nandimgsize=0x500000rootpath=/export/rootfsnfsopts=nolockstatic_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offramroot=/dev/ram0 rw ramdisk_size=65536 initrd=${rdaddr},64Mramrootfstype=ext2mmcargs=setenv bootargs console=${console} ${optargs} root=${mmcroot} rootfstype=${mmcrootfstype}nandargs=setenv bootargs console=${console} ${optargs} root=${nandroot} rootfstype=${nandrootfstype}spiroot=/dev/mtdblock4 rwspirootfstype=jffs2spisrcaddr=0xe0000spiimgsize=0x362000spibusno=0spiargs=setenv bootargs console=${console} ${optargs} root=${spiroot} rootfstype=${spirootfstype}netargs=setenv bootargs console=${console} ${optargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpbootenv=uEnv.txtloadbootenv=load mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeramargs=setenv bootargs console=${console} ${optargs} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${mmcdev} ${rdaddr} ramdisk.gzloaduimage=load mmc ${bootpart} ${kloadaddr} ${bootdir}/${bootfile}loadfdt=load mmc ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}mmcboot=echo Booting from mmc ...; run mmcargs; bootm ${kloadaddr} - ${fdtaddr}nandboot=echo Booting from nand ...; run nandargs; nand read ${loadaddr} ${nandsrcaddr} ${nandimgsize}; bootm ${loadaddr}spiboot=echo Booting from spi ...; run spiargs; sf probe ${spibusno}:0; sf read ${loadaddr} ${spisrcaddr} ${spiimgsize}; bootm ${loadaddr}netboot=echo Booting from network ...; setenv autoload no; dhcp; tftp ${loadaddr} ${bootfile}; tftp ${fdtaddr} ${fdtfile}; run netargs; bootm ${loadaddr} - ${fdtaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootm ${loadaddr} ${rdaddr} ${fdtaddr}findfdt=if test $board_name = A335BONE; then setenv fdtfile am335x-bone.dtb; fi; if test $board_name = A335BNLT; then setenv fdtfile am335x-boneblack.dtb; fi; if test $board_name = A33515BB; then setenv fdtfile am335x-evm.dtb; fi; if test $board_name = A335X_SK; then setenv fdtfile am335x-evmsk.dtb; fiset_default_envenv_importsdxbimaroc8(Hsaveenvfdt_fixup_memory_banksethaddr__of_translate_addressƹ̹ҹٹไ乄󹄀 ــ!'-1;5?D INS^insz ӡ ú ɺѺ޺纄𺄀 ــ $j6GPYary лٻ󻄀 "9Bf[iip{ ــҼ׼缄켄ــ  miiphy_register( w ń0ńCńSń]ńińsńńCźdfu_writedfu_readdfu_fill_entityʄʄʄʄȄʄʄʄmmc_file_opdfu_read_medium_mmcdfu_write_medium_mmcdfu_fill_entity_mmcnand_block_opdfu_write_medium_nanddfu_read_medium_nanddfu_fill_entity_nandg΄l΄j΄i΄1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./ 789-456+1230. #(-27<FP'@Bmmc_set_iosmmc_reset_controller_fsmmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupverify_bbt_descrcreate_bbtԄԄԄԄԄ ԄԄ,ԄԄՄ Մ3@ Մs@6ՄC@MՄS@dՄ5 @zՄu @ՄE @ՄU @Մ6@@Մv@@ՄF@@քV@@քx@ք9@/քy@Fքr@FքI@^քt@^քY@vքq@Մ@Մ@Մ@Մ@Մ@Մ@ք@ք@ք/ք/քFք^քFքքvքքքքքׄׄ2ׄGׄ\ׄrׄׄׄׄׄׄׄ؄؄4؄ I؄ ^؄ t؄ ؄@؄:@؄*@؄J@؄؄<ل,'لL>لTل>jل.لN0ք@UVY ZZ YVUe03f2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $-6?HAZSle~w =4/&QXCJu|gn2; ) zsha^WLE+"90cjqxGNU\dmv@IR[,%>7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy(((((AAAAAABBBBBBEPTGMK0123456789ABCDEF0123456789abcdef #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     ــv7_dcache_inval_rangeext4fs_devreadeth_get_dev_by_nameERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x I2C: %s baudrateNAND: MMC: loadaddrNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: machidUsing machid 0x%lx from environment Starting kernel ... bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled %-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddrethaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as arguments ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! bootcmd## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order initrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartnofilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'bootmboot application image from memoryloadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationdfu_alt_info%s: "dfu_alt_info" env variable not defined! listDevice Firmware Upgrade [list] - device firmware upgrade on a device attached to interface [list] - list available alt settings Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type \cecho args to console[args..] - echo args to console; \c suppresses newline EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... eepromEEPROM sub-systemread devaddr addr off cnt eeprom write devaddr addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'exitexit scriptext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem. All numeric parameters are assumed to be hex.ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4loadload binary file from a Ext4 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystem. All numeric parameters are assumed to be hex.ext4ls ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %ld bytes written usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [] [bytes [pos]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load. All numeric parameters are assumed to be hex.The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. All numeric parameters are assumed to be decimal, unless specified otherwise using a leading "0x".cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pin?alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'Error writing the chip. Error reading the chip. Valid chip addresses: %02X%04x: %02xCRC32 for %08lx ... %08lx ==> Error writing to the chip. %08lx: Error reading the chip, %02lx %04lx %08lx ? Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) i2cI2C sub-systemcrc32devloopmmmwnmprobeUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx Testing %08x ... %08x: Iteration: %6d Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Tested %d iteration(s) with %lu errors. bytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? %08x %04xmtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)OKERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! #part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device erase MMC %s: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesmmcinfodisplay MMC info- display info of the current MMC devicenoronenand%s%dDevice %s not found! invalid partition number %d for device %s%d (%s) %ug%um%ukmtddevnummtddevname%s%d,%dcannot add second partition at offset 0 %s: offset %08x beyond flash size %08x %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect mtdparts=mtdpartsinvalid mtd device '%.*s' partition size too small (%lx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08lx@0x%08lxno partitions for device %s%d (%s) unexpected character '%c' at the end of device incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=omap2-nand.0mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts variable doesn't start with 'mtdparts=' device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions defaultmtdparts=omap2-nand.0:128k(SPL),128k(SPL.backup1),128k(SPL.backup2),128k(SPL.backup3),1920k(u-boot),128k(u-boot-env),5m(kernel),-(rootfs)delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08x 0x%08x %d no partitions defined active partition: %s%d,%d - (%s) 0x%08x @ 0x%08x could not get current partition info defaults: mtdids : %s mtdparts: addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found no partition id specified partition changed to %s%d,%d define flash/nand partitionschpartchange active partitionpart-id - change active partition (e.g. part-id = nand0,1)No such device Device %d: %s... is now current device .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Not a NAND device bootdevice ** No boot device ** ** Device %d not available %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b nand_writesizenand_oobsizenand_erasesizenot a NAND device Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx quietdump no devices available Device %d bad blocks: %08llx scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x OOB: %02x %02x %02x %02x %02x %02x %02x %02x .raw%s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrnbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemgatewayipnetmaskhostnamerootpathserveripdnsipdnsip2domainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment Saving Environment to %s... ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandssaveenvsave environment variables to persistent storagedeleteeditexportimportprintsavemallocFailed to initialize SPI flash at %u:%u No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) Failed to map physical memory Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SPI flash %s failed sfSPI flash sub-systemprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset len - read `len' bytes starting at `offset' to memory at `addr' sf write addr offset len - write `len' bytes from memory at `addr' to flash at `offset' sf erase offset [+]len - erase `len' bytes from `offset' `+len' round up `len' to block size sf update addr offset len - erase and write `len' bytes from memory at `addr' to flash at `offset'Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory-o-a-z-ntruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificusbHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only480 Mb/s1.5 Mb/s12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. treeUSB device tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: usbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' %s arm-angstrom-linux-gnueabi-gcc (Linaro GCC 4.7-2013.02-01) 4.7.3 20130205 (prerelease) GNU ld (GNU Binutils) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacks*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" env_nand.cErasing Nand... Writing to Nand... FAILED! !readenv() failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. CRC32 for %08lx ... %08lx ==> %08lx syntax error ** Abort ERROR : memory not allocated U-Boot# *?[\ERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressed ** Too many args (max. %d) ** verbootdelayHit any key to stop autoboot: %2d %2d NULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialfailed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_get_configuration_no: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d usb_new_device:cannot locate device's port. Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox host** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type %s: Wrong sequence number! [%d] [%d] %s: Wrong size! [%d] [%d] - %d DFU complete CRC32: 0x%08x %s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... ;%s: Device %s not (yet) supported! DFU alt settings list: dev: %s alt: %d name: %s layout: %s eMMCOneNANDRAW_ADDREXT2EXT3EXT4Request would exceed designated area! mmc %s %p %x %xfat%s mmc %d:%d 0x%x %s %lxext4%s mmc %d:%d 0x%x /%s%s: Layout (%s) not (yet) supported! dfu: Read error! dfu: Wrong file size! fatext4%s: could not find mmc device #%d! %s: could not find partition #%d on mmc device #%d! %s: Memory layout (%s) not supported! %s: invalid nand device %s: nand_%s_skip_bad call failed at %llx! using id '%s' Could not locate '%s' ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpU-Boot BUG at %s:%d! mtdcore.cRemoving MTD device #%d (%s) with use count %d nand%d%lu MiB nand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%012llx No space left to write bad block table nand_bbt: Error reading block for writing the bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%012llx, version 0x%02X nand_bbt: Error while writing bad block table %d nand_bbt.ccreate_bbt(): chipnr (%d) > available chips (%d) Bad block table not found for chip %d nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Can't scan flash and build the RAM-based BBT nand_bbt: Out of memory Bad block table at page %d, version 0x%02X nand_create_default_bbt_descr: Out of memory ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMDUnknownNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitAttempt to erase non block-aligned data Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx Timeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters Error: Unrecognized Mode[%d]! ECC: uncorrectable. Error: Ecc is wrong Error: Bad compare! failed Error: Can't switch ecc, no devices available 1-bit hamming HW ECC selected 8-bit BCH HW ECC selected SW ECC selected NAND: Unable to find NAND settings in GPMC Configuration - quitting SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x WARNING in %s line %d f_mass_storage.c | / - \composite.c, H%c=%umusb-hdrccomposite%-8s%-16s%04xUnknown x%02xunable to find file size: %s file too small: %s Linux File-Store GadgetMass Storage FunctionGADGET DRIVER: %s usb_dnl_dfuusb_dnl_ums%s: unknown command: %s %s: failed!, error: %d usb_dnloadDOWNLOAD ... OK Ctrl+C to exit ... ERROR: No memory to alloc RNDIS packet at %s:%d/%s() ether.ctimeout sending packets to usb ethernet ERROR: %s: rndis parse error %d at %s:%d/%s() USB RNDIS network up! ERROR: can't alloc requests at %s:%d/%s() ERROR: received NULL ptr at %s:%d/%s() ERROR: rx submit --> %d at %s:%d/%s() ERROR: dev->rx_req invalid at %s:%d/%s() RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:af:00:00usbnet_devaddrusbnet_hostaddrERROR: Need valid 'usbnet_devaddr' to be set at %s:%d/%s() ERROR: Need valid 'usbnet_hostaddr' to be set at %s:%d/%s() cdc_connect_timeoutERROR: The remote end did not respond in time. at %s:%d/%s() ERROR: can't autoconfigure on %s at %s:%d/%s() ERROR: can't run RNDIS on %s at %s:%d/%s() %02X%02X%02X%02X%02X%02XERROR: can't init RNDIS, %d at %s:%d/%s() using %s, OUT %s IN %s%s%s STATUS HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready ERROR: %s failed, status = %d at %s:%d/%s() RNDIS/%sU-bootERROR: controller '%s' not recognized at %s:%d/%s() usb_etherEthernet DataRNDIS Communications ControlUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d ** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10d %s Failed to mount ext2 filesystem... %s read outside partition %d ** Invalid Block Device Descriptor (NULL) ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! ** Unrecognized filesystem type ** bootfile** No boot file defined ** %d bytes read in %lu ms (compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotateunknownautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx A33515BB1.5Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM Could not get board ID. board_nameboard_rev not set. Validating first E-fuse MAC A335BONEError %d registering CPSW switch A335X_SKError %d registering USB_ETHER raise: Signal # %d caught   D2DD;2tD; DDDDx@0j߀PD^ــfــfــــfــf ــf@ــ_ــ[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OS/ addr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.m|Rــs|\Wــw|Tــ`Pــ||TWــ|Nــ|LWــ|LPــ㒄OــLmSــb_NــMWــcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed@ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)@tــaــc@ــjــoــv<ــ}@ــp@JــTــO@Xــask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] [addr] - run script starting at addr - A valid image header must be presentaddr part [dest] - extract from legacy image at and copy to   ( ( 0 0 8 8 @ @ H H P P X X ` ` h h p p x x !!!!!!!! ! !(!(!0!0!8!8!@!@!H!H!P!P!X!X!`!`!h!h!p!p!x!x!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""" " "("("0"0"8"8"@"@"H"H"P"P"X"X"`"`"h"h"p"p"x"x"""""""""""""""""""""""""""""""""######## # #(#(#0#0#8#8#@#@#H#H#P#P#X#X#`#`#h#h#p#p#x#x#################################$$$$$$0ʄa,8   /   $$D!@#$%^&*()_+ QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>? 789-456+1230. 13457890=    ;'~ <>?789-456+1230.  & & &@&@&Bbt01tbBqq()*+,-./0123456789:;<=>?&0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N  28  !"#$%&'()*+,-./0123456789: ℀,a cx\|4|4,℀X_fx\A℀X_fx\[℀X_fx\eserial0lTnmmllmeserial1l\nmnmtmeserial2`ldnm nm|meserial3@llnmnmmeserial4 ltnmnmmeserial5l|nm$n mm{DD<儀||T} P716C67(6:6nDl7d6t7䙂~ 47|7 L6  77D7 7  Dς,ȂÂp9zEEEEE7E77  p9 p9p9zEEEEE7E77%  09Ethernet Gadget`7F9 5Fl鄀@6F 愀z鄀     @  @  @               @t삀삀L삀p삀/Q_(`d`<"!l",c ddd  JJ  =⚄@t隄KfPl^@!^ـ(鄀L$sfـmfL$sfـf@+f`f͖8e@0>e$P+C1j5D g2gـ`kcom|lۂ䄀@2zgg͖}@5hhƜCi7Ji\i.@ୀ i8iـi8i!jj9jkk09kkl9jk@T€m@:n*nn:n on:jnImH9Rmsm=v[ _@"__yLyziz@MnzzZ|8N^|\be@$ieeԀª|Z||i|LPwsw`o _ .f~`?ow| i$jhLjv`l'6||>>>>A AAhBlBC,D4DEEEEEEEEEEEEEEEEG G$G(G,G0G4G8G >8>P>h>>>>>>>?(?@?X?p??????@@0@H@`@x@@@@@@A A8APAhAAAAAACCCCCCCCCCCCDDDDDDDDDLEPEdFhFlFpFtFxF|FFFFFFFFFFFFFFFFFFFFFFFFLGPGTGhGlGpGtGxGGGGGGGdYhYlYpYtYxY|YYYY8<@Hhlpx $(,<@DTX\lpt8DHLP\`dhtx|  $(48<@LPT$048<HLPT`dhlx|  $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                 !!! !!!!! !$!(!,!0!4!8!,>>>>>>>>>>>>>>>>>>??? ??? ?$?0?4?8?Dž5$Džusr/mdec/am335x/mlo010075500000000000000000003031001220553173000132070ustar00rootwheel@ CHSETTINGS8/@ /@$/@(/@,/@0/@4/@8/@xV4/@?8.?8 r1) d D //   /@ @-P@`p00=000000 0 0000Vlp@`0t}p@)p@-2\@00  <0 00 P 0PxP#`0p@80@ 0S \0 +1 D     01    / 90@@y0@ 801     $  (  ,  T / 90@000, 01 , / 90@ H01 (  ,  P \ $ ` ( 4 8 /90@X0 0( 4@Xl pRR/80@0 DH/DF-`p$@ P{ U00@000000000  4 3Fa90@D0P(&'  '(&/D0P &'  ' &/D@-  4 4y0@@Gy0@\y0@@Gly0@P/3 8 0s/00@-  @@ P PPP 4P  9904@@000040 0y0@$0  ( ( R/y0@4p@- , @@@|$ @ Tl40,00044 Q  hP @ ```#\` V99;0P@ @h00@0003\Q  @@@L#p@ T99900000p0S2,0| 2  2 R`  ` R2d d R2 Rt2  `2 R ! !R02 0S" 00000000S 00 R101 R10  t10 R@ @0SL <0 81< R R1 R0  0 R 0S 0 0 RH  H0S| 0h0 L L RD0 R 0  Rpy0@&y0@y0@y0@p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pp,0    0 /$0     / 0 H ПP-`0@@-pB@P`  LL@D@0f@  ,$0fP6O@T:?0@?0@?0@//0 0 "0b0>?0S:0?/8@-P@?00 0#0?8@P/t Rl RP \ L0 R R   ,0 0 /O-p`@0@0@y0@y0@0 //D8@-,0@@@+ P8 <H@8H@-;H4 <0< S0b0000PH@-,0<H  b H@-@d0/y0@0/y0@@-g@6T0@-0 S S S 00  00y0@ПM `0@@-$0Р   `:I `0@2x0@/@-P :|B0@}0@{0@0@-@MPp =:PM PX 6:P&5 P @ 050 02P@0@Dt@0S 0S,T+& :P 9PpX|t 9P d0< Ѝ0B0@B0@|0@|0@|0@Tz0@z0@,z0@B0@{0@||0@B0@{0@{0@B0@B0@/s@-P P e@PPP 0 P `XT`0S P 0 PQ T|'C0@y0@rC0@U3C0@@- 449P( $9PC0@y0@y0@C0@@-1* H 14 RU%H 4 Ryl1l!l h!p H T +X1T  T H!X T004T0 ( P   [9PV *  O9P0/ 00 A9@P 0 0000P 0/| x0t0p  0d0PDD Dx0@C0@y0@B0@y0@ D0@}0@:0@:0@B0@8~0@|90@90@}0@:0@@90@90@90@L:0@D17@-0&468S0S #D+D0@3D0@B0@y0@T}0@4}0@cD0@B0@C0@F-`,M@@`FfR_ RVP=8P0 -R D"<1V  0Sp =7p3;p8W >`PA  '0L R QCS C00l0(P@`@0 50S400 ,ЍD0@~0@0@D0@ D0@0/~0@@-P000 00 Q 0S qЍE0@@-M@ ;Ѝ E0@PD-@P`0U@=S pt`Z 0Sl=PN-pP`㬐" T`$@ZPP @e`MP T`eV  000Ds<P @E0@0@-@(M   P (000 0F5P` P`(Ѝ蠂0@P@-01,03/\P@-01(03/\P@- 1 03/\P/0 |P/0 x R/0 s @-R0 00$03/@l\-@-"M@T /( ;@"ލ@Ѝ/@-0@"M T :@"ލH0@-@T 0S P P 0 8@-PT0 P@ b`7400T:(00T0@88LD E7LDp@-P0```N@N@JD T00Pdp0 cRH  a8p0`d``0 @d@p~0@0@p@-@Pp0DR `QP 0a   010Rp81p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p~0@0@HF-50S50SP @T@~T*@!51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0   # P PPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~cQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   01` 0dSf1 p1p0szpp~ppPN P*x1VIx1 U  T1 pp0p3DpPi  00cPp0g~p~ppp( 0e  0ppVPp Z0  0 J 0Z00 0  x0x 0S0h S0D00000dS( 0@@0LD~0@H0@@-p0`PwWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   4@~0@D-@QTD>T @Z 5pP PGBQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000yF-pR`PU PU 0S- @40P) @B40 s R @0 S T ,R:S,S: S8 0S 4P %4T" !* @@T0 S :SP0@0 R \,4PPd4P K43T0@F-`AM@ P4U P! P p3P `@P\ d@ʡ 3@P P UpDW00AߍE0@E0@80@80@ 0/$ 0R 00/T0@@- $0S 0/T0@@-P 1PyP YP tP T0Ps8@-$P@  $ $P@8@-@P 0!St@@\0@0/0DD:2P8088 0400  ?F0@mF0@0@T0@V0@F0@F0@ $P8Pp@- 0\ X\H@ `P` DRp\ PPpo0@p@-@%3Pp,`3PP fp pV0@F0@p@-@3P 4`2PP fpppV0@G0@7@-@P000000Ph P P2P P01P P>pG0@D0@wG0@;0@N-R0@2 Q`P@Z  0KS{3/@3/@3/@X4/@4/@@5/@0 l 00( 0d 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 5 0\- W  .RR&pW)p0  0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T 1P 8 0 (Ѝ'w0@V0@G0@G0@H0@G0@H0@/ $/T0@p@-PPD0@` 8@1P @T@pTQ0@0 000 /TP@-@P  2@@8@-@P ,0PS 00S P <W 40 0@@ 0S@88Q0@TP@-@P 0 9PQ0@8@-@@PP x1P8P08P 0P/Ps@-@P` P `00 QQ; Q9 <0 0 8< 4 00 8< 4 000 0CSF/@F/@F/@F/@F/@F/@F/@F/@ a 01,10 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKZ0@Z0@E[0@L[0@S[0@\[0@e[0@M0@H- 0` ?0?0@0M?@?@0& < 8 1R4!f4a<90@[0@[0@@-P@-,@02s0S 2-Ԃ0@8@-P O0"0- X0p  pPT @T*0qu80 "8Ԃ0@[0@p@-O``h-0p<0S0#h@PPZ.?P30l0ph 0P($0 0,P Z03?X0S Q2/\  $:Q$ $$0 0 L0<L04RF _P⌔?PZ0, 000d4,P0@08004000PN03? 03?$ZP00S3Z 

 @ P ᪠嫠#'4"0s 07)t0p SSs{#< )x0S*S8)ipZލL;0@;0@) ;0@@x}4;0@@;0@uy_0@_0@t0@00`0  00D01@01<01$1S?$1(0 0 /0@[/@XZ/@X/@D- M@XP4* 40S 13/ PPDPRN P,002 0S00 000P0S`200Xb_ 70 000uP1)0000P0  ,000 S aP%0SUbPU*_10 R@PD@ 00 ]- p- 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:` Ѝs@-kPP@3P 0`P%  I@Pwtc@XfL Y@ UQ0S|d0@d0@d0@n0@d0@ e0@'w0@D-P`pi@P  (000p00 0~/@$/@(/@@- 0h0 @\ 0 S< 0:0080$0P<0@P0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p i@T:00Sp0XQd@j P` X@T*@Tm0PpF4 pe0@@-`0P d@p 8@T:00SX1Qd@j`T0 P` %@T :00S 4 pe0@N-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P0@ @P0 ##U 00 00 e0@e0@e0@e0@4 7@-<@ h& 5\P 0P>0D-p0P<@ 00 Sd`P `V :p 0 P$m  04 e0@D-M`p@P p0 (0`0# 030 RFP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ00@F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\SH0p".d &.0h  l0H0, =x H0p.d .0h  l0H0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(&PUЍ2Tv"3e0@D-p`@PP{ @P P!P^|1 T040Dp@0 00L000H000P00* 0  Z0000<@ 00,00$00(0y"pM0p`0,0000H`  0@00< ; ;S s04 000M?M @ @ @ @  40,f0@@-@p `PP  .f0@@-00S 3/@-00S 3/@-@-@04 ,?<100sl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`J0`FV 0##0l !"(     "8 \ 0 1#(00 0P1!4P1#000v-ah0@N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0# py)(  S py)4y)0 p圗)8 0S f-h0@N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Z-ah0@h0@p@-@`P9Q" 0!",` !!4!#000f:p5 0 1!41#000p``@@ Pp@fV 0p@T  0p@p1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00h0@1D-@`` !v`R  - - !-  r  w?  1PpzP  Zw A PpUw?`Ppv`P  Vw k PpUN-`PMp z P@Pt >11n?1 1=11= >C= 0]1101 0S{0 X'5|0B0@ Sq 0=0= 0=0!00S7 3/PP41S( 0 0S 3/0q<`00P`4uP <= 0==03= <|=0= <`=0= <D<0<< 0V0=0 T=0=Tg?#| \0  \%0 00w/@00 0010ĭ= X =PU`"t3 Rꄯ/@ ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH V<0{,`(P$p.<0@0 0S Z00|0 tHV   @01P00MZ111400=-^P P0 S0@S0@'w0@Vj0@H=0@=0@@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp` $0p$p`y@-@@P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/p,=0@h0@///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# v00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S/@/@/@/@0SP 0P00 00 @T @TN%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$/hSU S  S% S5,0( c Z 1 { QJ0305f,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#S 1S0 0 0`0(0S B0 !001 00F0T0Tl0@k0@l0@k0@N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wppp (0 js0 S J , \, ^0s000S 0ss0 \x0305q0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 k0@l0@@-0S S@@>< @ $  0s00@0S/o0@0D p@-`P\ `@T  4/pp   /S\S`/0S/@-@0pS S SI1`Faa`aa0PPvf  \cP*P0S S S"00``V0! V V0P0p  0"4  00pSp0  0pSp/D-p@ w000P0 ߠ0 `.00 eP`0 0S  S00D:@-`1p@0S@9@`PP  3P@*@ 81 S@`$` 000-0` Sl P@@P P 0 8 P00@ m0@m0@m0@N-MQ@`P1 !)?! ? p? F $!!M??/  0 0 P- !1 @`c!V*Р  p P @`bV ! p ? ? F !!M?P?P P Р РK"m0@00@-@ @ @T 0 S0P@P@PU 0@ S@000\0000Q 000F-QPp1P0 U(` #   @U7 RPE @uPT:JoP0 S?2P>1 <P  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  QGm0@ xH-0P @?0?0@0M?P?P Pl `P 006H PR, P `Kx  =n0@Z0@Z0@x0 0@-TM P @P T H  0@ @00,@L@0 TЍ0 @n0@N-M@(D d ,0TP"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  @{ S`Gx`  0`G@` x`@0|0P`  0/S\S@@ C1Sʝ\\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8PH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ^ʝ\0V0 S! d/ S H 0NP IP\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  @k|P 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%4P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  DHRpW P @ + 4zW 0 `4/ /40S 4 0% 4mP hP @ \( $$$D3(#$0 \:`PP(d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 \P @Q`d@g ZVI `hPP@d0 S?2P:* pY0@SP/d0 S2 0P)* pPW`:  0%P@`  0P`@3`gPXd0 S2 0P* p` pލ kn0@'w0@ n0@n0@n0@ Gm0@ n0@@-@`Pp '00 0-Ro0@0 04@- @ #D$@@4$s0R=0@N-`p< @P0 0 0S 0  KY 0( P0` 0 Kcq'  P` `@@ V 0( ЍNЍq0@p0@p0@p0@p0@N-`@PW 303 :: 0 `V p@PZUT# 2\WV:`Vp 0Pd@` p@-@P` 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS:Q Q0@0pp @-@Pd0    `0SPPp0U00 N- M DP H@p y0 0S*0Q `V v  V95P4@\+W) \  L0 k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍq0@N-PMpPs%S0@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʐ@ 0 0 MS ISfiS mSa@@(0@: 0^, QQ @@06S(0@: 0[, , Q Q004S@@"($     l00S*[.00[00@@@( 0! v0 @!@` @H0>Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S 0bPЍq0@o0@p@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:Ppo0@@--\`@@-@-  : @ Ѝ/-@-  0꠆0 00( 0$ 0 00 ? /0    / N-0ᤠ(0`p,@ P`  p`T_0 0!Y  U !P 00@Tp@-X XPX`0#D@ <00S0h00  p@  q0@h0@-0SP0#aQ<@  R(E00@`@   q0@RN-M@` >n0?s0Si0?s0 SdpWaPU^0SZ   0 RQ0?s0S SJ (`|,  0@ 0     0 H*00S&  0P0U0P  S0 ``Px11(w0@ x0@T0@p0@,0@.w0@l12.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>v7_dcache_inval_rangeERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled A335BONESKU#01SKU#02A335X_SKA335BNLTUnknown board, assuming Beaglebone LT/Black.Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM A33515BB1.5Could not get board ID. ddr_vtt_enboard_nameboard_revethaddr not set. Validating first E-fuse MAC Error %d registering CPSW switch ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lxenv_buf [%d bytes] too small for value of "%s" In: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,*** Warning - %s, using default environment Using default environment ERROR: Environment import failed: errno = %d at %s:%d/%s() env_common.c## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flagsethaddr:ma,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" ERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx CPU-## Loading init Ramdisk from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imagefilesystemFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedNULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialstdinstdoutstderrCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file, bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxset_default_envarocsdxbim### ERROR ### Please RESET the board ### U-Boot SPL 2013.04-dirty (Apr 20 2013 - 08:30:43) spl: ymodem err - %s Loaded %d bytes autoloadyesNo Ethernet devices found ethactProblem booting with BOOTP (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") usbmmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d u-boot.imgspl: error reading image %s, err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpmmc_read_datammc_reset_controller_fsmmmc_send_cmdmmc_init_streammmc_set_iosmmc_write_datammc_init_setupTimeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters ECC: uncorrectable. NAND: Unable to find NAND settings in GPMC Configuration - quitting  SPI probe failed. SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x musb-hdrc~~allocate_instanceUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d musb_g_ep0_irqmusb_h_ep0_continuemusb_host_rxmusb_h_ep0_irqmusb_ep_programmusb_rx_reiniterror: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s (((((AAAAAABBBBBB %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s:%u: %s: Assertion `%s' failed.EPTGMK0123456789ABCDEF0123456789abcdef## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d bootfile*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameBOOTP broadcast %d AM335x U-Boot SPL Retry count exceeded; starting again %pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime, [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotatenounknownnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dipaddrgatewayipnetmaskserveripnvlan*** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) filesizefileaddr/ *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again /s TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx D h/@2Dy0@\y0@$0@/@2Dy0@y0@$0@DDDDP T 0X \ 0000 00000p0t7| 111122|77    $ ( , 0 4 8 < @ H 0L  ` `d 0000 0 0` 5  "  $ ( , 0 "4 "8 "< "@ "H 0L 0000 0 0 $X b\ b0000 0 0 $` 5p 0t   JJ  4}0@/@Ja; 3&PKPKa; Q&PKP2Sa0 Ԫ k&PKP~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ȁ0@Ȁ0@Ѐ0@Ѐ0@؀0@؀0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ȁ0@ȁ0@Ё0@Ё0@؁0@؁0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@$3/@D8  !"#$%&'()*+,-./0123456789:<0@<0@g0@(/@/@p/@>g0@T/@L/@p/@g0@T/@L/@p/@$g0@T/@L/@p/@eserial0/@/@D/@`/@/@ /@/@`/@Ȳ/@/@    @  @  @               @usr/mdec/beagle004075500000000000000000000000001220553173000126205ustar00rootwheelusr/mdec/beagle/mlo010075500000000000000000000000271220553173000134100ustar00rootwheelMLO-beagleboard-2011.12usr/mdec/beagle/u-boot.img010075500000000000000000000000411220553173000145750ustar00rootwheelu-boot-beagleboard-2011.12-r8.imgusr/mdec/panda004075500000000000000000000000001220553173000124645ustar00rootwheelusr/mdec/panda/mlo010075500000000000000000001025441220553173000132630ustar00rootwheel@ CHSETTINGS\00@00@00@00@00@00@00@00@xV4耀C\8C\ `)%2П@P`РOP h0 P: PO ,   F 0@P/@- @L@-@@T \  00{0J Rʔ RP  t0 R R  0S  0S  <0 ,0 /ПP-sO-p`00@0@ 0@0@8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(Kn0 0 b 0  H@-@d0/ 0@0/0@@-0@QQ0@S/,0@-0 <!"( #4-ܜ0@0@ 0  4Q /᪪H@1J@1JUU@->Z'N 0  0@@-808 0DAt&"*" S@NPN00  0Sb("(RR /@B0@@-@ 0PN@Bң0@400 ,0R $ $0 @//ܜ0@0D0@ 0@-00@@-D}A D`@000 0 0P@ꬡ0@:0@B0@ ? | @-Q@p:CbC `3440D0D 0 00P$@ܜ0@0D,t10@:0@B0@D-0pJL0P00008`pn0=#8< 0`1.80P,>000YDVꬡ0@@B<0@0 00@-0@0zP @@B[0@A- p@P`0 0 0#R0 R  T0$z|0 0 00 0V000rVA&l0@-0 `00S *T0@` 24 2 24 2l05l0o0 `@ܜ0@0@h00S,;@@HHPPPP000/ᬡ0@8@-@PPE@T0 0P B8謡0@:0D-@P`00Sp R0Z000 pWPP0Z000 PU0 P0S R\1A-0 P1R H1HA0@ 0 1D"1@ >0Y @C0`000  pT0 0A0 L`dl `0<000 0000    A6ܜ0@`D0@870@B 0t0p@- l0@_PPQH`@`` 0P00@0}20P0#0@00P0@` QPP0@0pܜ0@0D`0;`0/ 00000$00,000 |0R080h080)0000P0 P,0 P00PSQP1 3/PP) 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP CD a P0 0, 0  200 0 10p 1 3/PP&' 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC J(X$*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/D0p@-S(@ S ,0 0,0 ,0 0,0(10,0 0,0(10(1H`VP  P PP,1808,1,1<00[%X,QcP`eP((p@, ,10,1pظ0@0@< 8Q 1@- RH %H513/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p uP +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`BVUh\l0`$d4P`d h0! P \l0@.;#5"0 9000000 CP`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ ~P 0R 0R 0R  0R  XPL0pLp pW*L0$ P 0tčPPp5 tTpGp4x0p 0 4"$ t0p ##x#< x ": S(12P8* PU:Pk 0P@e  0P``  0P ( P`p: S`02P@e00 P1:H` +ݍ0@߬0@0@0@0@0@p@-@P ` 0p@dꡭ0@N-0Q`p 0 0 @T P`pZWV# 2\UT:@TP 0` pf` 0 R /0  b S @ /0 0c0\  BR00 @@ 0$ ? 0 ` 8 p p%000S@D, 0* LQ  `  lQ`  ` ZQzQ0 tQ hQ(" 0(B(0 ? P p @0S{0  aXЍĮ0@0@-@-   f @ Ѝ/@-c0@JpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOTd dH2 Phb 7 ?ñ2 Гh"R 5 C2 PhX00@(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJ   0J8J J8x0J`JhJpJxJJ@]Y$I2X }, }JJDJJJEJJJJJJJJJ  k }  }  k }  }@   @ (       k }  } { {}  } ^ ~"@x0J(J0J8J0x0JPJAJP 2 @ J J(J DJ(J J(J@J8JhJZJL^@BDFHJLN"$&(*,.0@BDF #(-27<FP'@BHERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s Clock enable failed for 0x%p idlest 0x%x DPLL locking failed for %p Scaling voltage failed for vdd_mpu from TPS Scaling voltage failed for 0x%x FREQ UPDATE procedure failed!!Bypassing DPLL failed %p SDRAM: identified size not same as expected size identified: %x expected: %x ### ERROR ### Please RESET the board ### mkimage signature not found - ih_magic = %x Assuming u-boot.bin .. U-BootSPL: Un-supported Boot Device - %d!!! Unsupported OS image.. Jumping nevertheless.. U-Boot SPL %s (%s - %s) U-Boot 2011.12Apr 02 201218:13:04Texas Instruments %s Revision detection unimplementedu-boot.imgu-boot.binspl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d spl: error reading image %s, err - %d spl: wrong MMC boot mode (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table usbmmc** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dCard did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_set_iosmmc_write_datammc_init_streammmc_read_datammc_init_setupmmc_send_cmdFAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s (((((AAAAAABBBBBB0123456789ABCDEF(null)%s:%u: %s: Assertion `%s' failed.0123456789abcdefraise: Signal # %d caught į0@į0@̯0@̯0@ԯ0@ԯ0@ܯ0@ܯ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@İ0@İ0@̰0@̰0@԰0@԰0@ܰ0@ܰ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ı0@ı0@̱0@̱0@Ա0@Ա0@ܱ0@ܱ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@IJ0@IJ0@̲0@̲0@Բ0@Բ0@ܲ0@ܲ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@usr/mdec/panda/u-boot.bin010075500000000000000000007444141220553173000144600ustar00rootwheel` 耀@xV4llȑ  L)  HUӟ@P`РOP& |0 P:Fl\ X00 pW W !   R:lLL@ PeO     OР iHM! H4P 6 MOЍHM<" H4P ' tOР iHM" H4P  OР iHM" H4P 4OР iHM\# H4P OР iHM# H4P OР iHM$ H4P 耀0@//////0????////////@-5GP/@- @L@-@@T \  00{0JP R H RP 8 ,0 /ПP-;O-p`00@0@Y8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(KΧ0 0 b 0  H@-@d@-/D-P@` ᱧ Sp ᩧ Ppᢧp@-P@`       00000000Sp0P/4R 4/P@-Qy-d0PR e?>/ e-ꀯp@-@PPp00 p@ꈬ@-@PP0"01 R @D4!N?O?0般@-@P$00 般p@-@`P<0R0@Q  pp般@-P/@-0@QQ0@S/,0@-0 <!"( #4Ӑ脬ꀶ40S/ 0  4Q /᪪H@1J@1JUU@-,0 001s0g끦@Y@-808 0DAt&"*" S@NPN@-@8@- 0,//-0 Y @ 8v0`000 pᒤ0 0A0 `dl `0<000 00@0    S PA8ꄬ`D(870@B 0p/t0p@- l0@_PPQH`@`` 0P00@0}0P0#0@00P0@` QPP0@0p脬0DP MP//`0;`0/ 00000$00,000 |0R080h080@-  '8&@-  @-/////////  800/@-0@000 0 AD('Z4-|@뉅Cx-N(-\@ LDrP 8 g0'>P l6>]ENꀔW@-'_ꀀ@-x 00<0P @fP@7/P pW8@AID$HHL@< @bN@gDPF F @P 0`F00\]' L H04@00cD`x H0Ն 0@L耉ꀰY뀘)@@- K'l@0  0A  ah@- 0 00$lATN-P MT@`ZZp0P  Lj`'X=p `R/ pl ;dh x00 at0l;PPil ;PPclS.0 0 0 0lP P/l/tx 0l-l F 000  00 1 0W 00000  R R  吅p  60 10d R hP hp0 bP 00@0@0@@O :/P ЍAT$lAT ATBT/,~&M00000cSЍ//@-O:?@-O:?? ////8018<0C0 R S 0 / $H0'$H|'$H'$H 0 P: 0 /'$H0'$H8@-@P  PP7&@@  80/&P,0@ @T:0 8L;p'$H0'$H@ 0 /T//@-mp@-M@ ㆅ00<0,08 040@P&($ 0%00 0%0 0 0%z Z c0C0bvVVdnN%@0TT  @018 0,%ЍplꀀI5RwꀍY@-@%@x@-@%@@-@%@@-@%@@-@%@@-@%|@v@-@%s@m@-u%hdLP@-@ p% l% h% d% `%ۃP  U%R%O%L `K%4 PG%xH @C%l@ 0?%`D ;%T 7%Ѝ!)4H^gq{ꀂꀌ@-03/Rp@-@p@" P⽆`,%D @P@ %p<, <4 /@-3PꀀPP@-`@$);4/ꀀPPN-Pp@?`"0S`0 70S`U 啃 Y & 0 0p 0-}[0DiP<`@4$: 04/Ѝꀍ@- 00csV'8@-@$N8PP|u$Pl 7PXj$7He$ 7P8 4^$P(Z$P81Ri~ꀖꀱRA-@pP`80A `PPV]>N-p0,`(@4P80j7V V)T T``($`$$  8.7000$$0 }`P000 $Y I:$dL#Y 8:v3 T#P 0SiN-C p.`3|6⪀6P6 ⭀}W<3@ l@:7TP@P7P\#P㈠##9+6P#96Z #/6Pt# h#9Q P#9P/90S SS S P T0"6 @0 P0&Tc#꘡@ 0@D09S#k9 PTAT0Sx 7Pd]0\0^ @00L06D0XS(#4,Z`# *P0X00`0ZZ ZY@d00h00 06Pl00p00  0C8Pdlf0 HP Ѝ(l뀌]뀓lꀁꀖꀴ(Hkꀏꀴ/F-`4M@P0 pE P Y  E 0i PvA0 S"00^ 1YaD Y Y7 Y`@YL YT YY>X0H0\00]00,0 000bPPJX,  aDdh x00 at06PP:t rIx kB+l17lp Q7  06/PP   06/PPx   06/PP T_"Es  06/P4ЍY(l@^N-R@MP0p`<08 800:SS #S   0G  0EPxA>X0H0\00]00<0 000Pp pD0S "0Sx!p!pE8  0{p[ 8$< X a]0 @S[ P 區pP 0T )`0F3/!8^ 0AT [ `@^4^ l!7  04/7  0+@Ѝ(l}ꀷ s@-PT`_0P @B@P 000`@! 0@|F]JF-b=Pv!p@删4 4`D.I.0O0R \.0S0m!0S< f! Y M!@TB@b^ꀘ$D-p@`VP \PP0cSPp /!P`VW %!R@-0 ڂ0cN- BpM@R&999:耄P  \P  㸂P  㰂 P媂{U l 埂pJP  gl0S` :S   l僂`P   KP\@ L }P <  00 0`  0 iP iP 0 KiP Y Y 1 i P  0` ZiXil0 d ` `hT`?pЍEN$A^3cꀈꀨ]RD-@P; pIP V 0S` :S B ! `T  @d@uiP\ ?iPL 03 h@P (, hh#UꀈꀨQR@-Pʰ ( `IpP 0S :S d 媁@@kP  0^n# RD-@P@0 ㉁pnIP 0S :S @ s`` XkP  0<T ,znP@ 5#hUꀑF-RM@P@  Gp,IP>0S :S 1`` kP  0y T     0np@ 0L`_<[8 <,Ѝ#= <, <4 /8@-@PU;8nPP$ #bu0 u0Pt %00T@PP <8,888Xm뀦)G-`QP00SS0XRSM R 0C R  SRS> @ )T}@@}PTG0V`FaFp堐{ T @Ttp@FPp TD P @T<G@2"$ꀍQW&ꀺ-/y@-$0 wNЍXm6N-R0M`@p0aS-R9P 8;8 " -P T   :@PT * ] tPP t R }P2T  hZP  T`0p  0@pT * &sI sPP`o Kt U |PPT\ڔI `pPC sPW3tx =0sSTF0T0 0 0i 0,0 D<R'00p@0'`Q`1,0  ,00eS0,0,0 R @,P>Q V>Q%[R&00`@0&pxPp,,0 S SP1,0 0D  V@ U,00]S,0]QPg@,h|,|P0 U ` @,0p@xWoP@0 =rPsll CPrPlSpSUP PT T` @(g@즟uopPscT  $0/o$PpU NI$?DmD `( )m0@SZpIII耤J耸J耸J耸J耸JJ lnT0 4&P0(\$&$d @T@ B@DT:dT@3 lpmP$*s#Tl dxTL d\ $L @dT0T(pP%P#  {P TnPrT qPP rHrPPr0hSLC`YPVP0P 80I$0 C0=04{U0,sU 0 $kU0$c2Smx][h {PP }200 zP ]~ @P W~<2 0$ zPPP00pS"am@$" 0lpPHrtg000X0 0 PUWaS ~ ~81 0[p@PE!rdS8 }0kp@P5r00cSTTPPT@  x}@ s}Pl`# 0"  nzPP00$L0ЍXmWuꀤ\m=2^yZ>)>ZUꀭꀵꀓ}2">Mdzꀑꀨꀶ)wR-0K}ꀜꀶvRA-P A0iS cSsS tS```` }@PBPP LVP V VPPpP3 01&ꀬ@-$$ `0A 0m۶<, <4 /0 .R00@/R 0S//RA-@`P8 p_P  E0H 뀈Q W SPMRA-@`P8 p P  E0P`V0/,\N-@ M`=Pm P,(3 @3000cimP mP mP V`QP0S mpP pt2 Y pWX, PLnE<n PV0Si`p`3r0p 0mp 0W 0 pP   0 R QS@1 0@p0 0h0S01 (ENꀔR  @-<0Q0  0S ЍN-P8M@0 ` p$cQ bQ(sQ tQ#R aR_` @T  0o 0pRP ` Q@DT -RI B HmV@DP 4 00 i P'000 04`[0000 00`0h@P000 0 [ x @-@M@ L0 0  00ygPX PXЍ 7iPP; Q =  t -0S P P 0 0P Q HXT R  0Ѝ0w뀷-< gu뀠R@-P2@PQR@ M kPd ` @P  P5iPP P3_ , G$P pWQ* h$P& p $ Uw `0FSK`V1 D0$`Pp I$p$W뀸뀸D-R M@ ^PY  PkPTt@P PCTP@PD@P! 4h R ^ g -:S  000 0S0Pʼ0@ <"<4("$Pm`p PpfV `) T%  Ѝ<P 72lk;@S<, <4 /@-@`PP!0P|P&V P 0S @PP@p| `V @P  jh`WP PꀙV'K]m{뀋R@-A aj@@//RN-`B@KgPP@`Fp@gP ;gP 6gP 0gP V'gP YhgPAgp3DgP7gPUUW gPfp3fPfP}fPfP_|fPf렯iXfP   j  j 0`sWfP   j  jZFfP   i  iZ4fP  i iZ"LfP   i  iZ|fP  i  iZUUW P`iV A[ z3z3 OfPP !P pSLORU뀷뀶뀺$ꀫ뀲뀣뀧뀼N-RhM R REA (i@< i@ P| d i`+PP 0SP``0S4Yd0S :S F dhpp |1P  De$ e00< 0%=01D  eP  ePt D00 $0X` 07@-1@S<!a0P0 #4dP(dPHdP ( H01S |!hh!8T!HC?0B/ $#4>Khu)뀀뀟7@-@Px0ll @  0\00T0 0L0S <, Ѝ0@ Ѝ0!뀍7뀥)p@-@P` PL 80Sp(`p@Ui뀕)뀣@-0  @t00Sd S\ STTz0Hu00S0n(@k뀮뀲)G-@}`P|Gp J%1YP|`1UG?)F-@P dp4` 0(0Pp S$%R0R\ \0C\0S8 Y 0  C W 0 0p|p p0 0!60 pS  S 10 cP(cPHcP H00 (0p5S  (P `5ZQW" &6N@- M@ d l ЍRD-`p ScP  McP  |?&Py+dD=L 9c@P< 040S(   *c@Pr# c@P"V u#PP 8@ T f`Sb#PP 0S @ TlF` bPD'D bP#V`p'@P 0S W` 'h.p e'0P 0S [.V3bP$`R0S)V e e` e@ 0<'` 0 [;QpPS 0 G00R .  I$R&R0000R00$R0    0 00Z @ 0fS  ` `0    |   000ppT]P/0@  @/@/PD0  <04,0Q0@///T]u 0R00/Ḵ@- 0S 0 /Ḵ@-P 0!S\T0LLL 0VP<0<0808 0  %%M`PkMf000!1eL`PM W|`  F!@  @!D 8p  p4P H PL@ 0 08@@8 , ( P,K P rPJ@DT 4 00 @D4 , ( P,K P rPJ@DTH0pP<WL@0X 0P L`P`zM8 $GK 뀀'뀙ꀈ'뀰'뀼'H&W&'@- !  0_N-8Mp V0007IP`,37 [  0HPP! T 4 XT 4@0S@PU00 d 0P00 H 0P 4Z` @PPF8Ѝ''(''p@-@PM/ GP` 0G 0QPNKPU ` :#:A]P``^PPc0 P0KPЍpp@-@P p@KLp@-P@HPp,LH p@K'N-@M`@0_IpP~ R< 80``P Pp0Z.p``)@TPp@-Pz)0p@-SP@  R0S 000`0 0   0 pp@-0`@S Pd00egP0S `0 00pRp@-@P ,YRP \Ppp@)8@-PP 0p@$S 0?S 8P4"_W8@RP8@T88Lv뀝)N-@`p* U j `r @ QPRUp  `P`P R PV@ Q00` QPPV QA @ Q PP QPT F-!0p0[ QP@P x CQ=QP``P1@@QP @TAQPW10Sp@/ + 0S &W0S00Q@QP t0Q@p @@T@@@uP2ꀠ)Lv)p@-PP0@pIQP @TpT0` 0S Dp@`0S00p@Lv)@-    8@-@P0 P 0PP8F-頡P@pQP`V0 %  p WWpp x 0 00SD pp pppT 0S  0R3 S 0 00R00 0 000  0   F 0R00 0 pW|aF-0@SP`P0S J0S 0 {P @r0\R00S RpP+ PzP 0 q 10\R0  S R00 0R00 0S ) 080S/Lv@-LPH@PD08,883P0(8@)Lv)뀄x**p@-@PM`/ 0S, .PP 0S 4PPOO|00t0P 000 0@ @0080@ 000 0@@Ѝp)pTN-@8Mp#0 C zC 0q0 PUS7PR 0 S 00SS 0 S A87  pW 0$pppP p`pp  BR 07P0Q@pWPPU PPUPG |PG 0u0$Q  RPqP3 0 ~GpP(W{0S VZ00Yk 000 0O "  `, 04p3F& S# gOpP@k oO@p,0` O,O  #O1 0@P0S 0Z 0P00004p @ `0Y 0P 0 0 ` 00P 0 0  W W[  W0[000S #S PP 0S @ ;P Z@. Y+ O=NP M0 0 0Z A0 P 0 1Y 0 0C 0, 1   0P 0 0 Q5  P,`m`N 0ZP UNRNN0V  0S0,`N 006141;gNP0x .P0` O L1P R 0 jR "0 00 0:/0S 00iz0 0j42"0Z 042( $W R W$# WZ 0SS0 0 0PQ@@TI 8ЍLv뀷QW *C*@*N-0M@` NuP` K0S  005 080S Z 03/[ 0KS(0S [   P Z  Z(0S 0S. [ &Z #Z $Z/ "Z;Z 'Z\Z |Z 0S (0S 03/03/ Pp#( )y ( " 03/03/00 0   03/ 03/0000_P0S 0?P {P .0     03/S 0  03/ 03/}Pp}P;9 0,00S8  03/'Ppp&#0,0(00s03(0 J  D&Y 03/   9|Y 03/ T 03/p\1  (Fl1  M   P u0 S,< 1PRP$P,%u00S ) 0R 0,000S00,(0 S ,$z  U0ЍY0S 2ꀂ*Lv|耇*뀰*@-000(0000 000 lЍ|8@- 0DPp@-@MP``P | ph \ P H P 4r,e00܍p(4뀨')474@-0SS G3/@-@P P'PQp@-@Pp 0SP _|P0S00pp@@-@P`Pt dPPpP  DPQ 0 P @@ 0  'D-@P`pP 0T0 `P CP@*p@000@-@P , !P '00@  R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSSp 0pS`V ` pP~00F Sx+++,逐-,逐-$,4,D, @ ` @ ` @ ` @ ` `  @ ` @ ` @ `  RpH<,!C<#J$#J%#J<P:pP3040pP*0p400P0 40 pP sP  pP0UfP P```@/8@-pP@`4P 4@EBP PU@@8@-PP@ <5@P < xC |B8@-P (048 840408 -t0DM4 4 8 d< 2CL SB10<0$040(00000,0,0DЍ뀠%뀔逤逬逴|02#0@-P> 0*A4+! !0|00.  S00@-@C@DT 0P/   (%L0p 3/L뀟%D-0`PVrBZ! 0$4p0,Ġ1'tp@5`0 0( 0g%V 5`FSV5SE @LXS8@-@ŀC%P5PESU%0P 88|/@-p`@  iP 1U@|`1TPN- 0@S` \R B0Q10p|>0S S30 S G 01 pjB0%10&1J#&! &! %!p%J 0QB00>0  $ "$ 0S 0PE0 R;4@-h0 w`p1M4P $K/  0@P PP0wVt0p00 Vh`l` @ 0ppЍ@-$(M"(@h 08#8 0d00  0Ѝ@-@p `0P`P PLd@` 0 4 S0 0[4뀀4@-0d 0 0 00 0Ѝ0@-MA0 Q|U|#&1S0Sl*h0("(1 4 ! }/  0Ѝ04@-h 0M!!$d0  @00 0tPlpЍ@-h("(0  Č! d   !0YЍ@-4h8@M#800!0 0d00  !0@Ѝ@-48M#8@h0 00$08#8! 0d00  =0#Ѝ@-48M#8@h0 00$08#8! 0d00  0ЍN-M⸓@`pPdh0 104 0 PPUЍ@-P!h  p@P00 0P00 0P0S0S 0T   \0RS00PP2@-RSpMP`@000 Q. 0Q  0P%0S" 045 0PpG 0? S *PUPP 0P  ߍ 0q0/HLp@-< Q`T0@L 0@0%<%@%D%H%L%P%T%X%8% (>H >Q  0"Q ( 0Q H 0Qߍ8565o5뀛55 6s@-P` @P/0 00 !(%R  t P\h'0 0<0a0($E U&P  c|86N-M@PPy @ *Pr $Pl [> 040#40 />  +>0 0S   0 0S  05`P=Kp3`/hP*<ⶠᴰ n  0 S(5S _      p5Wߍp@-`P@`P =`M@ T8@0<9P p@\<p@X`H$DP6e6D-\p\@P`T@Z=0000h0 14 D P z/ !0 PHd) h0 104 = h0 104 =(ЍpN-@P ` =R02 p0SpT00t3/P XX<00R0Sp2000T000X3/dX`VhNN-PR(M` @2p :#p@PP 0 R @ TPpp㐺*0AR0P  0UPg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 <R0( 200  00  0`PS00  3/P X0Ś 0k<00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  P_pP(ЍhN6N-PR(M` @2p :#p@PP 0 R @ TPp:p㐺*0AR0P  0Pg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 ;R0* 200  00  0`PS00  3/P X0Ś 0;00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  PpP(ЍhN60"P0p 0 /hN/p@-TP2S@Ð` 87p` @2Tp,phNL70@- @0S 4MR%PhPQT ] Wh `RT {;,00}?0 04Ѝ0USBChNN-D"00M!0R3`@0 h 0倠 0h 0 0僧0 0j}_h0 14   DS !0 P8P UW h0 140UMTpWJ X m$$ `[ P,0}/0 0 @ 5S  ` 0,0U0, U V `F,0PU pW ` ` `05  Br  0Ѝs@-% 00@$0 P joP `FvP dB00 0S0SS P 10C8#8S 1 |37뀤F-`M@Ppp) 0Spa 1#40101SPW Y05,03/J P0SSF  M:R02 00 0\00`0 0[0 0SY05$ 0SP S S  V T d`W  ЍR7뀏7@-h0 14 } 0 ЍN-1 MP@᪑iP` 0h  Ġ`- ``g00T0 S p Ywp  }/ X P 059 W  P2pp}?0 0p' 05  PP d0R\0" 0 BR 0S T QS ЍUSBShND-aPV@y|p'!1Su"1S`q So4 l9`P`"1 0#1S 0 :PS x100t1,0|0 G/ T100P1LK00S00P 0ĵ 0ĥ00S00 00 %0 Q P- `V+ `V( 0S `V" QQ Q  0S % R % h  t40$5E``QxFS逐E77tEN-bp?X00@ 0 0R0ء 8R020$00T0 0S000 3/P YYxvRb2 RM L0 0- 8 A8P V8 PQPZPP  0R P `++0  X08P% 8R0200T00S000x3/P PUPPP `PV -=0%=C0hN86.8N-@ M,h8T yA堡q`p Z80H`0PVP 0 0`dpp@XAXRP? "4`㖒"P/ rG"`h0104`$    }/ 0 G40P`œ'p   !P202Z2SQ\P U<@82S Ѝ0Q>8N(H逐JhN0Sj8뀗8p@-P@<`{8@qPTlPp`p蠆@-@0P4T@-PB04S ]004P,bp0PB! 0PS SS S404j 40 4f$4p0W$4[U1X+8S0tPM p0wPS;0404 0P=  0 P4aU0P/ (4S 0|P& @ $40"S (4S  50 $ 44P  08#8RD 0 $R@(0LP 4T쀐=X>X?XP@-TH0H  P@ @  <0A T,E>bH HHpX쀠0 /pX<, <4 //@-13/p@- 0 M000P0P 8@80001  3/`P 0  12 @00S 4?`@T*T7` Ѝp@R>h>-0$M0 00 1 3/$Ѝ8 @-0\0S X쀄>N- MP`@PpO pLQLQ 0 g00 0Cp7@ 0gZ!R0C   0 (R#   0 00 1 $!3/ P1 3/ P &0010v101 3/P  pW: Ѝ>>N-0M@P`P@S wPNq [ p1Z  :W000@0 S0(p00000P,00$01  3/PP ~P0 00W00S 0000PP1  3/P Pe@ W[0 ) P@0Ѝ ?8?J?@-S4MP000@0pS0 000 ,00$0p(P1  @3/`PU 0000``1  3/P !4ЍJ?F-@R`p PP@ Qd P Z 1 0 PZ0 `p'@ ?@-@ M0 1    3/@P}0 Ѝ@-Dq$M@o70 000  1 3/PP>)0000P0 P,0 P00PSQP1 3/PP)0 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP C\0 a P0 0, 0  200 0 10p 1 3/PP&?0 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?@-@0P 00 0@-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC JX*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/< 8Q 1@- RH %H513/@-D13/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p {.P +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`tVUh\l0`$d4P`d h0! P L,4.;#5"0 9000000 *P`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ P 0R 0R 0R  0R  s-PL0pLp pW*L0  P 0tčPPpGtTpG+p4x0p 0 4"$|1t0p ##t#0Ie 00rP@A뀨a!A@-0 H0lI" hP d"@PP0TH IO00 00T@@T Z9A뀷 QA @- HBH! @=@-0@0d! H5 H) H+@-00@ @| 00  @ A 000| 000 00   A  0/0  /@-@A0 / @-C耍[@-H Pp@-@ P`A p@ A08@-P@P8@- 0@0@@-@0@D@p@-@`P0P (Up(0Sp@-0@ S S !S "S (0 0bp@-0`00@T`\Pd"@ TpZZAQؙؙ  0!//ZF-h1QUU r/㲠[/BT`0` R@@@D 00cS\㚐 8@PTpI@\P0Px000P\0S# 0R*T P"QU p\0Pz* cR !R \ P 0 0 00S6 P PPPZ[쀔\N-xjtDP@s'P` T0`DT y(`01(R$4P5'4, !< !XC !T [UN r?80 0 nu|NYT[U\ r?800"LC: s7 A @3` ]$20@2Ab$0(RV2Wb Py?,Rt_ub0 0R_"b4R(PRb8rRb"0S ($ @4P84 0S `  0 0 0 0  0T0T0SP@ P @* P@ P@80SJ<=L0% L0 P@8 P*@l P@l P@ P @" , P}@ Pw@ Pq@ Pk@G PeT"@, |P^@P PX@,pPR@ PL @(  aPRB< <@h P7 @)h MP/P  P @E @AP @ P ;@aP< pU#2PUW W U Ѝ4 K`0V00 %P0:P0< 9hx0< c< vP0< Z< m 0 '?BB뀡0BPBB 0 (/ `@-BϠ`@P0(!(pWpWX "|0D`@P0"!GoH #!I 0P00S0SEĵFĥ0 0S00G00`J0 F?R +P EPFPGPE 8@-@RP T 8DD 3'@08P 080$000(0,0,0(00088 `CC@Х\00 PP/00//bhR#/! / S/@-P@0T/0R*0 0 P//@-P@T0T0@-@P 0T 0@-@P 0T0N-(`Pp,@0 S @@ 0P (0@s/@-P @T R$0Q 0 0 0 0LLL 30 00$0 4(0 ,a/Ѝ@$ЍC뀴{ZC뀁xCP/P/ 00 0/0P P/P//@-P@@-@P QP/ 0 0/p@-PK`@PHH K?D K/!,00<00`P00p5Cp@-@Pp@PUpX0T  Q0T X0p 0T08`0P@P00CP0@@0Sp@p@-@T@HC0P@- P/3AP*xضж退逜途逜逤逸жض$(P (P (\  P0j/05A˾00 4S S SCS S S< .10*0*000* j?" 00010PP㠠꜠P0 4WpWpZW  u0505YH h#c$ H뀑ctc뀥78@-t7 POHA000001fP$TAB]` 0@1 :D10L1P1T1?0X11P1@P  : 0 400#40 0 $  "$ `@1  @  @ 0x1@!( !888 h쀐H뀫HtcH!Ϡ\@->N-!oV@ p 8P失!TP UU` pNJ pN' h!8@-@ 1問 0㐏 0㋏ 0冏P00P0 0C/@ 0<000@008 0@0 0<ӏP|0<͏Pd壽8<SL0L 0 08 08XJГJhJJ JH@J HLJii8@-㩏P0  @00៏Ptum80 0T '0D "04 ( 08@J J(IJhJГJXJ0  @ 0< /lj0   0< /lj0  0< /lj80 R $ 0S0  /ilj@-Qa0A T0 pS*pcW0SH Wp 0T pTp 0 0W0 # 30t`: S(12P8* PU:Pk 0P@e  0P``  0P 幱 P`p: S`02P@e00 P1:H奱` ݲ+ݍj k퀀L뀒L뀠Lj k!L뀹L@-ApM0S- 刱000CS@PX`hpxH |@i0eDl @P t[ K `X0XV `0k@[@MpЍjLL:::A;@LLMcM 0p@-@P `0 0p@ BM 0P/8@-0/S\S10/S\S !g R Q0A/R\R    P.Q Q\Q/Q /\\\ @.T S\\/\Q 0/\\\A  B PR0T 0R/0000"/P@ 0eQ Q\ 0\/S\SL /Q\Q/\\\ 8ccc8@-(@02PPR8cU@-h MB0tT厰/Q\Q 0i 0$ 2## 2/ۍcNMvMp@-@t Mb0vP\k/Q\Q 8F $0, 2## 8@-@ P8D-P@`pP 8@-P@@08N-`@PPp' &S  P  P 0S @ P0@S   @0TSSp@-@`P 0 p@@-@P`\pjP PV z V@-@P@Z@-@P@Rp@-P@`PV@ 'V@ @pN- p@ `P ;5 P   P  PWP``PU@-@p`P 0 p@-P p@-@ P`P T  pp@-@p`P 0 p7@-X 0P@0P  R 0( 0P  R>7(1(s@-P,`@ P 0|'F-@ PpP+0P/S `# / P``  jPp p0/S S / P`` 0ipP0Sp@-@P  p@N-@Z`PBY? `pP+SPE/Q0CJZ0 P `) 0 S 0P/00P W 0 SUPE00 p W00W0S w`w` ``ЍF-P@ P#Tp' `0S`QZ0T  P00P0Spq @- 0P p@-P@ Pp B0p@F-(`Pp P  0P 0S P  BP@ 0Asp@- @P P P  &P` pD-@0t P`P  p v P  P `f`P`UM@-Pp`g@P   p P  P@@<, <4 /D-@P'PpPP`: `PP :` V#3@-@@-@$@-@ @-@ 8@-@ P 8@-@8@-@P88@-@P88@-@P00@8D-P@p(` ( 30   v`p r   iDF-P@`UpZ W 0e0S f  e @-@P`pP $>Pej 8k@-P`"2@pP (PeRM !T40/p@-@ePPP` P $  P PV ppL-`@PLP 0P@ HD pA-P`4p@P aV@ 0AD-`P@P  `P@ #  0 p  0hP@ N- M@p0@P e 0`PP  0  0EPPG uJLPPL 0 0{  pP00 0p m0 0pP 0 p`0  n piW0`0 0PP40D APU  N P Ѝ@-Pp`@P 0r P@   0 @N-@P`P4 0P,p*p Pp @PHP 0P @40    P40p@-@`P@ 0 p@A-`P@PpP e0At@N-P@p`P\9P`*$   $ P 0S`E   P P`5h , |( W$ 0 UT1*  Q  0  @00<20UT`Ѝ p@-@0PP`$C 0"}pP4/0/ p$0`0P/ /MMM<, <4 /@- 0P/@-@ 8@-@P8D-@$`Pp ` * pgp`V$D@-@@-@8@-@P00@8@-@'Q8@-@P L404020088/L-@PP$~PPy`puVP p  @-0 D-`P\@P pkP@ 40 ~8@-PG@PYP40@8N-@ 6`P?+ (Pip  PPPj $ 00 pPg0P: @  U  @P 40  (`ЍD-@PP>PP8 40 p`$ g` "pP p p ^ P0SP  @-@05 P 0R@-00P#  S:7@-0@P0$ ~0QS>p@-`P@P  @e@30P:@p8@-P0@(ܩP P8@-@G a0@-R1@   @\T:  ` p@-0 @`\UP2P5:PPUP@T: p0 B,R/,0@- ,@ D$@@$ R,R \p@-0 0 R , 0P"!C@|`@D `a &`a &`a &`a &TU!p$00S  ,p,@-@-  u8&F-`p<@ " 0  Z Z @D 0U ЍP " 00 0@ as' Dy" o" P@P @@83T (.  ЍF(,ꀟN뀬N뀰N뀵NN-PMpPp@S@@!PU= P8  UP! `T  0! T     `V:`    .`V P 0 D CHۦPpe00WPЍꀽN2N㈨N-@0@M$00(0Pp <0`d` P 嬦00f0Pp Pp [`噦 0 c  fq p PeP @Ѝ##NNN@-\   @ Č  @T @T\: TO+O 0p@-`Q0 p0S@@PPS* Q Q 0@0 `Pppj@-@P P`T0 0p0SQO` P0VH00jD-p `@P0 0SP00P 0```p `0W:0 jF-P@pP ` 0 R  }P0```P `0U:0 jN-M   p8@yJ 0Z" Q``  P 0UP g uU # 5PQ R 0 0廦`l0 ` 00S1 Pq0 lAP U0Pi0iPU/  0 R% PQ R 0 0偦`20 ` 00S P070 20 0S0S & 0R  00! \ P0``0`P0S 0S 0P00PP0 PPЍj0@-M  0@ 09PPP0   0"0 0  000Ѝ0jN-M@0R100MPp$ ( ` ` ,@ C U  @0S90 `0 [P0  0Z `0 `0 0#R00S$ 01g 0W`  ^S \S0S 0Y $1$,@_ 0T @ T*m 0 4( PU  $ 0=\"ጧ(0PP PP PP \PQPp0S00K$POjN-PP M@`p2   P1   x  @00S 0S ` @ ` @ P P ;[@0 S S` #S `0SD SA0`S=S S S R S R =S00 `00%000 `\R R`  0 R R00@P0 0[ <季 ` 0V*0S ߤ ЍjON-\ PU d @0p` PUVX V `Q@`V@pbqAPPPaPPP S:P@LS"*`↡ 剡牑q  Z W a ! 0S :@U\01 P3QP5P5@D2 P5@"'A  %*T0Q5 5Ѝ0/0 0 0 X0\0P T0/F-@Pp`0PXP\0`0\U@T:T1 aPy Pl`y ` @ApG000 0Z@:PpU @ A0  b V A0 b !APd  lF9P50@-0 @ PPQ*T*0 S:00N-pP0 00bG p@q0P6`V0:Y ``d Z** `Y `d`d`p  P @D l  P` aV:`d`Z  V R0 pKpG[`Ѝp@-P@`P hpO0@-P0 @X \@@@DQ@@Q@3T0 S://@-P@p`lUQ`g`s@-@P `PT  TT @0S@`V % LX%|N-RQP@ 0`7ApppW: e0g  @ 0P    xs @ pPP  Ap4 jr88 ( Q  R P Pa< `岠Z`,`Ŋ `Ӻ,,`af$ ff(@$D2f 0,<0岠0(@0((0D \D` 0P`@ `  V@ PF TX 0`@ T4  P Q PaeAh `lVP` \: `e ` 8`  Z``V:`$Q` q `` `fFa`tQ 4  Pp  @2  a岐DP@   < @`PR ЍRꀯP/0S  4   S  ( , 0 8 < lPL//Rp@-@P3 1R<S00-P- 0 0S(0 $0 S0 $0 0(3/P U0Pe0E20/U0P0ES$0( 3/000$P40p@pppNꀔN0%0 @-@P  R $0S 4Q ( 3/($0 3/D-RX@p h%X 0P2U\EPE`VlF`FQ RN0pGP`W`2U\ETPEV}GV=0pG00 P `P `P `P `P `P `P `P `P `P `P `P `P `P `P @`TP``PP`D W0W 1ERpGPR`PR`P R`P R`P R`P R`P R`PR`PR`PR`PR`PR`PR`PR`PR`P`W  @0 0CP`S(}Py`N-PHM< @T   Y0S00 S 0 8`q R%&b$ PPE>f  0 0  P4 `Wc  pGePU0S` >F =C 0S&$    D`&dE`D 0P0` 0W<  pGePU 0S`0  &4D`E0&8&lF0G`D 0P0` 0W  pGePU 0S  &$ 0  D`&dE`D n0P0`0+ W pGePU @`R`<` D`&dE`D M` 0S P000 ) @ W010!S Q P  b\ b 0%0    0 0@ pc0c@0@0S0@000 +$ W 0 Q0 P @ R7 2@ 5\S:    00\pc  0S 0@000 *$ Wt 0 Q0 $P @ (R7 2@ 5\S:    00\pc Q 0S$ 00   0WE pGePU1V9*P` 0S$ ,  0  4W(  pGePU&,&4,<l040`40 00P 0S  p8`l0L00T0T00/>0l0p P5. 0h 0d `00$0uT03L0C(0 (00SW$ 0pGePPW pGePU:6cPc0hLPW pGePU:Q6cPc/  06 &aPE$PW pGePU:6c  a W pGePU:6c  ccP0$ Q3000 h R7hh$Q:0S S>l0L0 0T0/΄T0l$` $0p Pd3l0`P00X0X08$0d P$3003W[ p 8`E0C0 MH0$@lk$ . H UeUUV.V]KVjV뀈VkV'$ꀹVV ]$p1s@-Pd!0@0CSI긚P|ꀠPPꀸ<0P TPaLIP P 0 P@d;008#,#48#80@<0<0l"@ <0<0L@@0@,|kVeW뀬NVVW뀎p@-T@TP0 0S0<<zp@"0l(0Spp@~e/WWDWA-`2@ PQ R 0V R RUp0PE#$48#8Sx S S42 `@ ` r P `@V:A?U0#DDH$H1T@  @ ! ( D Q#lQ`H1 RR R  Q `  =`0 S@0 000 0C## PE `Z0 R`50U(ʇ 0#$$("(ʇ0#$48#80CSP嶇 D0 <寇AaeGW뀊OWSW]W뀙W뀱W4kWs@-thzP  \2X_zPHB  Q*,呇2/ b2PB0U02! !4!0^ Pq:0PP P- 00XA`W\H1X RP0S D10S !  0R A A*;Q 5  0*P|@0000`E00`=Y` |h<0Ѝp@WeWW뀔lkX'X뀨VXSX뀌kkX뀌X뀲X뀍]XXꀈꀎ@-YY@P>xY@P>hچYYnY>Y>iY>fY@P`Y@X@-6VY>SYY>@Y@-:] 0  -4M(Z*( +)0,- yPx4ЍY @-00 |0R KY,YP`0#( (,##  ((,(0 0! !脬0D0J0J@-DD WY 88SY400 ,0R  @HYJ 1Jꀄ`Dh@-d  HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO>"R 5 C2 PhX dH2 Phb 7 ?ñ2 ГhTdY * Zh F2@-* Zh F2* Zh F200@1JPHpHHHH2X }, }  k }  } } ^ ~" { {}   k }  }  k }  }@   @ (        P 2 @JJJJ0J8J J8x0J`JhJpJxJJ@x0J(J0J8J0x0JPJ`JJJJJJJJJDJJJEJJJJJ J J(J DJ(J J(J@J8JhJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJAJ@]Y$Iv7_outer_cache_inval_range $H !(08@HPX`gnu|ꀃꀊꀑꀘꀟꀧꀮꀶꀾ*d!d*耣$do_env_import%Kdo_env_export W  $+ 5< C U-Boot 2011.12 (Apr 02 2012 - 18:13:04)bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000set_default_envenv_importfdt_fixup_memory_banksethaddr__of_translate_addressW3b3h3n3u3|3뀀33뀏33A뀍c2p2v2|2뀀22뀄22뀓2 2뀝22뀭22뀽22222222222 o3 33 3 3-363?3E3K3Q3뀍 011*131<1D1$U1b1p1 1뀘1 1뀵1111 11)2#2*252 H2Q2뀍0뀝00뀰0000000뀍  ( w 9909@9J9V9`9뀀9L 뀀 #(-27<FP'@Bmmc_set_iosmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupH\p$$7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-EPTGMK(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     QQ뀍QQQRR#R뀍@BDFHJLN"$&(*,.0@BDFJL^ZPRTVXZ \ ^ `b dfhjlnp r tvxz|~         2468: <>HJLNPRTVXZ\^`bdfhjlnprtvx z | ~  @BDFHNPRTVX\`bdfhjZ#Y0Jusbd_rcv_completeusbd_alloc_urbusbd_device_event_irqN/A*EHCI Host Controlleru-bootext2fs_devreadeth_get_dev_by_nameERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s SDRAM: identified size not same as expected size identified: %x expected: %x I2C: %s baudrateMMC: ipaddrloadaddrbootfileNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: Starting kernel ... bootargsmachidUsing machid 0x%x from environment WARNING: Caches not enabled ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... (not set)%-12s= 0x%08lX arch_numberboot_paramsDRAM bank-> start-> size%-12s= %s ip_addr = %pI4 baudrate = %d bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsresetPerform RESET of the CPUbootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order %lxinitrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartno%lXfilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSboot default, i.e., run 'bootcmd'bootdiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)loadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationecho args to console[args..] - echo args to console; \c suppresses newlineexitexit script** No boot file defined ** ** Bad partition %d ** Loading file "%s" from %s device %d:%d (%.32s) Loading file "%s" from %s device %d ** Bad partition - %s %d:%d ** ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X ** Block device %s %d not supported ** Invalid boot device, use `dev[:part]' ** ** Error ext2fs_ls() ** ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemusage: fatinfo ** Invalid boot device ** ** Unable to use %s %d:%d for fatinfo ** usage: fatls [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected usage: fatload [bytes] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read fatloadload binary file from a dos filesystem [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystemfatlsfatinfoprint information about filesystem - print information about filesystem from 'dev' on 'interface'The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "<0x%x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandsaddr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pinhelpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'?alias for 'help'Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error reading the chip. Valid chip addresses: %02X%04x: %02x%08lx: Error reading the chip, %02lx %04lx %08lx ? Error writing the chip. Current bus is %d Setting bus to %d Failure changing bus number (%d) CRC32 for %08lx ... %08lx ==> i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32devloopmmmwnmprobereadUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'loadbload binary file over serial line (kermit mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (ymodem mode)CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same %04xmemory display[.b, .w, .l] address [# of objects]memory modify (auto-incrementing address)[.b, .w, .l] addressmemory modify (constant address)memory write (fill)[.b, .w, .l] address value [count]memory copy[.b, .w, .l] source target countcmpmemory compare[.b, .w, .l] addr1 addr2 countchecksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]baseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'infinite loop on address range[.b, .w, .l] address number_of_objectsmtestsimple RAM read/write test[start [end [pattern [iterations]]]]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)ERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! list#part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device writeerase MMC %s: dev # %d, block # %d, count %d ... %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcinfodisplay MMC info - device number of the device to dislay info of mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesping failed; host %s is not alive host %s is alive gatewayipnetmaskhostnamerootpathserveripdnsipdomainbootpboot image via network using BOOTP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocoldhcpboot image via network using DHCP/TFTP protocolpingsend ICMP ECHO_REQUEST to network hostpingAddressNot implemented yet ## Warning: defaulting to text format ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed -f## Resetting to default environment %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name"%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps andpress ENTER ... ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: environment handling commandsdefault -f - reset default environment env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env set [-f] name [arg ...] editenvedit environment variablename - edit environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'defaultdeleteeditexportimportprintLabel: %s kernel: %s append: %s initrd: %s missing environment variable: %s Expected string literal: %.*s Expected string: %.*s Expected unsigned integer: %s tftpbootfile_path too small. (%d < %d) Base path too long (%s%s) Retrieving file: %s %ppxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sMaximum nesting (%d) exceeded Expected include path: %.*s Couldn't retrieve %s Ignoring malformed menu command: %.*s Expected label name: %.*s Ignoring unknown command: %.*s localcmdrunning: %s No kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel fdt_addrpxefile_addr_rInvalid pxefile address: %s Error parsing config file Missing default: %s pxeuuidusbethaddroutbuf is too small (%d < %d) 01-%08XConfig file found Config file not found pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r getmenutitlepromptlabelkernellocalbootappendinitrdincludeBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present-o-a-z-nminimal test like /bin/sh[args..]falsedo nothing, unsuccessfullytruedo nothing, successfullybootdevice ** No boot device ** ** Device %d not available storage device not initialized. Use usb scan Rawerror reading partinfo...try to boot raw PPCBoot ** Invalid partition type "%.32s" (expect "U-Boot") Loading from USB device %d, partition %d: Name: %.32s Type: %.32s ** Bad Header Checksum ** ** Unknown image type ** Read error on %d:%d See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyString: "%s"%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Self Powered Bus Powered Remote Wakeup Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - InOut - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dms480 Mb/s1.5 Mb/s12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. tree Device Tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device usbUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'usbbootboot from USB deviceloadAddr dev:part %s gcc-4.5 (Ubuntu/Linaro 4.5.3-12ubuntu1) 4.5.3 GNU ld (GNU Binutils for Ubuntu) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded %8lxfileaddrimxtractextract a part of a multi-imageaddr part [dest] - extract from legacy image at and copy to %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Panda # In: No input devices available! Out: No output devices available! Err: No error devices available! serial*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaystatusdisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. syntax error ** Abort ERROR : memory not allocated *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variableIFS \$'";&|#Unknown command '%s' - try 'help' or use 'run' command Unknown command '%s' - try 'help' 'bootd' recursion detected ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreeKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32Invalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-boot%.*sHit any key to stop autoboot: %2d %2d prebootbootdelay%*s ** Too many args (max. %d) ** ## Command too long! Enter choice: %s not found ^C ERROR: NOT USB_CONFIG_DESC %x unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dERROR, too many USB Devices, max=%d ERROR: USB_MAX_HUB (%d) reached Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) failed to set default configuration len %d, status %lX usb_new_device:cannot locate device's port. cannot reset port %i!? No USB Device found %d USB Device(s) found USB: scanning bus for devices... Error, couldn't init Lowlevel part Device NOT ready Request Sense returned %02X %02X %02X No storage devices, perhaps not 'usb start'ed..? Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry READ_CAP ERROR scanning bus for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIDOC device %d -- Partition Type: %s DOS## Unknown partition table ** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type timed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range error waiting for i2c address ACK (status=0x%x) i2c bus not ready for transmit (status=0x%x) i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%cCard did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCBattery Current: %d mA Failed to convert battery voltage Failed to read battery voltage Battery Voltage: %d mV Failed to enable GPADC Main battery voltage too low! 000000000000genericserial#Warning: serial number %s is too long (%d > %lu) usbttycdc_acmDas U-BootU-Boot 2011.12TTY via USBBulk Data InterfaceControl Interface scanning bus for ethernet devices... usbethmax USB Ethernet Device reached: %d stopping %d Ethernet Device(s) found Error: SMSC95xx: No MAC address set - set usbethaddr Waiting for Ethernet connection... done. unable to connect. %s%dsmsERROR: %s(), %d: RECV_ERROR actual: %d buffer: %d urb_bad: %d ERROR: %s(), %d: no rcv_urb! ERROR: %s(), %d: no endpoint! ERROR: %s(), %d: F A T A L: malloc(%zu) FAILED!!!! udu %x ERROR: %s(), %d: (%p,%d) NULL device or device->bus DEVICE_UNKNOWNDEVICE_INITDEVICE_CREATEDEVICE_HUB_CONFIGUREDDEVICE_RESETDEVICE_ADDRESS_ASSIGNEDDEVICE_CONFIGUREDDEVICE_SET_INTERFACEDEVICE_SET_FEATUREDEVICE_CLEAR_FEATUREDEVICE_DE_CONFIGUREDDEVICE_BUS_INACTIVEDEVICE_BUS_ACTIVITYDEVICE_POWER_INTERRUPTIONDEVICE_HUB_RESETDEVICE_DESTROYDEVICE_FUNCTION_PRIVATESTATE_INITSTATE_CREATEDSTATE_ATTACHEDSTATE_POWEREDSTATE_DEFAULTSTATE_ADDRESSEDSTATE_CONFIGUREDSTATE_UNKNOWNGET STATUSCLEAR FEATURERESERVEDSET FEATURESET ADDRESSGET DESCRIPTORSET DESCRIPTORGET CONFIGURATIONSET CONFIGURATIONGET INTERFACESET INTERFACESYNC FRAMEDEVICECONFIGSTRINGENDPOINTDEVICE QUALIFIEROTHER SPEEDINTERFACE POWERUSBD_OPENINGUSBD_OKUSBD_SUSPENDEDUSBD_CLOSINGInvalid string index %d USB_DESCRIPTOR_TYPE_INTERFACE - error not implemented USB_DESCRIPTOR_TYPE_ENDPOINT - error not implemented USB_DESCRIPTOR_TYPE_HID - error not implemented USB_DESCRIPTOR_TYPE_REPORT - error not implemented get config %d DEVICE_SET_INTERFACE.. event? EHCI fail timeout STD_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STD_ASS reset The request port(%d) is not configured port(%d) reset error EHCI fail to reset Register %x NbrPorts %d USB EHCI %x.%02x OMAP4 EHCI error: timeout resetting TLL OMAP4 EHCI error: timeout resetting phy OMAP4 EHCI error: reset TLL timeout ERROR : Unsupport USB mode Check that mini-B USB cable is attached to the device ** ext2fs read block (indir 1) malloc failed. ** ** ext2fs read block (indir 1) failed. ** ** ext2fs read block (indir 2 1) malloc failed. ** ** ext2fs read block (indir 2 1) failed. ** ** ext2fs read block (indir 2 2) malloc failed. ** ** ext2fs read block (indir 2 2) failed. ** ** ext2fs doesn't support tripple indirect blocks. **

< ? > %10d %s ** Can not find directory. ** Failed to mount ext2 filesystem... ** %s read outside partition sector %d ** %s Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block ** %s read error - last part FAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld(null)%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d Invalid pxeuuid: %s U-boot.armv7.omap4_pandaDHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddrBUG: failure at %s:%d/%s()! eth.cBUG!eth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! Warning: failed to set MAC address ethrotateunknownautoloadnetretryoncebad length %d < %d len bad %d < %d checksum bad ICMP Host Redirect to %pI4 ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) octetblksize%c%d%cFile too largeFile has bad magic %s; starting again Retry count exceededT blksize TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4from; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *Could not request gpio %d %02X:%02X:%02X:%02X:%02X:%02XBoard: OMAP4 Panda raise: Signal # %d caught  $Dd `耠逴@耜 p T 뀍"뀍)뀍/뀍1뀍9 뀍=@뀍뀍/ DZ耍뀍Y耍뀍X耍뀍 T耍뀍W耍뀍W耍뀍 W耍뀍S耍뀍S耍뀍R耍뀍R耍뀍@耍뀍}耍뀍Љ耍뀍t耍뀍}耍뀍 Ѐ耍뀍h %逍뀍Q 耍뀍耍뀍38耍뀍T]T]\]\]d]d]l]l]t]t]|]|]뀄]뀄]뀌]뀌]뀔]뀔]뀜]뀜]뀤]뀤]뀬]뀬]뀴]뀴]뀼]뀼]]]]]]]]]]]]]]]]]^^ ^ ^^^^^$^$^,^,^4^4^<^<^D^D^L^L^T^T^\^\^d^d^l^l^t^t^|^|^뀄^뀄^뀌^뀌^뀔^뀔^뀜^뀜^뀤^뀤^뀬^뀬^뀴^뀴^뀼^뀼^^^^^^^^^^^^^^^^^__ _ _____$_$_,_,_4_4_<_<_D_D_L_L_T_T_\_\_d_d_l_l_t_t_|_|_뀄_뀄_뀌_뀌_뀔_뀔_뀜_뀜_뀤_뀤_뀬_뀬_뀴_뀴_뀼_뀼_________________`` ` `````$`$`,`,`4`4`<`<`D`D`L`L`T`T`\`\`d`d`l`l`t`t`|`|`뀄`뀄`뀌`뀌`뀔`뀔`뀜`뀜`뀤`뀤`뀬`뀬`뀴`뀴`뀼`뀼`````````````````aa a aaaaa$a$a,a,a4a4aqꀗ='J/DXP` Qeꀅ QꀍH$RL[N]Tya;,fAq,fqr耽r tr/lpPd n耇뀓n耸j<,kA] mlk3Xs^| Dx耭 뀾 t  ^ }d 뀕 } 뀕 | 뀕 ( y- T   }u뀓Љx< ЀEax xh %l뀔xjXn뀖0. Xr{ t老 |耡  K"S"h"0RȰ"뀍 $$2$* ** $(,048TH   t x      $ D  P0$,DHP,0LTX\t(\4<X\      !\!####$%%%%%&''' ''''' 'D'h'''''(H(X)\)`)d)h)l)p)t)x)|))))))))* *`**+++,,,,,,,, -......D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2224444444445|77777777788 888888899994<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<======l>p>t>x>l?p?t?x?|??@@@@@@@AAABBB BCCCCCCCCCCCCCCLIPITIXI\I`IdIhIlIOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPP PPPPP P$P(P,P0P4P8Ph>l>p>LAPATAXA\A`ALBDDDDDEHELEPETE$HJJLLMMMMXN`NPQQpStS|UUWWWWWWWYYYY[[[[[[[[[D\^^^^^aa atcccccTdtdxdde eeeee e$e(eeeeeeeeefffffffffffffffffhglgpgtgxg|ggggggghhh hhhhhiiiiiiiixj|jjjjjjjllllllll4mmm@pADEpGMM8NNSTTlYpYZZ__ _____ _$_(_,_0_4_8_<_@_D_H_L_P_T_X_\_`_d_h_l_p_t_$o(o,o0o4o8o\}Pᆳᆳᆳ`dhlptxxV4JOLNPLN ) X LП//   @ ПP-P/@- @L0 , ,/@-=L8 <0, Rb0b00Ph00P  P@ P P  P   RS#RS5S/p@-@P PT `3``l048821 0 0 2 0000`03`0`0 3`03\1``i``i ``0<=<=ZE02 : 0202:: 02y02:02 dS02o<0002D3!)!@320202112a2 12\2 112V0 C0q!00  R  R0  R0  R0  R 0  R(0 AxR! B#00P2!)!-0S82P0USUPP$"0 S: 0!0 S: 0!0 S: 0S$s2* p1 /3' Q#%*13S0> #5!A430(0,0Q  B" , Q " , !@ !D !H ! )( ! | 0Sp0 " ! D0 06p@@ 0  Sp@pt#@DP@-GP /@-6}7z@- I @(M@-x@x0T0t00kh0 T0X@0f 0a0 \ 0WPlP @-0 Gl@-@0@!PU:6``F1# +PpPpppT0lPPrT08T0 010xTp@ M˿̿( 2$!@-5;@2$!5;13/@-:Р  ` PPP(M N@-@->@P9@Px4@l/TE @xR @j @ y @ @ @@idEjEmE<P@- 1$03/P R/0  -@-bM @T e/! @bߍ@Ѝ/0/ @-tE8@-P0@P0   @@@@0 PP 870J4 0000 008V' PE@-NP:PPZ0 03/ P$PtE0 @-      U   @dNE@-@P000@-@1US1S 68 P R$ p3HHH- 0` ?0?0H0M?@?@0A8 81PP[,30>B0Q .<1 00q84t 0PP ZDhXdZ,R0\ :R 0 00L ,L 0 Rp & 0`PB pW < P00S 0`|PP,PL00L0Pݍ @-13/D-PHp(@W 0`h0`vP``0`kPh0`dP 00D0S0  S0   8< @-Q 11 RH %H53/P0 N-M @$0 09I0 4릟?`P~I.p  AP +ˍ0I9 88404`Pg00:8+ 0I904 8 84`mVO$4l0P` d0hR P $x$$$$0 SX ğ!0  P U  @ PRP ?0!`p0 ;!/# 0`   U%1#)<00P  S<0+ ˍ0I904 884?`P000000[P?P2#S/0p3SP 0 84 0 < *&!:S R0Sh00S%20 9000S 0000 ] P`0 L0Pp0L0'   +70I9 8 PT84PˍI09  0T4P0D013/L0 2 2>Wt԰ w0P(W1 D 3/$D3/ P 0R 0R 0R  0R  *PL0pLp pGJwL0 110P0č PPTKv4xp 00"$ 4ht0p SSs#<h\x0\#.S HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOL11555115511511 #(-27<FP'@Bx@l  DRAM: ? %dMB ### ERROR ### Please RESET the board ### U-Boot U-Boot SPL 2012.10-04280-g1a8ac55 (May 23 2013 - 14:01:59) (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** -bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") mmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %5d %10d %10d %2x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPartition Start Sector Num Sectors Type spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dMMC: no card present Card did not respond to voltage select! %s: %d%c SUNXI SD/MMCWrong mmc number %d 0123456789ABCDEF(((((AAAAAABBBBBB(null)%s:%u: %s: Assertion `%s' failed.P`P-Tp89U<VH>WAX DYGZbJ[d?M\P]O@T:pE  TT@D!@0e@  4,0e`6O@T:0?]JJJ@-@+@-@%8@- P@8@8@- P@8@@-0?????0????////////@-P/@- @L@-@@T \ ПP-0 , ,/@-H0 =v0 P 5 %05+20 %/2 a0 b 0 @-@d@-=#v8 <0, Rb0b00P@-/h00P  P@ P P  P   RS#RS5S/p@-@P uPT `3``l048821 0p 0 2 0000`03`0e`0 3`03\1``i``[i ``W0<=<=ZE02 : 02L02:: 02E02:02 dS02o<0002D3!)!@320202112-2 12(2 112"0 C0q!00  R  R0  R0  R0  R 0  R(0 AxR! B#00P2!)!0S82P0USUPP$"0 S: 0!0 S: 0!0 S: 0S$s2* p1 /3' Q#%*13S0> #5!A430(0,0Q  B" , Q " , !@ !D !H ! )( ! | 0Sp0 " ! D0 06p@@ 0  Sp@pt#XJP@-627/@-@@-P@ 0N 0I0 D 0?XlP @-0 2l2$!@-5;@2$!5;13/0$   Q330/2$ 5;03///@-@@8@-@P8@@- t@0 0 0 0  00 ((  8 8/ @-uJR8@- xwtup@pP hoT8 Vi?P?< 000L ": "ʠ  0 S:o0?O@OOP_8@-@_T8 @@O8/  P/P/0  /@ @-@ @-@+*8@-X:0 u J@-@tld`LX4PHH@@D8 J J J J J J J J J J J J@-03/Rp@-@@P f`0D @@p( JP J0/@-@pJ) J PP@-`@&4/ JPPN-`pP@@"0S@ 0 $ 0S@V!bY   0[p 0 0bzb[0D@P`P4=g& 05/ЍJL$JX JF-p0,`(@4P0Q$V V*T T```  8$0000 \`P000 80S #&xdD&v3 T#P 0S J J J J J1JN-XC`K/b@#f`#P# i`;aY3@ e@Բ%s$pTpPp@Ph$P]2pP #%#Pp%#W L}#P8 ,s%Q v%P/q%0S SS S P T0 # @0P0TUXq@ ab0@D0u%PTDkn%AT0S< #P(p]p0\0^@00L0D0SX%W` P0X00`0WW W Z 0 00h C00#P\0 HP hJTJ[J[JV'JJJJ JJJJ@J`JJHiJJ/D-@0MP pPu ZE PoA0 Se0^ 0Z1a: Z Z[@ZD ZL ZT6X0H0\00]00,0 000{PPEX,  a_?dt0h 0p0 a#PP5p 6ef t /e_ &  06/PP   06/PP   06/PP `p b  06/PP0Ѝ8XJhJJ\JJJJJ4JRJN-R@MPp0`80< 8d<00:SS #S   0T~ bPw)AX00\00]0080 000HPp pD0S "0Sxp p?$  0p[ 8$8 X @ a^]0S[ P _pP 0T d )`H0F3/! $^ 0AT [ `@^!^ l#  04/#  0@@ЍhJqJJJJJJ\J Js@-PT` 0P @_@P 000`@ 0B|J:J[J>JN-p@`\VP t|`0P 0u0XP`0P0j0pe`VW TJR@-0 Lc0c@-P@-P@-P@-PN-hM` @+c`Fp PV)J)J)J)J `Pr  cpP`  P c` PU@ Id 0*PBd00  0:00 0d1= <P 0<PV V1 8 P` | 0;;X0TpL Xnc@X hЍJSJJJ'JTJwJ[JjJyJJR@-`dM@##P\ P 0d*pP\V  P`P`<<P 0<i8PP $::dЍ|J'J~JF-RdM@0\0/\ 0PP2*pP&\C`P  0|n Xb Sb  MGp 0 (pWTdЍJJJN-RhM@`0Pd0ABd 0P)pP;dCP  0./   bV P  bV P  b0 FpPX 0P p  8 0Xb(XP hЍJKJvJJJJR@-PdMl@\ @ 0)`P \p-CP  0SFdЍJJD-R`MP`@\PP\ P 0x)pP\ CP  08V (FPP `ЍJ<J|JeJ@-$$  `0A 0m۶0 .R00@/R 0S//R@-P`@p , P  D0!J0 R  /(jJ8@-P @@D T8(jJ`0@S/0?S@/00 RS#0?/@-@ P8@- H@P00#0P0Y00)0P0 8@(jJ8@- H@P00#0P0N00)0P0 8@(jJ@- 0, 003/(jJ0, 4 8  < /(jJ04 , 8 <  /(jJ8@-@@, R @P5/0D R0,08@03/8(jJ@- 1`AH)  # D _ Q^ H HPL PbU@@PU~00@; PU!00@6 N0PU 0Cs0 0 00@- OPE\U@00@$ P0PU 0C)0-00@ Q0PUD0#00 @ PUN00 @ PU1  @ U0 @ "   ~ ! @XPp0 `p0 0``0Y00@`))0 0`@+(jJN-(MPpPB  ]@U` ]U@ ]PP U  P R[P2P N[ PXYP D Z ,p $$3@003 pp@0 0)0#0D0PPH{ P Pmu p@W q pS pKwp Wf pG @D t@@Dt0[ p0< 0V p@7 R 0p2 [# ?  P* 0C @D_ s0t@C$= p DY@DSYH 0S0!H0T( p [3 ? P p P 0 pSYvBY< 0p@Ppd P ZZ9   ]pt  @U  P Z`22P Z P (ЍP.$0@PpBSJW!J!J!J!J(jJ8J:JtjJjJ!JyJJ[J "J2"JP"JRD-p@ \t0 PP\8` IR F 4 0 W  \jJ#JR@-(@ \ jJ#JRN-P`V \UQ  \UL  {\U@  s\P P%[ ZJ v * o  0  S:pZ ` R 0|[ } P A  p`0V:T@dPe@20@#JL$J$$JM$JX$JRp@-`pW PP/ \ @\P U0U00U 00CS U 00CS 0 S pRF-P @P( [` p[ ` [P p j 0gL T T PpjJ$JRD-PM`@ `P`:V@ 0V@@ p[ [p p [P gjV0 V00Q 00P ` ` pPU`( Ѝ$J$J$JjJ$J$JD-`0B@S pP W[l0 PPP[T   H[W W㰠P@PjJN-pᴠR0`@P$^ @P  "[`[`   [Pcf 0d&Q0 @P`jJZJRF-@> q P` - `P3  ZPPp V V P P 0-ST P0f0PT Z0S V VTP 0 P`jJJ;JyEJ$JJqJRN-p@ڴS0Sc,P0Ü0'VPP xC '0P 4P+PP TVPP8C'P4+,0P 0S ! VPP ,{VPPHW2@ W `Z@pW WZ ` RZPpd[@&PP<T +w 0S,O L0W (Pp""A 1@0S9  4 Pb-VP` 'VP` !VP`OD1&VPp  PZ PY YWP P/ 0 F+V V  0J8J ":JJ@-//F-P(p,P`@'=PD eD0SFS H@P Pl 7H 4=T DP0 $ "0S0 S0S  @00^"0S   0y000Y0   @`yP:J:JJJJJ J;J+;JG;JF-P@` }Pp0  @p0pT+ W@0 0 ;S * ;;0S`t H t 8t$c@@;J;J;J J@-`P@Wp2 0;`P 8-4P<`{<JL$JD-p0Q@P S`A-00C00 Sʀ0@ S0000T T0: 00C000C0LJPJQ@-@P` \#p BW@Qpp paW G=0\P  000pW0P  000*?J/0N-00Mp  4)0S(00 0 0PS 8 [ @(@,@;PPl P`P夨團 ( ,0p@`T`\00S P@,@1#PQP*bP PUp P P@@  _,@000!SSm ZV0 V [P` <0( ,0p`KA0@SHJJJJHJHJHJpJ0@0̠C( ,0`F 0 v( P Pb PD P9 aP(P* ( 5,5:Py P Pb P, P PP`z POP_ P\(00C(0(`Vh(0, S*(00(`V\ (00C(,`P*`F`V  ;(  `V0FB(0,S8*XcT%,0( 0C,0S(00C(0(0S,Q $,0( 0C,0S(Q ,`A(`a ;(  `V0F,00Cq0S% C4r    R0 4!K0S S 00S000S ß1KT CNNK(00C(0(0S,Q tt#S=,0( 0C,0S:v:( ,R.*b =,0(0'(0`, S*` _:,00 0 0(0 0" 0-P` $ (0( 0c, 00,0<0( ,0p`yLR\2 1 90 0S0S00 00 02 1 zxP 0` !:` @$`pP U U U3 U ;U  U6U U1%0t0gO00KT$00C$0$0S @ 0S $ 0`q@ 0S0 S 0S $ 0``@ 0S U  $0P @@$$000$0$00$0qP 00 0j0Ѝ4pJ_JXJ*?J/?JL$J,JPJ3?JLJJ 0 +C,JJ@-@ 0 S S S @ 0S1 S S00T0 L6?Jqp@-`@q9PPP  0:00p@pp@-P@  ^=@Pt`' TPP P@P:PdU@DPP0%T00S U BU?J J_?J?JRp@-@P0`P<p\PPUpppp,J@-M0!A!MQPPQ RP p `P`V P  PPQ B:`5qLa`W p PQ RA:R:Ѝ00@s R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSS 0S`V ` P~00F Sx4JDJTJdJJtJJJJJ @`  @`  @`  @`  `  @`  @`  ` @ s p RpH s03#" RA<P:pyP20py40P(04000P 4p0yPytPpp Py0UgP py P```/J@-pP@`4P 4@E7P PU@@謅J8@-PP@ <@P < 8 78@-P (048 840408 謅Jt0-4 DM4 8 \< h8H b71040$000(0,000(0,0DЍ謅J?J$ J4 J< JD J8@-P8@8YP@TTP8H8衆@-@0PJ@-LB04S E004,bPp0BP! 0PS SS S404i 40 4ep$4W0$4ZUW|8R0pPL pP0wS;0404 0P<  0P 4aU0P. (4S 0~P% @ $40"S (4S  0 $ 44P  0s0RD s0 $R@(0OPJJJJJF-@ T P `3P 0TA@@T pxP`@0pDADw ZP apDWZapDWWDP 7DP%SPT@TRPF-0,APP#00(40CT,T40TTT T$T8T4TQ4S 4+1PP0$R  R00 0$|0 $u h`FV(7(PC'404up `pWPJ4J(J N-Q>QC 0 g00 0C\9@ g0Z!R0C   0 (R 000#   $!g Pⴰ ` P &001 000UP D \ pP pW: p ЍDJEJN-0M@P`P@R vP JP A [ @1pW6T 000@0 S(@0000 P,00$0PP P0 00T00S  0 P000P T@ P T0[) @@0ЍEJ@EJREJp@-S0MP000@@0 S(P0000 ,00$0`PU 0 `000P 0ЍpREJF-@Rp PP@ QdvP a  Y `10P0Yp*@EJ@-@ M/   x@P}/ ЍN- M(@o7p 㴠p bPP9)0000P0  P,0P00 P SQ PNPP%/0S`V*Vt00 R0C00P0  :0 0001PP0T0S?@008P Ѝ D- M@  p ppPP<gl/Pp p00, 2 0   01 0PP#T/0SV`V*P0    :0 P000PP 8000T0S?@008P Ѝ-4M,0 , 0000 00(0$04Ѝ@-( M$4 @ 0P ЍP 0p@-+@L0 M0|0Q?P?PP 0`P P0S L000L0 ݍp?@-@0P 0 00@@-@iP1S3/-4M!"80 0@0,00(0$0L4ЍP N-+MPSp`@?p?`LPh70E>A8 813PP[,30>B0Q .<1 00q84 0PP ZDXZ,R0\ :R 0 00L ,L 0 Rp & 0`P pW  P00S 0`|PPPL00L0Pݍ @-13/8< @-Q 11 RH %H53/@-D13/P0 N-M @$0 09I0 4릟?`P~I.p  p-P +ˍ0I9 88404`Pg00:8+ 0I904 8 84}`VO$4l0P` d0hR P JJJJJ0 SX! @ 0  P U  @ PRP ?0!`p0 ;!/# 0`  ; U%1#)<00P  S<0+ ˍ0I904 884`P000000[P?P2#S/20p3SP 0 84 0 < *&!:S R0Sh00S%20 9000S 0000 &P`0 L0Pp0L0'   +70I9 8 PT84PˍI09  0T4P0D013/L022>Wt԰ w0P(W1 D 3/$D3/ P 0R 0R 0R  0R  t,PL0pLp pGJwL0 110P0č PP9TK]%4xp 00"$ 4/t0p SSs#<d/x0X#.S@02Dh2,`c+p '6%P  `LpPU7 @0cS w dǟp @n ZP0 U#` iU: RcPE `uPV:&%PT2 S?2PoM6& 6%HPv @00S<PE puPUPpF PE/Up @F/P 0V`@ 2* 0!C1S! S01U@ ,UE6&@d@ @l\0S0 P P  D% @6 bR  `T2 SQ6YN:$%]?Pp4 `@APT2 S( ?P% 1X% $pP P <pP  w W%P$%pP #6@ 00  Q,  PRQ #  PP Q PQ  P  r 3! AA R  B AAR B AAR pR `wp p  `T@0\R0@!6 jR%pG@ 7 @D@1wp 0@1W1 @!1 c6R%@%P@pT!8% ipP .p1 @T2 SA$8`1 0 0J@1% @0@@P0p%FpP   6%,pP p@P Wp*ލ% 0@PZV ``@ Pp@ @  @0` JJJJIJIJJJJJJJIJ.JJGJJ`JJ0H-?0Pd@f  US   PL9 S?2P 50 5C*`  0@ SP89 S2 0P2*`V :  0P@%   0P   @P 9 S2 0P* Pf` T@@| @zߍۍJJJL$JJJJKJKJJIJJ8KJ@-0 0+@-pM A0S- y000CSHJHJHJHJHJIJIJHJ |@Z0VDl @P tL K `>X0XV k@`0[@>pЍJOKJbKJAJAJAJAJAJAJEJoKJwKJKJ@JKJ0 @-@`Pp 00 0KJ0 p@-@P`  p@KJ 0P/8J8@-0/S\S10/S\S !h0 R Q0A/R\R    P.Q Q\Q/Q /\\\ @.T S\\/\Q 0A/\\\  B PR0T R/    / P 0A eQ00Q\ 0\/S\SL /Q\Q/\\\ 8`J`J`J8@-0$@2PPGR8`J|Jl 0@-MBtTj/Q\Q 0 0 2## 2/ۍ`JKJLJ,Jp@-@t M0Pbv\G/Q\Q 8 $0( 2## U4P_5_Z$pIy 0W LQP (ЍN- M`!2@pS0DH@#q ?0b QP:00 JS 4/PP#QP:$QP*0 ,H0W2P@ Q=  8 g"000!3PP+04P40P /_0 00P"! H"0H0 ,e0W2 0S IP ЍMJMJpL-M@B P` 0 0 0`@k022S0cP0  C0r027S 3/ߍp@-@P  0S@Ph`P 0 S*`#H 2S U,ЍpMJ8@-0@@ UT8&,%88諲*MJMJMJN-PM2@$ S $$4D@00D0t@00D0}PDp@0WQP$C@PD@0W3`` 0 $01/P@ TQP@@ 2 S0#q ?@0b QP: PP ء `47SPD@DCU 0dQ(`8P@,`81H L$H@P~LPUQP SR00S U8P("[[`^ P^( #0@0SQpL0S 4pL0P4 <@@, U( 0`gV`% pPPQ[%$TuPWC `4!L0S0#$4s0S (02" 004 ; $00 1/P {, [ 0 !QPe:PP@DPPЍ<@ `400SNJ'NJ>NJN-HMP`0020@S4 %4 T800<000uP$@STpP[<@80TQP%S8PE$ c}PT4P8Yp$p1QP12S8@!4q ?0b QP:fpP|;Х   Pb@B@P 00D r0(TP 0B "0# A 0 @[ Z$! "T , #!С " 0#\!! pء 0  " @ b 0I#7Q! ,p0@@D@pPDP@@UPAQP SR00S RZ PP0PSPU pE i2PI[ c0503#TTuP`I `Ơ(pp @0f050S00U @㔕%0P0SZء 0 S RG@`[&4d0v`#{00V5 P$啖& PdUP` `P'0@aS&4dv` T P0@(pS0S 0 `㖓,@ 0$04 4@ PP U4p$?@\8Z@p7HЍPNJHJBוWlNJ'NJdNJwNJNJNJNJ>NJN-HM@`@, lp7PPh00$PP //d)h P f   0 0/S S000 @eP Q D @D`U[\  0$@0 0PP480 (PP, 0#PP 5 #0 /S S@S* 0[  /[2S03 0& PP 8 0PP 0#PP0S03 003$#PP R+ 2S03 03&P0 0P00#P Ppn, R#, .hY!@P 0 0ppPP @ 0PP$SRPDX#|8 H0 pPP# pPPP h$wP$(P%^ 0/S SH  `P /VV[.S [.S0.S 0S P@PC 0S $P$,8 0"P2!rP+ # @ 0!#pP` @ /(P ``P$P PHЍ @ P2S |JNJOJJ8JOJ#OJ(OJ:OJMp@-"M#nP8D  Q0002 S04S32c 0$#P#K0#0 0`@`P/0PtA@#!P PE 002S0cP"ލp@Ѝ/KOJ^OJ#OJqOJOJ@-BMM`p_8DpP@_P2 S!, B AwW A7/$Ѝۍ@-BMMPpo8Dp`@;P"2Sp!, B Ah @0p`0   wW A7/p$Ѝۍ@-@ 0 0000P 0S$ǿ0ЍOJ@- 000@@PP `VPP᭿0`FP`1LPP   @ЍpOJ0@-M 0 0000@PP  PP  |  x Ѝ0@- 0000 0PЍN-MP0 000 0@PP0 0U%* `p p @ WP@` VaV*0WH?P  UPP  -  ) ЍOJOJ@-@0G4EC@@N-MPr@@`P r. P44`P ` 0@P%X%000[ 9$0 0Ġ 80<qأ 0 Pz PP<V(SR N PտA"ο: Pſ1)@PUT*)@ᘾ>@P尿xt PᨿUPL P40( Pqꎿ"  b(402P0U!GS R8S2T07@TDI p\@`e@ 4 @!SRS:0#QP  SRPPP|"0QPu0 QPPu2 P\ U `!`S Rd 00p0P@P 0(`EPU0S_޽@@P@pT Z:Ww P3PP 0X0 ZP4ܾ X @`SR( 0@@ PP 婽z ľ`0 S *垽o幾 ᷾`, T\ P  夾 ᢾЍWOJOJPJ1PJ5PJMPJWJbPJPJPJPJPJPJQJPJQJQJ0@#DD0"`w 0 0 PPg,4SW Q, B A A| 7/7 eS=0`Fcpl3Т,p 0!n 0 0`@=P  %0@H 0P  P(4S2cB 0&!n`@pPd P5SD P4˻ 4ЍۍRJqJLrJp]J:OJ0/8@-P@0 P@8N- M `p@PD@``aU`pU @ 0  0 ! 0! T: 0 Ua `p 0U   U   U!`pa ЍN-(M `pHPL@a``U  0@ 0 `p T:U `$p@ p U  h U  `!U! $X`pa(ЍN-JM0 @(`0@Š@ Ȍ @$ (0 (8 p$P@ R@XY%,% CaI$$@00@ ` 00p @` `$0 Pp@ 0 `P 0p( p@ Tp pp, bsu' |'p!pp'p p*c*c* p @ ` ` 0`00p p Pp$ P  JߍJ0?̠ !̌ Č!Č /N-M @`Ȱ?p@TP\@` 0SR: P 0S@ 0 C0 0@?P8U0anၡ PE/pu@@,@@ T:[@  @[@  P[@  @[ 0 @z 0P!ЍJD-0 @`@ T`@P *PP pPt{'{LW3Z%QPPUJ\:P\1P#P3:\*йuSJ0@- (@ D$@@$pRJ0p@-0R00S 0 R,| , @"!PA0`L p`a &p`a &p`a &p`a &\T!p$ 00S,| ,pJ@-@-0@0$SJ@-  lJ;JF-M@<` G 0 Z @ `FT NЍp 5 0 0 0@ A FS%$  P@p @@8+T (&  ЍF JSJSJSJSJN-PMppP@@S@PU<P7 UP! `T 0 ! T    `V`    .`V P T0 peD CҸP 00WPЍ;JSJJSJL-PР@`p Q U pZ 0 `p0 R000 W V0#02S[Z: Z 0 pf``0 ᤹)N-@0@MPp$00 `(0<0d`K P k0P0f0p WPp [`X x 0q cp  f PePi @ЍhJ`JSJSJSJ@-\    @ Č @T @T\: TJTJ 0 D-`P@pQ P `pWp@-`Q0  p0S@@PPS*QQ 0@0 ppPJD-@P `px0 0P0S Z \  0UJp@-@`TP1P!@Tp耖@-@@DTN-@͠ i`0!SR3:VRV&6  `b&  Šlf0``aPaP  Ul0  àa10 Q1c0000Ѝ0p0 0 Q P   OPUU%&00PS% 0 eVe` 0PPUef0``!a0!b00  @Ᶎp@-Q`@`P:0 0 0PER00SR 0PE0RpEUJN-`M@တp YP ' pq  R r0PE-PE+PE [ YPEPE00`0& Y Y`  @I 0s 0 |1   `c  0 @ ` `f0V00Pc    RZ/PE@PbZ[ Y0 @ X  @  0 RZ/PE@Pb 0 0CV 00SZV``0  0SZU`ЍJN-P@ `%S0@0p+S  S #S -S 0S @0C Z <,0Lp00C Y *Sp0\l 0.S00@0C Z0  #00Cp@0@ Z @*Sp0p@S  0hZlZ LZ ZZ zZ tZ@lZ@lY@LpnWO cW %Wp XWR\dWM iWMJsW oWA pWEuWK xW@;`L\00`L0\ ap Zp R p |00 ! @04!0?0 e :  %000S0@D+ LZ p@ lZp ZZzZp  tZ  hZz z  00 [ @0S0eЍLUJJp@-00S 0xS00D R R L`0 P0@D 00C 0Cs070CS:QPpJ@-00@pP`P  0S R 0d0V R@--\`@@-@0 KR GRMR kR iR BR0000F-0M0S 0xS00D R R @ `p㌠  @,7#``p0 D 00C 0Cs070C_0P @SR:YЍJ;-@-  5 @ Ѝ/-@-c : 0ɗ꠆@-SUJp@-0D@P0@@ j `0F  PPpXJGί0L CN- @MP :S 000C00 4`,@a 0,B(` B0CT` 0@ @( f`F4`X`$ ,fL`FP8< 0p($@K@ 8`<@ PRP@DB 4P`Aa@V1 `@  ` R520@ 2 f1R`P@UR 8 ` @ QA`P1 f @`R* R"520 2,d d`F`1`@jVj0@d T PhCWP$T PdP *d   T8@@W%*< dg[ P%*k@ @[W 0*gP@(PU@0PfTPdP*d   T 00@00000P0P_ `P0`X /f@@@0V@CKP堰` 00S ČK ደ 0 0 PSV0%T0``VP00) 0%@ D@D@PA`P: P@@@@@ f`F`@Qa@  P @@ @PS\1: PA d`A d@@@@ 0cl< @008< @ЍuUJUJUJN-M`4PP Q @4p@@TT 08xvS <  vS x vS x@@<@TU .wS.wSAvS vSz"vSz"xᧁAvSCtvSCtvSj"ySCvS=%vS=%vS(zFAvS+}7vS+}7vSvKy:{5NYAvSvKy:wSEwSE|týYCvSUpvSUpvS }ۀ&x Ї_ v =h,h5)j hՉ)UZXthdhS 3vgrSK_L;^X^*&Zgz.n)AA+7$XT~^$tETp~^cluΑ/bwykԳ=gjo}^S>?ZRjEJuԗ #[@\b|l-+SL`ĚP*9 8 I{ j0u`r#8 XOeAK+.Gz67P\WYG}?LfkLH9K9KW}ߛ:MQEC fOq7<geT|0A1EgčXP[Pew6EdǂZ=Cگ`xAG2v$^{i!2>$@k H'8u N;%-hvq6V;j"C",n-jޣMJJ\t+7WJ8{vBR:xyƚOZtesV'*;o&<ql~6[.3ǚ*|&LKha>߄I5UeNؔV~:pK?׻sQ4x^wuF+ . ..archn catdatenchmodchgrp cp dd df edexprnhostnamem ksh sh ln ls mtsha256sha512mkdireject mv pax tar rmsleepsttyn|syncn ... ... ... . .. tmp db runemptytzlist ... ...PTDQp@@P|U T@P@P@T P@   3겠Z\ Y 1 Q 1PአZJ TZ @p@3Z@TpP@G@ PT㻐Რ ഠP@ PU PఢUነⰢE@@TP PC,$ >P P@ p$p@ ` `$pP! @B gr << 8@Y  R(``@( d$pp,P(0ŀ `p0pǰ0 pdwp 2pp piLD@0pkW'Hppkp i`Z* H @00 0,00D@\@I`pL @0P㐐p@   tPpGwpt@W \\ (4p\8  P TPp@ `d0匰p aZ`⊠0Q: p 㯵v p l0pL0 0T0T00/>0l0P7.0h000d `000xTL J 0SW$ 0pG ePPW pG ePU:6cPc0hOPW pG ePU:Q6cPc1 0  &a6PE&PW pG ePU:6c  aW pG ePU:6c  cc0P Q85000 h Rh7hQ:0S lS>/l0L0 0pT0T0 0` P4`l08P00X0X0 0d Ph400 1WZ p 8` HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO>11555115511511] Je Jl Js Jz J J J J J J J J J J J J J J J J J J J J J J J# J* J2 J: JB J|JJ@Jdo_env_import%Kdo_env_exportU-Boot 2012.10-04280-g1a8ac55 (May 23 2013 - 14:01:59) Allwinner Technology bootcmd=if run loadbootenv; then echo Loaded environment from ${bootenv};env import -t ${scriptaddr} ${filesize};fi;if test -n ${uenvcmd}; then echo Running uenvcmd ...;run uenvcmd;fi;if run loadbootscr; then echo Jumping to ${bootscr};source ${scriptaddr};fi;run setargs boot_mmc;bootdelay=3baudrate=115200console=ttyS0,115200root=/dev/mmcblk0p2 rootwaitpanicarg=panic=10extraargs=loglevel=8scriptaddr=0x44000000setargs=setenv bootargs console=${console} root=${root} loglevel=${loglevel} ${panicarg} ${extraargs}kernel=uImagebootenv=uEnv.txtbootscr=boot.scrloadbootscr=fatload mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr boot/${bootscr}loadbootenv=fatload mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr boot/${bootenv}boot_mmc=fatload mmc 0 0x43000000 script.bin && fatload mmc 0 0x48000000 ${kernel} && watchdog 0 && bootm 0x48000000bootcmd=if run loadbootenv; then echo Loaded environment from ${bootenv};env import -t ${scriptaddr} ${filesize};fi;if test -n ${uenvcmd}; then echo Running uenvcmd ...;run uenvcmd;fi;if run loadbootscr; then echo Jumping to ${bootscr};source ${scriptaddr};fi;run setargs boot_mmc;bootdelay=3baudrate=115200console=ttyS0,115200root=/dev/mmcblk0p2 rootwaitpanicarg=panic=10extraargs=loglevel=8scriptaddr=0x44000000setargs=setenv bootargs console=${console} root=${root} loglevel=${loglevel} ${panicarg} ${extraargs}kernel=uImagebootenv=uEnv.txtbootscr=boot.scrloadbootscr=fatload mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr boot/${bootscr}loadbootenv=fatload mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr boot/${bootenv}boot_mmc=fatload mmc 0 0x43000000 script.bin && fatload mmc 0 0x48000000 ${kernel} && watchdog 0 && bootm 0x48000000set_default_envenv_importsaveenv;J;J;J;J<J<J <J<J<J!<J(<JL$JL$J/<J<<JB<JH<JL<JV<JP<JZ<J_<J d<Ji<Jn<Jy<J<J<J<J<J<J<J<J<J<J<J<J<J n3J<J <J<J <J<J<J=J =J=J=J=J#=J(=JL$JL$J 6=J?=JtJQ=Jb=Jk=Jt=J|=J=J=J=J=J =J=J =J=J>J>J">J 3>J=>JT>J]>JJv>JGJ>J>J>J >J>JL$JL$J>J>J>J>J>J>J?J?J?J?JL$JL$J  ?J?J@J@J(@J4@J>@J^@J)JJ #(-27<FP'@Bx@l  tHJIJ JJFATRJWJ|J J+SJ|J0SJ6SJOJ=SJOJDSJOJKSJOJRSJOJYSJOJ`SJOJgSJOJnSJOJ/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $-6?HAZSle~w =4/&QXCJu|gn2; ) zsha^WLE+"90cjqxGNU\dmv@IR[,%>7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy(((((AAAAAABBBBBBEPTGMK0123456789ABCDEF0123456789abcdef #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     WJ-WJL$J8WJCWJPWJ[WJoWJ|WJL$Jv7_dcache_inval_range1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./ 789-456+1230. ext4fs_devreadERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x CPU: SUNXI Family usage: watchdog seconds 0 to disable watchdog %p: %08x watchdogSet watchdog. 0 disablesI2C: %s baudrateMMC: loadaddr### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: bootargsmachidUsing machid 0x%lx from environment Starting kernel ... Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled %-12s= 0x%08lX arch_numberboot_paramsDRAM bank-> start-> sizebaudrate = %d bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsbootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIP %s ... Loading %s ... OK Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Trying to execute a command out of order %lxinitrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartno%lXfilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... bootdboot default, i.e., run 'bootcmd'bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSloadosramdiskcmdlinebdtprep\cechoecho args to console[args..] - echo args to console; \c suppresses newlineexitexit scriptext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4loadload binary file from a Ext4 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4ls [directory] - list files from 'dev' on 'interface' in a 'directory'bootfile** No boot file defined ** Loading file "%s" from %s device %d%c%c ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X/** Error extfs_ls() ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %ld bytes written usage: fatload [] [bytes [pos]] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** usage: fatls [] [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [] [bytes [pos]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file.?alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'Error reading the chip. Valid chip addresses: %02X%04x: %02xError writing the chip. CRC32 for %08lx ... %08lx ==> Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) %08lx: Error reading the chip, %02lx %04lx %08lx ? i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32loopmmmwnmproberead## Total Size = 0x%08x = %d Bytes ## Raw upload complete ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'loadbload binary file over serial line (kermit mode)dumpasciiprint raw ascii data[ off ] [size] - save S-Record file over serial line with offset 'off' and size 'size'CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %04xmtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countcpmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]OKERRORNo MMC device available rescanno mmc device at slot %x partget mmc type error! listdev#part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device erase MMC %s: dev # %d, block # %d, count %d ... %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesmmcinfodisplay MMC info- dislay info of the current MMC deviceNot implemented yet ## Warning: defaulting to text format ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment Saving Environment to %s... %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined stdinstdoutstderrCan't delete "%s" serial#ethaddrCan't overwrite "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps andpress ENTER ... ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'environment handling commandsdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] saveenvsave environment variables to persistent storagedefaultdeleteexportimportprintsaveBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present!-o-a-z-n!=<-eq-ne-lt-le-gt-getruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..] %s arm-linux-gnueabihf-gcc (Ubuntu/Linaro 4.6.3-1ubuntu5) 4.6.3 GNU ld (GNU Binutils for Ubuntu) 2.22 print monitor, compiler and linker version %s %s %llu bytes read %llXzfsloadload binary file from a ZFS filesystem [addr] [filename] [bytes] - load binary file '/DATASET/@/$dir/$file' from 'dev' on 'interface' to address 'addr' from ZFS filesystemzfsls [directory] - list files from 'dev' on 'interface' in a '/DATASET/@/$dir/'%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands sun4i#Unknown command '%s' - try 'help' 'bootd' recursion detected In: No input devices available! Out: No output devices available! Err: No error devices available! *** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedNo MMC card found MMC init failed env_mmc.cWriting to MMC(%d)... done syntax error ** Abort *?[\ERROR : memory not allocated %uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sIFS \$'";&|#HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodonebootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx -## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... Invalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressed%.*s%*s ** Too many args (max. %d) ** bootdelayHit any key to stop autoboot: %2d %2d serialCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %5d %10d %10d %2x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPartition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dMMC: no card present Card did not respond to voltage select! %s: %d%c SUNXI SD/MMCWrong mmc number %d ** Can not find directory. ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10d %s Failed to mount ext2 filesystem... %s read outside partition %d ** Invalid Block Device Descriptor (NULL) ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: overflow occurs error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: clearing FAT entries Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster ** Partition %d not valid on device %d ** UError: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! ** zfs_devread() read outside partition sector %d ** zfs_devread() read error ** ** zfs_devread() read error - block ** zfs_devread() read error - last part zfs unknown checksum function %d zfs incorrect nvlist header empty nvpair couldn't find a valid DVA compression algorithm %u not supported compression algorithm %s not supported incorrect dnode type: %02X != %02x incorrect dnode type too small osp bad ZAP magic bad ZAP flags bad ZAP salt external pointer tables not supported ZAP leaf is too small unknown ZAP type couldn't find '%s' invalid leaf type invalid leaf magic invalid chunk number invalid chunk entry invalid leaf chunk entry zfs fsname = '%s' snapname='%s' filename = '%s' root_datasettoo new ZPL version ROOTcan't resolve .. not a directory zfs failed here 1 zfs failed here 2 zfs failed here 3 zfs failed here 4 invalid uint64 invalid string trying to lookup past nvlist array incorrect nvlist array statezfs pool state not found zpool is marked as destroyed txgzfs pool txg not found zpool is not active zpool config version not found SPA version too new %llu > %llu vdev_treeZFS config vdev tree not found ashiftZPOOL config ashift not found ZPOOL config guid not found pool_guidZPOOL config pool guid not found ZFS Pool GUID: %llu (%016llx) Label: GUID: %llu (%016llx), txg: %llu, SPA v%llu, ashift: %llu zfs error checking label %d zfs error reading uberblock ring for label %d invalid uberblock magic uberblock rootbp points to invalid data zfs No good uberblocks found in label %d couldn't find a valid ZFS label couldn't zio_read object directory osp too small Missing @ or / separator not a file filesystem is corrupt :( @inheritlabelgang_headerzilogfletcher2fletcher4SHA256zilog2lzjbemptygzip-1gzip-2gzip-3gzip-4gzip-5gzip-6gzip-7gzip-8gzip-9lzjb decompression failed %llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld(null)%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionBoard: A10-MID-1GB raise: Signal # %d caught   JJTJJ JtJJtJJ\JhJ JL$JL$JJL$JL$JJL$JL$JJL$JL$JJ L$JL$JJ@L$JL$J JL$JL$J J4JL$JL$J J7JL$JL$J J1JL$JL$J!J7JL$JL$J!J3JL$JL$J!J7JL$JL$J !J1JL$JL$J!J0JL$JL$Jw J0JL$JL$J J5JL$JL$J@1JSJL$JL$J1JtQJL$JL$J1JZJL$JL$J1JQJL$JL$J1JhUJL$JL$J .JJL$JL$J1JTJL$JL$JVJYJL$JL$JP[J[J[J[J[J[J [J [J([J([J0[J0[J8[J8[J@[J@[JH[JH[JP[JP[JX[JX[J`[J`[Jh[Jh[Jp[Jp[Jx[Jx[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J\J\J\J\J\J\J\J\J \J \J(\J(\J0\J0\J8\J8\J@\J@\JH\JH\JP\JP\JX\JX\J`\J`\Jh\Jh\Jp\Jp\Jx\Jx\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J]J]J]J]J]J]J]J]J ]J ]J(]J(]J0]J0]J8]J8]J@]J@]JH]JH]JP]JP]JX]JX]J`]J`]Jh]Jh]Jp]Jp]Jx]Jx]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J^J^J^J^J^J^J^J^J ^J ^J(^J(^J0^J0^J8^J8^J@^J@^JH^JH^JP^JP^JX^JX^J`^J`^Jh^Jh^Jp^Jp^Jx^Jx^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J_J_JUJEJ9J9J89J9J 9J9J9J 9J ,J 9J 9J ,J,J,J!@#$%^&*()_+ QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>? 789-456+1230. 13457890=    ;'~ <>?789-456+1230. /RJWJOJ JxJRJxJRJSJăJ SJJSJxJSJ$SJh {f0ȠJJJL$J JJ JL$Jw JJ} JL$J JJ J JkJJqJL$J#<JJqJL$JJ %JJJJ((JJJ=J(JBJL$JNJ)JWJJJ,)J"JHJJT)JJJrJ@)J"JyJyJT,JJJ/J.J7JZJJJ"J"J#J>J#J"JE#J:JO#Jd#J%JCJ %J$%J JEJI%Jh%J%JCJ%J%J JCJ&J4&Ju&J\GJy&J&J&JFJ&J&J!JHJ&J&J!JhKJ'J/'J!JpKJD'J/'J JTIJn'J}'J)JxKJ)J)J*JOJ*J*J .JJ$.JL.JjJ-JYJ.J.JjJ%/JhUJ./JJ/JjJ1JQJ/J/J1JTJ1JL$J2J`_J2J2J3J_J3J63J_J<3J%J_JW3Jq3JWJ dJ3JL$J74JdJ?4Jf4J 5JfJ"J5J8JJ9J$9J J$J(J,J0J4J8JJDJHJLJ JJJJ(JJJJJJJJJJJJJJJJJJ,J4JJJJHJdJJJJJJJJJJJJJJ$JDJdJJJJJXJ\J`JdJhJlJpJtJxJ|JJJJJ4JxJJJJJJJJ J$J"J"J"J"J"J"J"J"J"J"J"J"J"J"J"J"J"J$J$J%J%J%J %J%J%J%J%J'J'J'J'J'J'J'J'J'J(J(J (J$(J(J)J)J)J)Jd+Jh+Jl+Jp+Jt+Jx+J|+J+J+J+J+JH,JL,JP,J@-JD-JH-J.J.J.J.J.J.J4/J8/J/J/J/J/J0J1J1J1Jp3Jt3Jx3J|3J3J3J3J3J|4J5J5J5J5J5J5J7J7J7J7J7J7J7J7J7J8J8J9J9J9J9J9J:J:J;J;J<<J\<J<J<J<J>JBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJCJCJCJCJCJ|EJEJEJEJEJTGJXGJHJHJHJHJHJHJPIJJJJJLKJPKJTKJXKJ\KJ`KJdKJHOJLOJPOJTOJXOJ\OJ`OJdOJhOJlOJpOJtOJxOJ|OJOJOJOJOJOJOJPJPJPJPJPJPJPJPJPJPJPJPJPJQJQJQJ QJQJpQJQJSJSJSJSJSJSJSJSJSJSJTJTJTJ`UJdUJUJUJUJWJWJWJWJWJWJWJWJWJWJWJWJWJWJYJYJYJYJYJYJZJP\JT\JX\J\\J`\Jd\Jl\Jp\J\J]JP^J@_JD_JL_JP_JT_JX_J\_J_JcJcJcJcJcJcJcJdJdJdJ dJdJdJdJdJHdJLdJPdJTdJdJdJdJdJdJdJdJfJfJfJfJfJfJfJfJfJfJpgJtgJhJhJhJjJjJjJjJnJnJoJoJoJ oJ\oJpJ pJpJpJpJ qJLqJtqJqJTsJlsJ|sJsJtJtJtJtJtJtJtJtJuJuJvJ(vJvJvJyJyJ~J~JJJHJLJPJTJJJ؅JJJJĆJȆJ̆JІJԆJ؆JJ JԇJ؇J܇JJJJJJJJJ<J@JlJJJJJĊJȊJЊJԊJJJJJJ JJJJJ J$J(J,J0J4J8J<J@JDJHJJJJJJ8JhJJ0J4J8J<J@J`JpJtJ$J(J,J0JJJJXJJ`JdJhJlJpJtJ\J`JdJ`JdJhJlJpJtJxJJJJJJJJJ<J@JDJJ\J`JJȮJ̮J JJ$J(J<J@JTJXJJJJJJJİJȰJ̰JаJ0J4JHJLJ`JdJxJ|JJJJJJJJijJȳJ̳JJJJJhJlJ<J@J,J(J,J0J4J8J<J@JDJJJJJJJJJJJJJJTJJJJJ,J JJJJJ J$J(J,J0J J`JJlJtJxJ|JJJJTJ\J`JdJhJJJJ(JlJpJtJxJJ(J,JJJJJJJJJJJJJJJJJJJhJlJpJtJxJ|JJJJJJJJJJJJJJJJ JJJJJJJJJJJJJJJJTJXJJJJ JJJJJ J$J(JJJJJJJJJJJJJJJJJJJJJJJJ JJJHJJ,JJ J JJJJJ J J$JJJJJJJJdJJ|JJJJJJJJJJJJJJJJ J$J(J,J<JJJJJJJJ J$J(J<J@JDJHJLJxJJ J J J J J\ J| J0J4JhJlJPJTJXJ\J`JdJhJlJpJtJxJ|JJJJ`JdJJJJJJJJJLJPJJl!Jp!Jt!Jx!J|!J!J!J!J$J%J&J&J&J|'J(+J,+J+J+J0,J1J2J2J;J;J;J;J;J;J;J;J;J;J;J;J;J;J=J =J=J=J=J=J HJ$HJ(HJ,HJ0HJ4HJ8HJ@HJDHJHHJLHJHJHJHJHJHJHJHJHJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJJJdJJ|JJhLJlLJpLJLJLJ$MJ(MJ,MJ0MJMJMJMJMJMJOJOJOJOJOJOJRJRJ0TJ4TJWJhYJlYJpYJh]Jl]J^J_J_J _JcJcJcJiJiJiJiJiJiJiJiJiJiJ4pJ8pJ?0S:0?/8@-P@?00 0#0?8@P/t Rl RP \ L0 R R   ,0 0 /O-p`@0@0@y0@y0@0 //D8@-,0@@@+ P8 <H@8H@-;H4 <0< S0b0000PH@-,0<H  b H@-@d0/y0@0/y0@@-g@6T0@-0 S S S 00  00y0@ПM `0@@-$0Р   `:I `0@2x0@/@-P :|B0@}0@{0@0@-@MPp =:PM PX 6:P&5 P @ 050 02P@0@Dt@0S 0S,T+& :P 9PpX|t 9P d0< Ѝ0B0@B0@|0@|0@|0@Tz0@z0@,z0@B0@{0@||0@B0@{0@{0@B0@B0@/s@-P P e@PPP 0 P `XT`0S P 0 PQ T|'C0@y0@rC0@U3C0@@- 449P( $9PC0@y0@y0@C0@@-1* H 14 RU%H 4 Ryl1l!l h!p H T +X1T  T H!X T004T0 ( P   [9PV *  O9P0/ 00 A9@P 0 0000P 0/| x0t0p  0d0PDD Dx0@C0@y0@B0@y0@ D0@}0@:0@:0@B0@8~0@|90@90@}0@:0@@90@90@90@L:0@D17@-0&468S0S #D+D0@3D0@B0@y0@T}0@4}0@cD0@B0@C0@F-`,M@@`FfR_ RVP=8P0 -R D"<1V  0Sp =7p3;p8W >`PA  '0L R QCS C00l0(P@`@0 50S400 ,ЍD0@~0@0@D0@ D0@0/~0@@-P000 00 Q 0S qЍE0@@-M@ ;Ѝ E0@PD-@P`0U@=S pt`Z 0Sl=PN-pP`㬐" T`$@ZPP @e`MP T`eV  000Ds<P @E0@0@-@(M   P (000 0F5P` P`(Ѝ蠂0@P@-01,03/\P@-01(03/\P@- 1 03/\P/0 |P/0 x R/0 s @-R0 00$03/@l\-@-"M@T /( ;@"ލ@Ѝ/@-0@"M T :@"ލH0@-@T 0S P P 0 8@-PT0 P@ b`7400T:(00T0@88LD E7LDp@-P0```N@N@JD T00Pdp0 cRH  a8p0`d``0 @d@p~0@0@p@-@Pp0DR `QP 0a   010Rp81p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p~0@0@HF-50S50SP @T@~T*@!51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0   # P PPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~cQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   01` 0dSf1 p1p0szpp~ppPN P*x1VIx1 U  T1 pp0p3DpPi  00cPp0g~p~ppp( 0e  0ppVPp Z0  0 J 0Z00 0  x0x 0S0h S0D00000dS( 0@@0LD~0@H0@@-p0`PwWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   4@~0@D-@QTD>T @Z 5pP PGBQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000yF-pR`PU PU 0S- @40P) @B40 s R @0 S T ,R:S,S: S8 0S 4P %4T" !* @@T0 S :SP0@0 R \,4PPd4P K43T0@F-`AM@ P4U P! P p3P `@P\ d@ʡ 3@P P UpDW00AߍE0@E0@80@80@ 0/$ 0R 00/T0@@- $0S 0/T0@@-P 1PyP YP tP T0Ps8@-$P@  $ $P@8@-@P 0!St@@\0@0/0DD:2P8088 0400  ?F0@mF0@0@T0@V0@F0@F0@ $P8Pp@- 0\ X\H@ `P` DRp\ PPpo0@p@-@%3Pp,`3PP fp pV0@F0@p@-@3P 4`2PP fpppV0@G0@7@-@P000000Ph P P2P P01P P>pG0@D0@wG0@;0@N-R0@2 Q`P@Z  0KS{3/@3/@3/@X4/@4/@@5/@0 l 00( 0d 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 5 0\- W  .RR&pW)p0  0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T 1P 8 0 (Ѝ'w0@V0@G0@G0@H0@G0@H0@/ $/T0@p@-PPD0@` 8@1P @T@pTQ0@0 000 /TP@-@P  2@@8@-@P ,0PS 00S P <W 40 0@@ 0S@88Q0@TP@-@P 0 9PQ0@8@-@@PP x1P8P08P 0P/Ps@-@P` P `00 QQ; Q9 <0 0 8< 4 00 8< 4 000 0CSF/@F/@F/@F/@F/@F/@F/@F/@ a 01,10 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKZ0@Z0@E[0@L[0@S[0@\[0@e[0@M0@H- 0` ?0?0@0M?@?@0& < 8 1R4!f4a<90@[0@[0@@-P@-,@02s0S 2-Ԃ0@8@-P O0"0- X0p  pPT @T*0qu80 "8Ԃ0@[0@p@-O``h-0p<0S0#h@PPZ.?P30l0ph 0P($0 0,P Z03?X0S Q2/\  $:Q$ $$0 0 L0<L04RF _P⌔?PZ0, 000d4,P0@08004000PN03? 03?$ZP00S3Z 

 @ P ᪠嫠#'4"0s 07)t0p SSs{#< )x0S*S8)ipZލL;0@;0@) ;0@@x}4;0@@;0@uy_0@_0@t0@00`0  00D01@01<01$1S?$1(0 0 /0@[/@XZ/@X/@D- M@XP4* 40S 13/ PPDPRN P,002 0S00 000P0S`200Xb_ 70 000uP1)0000P0  ,000 S aP%0SUbPU*_10 R@PD@ 00 ]- p- 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:` Ѝs@-kPP@3P 0`P%  I@Pwtc@XfL Y@ UQ0S|d0@d0@d0@n0@d0@ e0@'w0@D-P`pi@P  (000p00 0~/@$/@(/@@- 0h0 @\ 0 S< 0:0080$0P<0@P0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p i@T:00Sp0XQd@j P` X@T*@Tm0PpF4 pe0@@-`0P d@p 8@T:00SX1Qd@j`T0 P` %@T :00S 4 pe0@N-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P0@ @P0 ##U 00 00 e0@e0@e0@e0@4 7@-<@ h& 5\P 0P>0D-p0P<@ 00 Sd`P `V :p 0 P$m  04 e0@D-M`p@P p0 (0`0# 030 RFP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ00@F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\SH0p".d &.0h  l0H0, =x H0p.d .0h  l0H0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(&PUЍ2Tv"3e0@D-p`@PP{ @P P!P^|1 T040Dp@0 00L000H000P00* 0  Z0000<@ 00,00$00(0y"pM0p`0,0000H`  0@00< ; ;S s04 000M?M @ @ @ @  40,f0@@-@p `PP  .f0@@-00S 3/@-00S 3/@-@-@04 ,?<100sl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`J0`FV 0##0l !"(     "8 \ 0 1#(00 0P1!4P1#000v-ah0@N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0# py)(  S py)4y)0 p圗)8 0S f-h0@N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Z-ah0@h0@p@-@`P9Q" 0!",` !!4!#000f:p5 0 1!41#000p``@@ Pp@fV 0p@T  0p@p1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00h0@1D-@`` !v`R  - - !-  r  w?  1PpzP  Zw A PpUw?`Ppv`P  Vw k PpUN-`PMp z P@Pt >11n?1 1=11= >C= 0]1101 0S{0 X'5|0B0@ Sq 0=0= 0=0!00S7 3/PP41S( 0 0S 3/0q<`00P`4uP <= 0==03= <|=0= <`=0= <D<0<< 0V0=0 T=0=Tg?#| \0  \%0 00w/@00 0010ĭ= X =PU`"t3 Rꄯ/@ ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH V<0{,`(P$p.<0@0 0S Z00|0 tHV   @01P00MZ111400=-^P P0 S0@S0@'w0@Vj0@H=0@=0@@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp` $0p$p`y@-@@P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/p,=0@h0@///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# v00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S/@/@/@/@0SP 0P00 00 @T @TN%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$/hSU S  S% S5,0( c Z 1 { QJ0305f,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#S 1S0 0 0`0(0S B0 !001 00F0T0Tl0@k0@l0@k0@N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wppp (0 js0 S J , \, ^0s000S 0ss0 \x0305q0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 k0@l0@@-0S S@@>< @ $  0s00@0S/o0@0D p@-`P\ `@T  4/pp   /S\S`/0S/@-@0pS S SI1`Faa`aa0PPvf  \cP*P0S S S"00``V0! V V0P0p  0"4  00pSp0  0pSp/D-p@ w000P0 ߠ0 `.00 eP`0 0S  S00D:@-`1p@0S@9@`PP  3P@*@ 81 S@`$` 000-0` Sl P@@P P 0 8 P00@ m0@m0@m0@N-MQ@`P1 !)?! ? p? F $!!M??/  0 0 P- !1 @`c!V*Р  p P @`bV ! p ? ? F !!M?P?P P Р РK"m0@00@-@ @ @T 0 S0P@P@PU 0@ S@000\0000Q 000F-QPp1P0 U(` #   @U7 RPE @uPT:JoP0 S?2P>1 <P  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  QGm0@ xH-0P @?0?0@0M?P?P Pl `P 006H PR, P `Kx  =n0@Z0@Z0@x0 0@-TM P @P T H  0@ @00,@L@0 TЍ0 @n0@N-M@(D d ,0TP"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  @{ S`Gx`  0`G@` x`@0|0P`  0/S\S@@ C1Sʝ\\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8PH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ^ʝ\0V0 S! d/ S H 0NP IP\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  @k|P 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%4P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  DHRpW P @ + 4zW 0 `4/ /40S 4 0% 4mP hP @ \( $$$D3(#$0 \:`PP(d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 \P @Q`d@g ZVI `hPP@d0 S?2P:* pY0@SP/d0 S2 0P)* pPW`:  0%P@`  0P`@3`gPXd0 S2 0P* p` pލ kn0@'w0@ n0@n0@n0@ Gm0@ n0@@-@`Pp '00 0-Ro0@0 04@- @ #D$@@4$s0R=0@N-`p< @P0 0 0S 0  KY 0( P0` 0 Kcq'  P` `@@ V 0( ЍNЍq0@p0@p0@p0@p0@N-`@PW 303 :: 0 `V p@PZUT# 2\WV:`Vp 0Pd@` p@-@P` 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS:Q Q0@0pp @-@Pd0    `0SPPp0U00 N- M DP H@p y0 0S*0Q `V v  V95P4@\+W) \  L0 k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍq0@N-PMpPs%S0@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʐ@ 0 0 MS ISfiS mSa@@(0@: 0^, QQ @@06S(0@: 0[, , Q Q004S@@"($     l00S*[.00[00@@@( 0! v0 @!@` @H0>Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S 0bPЍq0@o0@p@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:Ppo0@@--\`@@-@-  : @ Ѝ/-@-  0꠆0 00( 0$ 0 00 ? /0    / N-0ᤠ(0`p,@ P`  p`T_0 0!Y  U !P 00@Tp@-X XPX`0#D@ <00S0h00  p@  q0@h0@-0SP0#aQ<@  R(E00@`@   q0@RN-M@` >n0?s0Si0?s0 SdpWaPU^0SZ   0 RQ0?s0S SJ (`|,  0@ 0     0 H*00S&  0P0U0P  S0 ``Px11(w0@ x0@T0@p0@,0@.w0@l12.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>v7_dcache_inval_rangeERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled A335BONESKU#01SKU#02A335X_SKA335BNLTUnknown board, assuming Beaglebone LT/Black.Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM A33515BB1.5Could not get board ID. ddr_vtt_enboard_nameboard_revethaddr not set. Validating first E-fuse MAC Error %d registering CPSW switch ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lxenv_buf [%d bytes] too small for value of "%s" In: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,*** Warning - %s, using default environment Using default environment ERROR: Environment import failed: errno = %d at %s:%d/%s() env_common.c## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flagsethaddr:ma,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" ERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx CPU-## Loading init Ramdisk from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imagefilesystemFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedNULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialstdinstdoutstderrCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file, bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxset_default_envarocsdxbim### ERROR ### Please RESET the board ### U-Boot SPL 2013.04-dirty (Apr 20 2013 - 08:30:43) spl: ymodem err - %s Loaded %d bytes autoloadyesNo Ethernet devices found ethactProblem booting with BOOTP (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") usbmmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d u-boot.imgspl: error reading image %s, err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpmmc_read_datammc_reset_controller_fsmmmc_send_cmdmmc_init_streammmc_set_iosmmc_write_datammc_init_setupTimeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters ECC: uncorrectable. NAND: Unable to find NAND settings in GPMC Configuration - quitting  SPI probe failed. SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x musb-hdrc~~allocate_instanceUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d musb_g_ep0_irqmusb_h_ep0_continuemusb_host_rxmusb_h_ep0_irqmusb_ep_programmusb_rx_reiniterror: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s (((((AAAAAABBBBBB %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s:%u: %s: Assertion `%s' failed.EPTGMK0123456789ABCDEF0123456789abcdef## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d bootfile*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameBOOTP broadcast %d AM335x U-Boot SPL Retry count exceeded; starting again %pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime, [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotatenounknownnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dipaddrgatewayipnetmaskserveripnvlan*** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) filesizefileaddr/ *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again /s TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx D h/@2Dy0@\y0@$0@/@2Dy0@y0@$0@DDDDP T 0X \ 0000 00000p0t7| 111122|77    $ ( , 0 4 8 < @ H 0L  ` `d 0000 0 0` 5  "  $ ( , 0 "4 "8 "< "@ "H 0L 0000 0 0 $X b\ b0000 0 0 $` 5p 0t   JJ  4}0@/@Ja; 3&PKPKa; Q&PKP2Sa0 Ԫ k&PKP~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ȁ0@Ȁ0@Ѐ0@Ѐ0@؀0@؀0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ȁ0@ȁ0@Ё0@Ё0@؁0@؁0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@$3/@D8  !"#$%&'()*+,-./0123456789:<0@<0@g0@(/@/@p/@>g0@T/@L/@p/@g0@T/@L/@p/@$g0@T/@L/@p/@eserial0/@/@D/@`/@/@ /@/@`/@Ȳ/@/@    @  @  @               @u-boot-beagleboard-2011.12-r8.imgELFa(044( 0I !0f(FP.f$BÖfHÖfdfMfXD@`  b:.symtab.strtab.shstrtab.text.start.data.openbsd.randomdata.sbss.bss.arm.atpcs00FÖÖ  = |3p2T4450@k0W|Co0w$B@̚14(?<052<8e <=q<|x7Xj3(;X3f? @CH_:Y$6gBrD<7!Z?a8L<1s7܉30I@,F H7X ܾ3,)8_488tx3B0FQP27\dġ2rd>d@5L(;96(CTw5D A0`=l<2`T #0hB8=8|O}W7e-?,r?m1\̰A$ 7<t:h 1)8@L54t>1A'J28;?B2;SXJ1]\Ahil8LBLQ=@8h-@`?wB$uAd08~07|%N?;6P$14a?oT5({|>T%CD=)24hty@`(5Z07XK6lv4$"@`!2-,4?h2P4PX1^2hd|sy0@Lm;lXo1 8m30@yB5p8X<FX:T@&TB?x4Il 2]4 Ar 1`|9pBBĚPH0dCx\S:PB7t?h7l0,A4E CH=$ \c; (, `9 5H  Y 9Xo [?z  8T HA B ~;X 9  5 jA L4p 34"  - d7B 3pI >Z 5f +p X3} G  1 8 CP ?L D6@ 2 0< x< H? @ۚ F F <<% 1X. CM A|\ )m $B 8> `A6 *48 3 BB  5D 6 |,=P Ї1 2; n1L# (y23 @x< ?K %Z ا2dl F0u  |2H 0h 0BP \9 L 3t ,A\ 8P h1 T2P d33 |q( 492 B? @5$N @b `At| 0 C 2 q1P `? p;1H ,< 44HB @=b?0z5D:43XJvT2e(A,pk3wtf0(h$(Bc43\?dq6(I2W?X@68 25?$_A @ܚ)1C6AI;$[3tc(6pd>@z@1 5l 0Az>X7X]:W6tA 3\1X.x4 <`B8IA ^7hAzܗ8t;@`B,}1Ě8F@(E@TP;\2`813Cd D`BLl>*;:AGC|Ytz6\lE6$vl1l 5 Fp)2@L+mC?pq?X0at8hv5@(06ER?Ww6x_hԚj04}XA7P uAK@ e$2;8Th2T**6 @E՚N10Zle`ʚl,4xL2x1КA(h1L< @, ap0`\@88,09$x771E`6OT/A\ @@f-yly2Ph-.3<d,@4B@$77{?<% ՚/x7Fx((P(3<[()lB|}L$A8t|;X:X8`;5`5D 6 <+6 p3@  <$bA@+x 3 G@B$T=H 1@[ 1d T0u 10`   % 0 F P? t4;  ? P 6 B !?t!!\S73!APJ!$ C0[!]Ac!lq!4ly!E!(0l!i3!p0!6!D^B!Bx!@!5!z?"G@L"LB+"19"6K"X8["4<$"h4t" <"F",}("0>8"#5",1@"3"$#8@"# 6#`<$J#][#p6q#4Py#?T#<~@`#*A #4(#1?,# 3p# 2d#1#80##أC0$l-1($BT"$;-$LA$2O$ph6l$<4Lt$@,$?$D:$h}A$|30$Z%1Xc%AC0n%T(9}%@%`o6l%5H%r>%@6%P0%G0%H;x%A& &@(&H=4&t6XJ&\BZ&0> g&t<|u&C )*ܪ4*?+`3H +q?\(+<?+,8xK+q\+9j+ 1l1=4131`yA(17,26d 285`2PS6`!2pn1D/2:2h0$H27X2+b22o2 V5(}2s?24 28p26P2dZ4t232h<2T4@2jp2R?35<,3L>L )3533 E3|>CM3?t^3<|r3D-}31x3l703]7@3̊<43C=d3D8303R?40495P40p'4xy5<242XD4S:P43X44`4x6;m40+t4<4044>CE4T;0$4(4? 480h4O?47B41,5,)5R15Ě 5H1l+5B55|[F5?T5a?e5)l5:Bp5/> 5h~8515t25p@58T5;, 686$q36h5*6q16l@6=K6?,V6ȨA e6F6 :X6D1t6+<6)C06dbAP606?680$6?6l6A47̢;7457Xw1L+7PH7@7ȡAS79]7TCxi700|7@70@P76H72|7A@7H7P5p7i17C<7! 70 83x8l0H 8E)8C ;8p`F8$>;O8\0LW84V5(b8D=Pn8L)2v8h88T58Bd817h8GC8k?828č8XBT8B38<9>9r(90;591xE9$>CO90)^9Bp9>d9?>9PC149Y8|9139D29$8,9d5`9ܠ:H97|:<2!:\0D-:B?: 8R:d5Lg:L4<r:l!{:8(: 8:?:<<:13l:$^2:X|3:+1:7L;43t ;X";B;`3$;001;)7;P @B;41M;|0Z;3i;`o;6\; (C;1;@3;3; 8;5?;0;u6<<0 <Ԝ?D-<T;<7<`M<,|4\<H?j<|;;x<lq4x<\p5t<X0<00< V6<(2\<\P0<3d<8"?<A<Xg70=`;=74)=g0L9=@H=H@]=?d=1Xq=@p=(5=2@=I9= <0=L$=,5x=p!=Xq@=$8=tM14>00B> ">H A*>2>B>4B>1XH>C Y> 1>0g>i8H>X9>v0>Lܚ>T^>(';X > B>(;d>X:>`?><=$?$38 ?5x?%3?H1'?B7?/@DI?̕0Y?"3 b?Av? R7<?O??C?k??>D?<;d?̆?|B??5 @2`$@,1@4B >@AM@T4[@$՚h@5>Dv@L!@m@Hm@$4,@6 @=2@Z@l@()@@L@>@>T@C,A@l Ay)Ar;@BAx?PAP4`A2 rA ACAs4<A CA|^>ACA`=A5;xAt8xBKB@BmBl5'B.B@1@FB,nBYBR=nBj= zB<BHCB{2HB 2dBj0B<4XB'2B-C?C6"CX0`5C BC0m1xNC(<aC 3ppC1xCBPC 4,Cx@hCt<<C|9CBC6CBxC\BCo;H Dt?7 Dj3$%D<-DC ;Dl 8DD4ODHXD0<_D meDX:@$wDJ5Df?DD2D?D7lD1 D+4Dv1D@E\E\p;<&Ek300E40FE,BpOET^=]E4B;\hEt>qE>}EЊ>ES@E`5E@1Et0,E46DED4<F2F .F0xBF`?OF4ZFAkF86yF Q?F"1F20$F n8FD3FDF0F2 G|3`G:h!G0L)G<::GH9EG@1tNGr>x]Gc;nG!xG?}GAG0AGPAG H]9pHe5HH5HT C H6xH$91HQ: Hܬ;I<`?I1`Iԓ;+IP8(9Io1GI?QI9 ^Ir1LjI4DzIpCI|65IdxIX.CIh&2@Id4I3I`:I5 I1B$I8z5@I8 JsJx5JL=-J8pDJ;XJx FeJU=rJdʚyJ7pJD(Jl1(JPwAJBJ JLCxJB0J1,Kn6lK!'Kx@9K5AK0DVKV?^K1XdK =1@nK8FzK.9xKBK`AKtK8@K04K\";PKBxK$)5Lt?5(L,ACL7A!L1|3L9xBL4)OLA$_L 44fLl9uL8)LL@; Lp[0 L0 L1@L1(L?LZ0,Mh)@M(</M&7 ;O@\MO94pUOh3eO+mO82zO8B\O"3tO@6O$=O0OP!>DOk3tOp2O0PP\= P<PD(P 17PT: MP1 [PL1fPrP8\@ Pآ6`P P>P3P՚P}4 P0@hS8U4<.S 1?SHIS3\S mS` 7xS4<S04S@DSn8SBSй0S=V\2@V|k: W2PW6<+WD$:W@BFW7L]WmcW<@pW8}W05W{70WX1W[;W/CdWWܸWlRBW؍:HXH-XyBt$XM?3XC;X1PKX`?[X32kX; yXP08xXP@ X6X|@X\o5XXlXXpU=dX$5DX4:4X>Yy;Y<1`&Y|B7Y 0xKY\0WYt?cYV6toY1BYX=Y0<YP?Y6Yk0lY(1lYBYH6<Zp<Z00,#Z-Z0"5Z?Zl?LZ[+[Tܚ[X8 [|2[dT[<)\t<1 \p0P\2d%\;\2\l5,;\Y1PE\|2Y\P;xg\4@u\PB\\H3\D%3\$\P9B\7\d7\D,\57D]8$  ]Lq3 ]&]|;@D:]h;G]\:U]`1?8a]4Lq]l1]<>4D]; ]v5D]Xel]D=C](>]]4]Ah]-]Tݚ^@0^@'^h<8^4@K^0@T^4 F _^?v^;D^,@H^?^3X^X1^ 5^ĔC^@4^̚^0^a@|Ta` `a`5jaп9ya|a0,a|1LahBaԛ9$aT&4adCa40aj9a6a8x6ax4 b|G6lb4F bB0bq;Cb1IbCSbX5(ebmkb4mqb50|b ;b4`b3b8"b$?4b90bL1bH5(b>b*c @,4c+x=fBNfX5Yf(%af$ ;hjfT4Hqf03tfe:|fP8tf4@fʚf63\f8f4Hf\3xf,Z? g?glB#g=0gb;(:g>dKg1Sg<@(_g<<vg pg@gW=g6Lgh @ g@+=<gLI@Xg0AgP70g1hh;%h\3H/hAhl>j@DLjTj\20^j8zj̔Bj$2pjA8j>XjjQBj8PjV<`k3  ktH3\k63+k3kA@>k C@Kk;l85LlT4xUl$?dl`rl`@6,~l>lX0lPB@l5l<ll[Al,%l8LlШ?lq4mPo@@m6m1D*m@R?=m N7(Umem̺?0tm R?m{<m m1tmALm,@(m@,mt<8n*n?!n4rn0;~n0n0Z54n;nXn`0n<4nm;<nCn57o3o%7ot*o27oo50Ko\V5VolaoDA0ool1$vo0\}o)Bxo|>loqoAo9\o23Do2Tox@ol< o$3 p`<<#p$=0p"10?pl4?Zp ;hp @op9}p;`tt|0t>t5tB`t5t(y>Du>1u(&u–4u>Ku .`Tu`\uD1gu7;@uu|>uj0DuM?uș?u:\u!8<u,u.2uhCu8 v!vp00T*v=B 8vDq6JvF:Rv< Xv7mvX?vl:LvD45dvP7;HvK3pvϚv?v?v\v 3?4vT_2wBCw4XxT;cxV6Ppx14vx;xh0hxFxP@(xȃA@xq3|x1xh@BLxE54x 7Lxج6x8( y<7hyh @ #yp:(.y49yz6P@y Iy ]y4eyD3nyh(3{yuAy?0yd83y:y: y|A5dy8LB yx0y 5y̆@z@zdN@1z;Bz,?<Fz|5TQz6]z = izC}zX-zpD@Xzz5zd0 z@r70zN4$zXzl={6{*{TbB*{?7{H7tE{5U{R50d{<<z{6D{H4{(=({04<{O@{={1<{+@{.5|8A0!| N?1|$8|@"?|t!K|J@Lc|5o|0 |D7P||Q0|4|@<|H?\|hA0|>4}H:}D?,}P7,}Lq6A}>PM}l-U}?5_}Ao}H}60v}1?x}|;$}B}9 }t?@}cAp}U@}9}:}4D~#6L~{5@ ~l6,~2h8~H0PM~l=7_~%Bj~ 8(~,) =6xCT 1`X42DiM0t;83d/@t\58@91H6Ҁ3lހ< 6`@ ,=li5, Ah?4*|r?xB 6dX1a<rpA(O@4/PX@7,r;tЁ6ہ4BXܴ@08?И%$r611Hp!R;[h4@p6 3L5T970\ʂV7܂ @h]70086X$-ܢ4D4P<<$DT@ST4]|-$d(0<8vT,`@LE ,>6ƒAH΃9؃9P6hhAP@, ,T5(3,D:6ń\!҄#6HtF@?HD DA;t (>x5H0A`0lO@X4Pc5h?89T($0pATυ7_ 2;1|,! 2/HA?"8V4xbX5kX,rCP~8lJ6pr9X@Q3 @,ˆ5چ\ԏ3PdH8lM0Y6\h7(B`KAQ@Hʇ5ۇ`!iBؓ@ 6\,Ě0AP&XAp7x;0LXݚST?Zp?d 0m$/0PCx6R?b;ˈ w;ވŚ(4g;8 2T1+4?1T*4$:CB[<U\38 ]5Tfi3xnlݚuȾ3~-;lB<A<,ȉ0B։|E@`:t@Y?04&t2G(@1Qx8f8h@w`R?pP=5<A64`2<@֊q;LT4`\q;8l4 _:"C$0t-; 3CpU3R4Xgl,s4l08ƚ7ܧ5D4;@D˚ċP0׋x3ދd)Dv5D`1K:t6,B,86X5A8R\5(^|Ce |5<q4L0z244D5h4n48Tx{7hU3<b3k?z CLHAD=%4ښϓCܓ4F6$:LB|0;)}<5,?@:dM@V9aŖ0̖3@ݖ]m8<g1 dx0H&T @D;4LI S5,V@P`P?sH@@46@$582<F—8З1p<Bx@;<9|y6.D0>@GpkB\V0@4] ?k5 yV0FB8h4hT7,Řp1ИDC,ܘ =| ?@|ʚF=T#l+89t)1 JLBT00a$m@A̗;H$?s1T)˙00ܙdB@< : [ |+d55`s4D>T8 S?^)n`\<v2;h5@(6@h2 00Ț@@Dњl0,ݚT@@x[4@ 72 l@"L@ *7HC=1O 6l[gtA(}"3 88d@,@8L4Q94ɛ,CTכd@[`O8 @=<8:D5PF8TPq6^l>>`m14y$]44At,3 =Ĝa?՜2;<ޜB|4@\9w5D 4zB?)@-2@5XB@Jd[5TTdAdxr@!1@x#784(4;0XƝ.Нڝ8 @0,5`)_Bp 75@%s>: EI?pXDךcpAu>< 4X1d30P$;1Þt@Ξ| C`۞8?p 2\ -2,l3LB(\=;7`U>C apR?t?|l;&=@aB8ښ͟d?՟p=@0G6 TuB0(5d %86;@A1`'|42D4;|AO54\0B=pk6xF9:X|6470(o1Ǡ@lՠd1ߠt@P;P7t/C@44(9B67K4lU 4d0u1s`&2{L8 2A4;\СЀ8(@<|;p;\  A(A`4j68QX:1bh64w?$84O7A΢l?آ( 8tG6<@21&B5Xs=cADJh2RB]t!4i7lt }z:@<( 9xȣF(ѣ@ڣ<8TD2,q3h?<tښ)-222$>=\S48o1xc;$DT:t8C<<%5h,344a?L=4_>8r(8,(?hy;0,|BL FեAHvBq1 AC0/p6<?)MԊ=W0a?Dir*5Z4H8DR?R96ϦpB@ڦH40t2;8 ,4 0L@>IH? Np] h|6s|1Ad1`~3H3p;3ħ$Чt14slsA)7hw2)'|?7TAE8\>DR3]Fd@p2qA\hԞ;08,Ϛ4x( Щߩ$9p,5HԈ7%R4X4t4ET,U?d]` ?g$A4n̄3z5|4X:T244`ɪ`֪BLA`C6h %P/#7P7(?D4?J@ښYhN=fױX5l5Dښ(3xT4*228S5x?|K8W|2<dQ?w? {4~2xRB@97в+6hݲX0'0\ܡAT 7<"$*+?1dAl>P(H$BW|AT`p?Xqs1`` >c;s9b5B t7γh4ڳ 0 0>0N?=h>l0=L?>PP<|[ATl:y7=X?8|A48޴6746,t @0)0$4FAXIb?_00k FsJ3h0>;<PLԉ7صtG4dh?<( 5(<5 3 7D-1L4tA @TH/?\`P85k]20y2($01 K BWl!;e8Hw,g@X?:JTZ5pe\5Hrd:$z`4Dq3l+@|>X3L6@_90ǽBӽh p?X!9|54b?$3;L$;2X1h@D4?X08XdԚ@x(-5dx5D2ƚx6`̾>\پ6X1LB0(p6<8j58F`D6XN@Y$3ey< D;Bd@> ǿ1 ֿ MA4ݿ܊?0H`-1 xz5T@ i50+v@:Dy6EƚhN^8k*xΚ3V@6p*Bp?$l5=<44t0@$D0 tx<#:?=74V1boA<}tCP[53;8x1T ?;@T2E3$\:M@P4`d@!p?*;3F7dK 3Uh <\k|6\x <@@7dC6@BDGAl=LPQ?M?/<83231TBD?x8HNZ6Y>C`l؟<~?<Z>pzT1Hq9v0 9> 7Ö!3,\;d@0? ,3dL2+CpϚ4lP;@1h'C8&BAd17TLښb@7dt $y;4jh6H4h@C @0,4?Y:,;553`118W5C0@O-?\6g,9w@? W;F5^2D<Hu1`pA=$|?T`2TQ?Q<%@7<dPX5^1fEAoXC w[18(j:0(6DHך>td<07=8Դ0X=5M@|d3CS5D/10'A3̚7L@6d[2npBTy@ 9/?tH =?\)P?hB88 DKC4D1#d@+p38D=X0<h <~ pC@?,7LȈ= L0  =88sBP9(lښ63XD|0pLB6V_8t=q\d5}R? 4@d:|o1$;\\I18Q?$85|f?)\=9BC54NO<a8<n74l@H:1d@7Y54qN?J> 002; @2d)x-)X;7C@Nb?dA$vh=2;X228@qt2@Py5D:456 At;+5,6$9<FBxYDd2GK4|W;Bhe0?q/?qh:d*?,9 40(xB7p8d$00,A)t=@;CPZ9a8Bm@p-yAd7;@t >;;A6`583P10.=x<4Ipx0Q|C_:s08<2Q? iB|H@:B70F!*4+C@;C@QtB`d30px<,Lo315dAXf8 <0&0 2 g4X-B5L?0495%%B2X)<l7QLB,ey;yp9hf8@? K=1</2lS6h :*?<*A:4=NPc\0hi,?{ȝ20T8= (1<;H2dA$ 6Cb;8}@(m96(3=@0\R34Y<7<l4B_ 44F?0tD;L8? h!> 2h3Bd';B\3TL><U-BX_2dp:{y3A<";dATZ<H74x 7h 014l&I;(/1 ?T[5Jlj;<f|0t^=<V=4X6dA|?tI5(=q1$@ %AC >XAt4?@ L$t87h9s3B@(S0\hl?s5D~AT2<J4lA]3>nt 8|A<t8`4P.0g7,Q? 5 ЫCx Dk3<ɚtf?&p0;T9Fp`8t`l0\uP0|܋4p]20D7N`64\t1|tBDP91@ L8<@>0Z=CdP@0TBlhA#@0Dpg2w/55D4 6M F(4`ث58h 8PЭ72@xo1 ?${&AT;30E$n bLllP1s"08| QBxԙ@l`:D6l2\y@D(2D@p-X20D 90LZ83f ytB$@8BH ?8l>HA\;,<,Ў6t˚LP=$B7t2؍3l@1`H(BR?dfd?4xĦAsLHA H1`;1 03(n;4l+ T24$$S@|A4,G7H[ԇ;lg7r@?$6TrA(.B4 8L47h%2?\@< 90Y:X$-27EAXX >0*;VBL`9n@|{O7$:6r302?@Q<\>C;`2( 2 ɚ ~5L 0<2= >pN,^:|msu8DԪ98|3@8X<<\d;̂@4`?=`}54M1 $v4HA@)@T8@@o@`O4@f 5Dk80zA8{@<40 BY:t>@A0p̍0B 853%2 =B<PPךX@R_o<`l;dsA\e<Ϛ d?@80D|?L8H5<.x64p2sB0#,@.ԩ<<@0I8<WsB8gHv6w7,C?<94@| F.<18.<4=,4Hz24N?4815806@1|)$3@p3p3|<CD|<U;XfTښs2Bt1)p,@H<2>`|7B?xE7TAt8#,-0???P|`[6 f\N?v [481B`X4@ZAAP?S?p=$4x(1|0H40 BX*(997B5TSBcBl@}lT=,C 3`ݚ<3ԨA0<@6X1X6t;@\l01$(1D>T7`3k<7PC8<7(h7` 7Lr<MC0/?8 x;-/!8.1EF\_1f]Ahn5`(1LP2D6P0`<,X<,\72h(3A?"@1,<2H4EO">X [܊0e.n DQ?<@ 00,#[0Р6P>x3D0U<d @@nX7tC4P?4<8D@^5PA3BYAs6X1XE7 +d49 2A mG0cLUCxX75@\50\?`!:B8(2LB870 ,M4% 0LB+`?<9 FfS]Y@6Pe@poA,}>;lO1<8F<5@3?,<6,:1HR?=@X`7  6$X:|%35L;3tI2C0Y08Xc|poBT|X0 7,,%؍<L2oBl&B<L<<S4 hC$'9:?1EQ?W0,dDn? d?-28l2@l}0ÖX3L42t89@o1lADDe5&::(02D\ښWԄ2xg vt?W32U:@x<8 ?Tך0l;0$a?$I(/Ȧ< ?pښO;go1<x8; x:3d)7#4@BY<v00ԳAXds33  5<$%#B8$GzAZ<gA}`I4n<H0d7,@@T5 @ H?2Ϛo1l5%Ԍ-7TBX0J$Y8|bq3i:u#9*0B43 C  ?D04?C\|5< D@`t,`<\<M Jpm?$OMCi\V3prHKBp| 0?P10P20TpV:D3d˚AH .30"C.2?=$K`?X0-_$Ck Cw`Q?|<>8( ?3>,<2d/=B644 ADD9?5( C0=h@Jh6DX@MATd@lyB?, ;<+8; c?M4DX0,@@he732(8F!5).64=t1`G_AP `8?qT= }<D)/0TG@H4aCP{tt6\t88 8, X;= 4J T8c 0(u l?4T| 2 B 1` L L9 <4 (A 12 \;t 5 l3 2p& x. P<< H1$E ̒CK j8d <4n 4v C dZ5 <  ! P p@ a: 2 X3@ b9x W:<3"XA4-TB;BG|X>dlBnd@%`g;?`!:(F-7> >CHts@0X|5<dh@v<@G> 4a:?ЃBZɚ-?`)0;;L$84d&=t84@4d$70;H7CF\6Lkx2CX 9p\ .?86`Ě 1(t2x7xB37|&5-:C?@I)Wt1e^5p$5{@`4;1l;>>,V@\F5HP<P7,h508 CI8CX3b5r~0}007LAXAl4t3Y?4#? H?HC6X&3<>,6O 5LY2id8Px[\22B@pBl5$tBH~@ 42L}3:@)|0<(B2Gl0pONBe 9ps3TxP0,\20T40>HP 5 Ab:? CEh0.r47z8@1$<XP5xܽ0|6;L/q0 @_?@4 @$ @#>CH7[0fXČ4Cɚhl6E`65 D(>86H-$A0Ox5VXך`BkA`w< ؚ$`?695(;B/3l; #3PtO?Ly?<-.?:?(A|!?<Q2dbx5p2l753AXpZ?dښ1H(3DAP @8"LU74hݚ>1P9YD8 rl?tW51%C54T4ďA$@@lD6;,102;1\. 5l>h6JsB4T[] t;;~C p;<50\:AHT5(H:Bp8d8 0D )@! 6,1 X5= =J 3?d p3pk 2{ ls dr!Q=!\<! ?!M7!(!x-0!$F!<%P?,%?C%}<Q%}8|i%d2t%`9%,9%54%F%%DK7%6%(1%4&< &H)&#&0 2&N?A&L)O&`A\&$8Tn&p3y&*1&8&lg&J6&}5@&?|& 2&/0&]9'\ 8$'A=+'1A';Q'lZ'Ěo'8}'Z8'x5@'x5T'P)'@'Dl'DB't?'L>'d;'E(w5D(D;8(8t,(L:=>(/?@S(G@Tc(1n(4C(7(}4P(\BX)7)d<5)?)T1)hAh)t3,)9)lh<* Bd*D,* 9?*|10U* F_*4>0j*5*t@*C*1*@8*p@p*;*W:h*{5D*P"*0@+X.?,+s2x!+(A@,+?F+?P+3g+0r+d7l+4-+įA+<=X+8+I +Q?+ @ ,4A%,@gB<8,7I,Y:V,h!_,Pj, A(y,5H ,X5,/2,$,9,,BCD,L5p,0, ),\0-@-d-!-P@.-p;?-A0S-O4^-?8k->v-N:l-p :8-lq3 -d-2<-l;-5-@cA-@B,-A8...\@8.<..6P:.ATH.@<$V.4i.T;x.7p.6. .s8.7(.5...Ԅ7.7 /D2t/9$/wp-/99/<D/D 4 N/Z4\/B4g/T8,t/l33~/g/-/Ȑ8`/(=/020,/Z;/ؑ=h/86//5H02  0~00A@%05d10&9\A0MBK07b0"40q00z0R?0>0p?07t05@0H00R?00161<84*18l<11XC1$)S1I k10\x19x1w9$171281k;1D @1`B1a7<18x1L92> 2x"2A\?2{@J2B V2,9c2E@y233\2l924l28 02E2:2=`2p,212|>p2023 j03:`'3| FP53E<D3p;?dX3 0`3(:;j3t1v3t/034L330@h3Lm@3tٚ34P44,CffsDKCmsdos2lockf@` lnDtnD|nDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDoDoDoD 444Dq3/5/5.5Dq355t5l555,544455\5445555555455X5855d555Dq355455555,55 544555@5Dq3Dq35Dq35Dq3X5545555 5ܧ555Dq3555555554445h5p54Dq3X55Dq3h5@5 5545\5 5`5ث5t555555455h5555x55P555. .. 666X4<+6664646#64(65< 6<6564 6X 6D 6L6+6H/6P 65h664`66#6l6686 686x6866 dC6@6111^^3333 DD66#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ l44 @ 7&7(6776H7yDd744d,7X!999497C9,9.99997lw9999о9T997L9H9F9I978H9F9I9$8X879H9F9I997)9H9F9I978H9F9I9̡888l87L9H9F9I9L9\D@576 dXH7L7T7X7P7<8Q @X,7777(5,505457777777777777775(@AAA==(A* dd%(i @@@@@@@@@@(99[[ 99,9@9D909$999CCCC,::t:|:::$>;>;=;X4Z;0;;(;4b;4B;`;Pa;L;l4;I;(';A;4;4;t4;;;$ ;>;<>;$:;C; L;4XF;tD;\;<;B;;5;$>;>;=;5Z;\544\;5`;Pa;L;55455X585;;;;55;55455\;55;;5$>;>;=;5Z;p544|\;5`;Pa;L; 5545\5 5`5;;;;55@;55455\;55|;;x586;x6;86;7;86;P7; ... ...;ܬ;ħ;; ;0;D;0; <=l=DpA=,=\;=3=/=/=2=x<?)!>̠===?C9,9L>99?lԛ9T9999??,>?>?>?: =,>?>?=X==?<=?+n>?,=?) 9,>>?9? 9,>>???,>>??D=?6@Q=LQ=@  XdXx@|@LBPBTBXB\B@@hB@@lB@ E8(@AAA==(A*@$@(@4@0@<@@@D@H@,@L@P@8@@ @T@X@\@`@d@Q pBpB  hD pD tD xD |D E E xE PE D D D D D D D D D D D\d*?D\8*?D\ *?CD,?0-? .?`D??{?z?Ly?>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyEAAA AtEEEEEEEDAAA`A EA|AAAAXo1xE  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  E%B&B%BXo1C$EE8E*pkB\kBlB,EXEE@ PE@E  E@E@E@E@E@E@@E @E @E@ @E @E @E @E@ @\E@$\E@@%\E@&$E@$E@@$E@$E@DCB H(0E@vw8E @'TE4L@@\E@E@H HE HPE1H%PE I&`E1H`EI`E I`E@I `E`I!`EI"XE@1HDIJhE HSdE H@E`0J @JJ E J`E1J`EPH`EpH`EH `EH!`EH"XE@1JDHJhE HSDLJ@JM@ED pED HE H|EI EHDE HEXEPDDDH`EpD``EHb`EH `EH>hEH@hEHEJ@(BBBBxB$BBLBLBhE`@B8BETC@E8 CpE| CC`E0DCHE0#CPECPE`+CE'CE8X.CE<1CXE8$8C3C2C;C:C8D=CdEEEEE ^^EEEE/ e-ꀯp@-@PPp00 p@ꈬ@-@PP0"01 R @D4!N?O?0般@-@P$00 般p@-@`P<0R0@Q  pp般@-P/@-0@QQ0@S/,0@-0 <!"( #4Ӑ脬ꀶ40S/ 0  4Q /᪪H@1J@1JUU@-,0 001s0g끦@Y@-808 0DAt&"*" S@NPN@-@8@- 0,//-0 Y @ 8v0`000 pᒤ0 0A0 `dl `0<000 00@0    S PA8ꄬ`D(870@B 0p/t0p@- l0@_PPQH`@`` 0P00@0}0P0#0@00P0@` QPP0@0p脬0DP MP//`0;`0/ 00000$00,000 |0R080h080@-  '8&@-  @-/////////  800/@-0@000 0 AD('Z4-|@뉅Cx-N(-\@ LDrP 8 g0'>P l6>]ENꀔW@-'_ꀀ@-x 00<0P @fP@7/P pW8@AID$HHL@< @bN@gDPF F @P 0`F00\]' L H04@00cD`x H0Ն 0@L耉ꀰY뀘)@@- K'l@0  0A  ah@- 0 00$lATN-P MT@`ZZp0P  Lj`'X=p `R/ pl ;dh x00 at0l;PPil ;PPclS.0 0 0 0lP P/l/tx 0l-l F 000  00 1 0W 00000  R R  吅p  60 10d R hP hp0 bP 00@0@0@@O :/P ЍAT$lAT ATBT/,~&M00000cSЍ//@-O:?@-O:?? ////8018<0C0 R S 0 / $H0'$H|'$H'$H 0 P: 0 /'$H0'$H8@-@P  PP7&@@  80/&P,0@ @T:0 8L;p'$H0'$H@ 0 /T//@-mp@-M@ ㆅ00<0,08 040@P&($ 0%00 0%0 0 0%z Z c0C0bvVVdnN%@0TT  @018 0,%ЍplꀀI5RwꀍY@-@%@x@-@%@@-@%@@-@%@@-@%@@-@%|@v@-@%s@m@-u%hdLP@-@ p% l% h% d% `%ۃP  U%R%O%L `K%4 PG%xH @C%l@ 0?%`D ;%T 7%Ѝ!)4H^gq{ꀂꀌ@-03/Rp@-@p@" P⽆`,%D @P@ %p<, <4 /@-3PꀀPP@-`@$);4/ꀀPPN-Pp@?`"0S`0 70S`U 啃 Y & 0 0p 0-}[0DiP<`@4$: 04/Ѝꀍ@- 00csV'8@-@$N8PP|u$Pl 7PXj$7He$ 7P8 4^$P(Z$P81Ri~ꀖꀱRA-@pP`80A `PPV]>N-p0,`(@4P80j7V V)T T``($`$$  8.7000$$0 }`P000 $Y I:$dL#Y 8:v3 T#P 0SiN-C p.`3|6⪀6P6 ⭀}W<3@ l@:7TP@P7P\#P㈠##9+6P#96Z #/6Pt# h#9Q P#9P/90S SS S P T0"6 @0 P0&Tc#꘡@ 0@D09S#k9 PTAT0Sx 7Pd]0\0^ @00L06D0XS(#4,Z`# *P0X00`0ZZ ZY@d00h00 06Pl00p00  0C8Pdlf0 HP Ѝ(l뀌]뀓lꀁꀖꀴ(Hkꀏꀴ/F-`4M@P0 pE P Y  E 0i PvA0 S"00^ 1YaD Y Y7 Y`@YL YT YY>X0H0\00]00,0 000bPPJX,  aDdh x00 at06PP:t rIx kB+l17lp Q7  06/PP   06/PPx   06/PP T_"Es  06/P4ЍY(l@^N-R@MP0p`<08 800:SS #S   0G  0EPxA>X0H0\00]00<0 000Pp pD0S "0Sx!p!pE8  0{p[ 8$< X a]0 @S[ P 區pP 0T )`0F3/!8^ 0AT [ `@^4^ l!7  04/7  0+@Ѝ(l}ꀷ s@-PT`_0P @B@P 000`@! 0@|F]JF-b=Pv!p@删4 4`D.I.0O0R \.0S0m!0S< f! Y M!@TB@b^ꀘ$D-p@`VP \PP0cSPp /!P`VW %!R@-0 ڂ0cN- BpM@R&999:耄P  \P  㸂P  㰂 P媂{U l 埂pJP  gl0S` :S   l僂`P   KP\@ L }P <  00 0`  0 iP iP 0 KiP Y Y 1 i P  0` ZiXil0 d ` `hT`?pЍEN$A^3cꀈꀨ]RD-@P; pIP V 0S` :S B ! `T  @d@uiP\ ?iPL 03 h@P (, hh#UꀈꀨQR@-Pʰ ( `IpP 0S :S d 媁@@kP  0^n# RD-@P@0 ㉁pnIP 0S :S @ s`` XkP  0<T ,znP@ 5#hUꀑF-RM@P@  Gp,IP>0S :S 1`` kP  0y T     0np@ 0L`_<[8 <,Ѝ#= <, <4 /8@-@PU;8nPP$ #bu0 u0Pt %00T@PP <8,888Xm뀦)G-`QP00SS0XRSM R 0C R  SRS> @ )T}@@}PTG0V`FaFp堐{ T @Ttp@FPp TD P @T<G@2"$ꀍQW&ꀺ-/y@-$0 wNЍXm6N-R0M`@p0aS-R9P 8;8 " -P T   :@PT * ] tPP t R }P2T  hZP  T`0p  0@pT * &sI sPP`o Kt U |PPT\ڔI `pPC sPW3tx =0sSTF0T0 0 0i 0,0 D<R'00p@0'`Q`1,0  ,00eS0,0,0 R @,P>Q V>Q%[R&00`@0&pxPp,,0 S SP1,0 0D  V@ U,00]S,0]QPg@,h|,|P0 U ` @,0p@xWoP@0 =rPsll CPrPlSpSUP PT T` @(g@즟uopPscT  $0/o$PpU NI$?DmD `( )m0@SZpIII耤J耸J耸J耸J耸JJ lnT0 4&P0(\$&$d @T@ B@DT:dT@3 lpmP$*s#Tl dxTL d\ $L @dT0T(pP%P#  {P TnPrT qPP rHrPPr0hSLC`YPVP0P 80I$0 C0=04{U0,sU 0 $kU0$c2Smx][h {PP }200 zP ]~ @P W~<2 0$ zPPP00pS"am@$" 0lpPHrtg000X0 0 PUWaS ~ ~81 0[p@PE!rdS8 }0kp@P5r00cSTTPPT@  x}@ s}Pl`# 0"  nzPP00$L0ЍXmWuꀤ\m=2^yZ>)>ZUꀭꀵꀓ}2">Mdzꀑꀨꀶ)wR-0K}ꀜꀶvRA-P A0iS cSsS tS```` }@PBPP LVP V VPPpP3 01&ꀬ@-$$ `0A 0m۶<, <4 /0 .R00@/R 0S//RA-@`P8 p_P  E0H 뀈Q W SPMRA-@`P8 p P  E0P`V0/,\N-@ M`=Pm P,(3 @3000cimP mP mP V`QP0S mpP pt2 Y pWX, PLnE<n PV0Si`p`3r0p 0mp 0W 0 pP   0 R QS@1 0@p0 0h0S01 (ENꀔR  @-<0Q0  0S ЍN-P8M@0 ` p$cQ bQ(sQ tQ#R aR_` @T  0o 0pRP ` Q@DT -RI B HmV@DP 4 00 i P'000 04`[0000 00`0h@P000 0 [ x @-@M@ L0 0  00ygPX PXЍ 7iPP; Q =  t -0S P P 0 0P Q HXT R  0Ѝ0w뀷-< gu뀠R@-P2@PQR@ M kPd ` @P  P5iPP P3_ , G$P pWQ* h$P& p $ Uw `0FSK`V1 D0$`Pp I$p$W뀸뀸D-R M@ ^PY  PkPTt@P PCTP@PD@P! 4h R ^ g -:S  000 0S0Pʼ0@ <"<4("$Pm`p PpfV `) T%  Ѝ<P 72lk;@S<, <4 /@-@`PP!0P|P&V P 0S @PP@p| `V @P  jh`WP PꀙV'K]m{뀋R@-A aj@@//RN-`B@KgPP@`Fp@gP ;gP 6gP 0gP V'gP YhgPAgp3DgP7gPUUW gPfp3fPfP}fPfP_|fPf렯iXfP   j  j 0`sWfP   j  jZFfP   i  iZ4fP  i iZ"LfP   i  iZ|fP  i  iZUUW P`iV A[ z3z3 OfPP !P pSLORU뀷뀶뀺$ꀫ뀲뀣뀧뀼N-RhM R REA (i@< i@ P| d i`+PP 0SP``0S4Yd0S :S F dhpp |1P  De$ e00< 0%=01D  eP  ePt D00 $0X` 07@-1@S<!a0P0 #4dP(dPHdP ( H01S |!hh!8T!HC?0B/ $#4>Khu)뀀뀟7@-@Px0ll @  0\00T0 0L0S <, Ѝ0@ Ѝ0!뀍7뀥)p@-@P` PL 80Sp(`p@Ui뀕)뀣@-0  @t00Sd S\ STTz0Hu00S0n(@k뀮뀲)G-@}`P|Gp J%1YP|`1UG?)F-@P dp4` 0(0Pp S$%R0R\ \0C\0S8 Y 0  C W 0 0p|p p0 0!60 pS  S 10 cP(cPHcP H00 (0p5S  (P `5ZQW" &6N@- M@ d l ЍRD-`p ScP  McP  |?&Py+dD=L 9c@P< 040S(   *c@Pr# c@P"V u#PP 8@ T f`Sb#PP 0S @ TlF` bPD'D bP#V`p'@P 0S W` 'h.p e'0P 0S [.V3bP$`R0S)V e e` e@ 0<'` 0 [;QpPS 0 G00R .  I$R&R0000R00$R0    0 00Z @ 0fS  ` `0    |   000ppT]P/0@  @/@/PD0  <04,0Q0@///T]u 0R00/Ḵ@- 0S 0 /Ḵ@-P 0!S\T0LLL 0VP<0<0808 0  %%M`PkMf000!1eL`PM W|`  F!@  @!D 8p  p4P H PL@ 0 08@@8 , ( P,K P rPJ@DT 4 00 @D4 , ( P,K P rPJ@DTH0pP<WL@0X 0P L`P`zM8 $GK 뀀'뀙ꀈ'뀰'뀼'H&W&'@- !  0_N-8Mp V0007IP`,37 [  0HPP! T 4 XT 4@0S@PU00 d 0P00 H 0P 4Z` @PPF8Ѝ''(''p@-@PM/ GP` 0G 0QPNKPU ` :#:A]P``^PPc0 P0KPЍpp@-@P p@KLp@-P@HPp,LH p@K'N-@M`@0_IpP~ R< 80``P Pp0Z.p``)@TPp@-Pz)0p@-SP@  R0S 000`0 0   0 pp@-0`@S Pd00egP0S `0 00pRp@-@P ,YRP \Ppp@)8@-PP 0p@$S 0?S 8P4"_W8@RP8@T88Lv뀝)N-@`p* U j `r @ QPRUp  `P`P R PV@ Q00` QPPV QA @ Q PP QPT F-!0p0[ QP@P x CQ=QP``P1@@QP @TAQPW10Sp@/ + 0S &W0S00Q@QP t0Q@p @@T@@@uP2ꀠ)Lv)p@-PP0@pIQP @TpT0` 0S Dp@`0S00p@Lv)@-    8@-@P0 P 0PP8F-頡P@pQP`V0 %  p WWpp x 0 00SD pp pppT 0S  0R3 S 0 00R00 0 000  0   F 0R00 0 pW|aF-0@SP`P0S J0S 0 {P @r0\R00S RpP+ PzP 0 q 10\R0  S R00 0R00 0S ) 080S/Lv@-LPH@PD08,883P0(8@)Lv)뀄x**p@-@PM`/ 0S, .PP 0S 4PPOO|00t0P 000 0@ @0080@ 000 0@@Ѝp)pTN-@8Mp#0 C zC 0q0 PUS7PR 0 S 00SS 0 S A87  pW 0$pppP p`pp  BR 07P0Q@pWPPU PPUPG |PG 0u0$Q  RPqP3 0 ~GpP(W{0S VZ00Yk 000 0O "  `, 04p3F& S# gOpP@k oO@p,0` O,O  #O1 0@P0S 0Z 0P00004p @ `0Y 0P 0 0 ` 00P 0 0  W W[  W0[000S #S PP 0S @ ;P Z@. Y+ O=NP M0 0 0Z A0 P 0 1Y 0 0C 0, 1   0P 0 0 Q5  P,`m`N 0ZP UNRNN0V  0S0,`N 006141;gNP0x .P0` O L1P R 0 jR "0 00 0:/0S 00iz0 0j42"0Z 042( $W R W$# WZ 0SS0 0 0PQ@@TI 8ЍLv뀷QW *C*@*N-0M@` NuP` K0S  005 080S Z 03/[ 0KS(0S [   P Z  Z(0S 0S. [ &Z #Z $Z/ "Z;Z 'Z\Z |Z 0S (0S 03/03/ Pp#( )y ( " 03/03/00 0   03/ 03/0000_P0S 0?P {P .0     03/S 0  03/ 03/}Pp}P;9 0,00S8  03/'Ppp&#0,0(00s03(0 J  D&Y 03/   9|Y 03/ T 03/p\1  (Fl1  M   P u0 S,< 1PRP$P,%u00S ) 0R 0,000S00,(0 S ,$z  U0ЍY0S 2ꀂ*Lv|耇*뀰*@-000(0000 000 lЍ|8@- 0DPp@-@MP``P | ph \ P H P 4r,e00܍p(4뀨')474@-0SS G3/@-@P P'PQp@-@Pp 0SP _|P0S00pp@@-@P`Pt dPPpP  DPQ 0 P @@ 0  'D-@P`pP 0T0 `P CP@*p@000@-@P , !P '00@  R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSSp 0pS`V ` pP~00F Sx+++,逐-,逐-$,4,D, @ ` @ ` @ ` @ ` `  @ ` @ ` @ `  RpH<,!C<#J$#J%#J<P:pP3040pP*0p400P0 40 pP sP  pP0UfP P```@/8@-pP@`4P 4@EBP PU@@8@-PP@ <5@P < xC |B8@-P (048 840408 -t0DM4 4 8 d< 2CL SB10<0$040(00000,0,0DЍ뀠%뀔逤逬逴|02#0@-P> 0*A4+! !0|00.  S00@-@C@DT 0P/   (%L0p 3/L뀟%D-0`PVrBZ! 0$4p0,Ġ1'tp@5`0 0( 0g%V 5`FSV5SE @LXS8@-@ŀC%P5PESU%0P 88|/@-p`@  iP 1U@|`1TPN- 0@S` \R B0Q10p|>0S S30 S G 01 pjB0%10&1J#&! &! %!p%J 0QB00>0  $ "$ 0S 0PE0 R;4@-h0 w`p1M4P $K/  0@P PP0wVt0p00 Vh`l` @ 0ppЍ@-$(M"(@h 08#8 0d00  0Ѝ@-@p `0P`P PLd@` 0 4 S0 0[4뀀4@-0d 0 0 00 0Ѝ0@-MA0 Q|U|#&1S0Sl*h0("(1 4 ! }/  0Ѝ04@-h 0M!!$d0  @00 0tPlpЍ@-h("(0  Č! d   !0YЍ@-4h8@M#800!0 0d00  !0@Ѝ@-48M#8@h0 00$08#8! 0d00  =0#Ѝ@-48M#8@h0 00$08#8! 0d00  0ЍN-M⸓@`pPdh0 104 0 PPUЍ@-P!h  p@P00 0P00 0P0S0S 0T   \0RS00PP2@-RSpMP`@000 Q. 0Q  0P%0S" 045 0PpG 0? S *PUPP 0P  ߍ 0q0/HLp@-< Q`T0@L 0@0%<%@%D%H%L%P%T%X%8% (>H >Q  0"Q ( 0Q H 0Qߍ8565o5뀛55 6s@-P` @P/0 00 !(%R  t P\h'0 0<0a0($E U&P  c|86N-M@PPy @ *Pr $Pl [> 040#40 />  +>0 0S   0 0S  05`P=Kp3`/hP*<ⶠᴰ n  0 S(5S _      p5Wߍp@-`P@`P =`M@ T8@0<9P p@\<p@X`H$DP6e6D-\p\@P`T@Z=0000h0 14 D P z/ !0 PHd) h0 104 = h0 104 =(ЍpN-@P ` =R02 p0SpT00t3/P XX<00R0Sp2000T000X3/dX`VhNN-PR(M` @2p :#p@PP 0 R @ TPpp㐺*0AR0P  0UPg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 <R0( 200  00  0`PS00  3/P X0Ś 0k<00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  P_pP(ЍhN6N-PR(M` @2p :#p@PP 0 R @ TPp:p㐺*0AR0P  0Pg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 ;R0* 200  00  0`PS00  3/P X0Ś 0;00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  PpP(ЍhN60"P0p 0 /hN/p@-TP2S@Ð` 87p` @2Tp,phNL70@- @0S 4MR%PhPQT ] Wh `RT {;,00}?0 04Ѝ0USBChNN-D"00M!0R3`@0 h 0倠 0h 0 0僧0 0j}_h0 14   DS !0 P8P UW h0 140UMTpWJ X m$$ `[ P,0}/0 0 @ 5S  ` 0,0U0, U V `F,0PU pW ` ` `05  Br  0Ѝs@-% 00@$0 P joP `FvP dB00 0S0SS P 10C8#8S 1 |37뀤F-`M@Ppp) 0Spa 1#40101SPW Y05,03/J P0SSF  M:R02 00 0\00`0 0[0 0SY05$ 0SP S S  V T d`W  ЍR7뀏7@-h0 14 } 0 ЍN-1 MP@᪑iP` 0h  Ġ`- ``g00T0 S p Ywp  }/ X P 059 W  P2pp}?0 0p' 05  PP d0R\0" 0 BR 0S T QS ЍUSBShND-aPV@y|p'!1Su"1S`q So4 l9`P`"1 0#1S 0 :PS x100t1,0|0 G/ T100P1LK00S00P 0ĵ 0ĥ00S00 00 %0 Q P- `V+ `V( 0S `V" QQ Q  0S % R % h  t40$5E``QxFS逐E77tEN-bp?X00@ 0 0R0ء 8R020$00T0 0S000 3/P YYxvRb2 RM L0 0- 8 A8P V8 PQPZPP  0R P `++0  X08P% 8R0200T00S000x3/P PUPPP `PV -=0%=C0hN86.8N-@ M,h8T yA堡q`p Z80H`0PVP 0 0`dpp@XAXRP? "4`㖒"P/ rG"`h0104`$    }/ 0 G40P`œ'p   !P202Z2SQ\P U<@82S Ѝ0Q>8N(H逐JhN0Sj8뀗8p@-P@<`{8@qPTlPp`p蠆@-@0P4T@-PB04S ]004P,bp0PB! 0PS SS S404j 40 4f$4p0W$4[U1X+8S0tPM p0wPS;0404 0P=  0 P4aU0P/ (4S 0|P& @ $40"S (4S  50 $ 44P  08#8RD 0 $R@(0LP 4T쀐=X>X?XP@-TH0H  P@ @  <0A T,E>bH HHpX쀠0 /pX<, <4 //@-13/p@- 0 M000P0P 8@80001  3/`P 0  12 @00S 4?`@T*T7` Ѝp@R>h>-0$M0 00 1 3/$Ѝ8 @-0\0S X쀄>N- MP`@PpO pLQLQ 0 g00 0Cp7@ 0gZ!R0C   0 (R#   0 00 1 $!3/ P1 3/ P &0010v101 3/P  pW: Ѝ>>N-0M@P`P@S wPNq [ p1Z  :W000@0 S0(p00000P,00$01  3/PP ~P0 00W00S 0000PP1  3/P Pe@ W[0 ) P@0Ѝ ?8?J?@-S4MP000@0pS0 000 ,00$0p(P1  @3/`PU 0000``1  3/P !4ЍJ?F-@R`p PP@ Qd P Z 1 0 PZ0 `p'@ ?@-@ M0 1    3/@P}0 Ѝ@-Dq$M@o70 000  1 3/PP>)0000P0 P,0 P00PSQP1 3/PP)0 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP C\0 a P0 0, 0  200 0 10p 1 3/PP&?0 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?@-@0P 00 0@-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC JX*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/< 8Q 1@- RH %H513/@-D13/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p {.P +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`tVUh\l0`$d4P`d h0! P L,4.;#5"0 9000000 *P`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ P 0R 0R 0R  0R  s-PL0pLp pW*L0  P 0tčPPpGtTpG+p4x0p 0 4"$|1t0p ##t#0Ie 00rP@A뀨a!A@-0 H0lI" hP d"@PP0TH IO00 00T@@T Z9A뀷 QA @- HBH! @=@-0@0d! H5 H) H+@-00@ @| 00  @ A 000| 000 00   A  0/0  /@-@A0 / @-C耍[@-H Pp@-@ P`A p@ A08@-P@P8@- 0@0@@-@0@D@p@-@`P0P (Up(0Sp@-0@ S S !S "S (0 0bp@-0`00@T`\Pd"@ TpZZAQؙؙ  0!//ZF-h1QUU r/㲠[/BT`0` R@@@D 00cS\㚐 8@PTpI@\P0Px000P\0S# 0R*T P"QU p\0Pz* cR !R \ P 0 0 00S6 P PPPZ[쀔\N-xjtDP@s'P` T0`DT y(`01(R$4P5'4, !< !XC !T [UN r?80 0 nu|NYT[U\ r?800"LC: s7 A @3` ]$20@2Ab$0(RV2Wb Py?,Rt_ub0 0R_"b4R(PRb8rRb"0S ($ @4P84 0S `  0 0 0 0  0T0T0SP@ P @* P@ P@80SJ<=L0% L0 P@8 P*@l P@l P@ P @" , P}@ Pw@ Pq@ Pk@G PeT"@, |P^@P PX@,pPR@ PL @(  aPRB< <@h P7 @)h MP/P  P @E @AP @ P ;@aP< pU#2PUW W U Ѝ4 K`0V00 %P0:P0< 9hx0< c< vP0< Z< m 0 '?BB뀡0BPBB 0 (/ `@-BϠ`@P0(!(pWpWX "|0D`@P0"!GoH #!I 0P00S0SEĵFĥ0 0S00G00`J0 F?R +P EPFPGPE 8@-@RP T 8DD 3'@08P 080$000(0,0,0(00088 `CC@Х\00 PP/00//bhR#/! / S/@-P@0T/0R*0 0 P//@-P@T0T0@-@P 0T 0@-@P 0T0N-(`Pp,@0 S @@ 0P (0@s/@-P @T R$0Q 0 0 0 0LLL 30 00$0 4(0 ,a/Ѝ@$ЍC뀴{ZC뀁xCP/P/ 00 0/0P P/P//@-P@@-@P QP/ 0 0/p@-PK`@PHH K?D K/!,00<00`P00p5Cp@-@Pp@PUpX0T  Q0T X0p 0T08`0P@P00CP0@@0Sp@p@-@T@HC0P@- P/3AP*xضж退逜途逜逤逸жض$(P (P (\  P0j/05A˾00 4S S SCS S S< .10*0*000* j?" 00010PP㠠꜠P0 4WpWpZW  u0505YH h#c$ H뀑ctc뀥78@-t7 POHA000001fP$TAB]` 0@1 :D10L1P1T1?0X11P1@P  : 0 400#40 0 $  "$ `@1  @  @ 0x1@!( !888 h쀐H뀫HtcH!Ϡ\@->N-!oV@ p 8P失!TP UU` pNJ pN' h!8@-@ 1問 0㐏 0㋏ 0冏P00P0 0C/@ 0<000@008 0@0 0<ӏP|0<͏Pd壽8<SL0L 0 08 08XJГJhJJ JH@J HLJii8@-㩏P0  @00៏Ptum80 0T '0D "04 ( 08@J J(IJhJГJXJ0  @ 0< /lj0   0< /lj0  0< /lj80 R $ 0S0  /ilj@-Qa0A T0 pS*pcW0SH Wp 0T pTp 0 0W0 # 30t`: S(12P8* PU:Pk 0P@e  0P``  0P 幱 P`p: S`02P@e00 P1:H奱` ݲ+ݍj k퀀L뀒L뀠Lj k!L뀹L@-ApM0S- 刱000CS@PX`hpxH |@i0eDl @P t[ K `X0XV `0k@[@MpЍjLL:::A;@LLMcM 0p@-@P `0 0p@ BM 0P/8@-0/S\S10/S\S !g R Q0A/R\R    P.Q Q\Q/Q /\\\ @.T S\\/\Q 0/\\\A  B PR0T 0R/0000"/P@ 0eQ Q\ 0\/S\SL /Q\Q/\\\ 8ccc8@-(@02PPR8cU@-h MB0tT厰/Q\Q 0i 0$ 2## 2/ۍcNMvMp@-@t Mb0vP\k/Q\Q 8F $0, 2## 8@-@ P8D-P@`pP 8@-P@@08N-`@PPp' &S  P  P 0S @ P0@S   @0TSSp@-@`P 0 p@@-@P`\pjP PV z V@-@P@Z@-@P@Rp@-P@`PV@ 'V@ @pN- p@ `P ;5 P   P  PWP``PU@-@p`P 0 p@-P p@-@ P`P T  pp@-@p`P 0 p7@-X 0P@0P  R 0( 0P  R>7(1(s@-P,`@ P 0|'F-@ PpP+0P/S `# / P``  jPp p0/S S / P`` 0ipP0Sp@-@P  p@N-@Z`PBY? `pP+SPE/Q0CJZ0 P `) 0 S 0P/00P W 0 SUPE00 p W00W0S w`w` ``ЍF-P@ P#Tp' `0S`QZ0T  P00P0Spq @- 0P p@-P@ Pp B0p@F-(`Pp P  0P 0S P  BP@ 0Asp@- @P P P  &P` pD-@0t P`P  p v P  P `f`P`UM@-Pp`g@P   p P  P@@<, <4 /D-@P'PpPP`: `PP :` V#3@-@@-@$@-@ @-@ 8@-@ P 8@-@8@-@P88@-@P88@-@P00@8D-P@p(` ( 30   v`p r   iDF-P@`UpZ W 0e0S f  e @-@P`pP $>Pej 8k@-P`"2@pP (PeRM !T40/p@-@ePPP` P $  P PV ppL-`@PLP 0P@ HD pA-P`4p@P aV@ 0AD-`P@P  `P@ #  0 p  0hP@ N- M@p0@P e 0`PP  0  0EPPG uJLPPL 0 0{  pP00 0p m0 0pP 0 p`0  n piW0`0 0PP40D APU  N P Ѝ@-Pp`@P 0r P@   0 @N-@P`P4 0P,p*p Pp @PHP 0P @40    P40p@-@`P@ 0 p@A-`P@PpP e0At@N-P@p`P\9P`*$   $ P 0S`E   P P`5h , |( W$ 0 UT1*  Q  0  @00<20UT`Ѝ p@-@0PP`$C 0"}pP4/0/ p$0`0P/ /MMM<, <4 /@- 0P/@-@ 8@-@P8D-@$`Pp ` * pgp`V$D@-@@-@8@-@P00@8@-@'Q8@-@P L404020088/L-@PP$~PPy`puVP p  @-0 D-`P\@P pkP@ 40 ~8@-PG@PYP40@8N-@ 6`P?+ (Pip  PPPj $ 00 pPg0P: @  U  @P 40  (`ЍD-@PP>PP8 40 p`$ g` "pP p p ^ P0SP  @-@05 P 0R@-00P#  S:7@-0@P0$ ~0QS>p@-`P@P  @e@30P:@p8@-P0@(ܩP P8@-@G a0@-R1@   @\T:  ` p@-0 @`\UP2P5:PPUP@T: p0 B,R/,0@- ,@ D$@@$ R,R \p@-0 0 R , 0P"!C@|`@D `a &`a &`a &`a &TU!p$00S  ,p,@-@-  u8&F-`p<@ " 0  Z Z @D 0U ЍP " 00 0@ as' Dy" o" P@P @@83T (.  ЍF(,ꀟN뀬N뀰N뀵NN-PMpPp@S@@!PU= P8  UP! `T  0! T     `V:`    .`V P 0 D CHۦPpe00WPЍꀽN2N㈨N-@0@M$00(0Pp <0`d` P 嬦00f0Pp Pp [`噦 0 c  fq p PeP @Ѝ##NNN@-\   @ Č  @T @T\: TO+O 0p@-`Q0 p0S@@PPS* Q Q 0@0 `Pppj@-@P P`T0 0p0SQO` P0VH00jD-p `@P0 0SP00P 0```p `0W:0 jF-P@pP ` 0 R  }P0```P `0U:0 jN-M   p8@yJ 0Z" Q``  P 0UP g uU # 5PQ R 0 0廦`l0 ` 00S1 Pq0 lAP U0Pi0iPU/  0 R% PQ R 0 0偦`20 ` 00S P070 20 0S0S & 0R  00! \ P0``0`P0S 0S 0P00PP0 PPЍj0@-M  0@ 09PPP0   0"0 0  000Ѝ0jN-M@0R100MPp$ ( ` ` ,@ C U  @0S90 `0 [P0  0Z `0 `0 0#R00S$ 01g 0W`  ^S \S0S 0Y $1$,@_ 0T @ T*m 0 4( PU  $ 0=\"ጧ(0PP PP PP \PQPp0S00K$POjN-PP M@`p2   P1   x  @00S 0S ` @ ` @ P P ;[@0 S S` #S `0SD SA0`S=S S S R S R =S00 `00%000 `\R R`  0 R R00@P0 0[ <季 ` 0V*0S ߤ ЍjON-\ PU d @0p` PUVX V `Q@`V@pbqAPPPaPPP S:P@LS"*`↡ 剡牑q  Z W a ! 0S :@U\01 P3QP5P5@D2 P5@"'A  %*T0Q5 5Ѝ0/0 0 0 X0\0P T0/F-@Pp`0PXP\0`0\U@T:T1 aPy Pl`y ` @ApG000 0Z@:PpU @ A0  b V A0 b !APd  lF9P50@-0 @ PPQ*T*0 S:00N-pP0 00bG p@q0P6`V0:Y ``d Z** `Y `d`d`p  P @D l  P` aV:`d`Z  V R0 pKpG[`Ѝp@-P@`P hpO0@-P0 @X \@@@DQ@@Q@3T0 S://@-P@p`lUQ`g`s@-@P `PT  TT @0S@`V % LX%|N-RQP@ 0`7ApppW: e0g  @ 0P    xs @ pPP  Ap4 jr88 ( Q  R P Pa< `岠Z`,`Ŋ `Ӻ,,`af$ ff(@$D2f 0,<0岠0(@0((0D \D` 0P`@ `  V@ PF TX 0`@ T4  P Q PaeAh `lVP` \: `e ` 8`  Z``V:`$Q` q `` `fFa`tQ 4  Pp  @2  a岐DP@   < @`PR ЍRꀯP/0S  4   S  ( , 0 8 < lPL//Rp@-@P3 1R<S00-P- 0 0S(0 $0 S0 $0 0(3/P U0Pe0E20/U0P0ES$0( 3/000$P40p@pppNꀔN0%0 @-@P  R $0S 4Q ( 3/($0 3/D-RX@p h%X 0P2U\EPE`VlF`FQ RN0pGP`W`2U\ETPEV}GV=0pG00 P `P `P `P `P `P `P `P `P `P `P `P `P `P `P @`TP``PP`D W0W 1ERpGPR`PR`P R`P R`P R`P R`P R`PR`PR`PR`PR`PR`PR`PR`PR`P`W  @0 0CP`S(}Py`N-PHM< @T   Y0S00 S 0 8`q R%&b$ PPE>f  0 0  P4 `Wc  pGePU0S` >F =C 0S&$    D`&dE`D 0P0` 0W<  pGePU 0S`0  &4D`E0&8&lF0G`D 0P0` 0W  pGePU 0S  &$ 0  D`&dE`D n0P0`0+ W pGePU @`R`<` D`&dE`D M` 0S P000 ) @ W010!S Q P  b\ b 0%0    0 0@ pc0c@0@0S0@000 +$ W 0 Q0 P @ R7 2@ 5\S:    00\pc  0S 0@000 *$ Wt 0 Q0 $P @ (R7 2@ 5\S:    00\pc Q 0S$ 00   0WE pGePU1V9*P` 0S$ ,  0  4W(  pGePU&,&4,<l040`40 00P 0S  p8`l0L00T0T00/>0l0p P5. 0h 0d `00$0uT03L0C(0 (00SW$ 0pGePPW pGePU:6cPc0hLPW pGePU:Q6cPc/  06 &aPE$PW pGePU:6c  a W pGePU:6c  ccP0$ Q3000 h R7hh$Q:0S S>l0L0 0T0/΄T0l$` $0p Pd3l0`P00X0X08$0d P$3003W[ p 8`E0C0 MH0$@lk$ . H UeUUV.V]KVjV뀈VkV'$ꀹVV ]$p1s@-Pd!0@0CSI긚P|ꀠPPꀸ<0P TPaLIP P 0 P@d;008#,#48#80@<0<0l"@ <0<0L@@0@,|kVeW뀬NVVW뀎p@-T@TP0 0S0<<zp@"0l(0Spp@~e/WWDWA-`2@ PQ R 0V R RUp0PE#$48#8Sx S S42 `@ ` r P `@V:A?U0#DDH$H1T@  @ ! ( D Q#lQ`H1 RR R  Q `  =`0 S@0 000 0C## PE `Z0 R`50U(ʇ 0#$$("(ʇ0#$48#80CSP嶇 D0 <寇AaeGW뀊OWSW]W뀙W뀱W4kWs@-thzP  \2X_zPHB  Q*,呇2/ b2PB0U02! !4!0^ Pq:0PP P- 00XA`W\H1X RP0S D10S !  0R A A*;Q 5  0*P|@0000`E00`=Y` |h<0Ѝp@WeWW뀔lkX'X뀨VXSX뀌kkX뀌X뀲X뀍]XXꀈꀎ@-YY@P>xY@P>hچYYnY>Y>iY>fY@P`Y@X@-6VY>SYY>@Y@-:] 0  -4M(Z*( +)0,- yPx4ЍY @-00 |0R KY,YP`0#( (,##  ((,(0 0! !脬0D0J0J@-DD WY 88SY400 ,0R  @HYJ 1Jꀄ`Dh@-d  HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO>"R 5 C2 PhX dH2 Phb 7 ?ñ2 ГhTdY * Zh F2@-* Zh F2* Zh F200@1JPHpHHHH2X }, }  k }  } } ^ ~" { {}   k }  }  k }  }@   @ (        P 2 @JJJJ0J8J J8x0J`JhJpJxJJ@x0J(J0J8J0x0JPJ`JJJJJJJJJDJJJEJJJJJ J J(J DJ(J J(J@J8JhJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJAJ@]Y$Iv7_outer_cache_inval_range $H !(08@HPX`gnu|ꀃꀊꀑꀘꀟꀧꀮꀶꀾ*d!d*耣$do_env_import%Kdo_env_export W  $+ 5< C U-Boot 2011.12 (Apr 02 2012 - 18:13:04)bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000set_default_envenv_importfdt_fixup_memory_banksethaddr__of_translate_addressW3b3h3n3u3|3뀀33뀏33A뀍c2p2v2|2뀀22뀄22뀓2 2뀝22뀭22뀽22222222222 o3 33 3 3-363?3E3K3Q3뀍 011*131<1D1$U1b1p1 1뀘1 1뀵1111 11)2#2*252 H2Q2뀍0뀝00뀰0000000뀍  ( w 9909@9J9V9`9뀀9L 뀀 #(-27<FP'@Bmmc_set_iosmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupH\p$$7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-EPTGMK(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     QQ뀍QQQRR#R뀍@BDFHJLN"$&(*,.0@BDFJL^ZPRTVXZ \ ^ `b dfhjlnp r tvxz|~         2468: <>HJLNPRTVXZ\^`bdfhjlnprtvx z | ~  @BDFHNPRTVX\`bdfhjZ#Y0Jusbd_rcv_completeusbd_alloc_urbusbd_device_event_irqN/A*EHCI Host Controlleru-bootext2fs_devreadeth_get_dev_by_nameERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s SDRAM: identified size not same as expected size identified: %x expected: %x I2C: %s baudrateMMC: ipaddrloadaddrbootfileNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: Starting kernel ... bootargsmachidUsing machid 0x%x from environment WARNING: Caches not enabled ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... (not set)%-12s= 0x%08lX arch_numberboot_paramsDRAM bank-> start-> size%-12s= %s ip_addr = %pI4 baudrate = %d bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsresetPerform RESET of the CPUbootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order %lxinitrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartno%lXfilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSboot default, i.e., run 'bootcmd'bootdiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)loadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationecho args to console[args..] - echo args to console; \c suppresses newlineexitexit script** No boot file defined ** ** Bad partition %d ** Loading file "%s" from %s device %d:%d (%.32s) Loading file "%s" from %s device %d ** Bad partition - %s %d:%d ** ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X ** Block device %s %d not supported ** Invalid boot device, use `dev[:part]' ** ** Error ext2fs_ls() ** ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemusage: fatinfo ** Invalid boot device ** ** Unable to use %s %d:%d for fatinfo ** usage: fatls [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected usage: fatload [bytes] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read fatloadload binary file from a dos filesystem [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystemfatlsfatinfoprint information about filesystem - print information about filesystem from 'dev' on 'interface'The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "<0x%x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandsaddr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pinhelpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'?alias for 'help'Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error reading the chip. Valid chip addresses: %02X%04x: %02x%08lx: Error reading the chip, %02lx %04lx %08lx ? Error writing the chip. Current bus is %d Setting bus to %d Failure changing bus number (%d) CRC32 for %08lx ... %08lx ==> i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32devloopmmmwnmprobereadUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'loadbload binary file over serial line (kermit mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (ymodem mode)CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same %04xmemory display[.b, .w, .l] address [# of objects]memory modify (auto-incrementing address)[.b, .w, .l] addressmemory modify (constant address)memory write (fill)[.b, .w, .l] address value [count]memory copy[.b, .w, .l] source target countcmpmemory compare[.b, .w, .l] addr1 addr2 countchecksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]baseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'infinite loop on address range[.b, .w, .l] address number_of_objectsmtestsimple RAM read/write test[start [end [pattern [iterations]]]]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)ERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! list#part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device writeerase MMC %s: dev # %d, block # %d, count %d ... %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcinfodisplay MMC info - device number of the device to dislay info of mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesping failed; host %s is not alive host %s is alive gatewayipnetmaskhostnamerootpathserveripdnsipdomainbootpboot image via network using BOOTP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocoldhcpboot image via network using DHCP/TFTP protocolpingsend ICMP ECHO_REQUEST to network hostpingAddressNot implemented yet ## Warning: defaulting to text format ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed -f## Resetting to default environment %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name"%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps andpress ENTER ... ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: environment handling commandsdefault -f - reset default environment env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env set [-f] name [arg ...] editenvedit environment variablename - edit environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'defaultdeleteeditexportimportprintLabel: %s kernel: %s append: %s initrd: %s missing environment variable: %s Expected string literal: %.*s Expected string: %.*s Expected unsigned integer: %s tftpbootfile_path too small. (%d < %d) Base path too long (%s%s) Retrieving file: %s %ppxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sMaximum nesting (%d) exceeded Expected include path: %.*s Couldn't retrieve %s Ignoring malformed menu command: %.*s Expected label name: %.*s Ignoring unknown command: %.*s localcmdrunning: %s No kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel fdt_addrpxefile_addr_rInvalid pxefile address: %s Error parsing config file Missing default: %s pxeuuidusbethaddroutbuf is too small (%d < %d) 01-%08XConfig file found Config file not found pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r getmenutitlepromptlabelkernellocalbootappendinitrdincludeBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present-o-a-z-nminimal test like /bin/sh[args..]falsedo nothing, unsuccessfullytruedo nothing, successfullybootdevice ** No boot device ** ** Device %d not available storage device not initialized. Use usb scan Rawerror reading partinfo...try to boot raw PPCBoot ** Invalid partition type "%.32s" (expect "U-Boot") Loading from USB device %d, partition %d: Name: %.32s Type: %.32s ** Bad Header Checksum ** ** Unknown image type ** Read error on %d:%d See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyString: "%s"%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Self Powered Bus Powered Remote Wakeup Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - InOut - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dms480 Mb/s1.5 Mb/s12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. tree Device Tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device usbUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'usbbootboot from USB deviceloadAddr dev:part %s gcc-4.5 (Ubuntu/Linaro 4.5.3-12ubuntu1) 4.5.3 GNU ld (GNU Binutils for Ubuntu) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded %8lxfileaddrimxtractextract a part of a multi-imageaddr part [dest] - extract from legacy image at and copy to %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Panda # In: No input devices available! Out: No output devices available! Err: No error devices available! serial*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaystatusdisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. syntax error ** Abort ERROR : memory not allocated *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variableIFS \$'";&|#Unknown command '%s' - try 'help' or use 'run' command Unknown command '%s' - try 'help' 'bootd' recursion detected ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreeKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32Invalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-boot%.*sHit any key to stop autoboot: %2d %2d prebootbootdelay%*s ** Too many args (max. %d) ** ## Command too long! Enter choice: %s not found ^C ERROR: NOT USB_CONFIG_DESC %x unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dERROR, too many USB Devices, max=%d ERROR: USB_MAX_HUB (%d) reached Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) failed to set default configuration len %d, status %lX usb_new_device:cannot locate device's port. cannot reset port %i!? No USB Device found %d USB Device(s) found USB: scanning bus for devices... Error, couldn't init Lowlevel part Device NOT ready Request Sense returned %02X %02X %02X No storage devices, perhaps not 'usb start'ed..? Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry READ_CAP ERROR scanning bus for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIDOC device %d -- Partition Type: %s DOS## Unknown partition table ** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type timed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range error waiting for i2c address ACK (status=0x%x) i2c bus not ready for transmit (status=0x%x) i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%cCard did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCBattery Current: %d mA Failed to convert battery voltage Failed to read battery voltage Battery Voltage: %d mV Failed to enable GPADC Main battery voltage too low! 000000000000genericserial#Warning: serial number %s is too long (%d > %lu) usbttycdc_acmDas U-BootU-Boot 2011.12TTY via USBBulk Data InterfaceControl Interface scanning bus for ethernet devices... usbethmax USB Ethernet Device reached: %d stopping %d Ethernet Device(s) found Error: SMSC95xx: No MAC address set - set usbethaddr Waiting for Ethernet connection... done. unable to connect. %s%dsmsERROR: %s(), %d: RECV_ERROR actual: %d buffer: %d urb_bad: %d ERROR: %s(), %d: no rcv_urb! ERROR: %s(), %d: no endpoint! ERROR: %s(), %d: F A T A L: malloc(%zu) FAILED!!!! udu %x ERROR: %s(), %d: (%p,%d) NULL device or device->bus DEVICE_UNKNOWNDEVICE_INITDEVICE_CREATEDEVICE_HUB_CONFIGUREDDEVICE_RESETDEVICE_ADDRESS_ASSIGNEDDEVICE_CONFIGUREDDEVICE_SET_INTERFACEDEVICE_SET_FEATUREDEVICE_CLEAR_FEATUREDEVICE_DE_CONFIGUREDDEVICE_BUS_INACTIVEDEVICE_BUS_ACTIVITYDEVICE_POWER_INTERRUPTIONDEVICE_HUB_RESETDEVICE_DESTROYDEVICE_FUNCTION_PRIVATESTATE_INITSTATE_CREATEDSTATE_ATTACHEDSTATE_POWEREDSTATE_DEFAULTSTATE_ADDRESSEDSTATE_CONFIGUREDSTATE_UNKNOWNGET STATUSCLEAR FEATURERESERVEDSET FEATURESET ADDRESSGET DESCRIPTORSET DESCRIPTORGET CONFIGURATIONSET CONFIGURATIONGET INTERFACESET INTERFACESYNC FRAMEDEVICECONFIGSTRINGENDPOINTDEVICE QUALIFIEROTHER SPEEDINTERFACE POWERUSBD_OPENINGUSBD_OKUSBD_SUSPENDEDUSBD_CLOSINGInvalid string index %d USB_DESCRIPTOR_TYPE_INTERFACE - error not implemented USB_DESCRIPTOR_TYPE_ENDPOINT - error not implemented USB_DESCRIPTOR_TYPE_HID - error not implemented USB_DESCRIPTOR_TYPE_REPORT - error not implemented get config %d DEVICE_SET_INTERFACE.. event? EHCI fail timeout STD_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STD_ASS reset The request port(%d) is not configured port(%d) reset error EHCI fail to reset Register %x NbrPorts %d USB EHCI %x.%02x OMAP4 EHCI error: timeout resetting TLL OMAP4 EHCI error: timeout resetting phy OMAP4 EHCI error: reset TLL timeout ERROR : Unsupport USB mode Check that mini-B USB cable is attached to the device ** ext2fs read block (indir 1) malloc failed. ** ** ext2fs read block (indir 1) failed. ** ** ext2fs read block (indir 2 1) malloc failed. ** ** ext2fs read block (indir 2 1) failed. ** ** ext2fs read block (indir 2 2) malloc failed. ** ** ext2fs read block (indir 2 2) failed. ** ** ext2fs doesn't support tripple indirect blocks. **

< ? > %10d %s ** Can not find directory. ** Failed to mount ext2 filesystem... ** %s read outside partition sector %d ** %s Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block ** %s read error - last part FAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld(null)%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d Invalid pxeuuid: %s U-boot.armv7.omap4_pandaDHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddrBUG: failure at %s:%d/%s()! eth.cBUG!eth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! Warning: failed to set MAC address ethrotateunknownautoloadnetretryoncebad length %d < %d len bad %d < %d checksum bad ICMP Host Redirect to %pI4 ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) octetblksize%c%d%cFile too largeFile has bad magic %s; starting again Retry count exceededT blksize TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4from; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *Could not request gpio %d %02X:%02X:%02X:%02X:%02X:%02XBoard: OMAP4 Panda raise: Signal # %d caught  $Dd `耠逴@耜 p T 뀍"뀍)뀍/뀍1뀍9 뀍=@뀍뀍/ DZ耍뀍Y耍뀍X耍뀍 T耍뀍W耍뀍W耍뀍 W耍뀍S耍뀍S耍뀍R耍뀍R耍뀍@耍뀍}耍뀍Љ耍뀍t耍뀍}耍뀍 Ѐ耍뀍h %逍뀍Q 耍뀍耍뀍38耍뀍T]T]\]\]d]d]l]l]t]t]|]|]뀄]뀄]뀌]뀌]뀔]뀔]뀜]뀜]뀤]뀤]뀬]뀬]뀴]뀴]뀼]뀼]]]]]]]]]]]]]]]]]^^ ^ ^^^^^$^$^,^,^4^4^<^<^D^D^L^L^T^T^\^\^d^d^l^l^t^t^|^|^뀄^뀄^뀌^뀌^뀔^뀔^뀜^뀜^뀤^뀤^뀬^뀬^뀴^뀴^뀼^뀼^^^^^^^^^^^^^^^^^__ _ _____$_$_,_,_4_4_<_<_D_D_L_L_T_T_\_\_d_d_l_l_t_t_|_|_뀄_뀄_뀌_뀌_뀔_뀔_뀜_뀜_뀤_뀤_뀬_뀬_뀴_뀴_뀼_뀼_________________`` ` `````$`$`,`,`4`4`<`<`D`D`L`L`T`T`\`\`d`d`l`l`t`t`|`|`뀄`뀄`뀌`뀌`뀔`뀔`뀜`뀜`뀤`뀤`뀬`뀬`뀴`뀴`뀼`뀼`````````````````aa a aaaaa$a$a,a,a4a4aqꀗ='J/DXP` Qeꀅ QꀍH$RL[N]Tya;,fAq,fqr耽r tr/lpPd n耇뀓n耸j<,kA] mlk3Xs^| Dx耭 뀾 t  ^ }d 뀕 } 뀕 | 뀕 ( y- T   }u뀓Љx< ЀEax xh %l뀔xjXn뀖0. Xr{ t老 |耡  K"S"h"0RȰ"뀍 $$2$* ** $(,048TH   t x      $ D  P0$,DHP,0LTX\t(\4<X\      !\!####$%%%%%&''' ''''' 'D'h'''''(H(X)\)`)d)h)l)p)t)x)|))))))))* *`**+++,,,,,,,, -......D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2224444444445|77777777788 888888899994<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<======l>p>t>x>l?p?t?x?|??@@@@@@@AAABBB BCCCCCCCCCCCCCCLIPITIXI\I`IdIhIlIOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPP PPPPP P$P(P,P0P4P8Ph>l>p>LAPATAXA\A`ALBDDDDDEHELEPETE$HJJLLMMMMXN`NPQQpStS|UUWWWWWWWYYYY[[[[[[[[[D\^^^^^aa atcccccTdtdxdde eeeee e$e(eeeeeeeeefffffffffffffffffhglgpgtgxg|ggggggghhh hhhhhiiiiiiiixj|jjjjjjjllllllll4mmm@pADEpGMM8NNSTTlYpYZZ__ _____ _$_(_,_0_4_8_<_@_D_H_L_P_T_X_\_`_d_h_l_p_t_$o(o,o0o4o8o 0KSږ S㇀Gӌ0Sf 0 Td $ 0Td $0S00 T tt00,,! 8 l81@(P8 0T 0T 0T 0T 0T 0T $ <0 <s0TFf@0 0)+0F<F4F)@B Q-L@ Q Q 0@`x0 RP hp0S<⥟PT0002/`f p-L0` 00 R$ژ0SP00S PU@ 0@: 0:8P <lTjl^pPe@R'0p0a 0U U00s0#!13 300s0#pPp// 0-Ql2x"@P@L p,l”x"p *0:\0///0 =2S 00/0 &//6D0/ p-PL$`@640Fpf -`LQPp 4@T0000 L0 p-@L8`P6S\0&\0`0V`@pf/( D0R <804 S(  6SL0L06/ *YSUBDEERFD -L0H  0S0S R600  0 0h D -L0 010,D -L@]P0h` p-P0 LR0`p0Sp @R600  @h 00@ph6c -L@pT`= 0S: `PU% 0 0l0t!c\0\0\0S `Pd@TQ d@T Q Md@TQ E000x&\01x0 1x0b\0SwTD -P@L 0p<00C<0 R` 0S R600  0 0f D -@T`Lp\ 0b\@0P0 ;0Cb 80 0 , $(\LpC 0b\QP 0hb  p-PT`@L\0bD0 D0T\0HPbD@D0 SH@P000\0phub p-L `

0& 0\0 00 8R804PE 4 B[TP80180 X,\ , D<4 0Q_`px(K ` X 0@0<904 D04_ ,p DDDD -LM`p$0 S0S 0S @Q60 00@50 @000_$K&8P@ P 0@O00^ 0(K,K0P@P@P@0,( S  @儠(p0S <2S 004Yp@ sf4DXj0 -LMP@,080 032 qpP l`Px $800R@ 倠 40 ,` c80<, 8 0^108 <0<D4 , 0 0,04,8t^!1Z000㰅 4<D4 c^0`Sp= H`40S@@60&0P0(K<2Sp@t a,K0K  0 P;P  A >X\084 004`00<D ^sfXj0\D 0-LMPFT D06D .0H0D0K0 0K^P à ,0 0 P K\ ^TX&@D 6 -LMP p@ `=2S ` R0 6SP`3,0(KP `2`,0 Q Q Q,  & , P Z4  $`0,0 4^= 8 ~8P0 ` 04, 0P4~ 0\4894 ^0010; 8;!  00 0T\ϠD 0S]004 R񟗞K0J0K0\K00 l!, 00Cs0SN 0$0`<080400S `0F{ 80]`P0@,0P0f(`0v,0`@ 0PH`S|0p@,0`P0dD 0 4,FFDD FDFfFFpD -QLP@0 D6 p`@V`!V@l•x"1@  p,/.00b* T0!,!@V 0 0 i W 0-@PL l2x"p ,?p0=20P 6P0&0l”x"0 p\X2\"0 X2\" #+$X2U0CX2 l”x"006 p\ l0`X2 0CX2="0 ⭊ PmPPPD DD -Llx"@p ,6h -@PL =2S <2S l2x"p ,?0hrl”x"p \ 00-Llpx"@\PdU' A_l2x"p ,P  l”px"0\P,_l2px",P0dUv 0q<D(D 0p-LP`U0@PUJ_=2Sl”x"p ,6?0  0SpPUZ00phV -LMD  0 S@ =2S D@0"8! B00CR%(KH0@20S @D0  0r03R0SR0 0 R 00  R00 00 8@oP8 < ՍP@< , 4 @Uph0d04 < 4@0D40 ʠ040 , ,ʠ0:#:0d 0>0.S 0!C60P 4804 QO0 pWp@ 0\* D0 S,0 0@ `p> 0W$0@ D0$ P 0,,  08 Q4 0$0D( 0 $::5% 0 (0 ,0  , @ nRF1910d0D <0Sp8c @D 2P0C"  00C3 R PS0Q80S*<Q@<R\P @ @2 0S00@0h01@&0\0&\0xS`0`0@ d2Pc 80TDD <080<0<00圐@@60&@ Ƃ$@@<2S @l2x"p ,PDDfDD -L@TPh -LMP0`="R @;H0N0 0p 08(K,K? P6@P+0,( S 3 @ܠ(O0S <2S 00& 6@P@<2S !$K@VTp@+0 夕{ mfXj0HD$D -L@SP0h -LMP0`="R @;H0N0 0p 08(K,K? P@P+0,( S 3 @ܠ(0S <2S 00& 6@P@<2S $K@Sp@ἔ0 ᩓ5 fXj0DtD -L@+SP0h 0-@0L P=2S 0H080P0<2S0o0D -L@SP0h p-PQL`@pU 000ESQp  0000ASQ0p l*-L0M0,0  p=2S 8H04 32/.0T10 D@0Dd ,0- $R9Ro 49R Kڣ R 9R 09R00Y@1SP, 0R9(KP9R R R RTӼF 0A?CR< "9R, RU0008R 0 :PTLǟ"U@1@# 2 C4 0(C@;T`K( 6 R0Kl—p, 007 0P0KQKO KP 0  @0P0 0s0S@1@!  TKVڸ6VUl—x"1@  p,5   A4XKW0K6 S L4XK U0KVK R <5R 0TFǕ 05R 0Rr  -LM=BT (Km. 0 6X0 , l2pBxR` \p, @07/x 0l ?0u@P Z,@ 0W4(Ko,00(KoWfFD$D -Lp` 0P=2Sj<0 XQ{0 X00@0!90褑000@pTI\T@ 0U\@00 ;0CUPU D<@ 0UD@00 ;0CU4PU Y@FP I 0 @00Ol0\@PpĐTIO00ԃ lDfDDD 0S0 0eca p-L@(`PUpf-0 =\ E 0 d`0h lTJj0  0-@LP\T0;UHD0 D0D0 SHH 0\T-U0h -L00`@HpP0 ?00i&f -LFT L0S6m>6`0( R P县 -0040 (0e !S@PEERFtDYSUB 0A-LSho0ll04n0l0ll0tl0i莗㌗`<20<2l2p ,2lB˜x",0 0p\l˜x"P0 0p\6S`@6Sl2x"Q@  p,@=Sl˜x"@0@  p\6`SVw 2W6Sq@6Sll2x"Q@  p,@=Sl˜x"@0@  p\<2&0R<2`@6Sl2x"Q@  p,$2@0Sl˜x"0@  p\6Sl2px",l˜px"@00\dTd dWl2x"p ,@ <20C<2P `0=2l2pBxR` \p, @ 08107/l˜x"p@ 0\dT& *Wl2x"p ,@ l˜x"6p \2W<20C<2i茖l˜p 0\[ W DD 0-@LPP 7PPnKV0 0-L=2PS0X20QX2 @~T|2 6S na6SX20CX200 6فX20CX20 -l2Lp$l™p x,l2p ,b0`2 HPZl2px", Ps0t0r0s0<2奯 * 0SP@"0R02 2 !Ql™x",0 0p\e ZQP  t3j. &00D 70 P @4 6@T ?P Rl™p 0\劽 ;2<2@LATL`@D` @@@\RP@` TD 0*p :0P!=C 0D L`\TD ;0CRT"P@Ud:@TP!0 R @P P :0@00 ?0C 000LT\H@D@D 0Rl™Fx"P00p \ n富m4Sl2pBxR` \p, 08107/l™x"0@ p\dZk Ul2x"p , l™x"6 p\Kt# "P001"PtFD 90D/// -ML0BT1\z0 )-ML05T1\z0 e-L`P p<(00p04p4S80,0d080 Ψ00 Ȩ, 0@< 07wߘ&88&#Č, @   Č 0i{x FDDWEV\z0 -L Ƞ Ƞ`,DP$ ቙pP@ 1UI t1U) *@kT1U* L1Ue/@,10S @ 0 ኝ@P @P0U$ y02 0 @  eO0@ be/}Q 0U &$ 40( @ rdAhdsd edAk~gd\z0 -L M|H0#88#!P( > (  哘p* (H0P 0(20 0 , y 00P`|4Q!@04@aT@!0 '  L#@00dD0P@ '($Kk输4 @+0804 DDP@ $KL  x F| Ff 8 8-#TLH%pᨘ`P0@ǜ ም῜ና 8 8-#L@(ዘPPp 0`ᬜpP q0S  0㌝pᗜ0 pP -@L0⫝t|00L00 -p`0L NP$  N@P P00 `(Pp 0ʺP,\0@P  0@ i ˖| DlDD -Lڻ8D -LԻ8D -Lλ`D 0 0 / ˖,і$і(і -`pL0Spdd0@P?U L 00C0,іf(і$˖0  // P00/ ˖ 0-LMDP0@K00 P  0R0K0– ˖D?CP/კ 0-L1Ps0000@<0 00P0 f0і 0-@LPPD R00 0S00  0f0і 0 / $ \/,і A-L0 R ־,і0і -LMpP0Q@ 0  0RK8`K0HD ~P3P k# m–$˖DT?C -Lp@W P`?V L @@W00 h}d坾X0 R Lȹ@ ,0?S?0C00}剾,і$і$˖0і ˖D(і 0-LM@@ ( $K,0  媥,K 0RK–`?C 0-LM@@ ( $K,0  呥,K 0RK–x?C Q#-QLMK 0K 0SB$  p-LMQ@1@#PK` jTCJ |4QZT00V0Sp 10C p 00/ 80 P/0S/0S/P/ @ P P 0S00` DP -L@T00 ((0 R0@0H D p-L`P@P @ph8P , P @``00p ph)D Dr -L\@0S P@T<0 , @Th D(Dk3pED -@L 6hj 0-L@P0S040@T  $@T000 p-L`zPP @0 0` @0#pøD 0-LTP0S0H0@T  #@T000 0@-\P@ 0R R R  0R RT@@\0@0@0 / -LMQk30Q jh`!D4D p-L`Qp 0Rp 0 S0\ P \ 0S@@PP w  \ phn `a0 -L X -LH -L H I -L -LI  -L -L P -LhMa@K0 0 Plw 0RLK@p P% @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK7/@0@ <K зlPKP@@ W P ÷: tP @J P  TH崷+ Tʻ, 娷 –PDDD`D?CtD P-L 嗷 0PLDk3 k3Q0 hP k3 Wk3j fQk3 fQk3 fQWk3 fQ0ut,k34 fQ0j0k34 fQDk3 0-L 40fRPP@T0 @T00k3 fQk3k3GJk3 fQk3 -LQ@  QD -LM`r`0@ 0 P# PP P 4s 0RpKTH PK GP7 P1  @T; t P W !0@ 0K\ 0K0   h1 R`1T1\!X!@10!0嵶, $屶( @ 00@@4 P  @KKTP@0 0 00@ " P  00 0sx忋 P hK1PLwyKx –Dd DD?CDD 0-L0M@0 0   0@^S已P2p/-t M l媲h0`*`l0埲P8և–tDpEDDDCDlDDDk3HD?C 0-L0P@St  0hx  -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P Do P XdDD -L@P P hP  ]4fP 00c0ZD p-LM`KP Kp @@0 t PPP0@S00S@ P# K^P T 0S T U   T$T  0 4T  '00DD p-LM`KPKp10@S@ PK T00  00b0 0 !0@S@P00D p-LM`KPKp0@S@ PK RT002320 0 0@S@ P4 R$ 00DD 00Cs0/ -`@LpP 0 @r0 SR 0ӧ P R @ 0a0CSa0Q-S   RD@T 0a@_Sp Th ?C?CDD  -L$M0sS `PLKV=  G a0@S( K$ \R0S  0S0SQ+0@a$0Lv U TA0 001 ɰ(KYJ 1 廰` t!0S PP\aBTU P0K0@ 8 r@600cP C 0 ,,U`%0S@  @ 0a0Cs0S0@SV P000 R  a0B(Ks0S +00B R0:S 0:S_0PE$0L00C Y][ꬨD0 0-@QLP0H @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0TX p-L8@8`8P0c0`000pTX\ 0-@QLP0Ha @TZ0 0@-L@~S~ȭ0 080@0l0080ܮ08000800а080(080080,0080080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080808080ܮ0xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q*s 0004$0Qd帄0\ᔔ $0ST t吤T000pğ 0 SX400S0  00  @04#0S*cC3Q`3 be#C00 Sn \\ L0C  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p000 0 1R R1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @= XPT\\d`X D -LP@XpT`T0T @@D@PPP P  00`\XPT0 00/บܸ`4 P00/ 0 Q#45/h`ܸ0/h0/l -L 000hl -Lt T8 !0@]S@00@ SE0P03Pc0p0 QR`TWpD@T7pD0u" @/TA DaDU9070T0pDU A D00DR Sa0D_TS(oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@0^([0hSp P@O\P_P 0?SDꔸ0000000000000000000000000000000000,0$000 00000000ܸ00000000000000000t0>P+@堬 <P*@.P@  X Ddܸ0 D< DP D P 00/l x-L$@0P 0@0บ`ܸ0/p p-LMPP`V Dph@8@0 ,$0`p@і` D Dj3E D S-LM@ 00S S h0Pd  0^0?l 0啫000 P  0 P  D D D D D D0 0 `R/ppE -L℠儀p`Wt0@VW@@ <T0g0C `pW` /pxp|1 -L `Rڬq B0R !0F]S' VU V2 VL VhdQ-@ @TcP9 qP7 PP@0P0C0APU @0 0 S 000P@00CR t 0 00 0P0L 000$40 0 t D Dpx| H-L4M<08S , 2PLKHpKPKTK ` 0L @@ , L %TQ 0P PL0P P Rd P0Sl0HL, 0R (K0@,$3CB–!D !DpE $!D@C@0r  4 40pQ 0/`ldh400 ,0@pQ0 /hld<08 40pQ@ 0/hld\ cR] B$0 0   0 0/hd -L4@P 00@P00 0- H@LP Q 2l 6S Q X0X 0S 2H 8S `T $000 0S/00h -Lp@0HPSS S 0S i `000 Q 2| 6S Q v0000SXP 0  iOiihd -PL`ZHp~@P7 00CS0 X@]@0S0C0S# S6 SF 0S 00G 0 0 )4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8婩,奩 0Q/ 2 8S* 0 RT T U 0Q 2 8S0偩00 CR@@DxTX`r U\ 000D 00CS0y h`l(!DpEd,!D\D -L\ t$0 -L0St -L\  t 0-L|@xp`P M0 ,0 \ ,0K ,0SP1@51@T00 P(Kp -L\t -@PLMP`@ Tp 0KPV 000)V 00p x00-LM R0K L@PD0T 0S@ zP UP 0 -LM@K< 0S0B :00A0 R 0 EіDі -LM \  t -LM@  0 0p -L\ t0 -  p 0 -L0St @1-L`M4P P( `pl KtKx KJtP 0l R*x0S@ hK0@@6/( 0R!$K6/l R W 0pK| KP p| L6/@hK0@@ 6/F}–D@!D$!D@C p-L@P`ዓPp0Spၓp3p -L `RP; R :R0p@0E2S eP @T:00E.` RZ p|0"P@0Sp rP W@PT:00E0PpL!Dp -LM@ 0P  K -LMP R@ ` R :R0p@0F2S P$ @T:00FP RZ `0P , 0"@P0`Sh \\0 KV@P(KT:00F`0 , L!Dh!D0 -L\p`@2 PR ’P @T h+0 |!D p-P\`L@P 2 R 0 @P`p p!D -L`pPU0FS poВ@0@SS ΒP 0@S o٦!D!D 0 -L@ h茦TT l0\ `pPb`< @0eP\0(0hrpd)FHD!Dt!D P0-LKQAM0!0P 0Q#0S厦H0@0m0 R0 R +P|zh(00K0lpdm0S P D0A8_\! d("DE`!4"D"D"D"Dk3EpE -L0S 3/0 -L\  0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P 8AP4P`0``, 0R(KP p  00@1Qp 8AP4P`0`s–0@CG-MQ= 0p`0GPz @jzf. 3*fχ*1 ʠu4# Q!ʠA0# 0#0#!0#0#\W!!"0 `V!0p0ЍĚD@C//1s s0<0/ 0<0/t/@-;@ 0$@/@-:@ 0$@/P/კ$0 -LqhnCCĚ, -LMп00p`̠(00 @\(0,@堀0,0 ( @噿,KX\尿 P@P\0 0S05<0% 0%\偿$Km`H`pl Ě P-LMp"0Ÿ @40 , :BU 0 0c bo"oFS0c aR bV00S0 "Q08 C4C2 C10Y_P 0   0 0bC2S0c0SX `0!PU[B"UaY UPV 4, : "1Ax1  0<0 8@ }b  0@p  CtF`a0DĚ00,H0#D -LtQ@pᆽ0SI \!0Z0j005@*Z@ `.44 ;0,( 㺆?V0 0pS PV@1@!c z` ᥆0`d0dS0 V0  `@0  o ,<44,V 10DH` -LlMd@p0T$0 $ 0RL K  a. TP`0Q$  Q@1J#U 0K 7 L@P U㞅0[ L@PQU@ K@㈅qL@KPK(D,0I,K(uPo–d@C <p-L4AM⻼0S: !0S0C01 a0S ;0,( ?0@ aK⹾P` 0@ LT fp,<44, 10DH` P0-PL0ed@T^0@-pPh1U``A`T1U!2``"1  1A3`Q#20@! 0Q@D@ ?2c10!0U%320!0U Pڄ 0P`   B @P21C0#!B <0P`mQn@C -L0MPKP@p80 ("0l"0`᱿2ŸP /A!b10bc@!<2n10!0\#3n20!0\ 1STt!<2n10!0\J3n20!0\B ,1`c 1ST!<2n10!0\/3n20!0\' P0S `c0 Sr0 `4p 2Cca0/"b 31Cc K$00L0 @CQ$IQmnųL0-\<< 0S 0R 1 P  Ě P0R 0D 4S1(S0S /2 S//ELF0P/000/E-P`0f 0@0 @  f0`p 0 -L@P 0`pTCP0 00KCP 0hCC @1-LMpK0@(1pP@!, @6ᑄ00B`@ dW, K ᠖P , 0R'(KD| K0x t |@ PIK }Pd| K0|@ x t Pp P000 m–$D$D@C -LMQ8p0|,0   PK|Ah $@dp0h 0  1LK|0 !x 00 t 0 0p 1 l 1 0Sh0 00 h @ 0d 0` 0\ 0 X 0T 0P  h  K1 P0`P , 0Rn(K81 @ P0K0 =10 @ Q0`K PK` ` ؀ Ȁ 0 P `P0S` 8!00 K 0 WB`P000 NB`P 0!  0CB`P 8! 0100 嘀K  P`P@0 0TP T   P0P@T0P`l–$D@C `#-LdM Pd0K, d yPPd0h Kd PP B ,, 0Ro(K`@K4 Ђ 㜻\K[KZK(K[4 0D K@ RKYPKXPKHP @P  00 , 0^nP`U @^E*"@!BH1f0`  0040, 0 (K@^,*>A0@> 0Z  0 008 0iS0c80a, PNJFfB{*1t)1(1 p-L M@P`  0  0K`aP0SKp -LMPBpB ) @`0@P/22 V/*@ @T**0S 0 PP: ( P0@P  R0S  ₀P @**P 0-L4MP p3R,0 `,P10Cs0S(K!<0S 40 @B B( @ 0cP e*E01 1\$ @L 0 SJ*̌  0AP=\ @0SZ SLQL L 1S0D0 i 4 41, 0 S%  3@@6P 3\ @,K0 0>0 1!@D0Z0$1  x'HD 00" D000, 8D! 7) 40!16P aPK$D.$Dۣe(1 -LsMD, LPK  ! 1 P 儀 #`P @0pW `P(d00(, 0Rg(K0!0 `PL0$ 00 `P P 0 `@K 40`PfP5[S `C[ B&D @P0`PC[Ta !a ^  0Sq0(K. !p0>00b>0q 1 ! thz q0G 0gP p@ DqpP( K10    h !t.  . a0 S1Q>2=12>303h0 5T( 0! 1 1 hKP Z p@Dh0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l QlKP 0c!d d hK d0KA PH\3:h0\d% * d b0 0b$1#[0d0 Z!0Q$*1"!B001 0j1 000 #[hd ` b/ 1–ACۣe(1 -LHM@@aD1Vp$0  8Q$K 0uP P ' K'`0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 . -L@P@1S<@ -L$M` (1@8 @  0St }P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S* T L  0L0  T LL L @T TT D H 0;00 0 40  8 0 0   '(1@,(,K.@p,(W<@ v(1, 0(100,0, $,0, (00(0, 00CS 0  c00L ?P @(1 0(1$? < $ 0` Ȍ.@P0qΌ  00 `Kp -LMpP`$K0.> `0.@P0 0 `0 `P0@ `  0``P0S   . . 0` -LMP`P@" 0:#:S%0:#:S z'zW P @ @ ȌP qΌ00p G@P K0@ 0-L@Q P21C 0 P X QP P0\0 ?$00P0 -LP`@! pP2 1C@  U 0 000 P p@P00 R00SJ,%D p-L@0PS:T 00? @""!B`z 0P ?$`p(Z 0oT%Dt%D%D%D 1!p-@!10 PL00>0>0 1/*"!B` ` 1 0a0`0PP PPP0P:21C  `0 ! ! ` P PPp(1m0h 0h 0-LHM,0 0@ L0 T0$ ( TK BP T0 UP P $忎 K廎@y%D%D%D 0-L8MA <0 R0 !`S0S $0`(K a1@P *0!00 `!PX p,0x0PUM +zp0@c 00 t0`C0K 8@ 0p lX/@F 8Ke80 PKD KP0 L@ Hp P& P [PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ =<` `F<K 5(K,6()$'ƚ&D l8&DĚL&D`&D&D |6-LtvMphq0]e-\\\V='k%\)lG |`0Q00`pP 0  R0pdP $a 0 Ep A 0şS40 40800嘅p0(80 R 0t%@0@ PP`ٕ0-005(( 810yT S] SO]50 @*0 张>4$04 0A R4@ h4@@ P [`@P0@0PoXP @P`FPptX@\Ph@lP0RT@@*@@1`d3 PT!(_0rPl2@pabg\D#0S @P3/0S`STc@c뫯O0S, 5@d c ß 0@@ `$P"B000S 0 "Q0SF>~20S 3/P ,K,00ŸR$09$0 0 @Pc H 0!0 @ 0 0 0 @U`V =PU @S0 !1APU`V 1P5p!pp1P, \\1~P# HH1wP 441pP(= !00\P !0@QQ凍免働偍}{ (ȚLך,ACDƚPךDךɚtٚɚĚh&Dy22ĚŚ$Fd<ƚL Ff–ĚD/1Κd|&D$&D0L/ɚ<&Dɚ.1&D.1&D.1&Dx< 'D$ƚ('D&Dp&D'D'D&D&D&D0\0 \00/ P/\0S0 /0S\0\00/P/0@-P@T! |0S \ R 0S\ R\0\ 0\0|0S|0S\@0\0\@0 0-L@P\0PS00 0U 0S0e00 -L0@S ^ 0Rڭ00C0 0\0 \0 0| |0S -L @R \0S0@ R0S\0\0 0/0S/0S/!!  -LEP 0  0  -L3P  00 h0-Lҭ\0PU @˭0$0$:OᩭPU 000O0h螭!!\ʚ p-@PL`ᯭ0$ 0CR0 S 0S  0R:Ⴍ0d0p O{0d0pO 0-@PLክ,0@g0 p-@`LPy,0phU 0-@PLj,0 @G0  -L M, W(@,8 T3 ar0fP + ,G(0 SP0` 4p  "100 0c04 @P4/X 0f0P0f0,0(, 40 0b0(KAC p-LM 0x0t0@Tp P0 S$ `D0 jP0Sڬ@Tp!\ʚ!\'D -LM@`p$0S $PP0 IP$0Sd@000,0h鯬d'D p-LM@0Sp P╌ᾬ 0R: `  40P 0 BQ *ph鉬l'D -Lp 40 ;8 40@ `PPf 0-LM@P,0  {0S p0`` O0SL R00 0S00 0h@\ʚ!t'D! Q-LME hp0OO$ !RBb^V )ڀP@p21C Pp, (P! P+0S 0xx O0Sd X00 PRPppU 尊宊+AC\ʚ!'D!'D|'D p-LZ" 000X00SZ0PZ 0O Y,@`PPppYp `0ST0 P0Bc&0@0@?JPp0YFF@Bc 0p-L M `$P ` ?Ac 31C0R D0 R 0P, @`  $P ` $KKpMb?B `0p-LMT`P0LPH0@^ ,0K(P $@ ,` <KpFdʚF F`ʚ -LDbD@P0 hQS RP L M 2=00S- U 08  DL00CSL0Ȑ1SGU0 00400@408@0UL0L0!0L00S000i^p80 7L0,0CSL0|00|0(!R/$0 0@$0(@0T!0H4L00CSL0ȴU T0S 0@00,0 L,0 H0 0@0 @<0 0@<0@@ `ʚʚdʚ p-L80 p8㕐` 00CS0pL`0Sp@@ 404 P啱pʚdʚf 0-L80 08^h 00S00T0 R0H@ <0< 80P, k0ʚdʚfʚ`ʚ p-L@ M$KN $0PQ@c=YB@DB ]BT00U00S Kpt0Tl0`~TP0@AdP$  0A02 YcFF@B -LaphQU (0"  0@0SE !1 1SH1 R! H00CSH0#PWP1@P `0S h0AIRP(Ï0 H00CSH0ʐ]PWP000 0@@0\ 0 1S 80RP(㖏0  dʚ|ʚFИ - L|3x0P l l0@@@宰\0\QT00Sت<< 0S@h N$O 2|ʚdʚ`ʚF Fʚ'D-A" J1S 1 0<S RZ020CQ^1S100S^0Q:/0P/(0/ 202/ (("</00/ 0-@L,PR0 !$U$P1s 0!10 ! 0U 00C0001!0 !00C0 0ȇ'D 0-L 0@S0SP P Q000  #( $00C0}0墇˚D˚(D 0p-LM`Pw@P P \-P Kp 0 0 00$( $ 1K0 , $01KP K(00(00 00K P 00CS 0 00K P01K(00 (0 -LM`Pp Q)0AW 0 Q D0 00CS 0 K0S@$@PK 40K,@ (P 4@ 0P KL T(D -Lp`20Cs0S2 P@U R 00 0 PU@Z000S!0202S'l'iP P 8P \@P W0h|'P00202Sʚ 0-@L}TP @00 P ,\X0@0H 2000C400  @2$@0ʚ4(D -LM,0,0 <}H PP q P m,0 2 0SP@ `PH0 0 0qa 0 0 @ ݩ ٩ թ,  0@S`\ 0 0 `S@ R 0s0 \9 0`S@40s 040< 8 @ m@cTڃ ?@cTT' 02`Q q '0'a   ʚ4(D -L Mp,O 1R-P!`24 , ' @A ] dp@ T,0 dp0SR020V400(K040 042!Pb, a' _P'Q 0 X@@B@BA 000 dHp@@ B@@A  d:p00202S''0'0 -`LpOPP ` 0 S  S0S<0 ``0BS 0-`$@   B  `  -LlMPp@P ` 0匀K0 0  00CS 0` V  KTVP l P0` ` -@PLp,`` 0s0C  00Z 00 00A0   Q%  0R0Z0S 0Z `40V    12 1 1s 0V0 `00 121 `0-@ MLPPPT 0P}804 P@{}0@K0D˚(<(DD(Dʚ˚ -L@,Pp`1h 8005jP  00R  0s 0` 0 0  00 0101 1s 0U0 P00 121/ R <0R  -L M, p0`$ X 0RS1!Z 1!00  \4 B:0BE c!03P> n2@`v_  V1@J0 SSBB c!03P; n2@pH,!$0!`0\ 1!Z 1!X0R  U0 Z(K@020Tp 10 p@T @Tp 10 p@T ڸ`2 ^   1@2 1 1s 121 0$ ^0 000R$40 0$F -L@MX pPj`PJ  0 S"`18a1Pa1a1a1b1\b1b1`1b1`1@ T 0S$0HK P0 |Pq3[S* #[RH RO R 0AS 0X (KX@0! 0@`0 \@ 0T5 Z*,@ X, KP  0CQ  ZX3r 000 ,@0  000000\ 0 s00C0r 00  40@K00 s0  r0000  X0P= 0S3 XX00 K000c0 0S P0`0kP z 1   X0 m0S) hPT Nc` S`v$0< [0t@000  X0P L3800 0  X0 @$0HK L0 |P3[S #[r0SS S R*@L H0KPHK | 0  D⇉TP H0KFVl @P@ PH0K@@  0 D!T@P H0K@.HK @@KR00 @H0 D@ _q @ < 00S@H0 D@ q @ < 00S@H0 D@ I$F3~fwt@vt}f -L M`W  ,P@P 00 0", KipP 00CS 0W (K p ,0pp -LM@`0  oPP  !0S p(K0S1 T*YH 0,0 00T2 , KpP 00CS 0 W  b W ,0T6$0T$@1s 0!10 ! 0T& 00C00  0!ps00p@01!0 ! $FL(D'D -LM@p,c$`KU( PP1 Q@$P$0U$P1s= 0!10 ! 0UI= 0(0C0׀P00 w0(0 R- 0S00 0W $00 0 000X$00 00 001!0 !Z ( 0S0喀˚$FDD˚˚'D -L@p,PaV5 0 0 0!$0U$P1s 0!10 ! 0U  04 0CU0h]01!0 ! J'D -LPp,`@ 0T  0@S*u -LP`,p Q@@Q 0   @QhU p-LP@`P P ,@imP@p 00 0/ -L8 018 s$0<0  /,!80$ R00/ 0S00  /80$ / R $  / Q,08/4 R040/ 0S00  /$ 00/@-0@ 0$@//10S0<0/BC///P/1,  , P/ p-@L` P,0 \ 0 0 00 ,00,0 000p 0ft%D\(D;|(D 0-P<@L0S" 08 1 Q000S0 0 ,0<0 R 8 00CS 0 @0hu0< @#4#01 8R̚ p-L@`TPp<0 @Tp0!8 00CS 0/t̚ l p-P$`Li0*O  D0H@T p -L<0P` R<\3 0@ #4#0 1000P,04@0TLS* k4 8!p64 `!_i8P +4@8p08 1000P,0@ <0@/<@ -L 0@ h20 0UA 0 0 0hX p-@Lt` P,000  0@,00,0   ph 0~ft%D\(D,(D 0-L@PT0@T <0 P ,00,0@T0 0-4PL@ 0h,00,0/ -LM, $p4Q8 1@T `0PS`, U@4Q<Q q @ 1@T `0PS`" U@<0S,0@$@ 00 0N<08 00CS 0 <sP<0sP 8̚ -L$Pl @pA@ `V n 00 0@f Q-L|M`    h S@ @5 4 0 T?L3c ,0 RT00 NP㜠P 0VU @TpL0SX 0F0 0d%03A PUA4 00 ,0S @KD@pK40KW  T r R40KLK80LKD P cRL H D H0Sڜ4$ 4@KFPPP  0(K 0K0 PK0KZ㈀ P0Q $P , 00C0ZG @Q 0 0 000 S00 0 , 1M 1X 0N ,0 0,0 $ 00C0YJP,S v P0PSP pZPᔐQ0  0 0 0 0 2YPj "$!Bv0j <0 P,00,0  B 00 0 @,00,0 1 B <0 7 1pQ0Z +  %00SDڀ1! @KC4pK@0K,X!p80Q4p 0 , 0p@=)A -B4p 0 , 0 ,0 @040 0@ S X8 ,0R  L 0R 0@=) -L H D 4 h0R 00 fUu00 ` P#U㔀 \@ XMbf(DFQ?B -LM`@QqJL3 Z~ 0S pP - 00 040PP#(*80QU#PU 0S!0S 0,0 / <0  },W 00CS 0B p0 Ug 000 4 0(0 <0@ P.  ,0 A ,00,0  ,0 a ,0 R0,0@.    ,00,0<PpP @ .4.0QUPU 0^0S1SpzOrP  8p@<0@00 0 4P 0@YP p{   ft!f̚ 2-LM`0pS" S PK 0@(0 $@ 1(Pʌ4K 4 K,p P 3KP8,0l 0 !,0]/0@ 0$@4Q 0S 0 0040 -L0MH L PD  0S < <(K 00 0P 8@K CtP< D 00CS 0DH@D Q$M0$@0 P QP", !B#tP< ,\) p2B AD:$@@2H w PPo 0@S@ 8 920P4` {t 0 0 B 0 ,p\ 2 l1C0R 0@\L  _D 00CS 0 H0  ,K< JL ,00y< DHv -LMp`,@$K( KPqU  K$0  $0 x $0p  q@P$0$(004 R4P$ `(00(0$ 00CS 0$:̚! -L@@Iu 00C0l! 0p-L M` Q &00 4$K1?L3c@_#$@ P !B A31C010 '1 01Pt  ,@cHI@@Kpp!l!Mb 1 0-L M 0,P0@ 0$@, 14`0 KBa0O# 0 @ !B L3 1C 010 @WIK0Mb p-L@PP' 8`$0h0U  0S P p18P 0 1 4s0/: $ 14004@pp  X0-@ MLHPH 0Pr0 ,D0P@rK0̚((D(D̚ -LMp40@`8 Vc>0 `Ha@#@P @0R 0` 尴P @ˈ (K ~@P@ >0X0X,K@0 0` 唴P 4,o0, (= -LMp@P 8K4 8 ` rP*48@0 10A0!0Q,0 P@8 ,K , tP8 0,0 B0R,0 P8  r@'00KP (K4K  rP`@Z`J,K ,sP0 ,0@T0P,0 J r`'00KP  rP "-L M0p(0, ` PP 0@Tw T P8Pn(K0 0 PPL0$0!@0;00 0 PP1 I 0 0 oPP  0@@ P ,KPP:, 0h0b 0 RP/PA 3/P41<  Y Y (1#209P @0S00S 0S Y P P  0S* PE  0 8`mxPY$1 !SP#P3R0! $0S Ud PbD. -LMh 0l" d2 0 0\2 pP (Kd8p ~h"Jc0? 0 P lp hp p d E ʟH" 0K @2 <" #>KB/K%K(q Dr q q 8r 42 L!  L pPH`:OP` - (1Xr `BFh"`V `2`,K,Pg 0 00KrpP00X`@X Pd  0P ppP K(1BQ 7mP  \" 0Pw` \*mP)`'㱘L? pX~ ~$ RXr `B `BPXr 0S 00S00?  XRX $? (10(1 0,(1 n r,E h"`V Tr ,P 0 00K%rP00`@T2Pd0T2   0P kpP p?W8pGTr W0S ! 0X"00T"000!100`00`00S00 pl 01 ! Y `H!p D1>0#6`0@0t0#6l08!x 41|08"R! %KP00X"cT2L@KH @0 %K `2$P = pPP5 `&Q DdlP  (\\l\" 0P6`'ޗL?  0p}p?Ppp  B000 sIvdN @ 4& 4Q`T0S0# X00 `dO<5 0@00Pd"P1T00 p9}d80@0 Q0Q p )}1  XPp.}0 00 0  d"80 c0@ 0@0@0@0@4 `'b\k\"P 0d"4 ,0S %K3/Pm l2%K ( Pad80  #L?; 81S! L R  S 2/(1 /  1S/0D 0R %K 2/181p| ypR d2@S=E2d"1C0 \ ~\vup@|d" 8|d2 88Lp0|0\@c1  0 001 P0 00, 040 ,P4  PU, 8 0Q'0Q$p ]|# 4K< KU@@P4<0S>8KP&08 0 UP'8 <00<040@4 40408 $ 4(00(04  00CS 04 6<4 ,9 s<4 8,tĚE.!(Df(D.)D 0S/$ R(0(0(0 , 0R(0$0(0,0$ (0,/ -Lj 00C0֚! 0-L@P$P(0(0( 0(0$000P00 md1SXP * \j0S0nTyjLvjH 00C00h00/,0t).0tؚhԚ$՚!t%D$)DD)DX)D -@PL`PP pP 8@{P@~ !h!7HH0]/0$S$0#H0\ Q 0 0 0 0zh~ -`Qp0 !L`a ,@T 00S 1 r $@TT 8P v-\T 80< S \,  (0 (*{ 00Y0h10< R -0S(08{ 00Y0 <]/0400 (0  8z 00Y0 ]/0400^ 0t 7P  00Y0]?  0S \P , ;0@ x)D 0-L\M@0 S  K\0hKPVPPQ K mP Q hKP mPK0 0-@L8Д4P,0S40 4080@8P婔0h56!! p-LM`幔@T  08@T 4Q80808 04080兔N(0P80) q0-0  5!!&D -L00PSp@ (8z`0S T T  R00000  ( y 0S \X 01(0 81L0S 3/4 0R-0808080  8R4 0 0 0 ( 3 R 0 0 0 8   0S0 0 0` ,@T T05W@ 0$p80 Q8y< R   hW@](0 3p # i"(0 d10CSd1ڐ"000幒|r0S @02\"M60S80 y v `*880  1 @ 65SB  @0S@ _ 0 $ 1[ 8myW0S48@ey0]/p8@. @ky 8gy 5$0ym C )i\0S\% h\ [P 0S 0P0 00 4!$tr rhhh h0Or|P  ݀P TךĚd)D)Dؚ)Dt%D$)Di)D  -L -LM@Q K00  kP   @-88 L210!0 c Qh͚ - L@R 0 S PB PP0Q  1S 0S Q 00 Rh͚Tךh0 -L RP 0@@<b@P [@PΚ 0h!4o -L0@8   mhto -L`P@h p @00400,`` Pdq[H GG⮔(h 委 000!0000P0 Sl ?8 0080 0S  <@ R0 0 @8x$՚hԚ2Lך -L;L0  7@  8@Yw8VwH0 H0 $Y O81H0S  3/\t54R  < D0T   /8    d0l 00080  8 R000 ğ R0 0000P  p1S40!40800 0Yq00 010800S0 0@0, 0R0$0(080$  , ( ,@ 0  0 QP  8\ 0XX 0 X0 X000 X000HQ 00(K=9 =0 H iPY 05O? 000C 0-0P 00U0\ *Y4 0"@<0^00000Q000 Rp@0SL\ 80 f ^ 00D"Y  0 x "0380   <@YG8 GⳒT =80 1L  80  8=v@ 88v $00  0p< Rc @0(0@0"v\    d0l 000 U  * 0   t 000`  d0l 000 F!!0eDF!,=(=Xe)D֚y2f?ΚPךHךDךfd@B)D -ML 0  K -LM@00T $ 0@ @K耨1 p-LMP`0L S@Kp0 $K0 $0 0 h@P($  0 @P`@h1 X0p- P`L @Tp04PS0P@TpϚ!h0 p-L@`TP 6/p  P $ `P@0pAnϚ!)D @P-L8Ph P0h0 6m *D p-M@LK`P 0T-@ @P (*u YV00Kp(Ț 0S-L `0`S   000@0@0h44Q 001n S 0,n U 0'nt%D4*DT*D*D*D -L P P 0-LP@Q nX0h 7 0nt%D4*D,+D-X0SLL L0S900S0C1S0! S0%5!!< 0ÃɃQN ` PP0*0 Rr 3#!8 8 \9Q B0 .,0 幔,0 "4 奔40Si ,@K [  00K[P00<PŸ0U0qn@2 RC |W o[Ÿ!>0 C6 H @@0 6RL0  0P @@@RPD 4 !DP Y0!0cC61 `@ŲL 0@i@i <[0000S00#0D! Tn,@K j,8B!0 k" <0D6 vk0x 0l `lp0, 080000hL RlXPlϚ($Ϛf!(,D!T+D3(,=ϚϚ,Dd,D,,D+Dt%Dt+D+D,D,D Q-LHMh l0 0S$ S S- (KP PT"0SR DŸhl 0M(Ÿ@T* hl 2B 0P l Q0d@KP 1@< lV V0 Ã/ 0Rl PR 0/0S00 /00/0/0S/ 0-PL@mU0h -L0Sj0D -L0  0j0D -L0 , h10Qjj 0D0D p-L0P` @ P V@ 0D Ppph<-@0D \0 -Lh  R h0S 0CS0 R/ 0j t%D0D 1D -L2M! ph1 0  `< @0<0 SPP0S (K,X* $jX!X0<  h1 0S2@.8K 0Ph, &p38K-  # h1 0Spi8K4-  p38Kv-8K,P ii\BC 1D 1Dp1DD1DT0 -L h  R@ 000qP00 0-L@P  0h P0 0-L@P 0h DP080 -Lh!@  Ph9 -L@ h- P@0S8@0/ -LM8CP`<0 (38 Ph (K)0  @L`2"00H408P0P`0Sw4P 4 1p0S 40<404 00*  4, 4 |00S8@0@0<1/@PUwUw0 R00,K  儅PC,0SL0V 803/40 @0!,40  40040T!,P4 0  !40  8X@ D0R=J U5 0l  0O l\X  0S@ u0x^W7,0L0U40S4 f0h,h(h$h ft,!Ce1D2D1D1D1DP Q 00 R//H0H 0 P/00 S/00 S/4P/HךDךT0T 0 P 4P 00 S(0//HךDךH0H 0 P/0 S/0 S/P/՚tٚ  -LMQn00 mQ |R  RmRRu X2nRP wRy aR<Ÿ<<"<2<cgUP , @ T<wSI aS T1 Ng@T- -0S 10 hQ *@g0nSZ !0-p0RP0 S(08, l R`( ΄ H@` g@T, P0"U00S0,0 1PU(KP0S8! lP g`fff(Kof\ 0f4 q(xx x0xfw02DLך3D2D3D3D2D3D 3D3DTך4DE82D`2D2D2D3D3D3D|3Dl3Dt3DX3D`3Dh3D(3D -LMp- `0Bs0S71 000 7/ (08 7/ !!(17/ 07/T! 07/p@tPHăL P2  @`@\7/|P7/K!@K04 e0BC(4D4DD4Dd4Dx5D5D5DQ5D 6D`$E -L@T-0S0- R Q  @T -L 0@P 1pS ` 0S! ,@T$@T P 0S -00Cs0SW00000CS0$@TR00000CS0 -L 0@ R |0S0|0 Q000   00S0 \h\՚Xך -@LQ000   0S 0 10 1 -LPp&W`P00 Sy ! 0Sv V* VO \" U\ d  ` Q000   0S< a0S0 00P`@2\00 RG\) 00000 `!R 00!  0 0100\ \R@ `p 1  P8.mP0 ph!Q <e [(e$e eXך՚՚tٚ 6D,6DT6D6D p-L0 0P1`@T@T 0Sp) @T P0@S00`p@T 0S):p֚ ՚ -L@ 0@T @e6D 1-L M`P ``) 1`@8AQ )0\p1pq\+ 0\)L1L!0 R00  ! 0 P 80 f$ $10$1$/ 0 /-$8!0Q0A""0! !!Q0 1H$ -@1L0`p P@T T8<@1 T8!<@@ !1 01@f10/,0hD!/<1@!0cS#3/ , h1 018 4004/ 84 R040/ 0S00  /@-  3R $0  / 0 0@ 0$@ -L@<`V-0<089`@T@T T (0 (*`tp -0SP @T(0P0S0-0. 00Yft%DT8Dp8D 0-L@0@S0@P02 @0S08D p-@1P`1L($`_08<1J 0P p8D 0-P A$@rL1 01 !0000 8<X0G 0`1100110`@1100110 1 100 1 10110011Q 1! 101 R101 0QE_X1011 0100nn_`0 $Q 0  0S `_nL_H_fH$Ě -LP`<0S$ P!80  0-0@}-<0S Xhp@00CS@0@80   80   f -L`pPPV^p2p2d228^@0T@0

 E0@PCZ$ 18 8 , =  SE !1R/0Qj6 8  1 R]?ZPa Q @8 8  !0@3PPR Z R8 8]?P Z P @MM8  ]?P  @0Pz@Z$ 1 0^R8k'8eH$fh9DH9D -L MAQP 8 0Yq X00%l4h!R 0 S  R (0 11P R4 1$@as80 $ 1c10,0 1,   (1S0(1ʅ 1 RM 0,0 EZ 4 Z000 ]$00Y00S @T T  @T,PU -0S` Sy S@T T (Ko80L Xw 40S0P{P0S (0 (KY14"@a FO@Yb, 4 E3Y000 EY(Y<PE(KoY40S -0SEY,@ (0 8  @0,p34P00S*0P00S@ @@EzY]?᳀(0 (0 11P$(bY 12S20 1ŅZ'oEXY.R(@BYNY,P ,0S@ P0S@ 0-0VE:Y H$fИt9D - LN0 -L@T@T 80  8Y $ 1  @T Lך -L(0@@ 608  10 P 3Q(0  !1 1s D (X`1Q1Q 08  10 P(0(X(X(0 -LM @80P $`0A s lphdQ Ki+!00008 10! !1 1 0U1 0!10101 KH$ Pp-L`Pp@TpU  80 @Tp P-L@P h S-`0Lp( H1PU" PU @00S(040T0S  0P W PUXR  PPU PU @h 00S(0 R  0P W -00Cs0SLך -LPp`PNPU 0 R Q 00S U U U h\lKP@T0P \ 00S U U U @TU :@T -@P0 UL p𩝈R&0R = B @`P  0S  `P (0 0iP Ur R0i 0i b0i@B$$10CS$1/0$0Ftښ 0-LP G$J/@s0$10tښ 0-L$0P$!R0@$@0 -`L$P\ p ~:0@@ 1E T101W0\1O< 1P 0R 10P0H$ H-L M< w4@0 ,J 0@HK(ۚ%2(9Dtښ p-L`P 0Sp@ T0p.@T  Q00000  @Tp0S/SQ 0S/\0000 000 -pL@` PPW` P 00  00S00@ P0-LPP@@@T:P0T 01 R0D00;O9D 0-LMP0S6 Q1@ R 0A@S0@& R 0S S0 0 B00 0@ 0@ 0K `IP0 NN9D9D -p0LSPa0SV WZ\U0 0CW .\, @ R W`1`!P$1 70S( H^ 0 f0 00@ pf fW P0S  "I #H I$ 0h!R NN 9D9D -LM6 K `-LhM0 @P@, H0 D@ P` $$0S @T0X0 P `PP 9P@PTPXP ßP P 3@ 3 @3@@tß  X@Yy \@ T@ O 03R\,30X  l=K#L\0 d ?9ŸT T0P\P`0 T0 p\ 9d_o, d 00< l h 0@8`XH` p@T$( H0,00@P48 h0l0doY @=K 8T @HK +8P A @0=K B!CD EFG@@L\\h00CP!00@4, `0RF(KU 1Z `0P0 P PpP 0L0 8Ln, d 00<t p 0@8XH P @`` P $`(pH0T,00@P48 p0t0LnZ(!–%%%E$:D9D0CC-P  0S 34\^ FGQ/0S :P/0 (00 QQ-L MpP1Q1 $0KYPP) D$ `p$0 $00$ 0@0,@0P$84$<8$@<$DD@Pn K(KPP l(0 @(7(T Up(0 lh0lwPH -@LPp`7T  0R 𨝈UT hF MP-L0 0S R K P F P-LM0  0S RP KF Q-LM@NQO `PM Z: @0C -00Cs0SA(0L> 0  0R>802P U;P00 U"@#0 @@0p/ ( KP0E0"@E0`0@P (K@@,  ` F@O@P Q-LTM| Q0JS-|@P |P -00Cs0S(0  800JS @ l@ P00P0 @HK=1`8 P`0 \@  80KhKX TP 4 h0 dP P` L pl2iPZ Z Z|0D<x x x@ t0 Htp  1 p 00!\,0 A eZ,Kt EPfp@P00KX 4  80 l80KhKP `@ \P T h0 d L hPN0 RA :#:jc0@PT0 d0 08K lhK`@ \P 8p 4` h X` P L0 hP2V6 0S@10S @T000Z8, _EP ,0 0T ,0 50 0 00 (K Z(K00 t CEl΅@ 0 0R@ aP;  | D0, EP ,0x 0\x ,0 tt Zpp U | <0eZZ0|700 -LMD0  1P`/ 5DP   0@ 0$@ 04 0@80<@$ @D  0@H0L@\ X\ 0@ d (0,@(0@ h08, 1x00000000 04…08…0nV0 - 11=H + 00,5 B/A#b 00=9 =\2 01A !L D p0P0H0@1AD0]1! !1$1$0S1(1$0S1,1-001(!M?3!O/ 0  8V5 NQ5 M50S`00`00 S`00`0- 0Bs0RS) 0S X01 `01 h01 l01T1@0@- 0!t00x 01 111!!2!P0S lQ  5DQ1SP0D2HB-00Cs0SS 0!1=1A2H!B/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/"0O2B/ "0O2B/ "0` `1pQb$b(0@L2PB$!`"00 l 0S00 p 0S00 t 80 Q p00|0D@S0C0T|00@P0T@0|00- 0Bs0SR 0 0@ K4Ku,80/4@?L#bN3c1!(K`00h 0\2/C#b l00@t!|01 A =A0`p AP0@X1\A3Mb?B R-L$MH0 HD Q`V pWV (K03hA1!< ,0 4 Lp30 DP  2DP @ 8 U< !R6 @-0S2 ,0Sn4J2K2K2tK2@K2K2J2@J2(0 #ZWj4 R @T@T ZW00@ @ B fpGPD@TPU80Sa18 P0 <0Q P0 < 0S P80 0 0S p0<S P 00S 00 <0R P0< S P00<S P@0Sa L L[@ 004P Q Q@p 000Q@ iBP fpGvD R 0bH S 301H 000 LךTך -LxMP `/p 2U|  X0@00( 00  00"0  ( 0 , [P. 0 0 R& 0@80<@00CSnN2DP2 P2P2hO2O20 @ 0$@ 0(0 ,0@004@$ @D ,P080<@,HL 40P0T@<X\ D0`0d@Lhl U$pX x0@p0t@0 x 0|04 0@0@L  LQ ` 2  0K P0Kh#0@0|@K0D @P  R 0 00x1000@A00=9 =12 R0 !(K$04 t!$0 l! pX$H0@`1dAL0h1$X01 !W 0@1A 0 ! 0 $0@1A !L0Sq X@1AT01AP $1SS S6 SX 0@X1\A !0@1A pt 0@1AQ 0y  BjyW 0y000000x0 | 400G0@1AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !IXD0@(1,A3018 4!3D1( H!019P0S0@1AH- Q-L8MP0 Q PU RH PH  0@U< (KD0 8hU01?# @0 p34 STL r TP T8  LX8Y0!0  P0S 3#P<^s7@T  `8 8  8 @T 0S HDP030#Q0S 04L L@ ^@PHDeA`H D 07@T , 8 p(0 80 -0S S <\-0 0 S' @T<0s6@T 0 8 p(0  80 -0S S <\r00 So @TsLQ\ HD^030#Q0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  R`80080 `R0Q (0HD^030#P0S 40L Pm@ L,?P ,HD  Be, H D  L$ 0\ HD^030#P0S80080 \ HD^030#P0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  RO`80080 `RG0Q (0HD^030#P0S 40L P@ L0D?P 0HD  Be0 H D  4 0LPL,@ )?PD,HD e B, H D 74 0LPL,@ ?P,HD e B, H D 4 0LPL,@ >P,HD e B, H D 4 0LPL0@ >Pp0HD e B0 H D c4 0LPxL0@ >P+0HD e B0 H D 4 0LP_L0@ >P!0HD e B0 H D 4 0LPFL0@ >P0HD e B0 H D  ˚Lך P-L`p @ 0S 38PVPR00SP0 @ h>P00 h= -LMP p, w/U`$,0 SR00 SU0 0S @V  8>P00` ,  =000V R S  D>`P @A >P00E -L MP K -L MP K Pp-LP`  0S p@U@R00SpP 0 =P00p phR= Pp-LP`  0S p@U@R00SpP 0 =P00p ph,= p-LM`\Q Q0 \\ 2 1C0PU P 0KpP H0 <@K $@00<0R@- @Q\ 0@- R0-LMP@@ KxP0T30%K00 -L M@` \QP20LS5 b2e2d2d2d2td2Xd2d2c2c2c2Lc2a24c2c2c2b2b2b2b2lb2PP 0dSd00SP0S  K830S,-P 3$P 3 Rß 0KPŸ 0CP2@FP 0PP20S  Pp2p"@ 0@c\20S-PH20S-P420S-P 20S $K3/PP $0PA0cP 0P PP1!0à L Px PPsL10S 41Ph :Pa 0 0b 6PU 0 6PL 0PE 0P= x0kP6, `P.Lܚ$PܚEDܚ%S񟗐f2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2(h2f2(h2(h2(h2(h2f2(h2(h2(h2(h2f2(h2f2(h2(h2(h2f2(h2(h2(h2(h2(h2f2f2f2f2f2f2(h2f2f2(h2f2(h2f2(h2(h2(h2(h2f20BMSfdr2Hr2,r2r2r2r2q2q2hq2q2p2p2p2p2p2p2p2h2dh2dh2n2h2h2n2n2n2n2Hp2$p2p2o2Xo2dh2Hh2Hh2Hh2o2m2m2Ti20i2 i2h2j2j2pj2k2j2Tj2i2p2p2p2i2m2lm2Lm2,m2m2p2p2p2l2l2l2l2\l28l2l2k2k2dǟ 0L 0L 0'Ɵ 0PMhL 0L 0L 0L 0Ϡ D64Ɵ 0Ɵ 0ş 0L 0@L 0@d5\K T5RG 0b\50L5HA DQ Bn  R?K@ sE 0@PPi0Sf w6d 4]ğ 01Uğ 0L 0!E0 S<0V> KOKu 94,ğ 0+ 40S00<1 <1  O?K7ß 0͠ 3& ß 0tß 0Tß 0L 0@- 3 s B0MK 4 l410Ÿ0 L@!P00X00ST2  HR00  KJPX 0S0Q S00S 7k 0, 1( 1Tx l1q T1jH 0a( 0X  0jNA0|G–@ۚ\ݚh!Κ .hʚ )!<F(`a0!4FE8F,-,(FX"0,"˚ɚMb($>C! F$ *`.h,d,a `ݚTܚ@ܚDܚ$F|>C >C>CF0@CC -L@MP0`S,  0B S@(K!\K7@P\00C S t2 u2,u28u2t2Du2Pu2t2\u2hu2@P -@X0q S P ,K 7@PP( P@PX 81, H  a R<*y @qqqpppp,0 ,K0 A `XK 07/Q@ X dLT Q  8@ *Z 0]Z@P 5{e2%de<43a2m?05 00  R/lݚP0S/ RC408 10000  P /lݚ 0-@PLM0 Q PK =7P000 0 70 70% -L -0pQL`hQ -0S@0 00@`0 G$ L0! l @Ppx@00PPw=u= flݚD:DX:D -`LԠ PF40 1pPU -@0As0SP0S PUT0P000000 -PE Q ^5=flݚl:D -LU00 u 0@T `@T D0S`D0VD0V0 00 p-@LT` P0SP -0S (Dpf 0p-@LPhQ`p`P PQ 08  10 P $ @0 0``p `p 0 Q0-LhAP0(C <0S P0S 0 -0 0Q 80 10 P PP0 < -Lh(0K (C#T(  Q/0hT;  Q0-  0LS  0RPhA  0- x 000S ``e-0S0!!D @0(0hkCQd=< )LCCf:D -o`LMVPp30 R0 R @ 0PK,@K 0 oQ}PP00U00Sn 0@<E`!fDlt%D:D:D -LMD X`p@ @ V0<0 B 8 K@P08KTd Q LPIr R @<@P#@(K00@TP c ZPt!t0 O S.AJ`^Z?D D@<@PP ,K 5P,0S@ D 0D0 D D0S xD0D 08@D t0@D0U 00R  0@ k yFF2:D -L Mp@P` (PK 4P KPI -LM\`P.Q1 4@Kg묠 V\p' @ t3WP$KY\$$ 0D; 0?;ft%D:D:D$;D 0/ -LM @0,0 @ P`0 pc5F$0@X0 @  , R @0SW0@ 8% -LMp,K,P ,0K `500@Kʚ; 0-LPd 0Q 0 P0@  0 -LMp,K,P ,0K `500@K@B0@-(P40@@T @0S08%0@-(P(0@@T @0S08%0 /8%`0 -L0P@S}?H H0 Ӓ< ?A3c0 0 F %Mb4p@-RRP` ڔP`Q 0@0$0@p rP`<0Q*0P`Q 0Q| %x@-P,0$\ $0(@ % -L,M@0P,0 p Pp w00@PT 0L`K   8 $ @`0T 0 @'$, 0R(K#4%–E0;D$E\CC -L,M쐟LKP, p@` $ 0PP , 0R(KK$P h0@T @T >$P0@P %–4%pCCQ-P00CS222(2- L0 80i0 0 H40 0-@0LS  0|` 21C0`ÂQU! 0 0@ R0P0R0 Ě@0 0R0 0R0000 $77F4% %0<;D`;D -LMp,K,P ,0K `500@K@B@-HpDP 0@`$^500@ @0S8%ʚ; -LMp,K ,P ,0K `500@Kʚ;@-HpDP 0@`$^500@ @0S8%@B 2-LMPp@ D @< @P"@"0 Y@P n @   1 P`A$0 @V 0$@ 8`K@00 K @PS0@ ,P  8KU0 0@0@R8K0@ 8 4  8 4 (0@cT@PTP@DT8K(, ,P5P0@80K408@,5<@0Y@ !K P@P$ EL \%`qG_< (`@P0H 0 @P@04 00(K8% % @Bʚ;$%,%$$ 00S0/0084 -L4ML 8KLQ00KOH D L u!%!H0K0W@T@0 <@ JG 8HK8PK`0 p pW0@R00 ,@ 1. <쐟P`@0K 0 @9L00@8P 4` ?0 R , L0I@Ph8 K @ 57(KQ0@P`S0@ K ʚ;ɚ0;D -L(M\ŸL  (KoL 8RP L@L P0Op蓕H D !%! pY XZHK0@ H D !HKY P` p$PW`@ <0 0P ,` ,0SHD @KTY 8 4 0 K 0Z 0,) !840, OP8 s,,80K `0?7^@QQ(Ko WY 0@0@T0@pP(K K8%lFF@B0S P(0P// 0R/ɚ;-R \D0\\ ,00\00Q?BF  / R/ 00R0/F@-\ 0 l 0@=Ɍ ͌   0 `  \    0 l\ 0=Ɍ@ ͌  0S0 -Lp M4K <4PK`,0PU`0`S!X0  V 00(K X࠳00X\P 0@P`U -Lp M0K@`0K(0Q SJS T 0$KSP\ 0T0SP 0= @ -LM` 0 \XK(pK0 X1 R 0@=)B -B (@K0P Q  r RP Q 0R  R 04K 04K, P cR4 0 ,  ᮪80@QS(pK0@=) -4 0 , ?B -L$MP@`T$KHK ` 2 1C0T@0H D <@ 8P 4 p@    /0Kk<K040S 0@K0P% U T r R 0@ 4 <0 8@  4 (0P cR< 8 4 0@=) -< 8 4 Q4 (0R  f -L,M`pWTPU TK F.@PHX  0K, 0p w@P>U@; HPKTKP8P4W4SOQ<KH D0 @0S _H0KD T0p- LH`hA0!!-0 !Pz000p f 1-LM!, `Vだ1`VV t1@T@ hq@T; -0t 0C s0St x0p 0x0x0S5p0 dVpPL L"1KH0 p L KH 1Q-0S!! !@Tgh,o!!"1!S !1 1 (( $0)dʚ`ʚPך(f\t%D=D0>D @-L8@ ,0 $0 0/A!b hvd2<Fgfff`0 0/tl 0-P (@L 0S-0000(0P(@0 000/d,00,0/ Q-L@0Q0P (0@ ,00CS,0/M -L@`TPp& p@T! $0SU U)pW  'U U U $0S 0 @TVp ' '4>D>Dd>D p-L 0P`@0S 3/@p@p< -L0S 00C0 Rh._(d>D -Lp`@TU@ 0P$ RU 00000   㹼U@t p-L$0@S` |P R 0S R ̺P 0@ `0  0ph( ( (t>D>D?D #-LMs0P,0 UI0S 2 0S0C0'I <K 00Cs0SP0S P T-I00S040I ,  0R{(K 0S*  3/P@T $0S[ @TRb!0S@ @ @0S V0SL S00q R0A0-QH10 0  000 01! Q0S  Q00000 R<Kl1S R|c& p^& 0R00DH'@<D' 0@'–h(D?DtFlE?D?D?DCCP?Dt?D p-LP`@P0 0 P $0SP ppl -LMp0@`/P` 㹹PP_ 0 0( @0S* 000h!%PI$p @RTR 㒹pP= T*p 0!R20,00Q0S Q0!R 0S S0 R 0Sʵ!+-8&4&0&(&$0T  &X@D @D`@D @D@D@D@D@D -PQL 0 Qp0S`0S 0Cs0S 0S@0S 2 0RZ 8/0S `0SEtF -L0@S`p60S'0S  3/0SP+0U 0S P 㹺Pp0Si诺00S0h(&0\/%0S D)%p0 $%%(@D@DpD AD@D Q-LM0P0 4 ,0 (  0 Qp0$  0 R `0S 0Cs0S  0S@2 0R 0S `0S`0 R , R $0DS0 00$,K4Ke$tF(< c080 4K  8 00Bs0 S?/(K0 QP2 0A1@T (0 P @  P- @TZ \ 080 ""{P0.S a0B8 s0Sa0Bs0SW0Bs0$Z–DE P RT `XT X00P(L(0000Q,Z 0#4@P0 (PK0@#88#Da'$B0~   0KE@P VPPpT00S 0S V 0Si 0SN T ,, 0R(K R 0S(0 @ &P0&>0T0U0Sv긦0s0Sj @pPP0೼0  " 40 $ 020$ 04 <<6  0Ɵ$0a6 0G W 0S% |" 0#(#4(@"!| ,40T,8 8#$"Q r  h0R`5  Lp p145 ,Ƞ Ƞ,$0a0"" p p4 ,Ƞ Ƞ,$0a0""TȤpKV 0S|  @|m P|\ P 0u03V0SVU@E( K0^*SB K0 PP 0S& 3\#   @Z|3 T|td P X,0S] S7 @#0TPPp0㸀K 0N?PP r  Pag~ 0K*P 0S  P @ lO@T@T $0s (00?@T:AeP H0 ,(,("4#220$ 04 P j K0`@P 0P@ P`  O   R P pW (0 P @ C P @VPPzd@ YHD@ 0`@P P@ P`–ĚCDCDF,CD䞖螖CDt2 DD0DDpEfLCDXCDLDx$ECDhCDE]DtCDCD4CDECDCDCCCD@DDM 0-@PL@,00S,0 0h@d 0-LM80 < @,00Cs,0c 4pK4PK`d0,l PU`QOJpx X1 Rptx 0@=)B -Bptx d0<\+X< PP`8p0OP` pPPT`8p<8z@<0)(KHP`0p 0OP` pHPL`0p4@0 0@@0D@0=@P` ?BDD -L⬀`0S Pp@0@S 0PSp0SP`p@00@S 0PS  0  0eGe@R Q-L R  R | 000| 10  0| 001| 0 00  0t%DDDmDD Q-L&Q S 8Q20 R  \  \ | 0 00|  | 0!| /0t%DDDDD0 -L0@S 3/XQT00 0  000  0R V|DD 0p-LM`@P T @T $0S M(0 0 (0_ 0RKpd0K KP(0,0 K(00(0 –DC 0-@L9%?(00(0ED p-LM@(0P: e 㧰P6 X``00 U@0 000@ 0$0 P P 020$ 044$0$0s D `<00Sp 3/p2| ED -LMH0p#8|8@#P2 8 0 4 ,0  ,,"p(Ÿ, 40 " 20  a04 @8,@'RD 0p@ w4qPp`@P@ DH0`P04@Z<@4p pY@@㾤T@I(K0 S8Sࠃ80S (0S 3P m8S'ڔ`pP 0@@pP8`S 00 *@ ' @Dp0WEV -LM8 R 0 $Tl  (Pl l(K0@ x   0@ Kp0p0 pP t0 0@ T  41H$ |0@( 440@ 90 8 40 @L  DdT PP@P0p@p`P 0 00XPl +(P U( pKpT` 0 @4 ,5A$ |0@(@4 40@@90401/ _PK$0?L0@K0 0 K "l |0Syv(P 1L$UQ(00 0 0   /( -LpP^ QP𩝸1@T  P   R @0T0NS 3X 38 3 3-T& 0S# 0 iT  0 i[T T` 00 Pif0 ix(f p-P` L@< P800000`0  0@p(( 0-LM@PP T 0H5/@T  (5/@TK0EDEDFDEDDCj300 -L@T@T\k3 p-L0@`PP00p aP P 0U,  Q000  FD -L0@  0  00 R 0  0ThX 0 0S0 0  0 00h&E  -LM`P@pn 0TC:D 0PU>Tg0ppP  P @0T6 TUA B:P3 T U-:TU\00 000W 0 009 0p  U*00( 0l 0R 00 pp @( 0p(DCFDHFDFDFDEDtFD p-LSP@3 0  0S0`` 0P  0S VP0A0 00@@pV 0^ 000 000 ph0\  0S 0A0 00S00@@Ppph -L(M`P@pPE P? QB ^ TX:^S  CD D dZD @X<0J 0$N  0I ;\1 P Q # 2R@ 0D0l0`0, ^Q  R# @!< %:0 S* RQ< 0 S:0,0a 0@R  W3 #8 50 54 58 %0 %4 %T:* P:@0S2  0@  n0 0H cH0N  R 1:0LS@0*P* 0,0l0 @R0S% < W#: D0RX!: d R000Sv04 R0#03\0S<08  4 0 8 < D0% "=*W9:@ R 0 @  n 00 jN0 0S01 :QD@ P*W % 0 ::SX!: e 00 R0S304 R0#03Z0S8< 4 0 8  00 q 3S R 5 0000H!P  @= 4@8<  <0l@(K @< 0 8 4 $!# \0|tD 4`X P8 0 4 \pDCTGDtGDFDGD@GDFDFDEDFDGDHDGDGDGD -L@p@p @ P`pig0HD4DC -LMpP`@PPP K  0 @LHDXDC -LM`P@pc RY 0APQ`0Sf 0Qv: U  0P \\  UY: T 0  U: T 0P  0008!0!P = T: 0S6@0pd 0RDA 0pF85U\00 000 0U0SPB20d2p0: #DCHDFDHDLHDFDTGDtGDEDFDtFDtHD 0-PPL) ^ 00 @k@T0 @  _ R000  00hVEDDC P-LM, 00 ` R:U+V00SpXK B^W We  _@,0FS0$P(` 0@ F,@ ,0 0S B0 0R 0 0 ,00 000 0000 0 M R  Rq R0QSO 0S 00 UV i00  @(Kd0 \- D( 0W0 0   0P! ,0p 00@0 0000 0  |PP  0S00P0P0$@ |d0, Th#`@X4X0匧@ TX\lIDDCIDIDDCDIDID4IDHD0-p0 R0  0R  Q R0S0S0000 00S`a0 P00/X0 /Xd 0-L1Ps0< <0<@<00 @0$ 00P0`(fd 0-@LPP D R00 0S00  0fd@-@ 00bO 0$@P/,1 Q-L`7 1Q 1Q  1Q 0Q0  0 00  0  p@  0PaU0 PPP4 0 0000 00}f~fvtwt@d`fx0 -L R`@0 D@00000 E0Xh` -Ldp@`A@P H0 S  @f`h 1- L@P`p\ 0-`P  000^  S 0El@Q@1@!T `P0Q 0Q`#``fdID Q0-L@00PA0 R  2 x0 P0R0 R {P P0000 0S0SU RU`a0T\ 0/᭾ᆳ @Q@#0-!ALP000S0 @Q@#-!QLp`@ Q   1S R 0@-P@\' 0S$ ^) ^ R  RA 0 0 R0 00 S0  0S\ 0 000@ 0 0  R \-  R / 0^ 00 S 0  0S0S0P@ 0 S@@0  @0@ 0 0 0S00S0@ 0^@@  @0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -LpX5 PU?P0S`X`V  0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP& ( 00 S\  R (0c\0 0lS0P 0 \00 0&-P( 00 S00SP (0c\0 0lS00@-P(@ 00 S00S@P (0c\0 0lS00 P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0S000/ Q0-PL <@D,1)1400@-HQ@P /x@0@PL| 0@0/ -LM, pX $`,@V P, :/P 0U@XPU  0,@02$` 002 TV 0@ 002T , `F:/V 0PU -LT0 T0 &,@C -PL8p@T 0 `,fLC0  ,XC p-LM@P`@(KT@ 0@K `  x,KpDC@C -LMh`P,@KPp K$P T0 P$[,@KDCfLC p-LM<P`@(K@ 0  @K ` >,KpDCXC p-LP@` / T0P)/pT0Pp -LMRp0  S`, 1 S* S YQP(1@T ,  , P0S , P0S @0T 0S  ,KYQP0y03Q0SPP P P X0 R 𯝉 Xn  if( -L`pV$ `(7/ 02 P@T0 7/0 03P`VIDID -LMP0`Sp ppS0pS(`@ $0X@6/T6/,6/L<D H06/6/6/W 0S 6/0S t6/0S X6/P (86/K,6/ID$JD0JDdJDJDJDJDKDKDHKD4KD -LM`T(4 0p^X `0 e 02R P T0( @^:0 03PC @R T 0X( 0  0x p0S 40S @A, K00KKP ,( X10P 0 T0( @^  (0X P@ (K$<@ 0S X 0@q  dl X (0h@f 40 0Z0 X 40,U XKDKD(LD`LDLD`KDMD p-L@PT` `< W@T`@T  L@T`@T  A@T`p -L8M⼢ ( pWaWW "2O 2`Vkt0Sd 40s 8Kd" X X; P@_e@4 @@@Od$, P@P_e$ @@@Od P@P_e @@@Od 8 P@P_e @@@Odh 0 P@P_eH  @@@Od, @a W `V aWX T0 `V( 0R"$K L 0 g8K 4 qx p–MD`|DLCE ND(DD0ND8ND@NDHNDPNDNDMDMDMDMDMDMDMDMDMDMDMDpMD,NDTMDDC -p0$S(00P@ 0 0Ln 00# 0 (@T0` $`0 `0 F pl 0 Q0pp`Y0 0i,<`D0V0D0( J 0 @ /V  @ 0 `F%  0,0# ! 40S AV 0 S80P0S800hP 9.0 t%DXNDxND p-L8M@Q` dp 2 Rڔ3H0S `0<s T0t  P \2 R  002 T} 002D40ST00S00# 0$0 $0C $0H00CD H0\0Q P D 4$\04 0S0N Q000 Q0P0P0Kp<00C\ Q000 0S00P0P0P<\0$\ AhPK 0 (@ PP ( T:000T:tt p0 Xh1  *L) XD1 @$ <"  ,0i )EC(t%DXNDOD,ODTODNDNDNDND 0-@LPe+60000h@+ p-L$0PS@` 0S7 D< Q0C"0%* D< 0bD0 Q000  `0  80 0C 80 V 0S00PP`ph(f`0 pph ODhOD 0p-LMP0 +P% 8 00@R $0S>D0< ,0bS`K"*8 00R$0S.D0< ,0bS: @ T*@Tp@T Q00 000(`0 (Z@Tp 0 t%DXND!OD p-L<`40@TP  @Tpf( -L @R" R$ 0S T 0S 0 00HQ  &Q0S0SHHH H0g 0S00 $ $0[ (t%DXND$PDODPDOD p-LP@" S*`P 000-*p p 40 R#*p 0! (t%DXNDDPD -L`0 t0@ 80 RT `4  @( -LM@D ,0R!* pKd0D, 0Q0*  PP `VU U . Q0-P,L <@D**0)D ,0R*0h) -LM`P)<@D**PP($K00 0 U00  kPE @P upWT T 0 40R0"40%s)0 0-LPpM 0 H L0R$& `VCD R K8@P  CP"x \ X0,\  `H L0RX 0Sr\ ,\ X0  0 0R0  )$8) 0p2 D R @rTl2 R 40Sf 00#Q00# 0D0H 0C D0H $Q0Si 0C0 Q000 Q0``$00 0R$ D ,0R:K0p00XXTx0S |P.0p00<0Q> Q000 0S00`0`0 @A$ K(0KP $( X100Ptx hIX`FXXN<A0( X0048X(5dPD(PDPDtQDDQDPDPD$QDQDdA( -L MtP`Q p QV QW @TJ@ 0Su X00HUPp)P0400 `00@P X00L0@P     8 , 0 \ $TpD H x |@P 000P0 R 0 PS 0CU2:0t0@h0 *)(`&) `1)P<t `*)0d0Apl0' ^ 10 R 0 0`(K U*`0<`0 8@Bt@0d 0@@$ 80Z U Upj>0>0S%  !(0P11""00pp@TO\Fp0p p0p @0 0 ?XOTMLJHHH H0(dCRD(pp 5343|5343 RDTRD(RDt%DXNDupRD \/ 0Q|/ 2 1C c 8 -L MtptP`@F ` 0 04c`V pPK`8RDC 0P \/| 2 1Cc8T1 -`D1PP81 p U00SL@% 1 Q X00S@Pp PVP$1 VV!W 0X0Q0S Ui)Y U   xPW H 0U0040 R v0`!\!X\) R-LhM ! @  |@ , pPP@ P t l T t@%PP00mPx d0 t@ @h0 ` \0 t p  t p 0LZSCa3a3a3a3a3a3a3a3a3a3b3^3a3\3`^3a3^3 ^3 ^3 ^3 ^3 ^3 ^3 ^3 ^3 ^3a3a3a3a3a3a3a3a3a3a3\3a3a3a3a3a3a3a3a3a3a3p\3a3a3a3a3a3Z3a3a3_3a3a3a3a3a3a3a3a3a3`3_3\3a3a3a3,_3\3a3a3D_3a3t_3|\3D`38a3a3_3\3Z3a3a3Pa3a3a3tZt  P W00 S} 0 zP, 0R`(K> mhh h   `@@ \  `@T`00P0hs0S,@Kh l@  RX , K2l 51:R[ ``|A P`0l@0  dl@ h d 0R00l l0b a bl ``P`h(h %h@" P@@ `h0 h h@ P@@ `!p00Lt!0000@ Qt p d0 t*P 0@ \ p ` t0P!0p 00A 0 \?`0 t nt h00h0 dt+\ _0@PCKl XP C0K`@ \` th @ h Nt0lPhh t0 h h B@@ .0`l0 l8^Q@l ` P l `0PbU`PX h  T Y `@@ h 000h   h  \ \0 0h'P`h0@T 0@ x@ h0 p@ \ h M L H  ` 0S S S`HL0CK& @C0D RV ZH PW00 S   G @th  h h \ T h0h h@ P@@ `t0ȟh p\  PCKl XP CKP\Q t t0\ thh 0Rd t@@`PX 40@Po@ 0@P`@ 0@P`@   @DHP W00 S 0  l@@l@ PU):lZ dX@aTAZ P W00 S000 0  @D0 @D,0 @Dh dX@`TZ PW00 S 00   @DTP  @Dh Z] PW00 SH   \ }V U-K,Kl ',Kl %T0&"P`l bl  b4,K @ 0 ) 00d)QP` @Dl@ l@00 d0 P0@P`@ 000P0S  Rp @ ,  0*p %h h  h@ L  L@0@L0 H@ 0 L H  @|0S@pL@H @t `Pq  P@ l@ \2A@QLK<@00` !0@s0^S!0@s0^S^<,Z@ PW00 S   !0@s0^SP@W00 S   !0@s0^SZ –RDRDRDRDRDECRDDlPX 4H@L0CKH @B4 HL0CKt 6(^ Z PW00 S>00  qt00@?t `0 Q-L@M  K 0"( K 0 K(0 -0- L M0CQ0  0( K  K0 K( 0 0-LM@TPd" 0P|40 R@ ;"06"0(`! --LMPG" 0 ],0 R@ "K(`! -@LCD -LD ,0-LM Q0/T --LM00 K - -LM0  K -`0-LMh!80 1 Q  1 0 K - -LMp@p 0` ` `P40 R0` ` 2KfX p-LM`@0< 3PK0 f0\ 3[P @ ZP >S 0RKp–`$EEC --LM@xP p` 0@ @ @00 R0@ @ KfX RD p- -LMP0P Sx0`A  hP TP0 R .R0@ 0@`!) SDpE) 0-@L @<00S S SRhahRSD)4SD -ML  0PSD -LM`RP80#40#00S4!R𨝉8 b01#88Q$H),1pK@ P1[0 1KP v -L0K? R  b1#880S$H(P1L0P1(t0 И -L @pT`𨝈TuH@  4! 081 ,!001Puf///N/-// 21C/G 32C/@Rh0 $P/H0 P<0p,0 !4$ 04/efe0- $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ efe80 -L R'0Q )$EC SDE/// -LP@p``PV P@ -LMR,0 pP ' `0S` VP 0 S00űgv @P 00 00 0 00CS 0v,0 -LXM#x |0 0P! P3h 5:A T`Kt   xtPh t0R Òh(KZ 0t1 0 R0| Rd P` 4K`|04PK`,0P0d0 d2`PQ( 1(`1 , 08<10p0 " @ l 0t `0SO|Q! 4K-4KQ= V06 0s0S>,0d Uc\@ < 8 C<0SL1!p A (0@p l 0SC  s` K  t txEPh oxU0R,0dP00S @h#P [p5 PWx th Q0@ @ < <0 S8 @ 0R@K0sp @p0F Gh h0Sk 10e@P6 `d Px tPh h $Fɚ;h!FQfʚ;SDd! -LM`@Pp 0PK P KP P $PK P0p -LMPu Uh ?\poA3cO40 0@ $"4KPU`7G$,0  0(KMb@B -LhM Qp@P  Tㄑ  Te 00CS 0 $u (KT PK00 gP< 0TpHP D@ 0 4 ,0 8 p8p 0S3W00p8p 0S*W( RP0  H KP80,DP`c0pǏ@ P`,0 DPH`00S 80W pP  9P #P -LM@`Pp[tP 0 K 0 0 0P p] -LMPp`;t@P 0 K $0 ( 0 0 0@(0KP@ 8 0-L0P@P0PP0譓P P 0R0000d! p-@L }Pp00@Pp` P 0RP (0@p|0p  ɾu00@Pp-0S (@p fd!h! -L M< D @ H 0 , 0 DH00Z8 40 782a070`>0PpC @@# Z!ڙs PP. 0,0 0   P <040 !<0 0! ! 00CS 0s Z,0  ^, 0 0< (K4EC Q-LhM| 0 PY0| P0| R!Rp PX@K T`Kl@ @ P@KL KH0KDK` d0 h P lp PP RL p PPF ( @muP #U U0S `p =PP \ d p 3PPP hp *PP l0R 㛏(KAd p 0 0 l `@XK`0 h d 0S p PP\\ `p 4K&, 40Kh"`pQ\ 01#@`e(p6,\ 0S( 1(`1  08<1t ! @ x p l` |0PPq0Sc R! 4K4KQ0 W0) 0s0SR,0\ Vc\@ < 8 -<0S! 1 !t A (0@ x 0S" PJV0R,0\ S00@ 0R@Kpt 0x @ @ < 8 @FL t0H!PU @wɚ;h!FQfʚ;SDd! -L M`@Pp 0PK P KPP $PK PA p -L(M`@Pp 4PK P KtP,04K(K#( $ !B !  pq -LM@qPPA 0> `f/gfff0 0/H","R  Rx0x0'' Q Qx0x088 R/Ak0 -@L 20Qp00  (00H >1>1>1t00  |0S 00 0l0$0(Q,"H" Q0-LM@P@00CSL3333300 0P@K0-@t0h0\0KH0 20* @@"0"$"8"," p-`PL 8Pt00t0@%paf@TD >0- L@0 T;:|@Ph0h0hH(h DHh @00 8 ,P0 00Pտ0H","3 0-LP 0NP0.t0R0 -LM@pP`H0St0t0# 0  0S 3/H0St t  0  0S 0t0H( (0PP f) -@LȠ`^VH ph10RUV tp t0l0t00僴H0U uh@ 1HX  f FHTD -LPMP P(K3P@"A@1@K3E$  1   000cP0S P|0S \` \6 V/ -- A0@r QRs0  PS000S S S 0A @s0S00r R  R Ru R x x0R:(0 (0h`\- p04KL0 0Bs0RSD 0 0$D @ K`2,"K@^, S84KnjǨ@\8 ]@pK01Ìp@eȌ6̌@p < 8 -00SH Q SQ lPx1UPp1L lO D+T0 %>H p P`0O0@`d  d >V J0>y  0@d 0 d  H P 0>cJ` 0s ,!0 Q0As ~|A0J\ZSP pP`\H0@d  d Pk =^p!p(p'p)Z)p2 l 0@d 0 d  MH PI>SC ?0"HECfXE -LP`@t0 p  U 0  f 0-Lt0P   % "20#0 P0S0 0@@T 0h@T00 P0S P ^T @^? -LMPP  봠(`(pK @P ( @P` @P ( @Pt0:t00>0>f p-`QL@pP\ YPUUp 2-LM@P0 S50 ^ B?@0CS+1 ? Rl  t0 ! T0N>K2n @ :t0\ ~0S萟t0 :t0>%`,pKⰎ >f PP , 6 PP0t 5*0t .xr0c Q.PPQJPUZHECUDf -LM<" P$`P0p0 8b 4b ,0 ,4t @0  <"#34 4Q  I##0h  R  VR8 0H0XDVa V(ڠ0@ <#?0 @V' .H >` 0> 0O p0@Pd `l d Mʨ0H0X9 VR  gNBP70p`FH0X!4H0$BX'<"\t0"0t0H24 4"Re  R`1l#OK GP4 =8Vpp8b ŌH0CM8 w |0Pt 0q @o$0!k1Fh0S@  ˚$! 1@P4 , I  82S K|, 40R(K  82 S 0R#  4" 4  #042 iTc8KR  042 ]–f) HEC0")\)@EC >p) -L@ qP` (Q/Q)t0 >;.t0.O p0t #40,àt x LHQHPZc- (* Q HP# f@R Q-L@ t00t0t0 0t0 0) P P   -Lt@ 0R'0 t0! 0)P P qQ  p ̌t"$ L32C 00t0h4,"H"8UD -@0LS00> 0Q>|  00CS0 ttX՚ -`ppLIL0 Y㨀@  0@D  D 9@P 蜠% ,t 00S r PWP|@$  20P; t zRxW  a @h0(PTgʣ/0S\(0Sڜ0  P H Pt0@t0 0S 3/Pt@tt  p [ |t  0S, 0S  0S 0SH 0SW~ X | 㑘t t 0@$  $ i0 t@0  th0@t t    0R20,50t oh pG0 #Y!   A0GS p0S P 0S 0SL @T T   t@(0 h0S&  .H0SBtq  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >0s0S>>>t  ^-0SqSo m >u 0bS@1@#Te@DT^0p  y t  (Wt{pq !W|pm 'W`pj qW X60|S W 050<#(0 0S050-| ㋗tW tW   ^tt { Ty 0>(mxW 0S  'tWW: tl 0WtW  > Rt lQf0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S tt/ W   jt~\Wty.op0t#40#"B )W}p ^W~p  R @q0S5%| 㵖zf8"@"$"HEC@R 0-LMp Rx@@<0S9  㔕,$!(1@pP 0\Gx#W  cp 0'B0Sj8P0 iy 8 X8ံ8 0R,0 !V8w0p0 #pp0p fFgfff))\)3|0 -L @R\0  (0 P0Sy0(  )\FC -p@Lp' 40#`"B P0O 0$@0  $0St0191191 0S𩝘@Rf 40 -Là` L@Ap(0P  UWt0P.H0SP   aPʤ0  Pt0P@Rf -LXMP|0 U`' Jt;U# h;U J0U T;Ur FH;U z<;U ;Ux 0UL ;U: p(K;0S  0 S8 |0^ @$01F0S G *:@^pP p:U+0CU*0CUL:Uf T0CUN 0:U 0U:t  @0 5,0t 9p9U 9UIA?p |9U? 09U :890SD9@90Sx $0Sx9pq9U }8UB 8U9 8UcH0p0`Xt@ pSP X0S Z t0(0(SpE  @0h X(D0 @0CpKl0 p H@ @ DpP6 \ii 0\ ;g p\h\QW!Q0CU\ 0UGt0p;t07U d7U 0 0S |03 1 Rz80w l08' 20p7U 7Ul0p06U 0U=| 1 Q80 Pp 0Qp| px&0Zp pp0Ft0p;t0@6@p` Tp#*l0S ܕU| t l0 20  pP   l0tpP x@  P  | pt pp , pjTp@ ] 1 QA80> 0p 0OhDx0p8x0 @8x0  x07x00@x08x00 x07x01 Bp-  ]p' 1 R P|pPp|30St0t000t0t0\ 1 @T40S0 R.R 00CS0 18 p000 ! 00 !| 1 (0Sh0S  3/pPt  0    00CsQ 00000!30 !0l0 10C<0  0@-0S| x 00 QRT0 BR 0P@@ R00c!R!<0-L0P R 00c!R!<0 -@Lp RP`$ 0  BQ0A0 00C 0 0 Q  00b \20 200 00SPP0 0f -PL`V@-Q@)pQ$ 0S`0`Q@@  P 0a0 0S00`dd0Vp@hQ  f -@LP >uP 0SB>u000 p-@`LP >sV`0 0 0P  pUB> s -pQLP@p4 Q( Q+ `0Q! 0Q a a0RPP 8`P  0a 0 0S 00pe 0W R 0 $  fPUD -LP a@ Rp7 R0S* 0 0 0P \  0a 0 10  0P000  00 10  ,\ J0flUD -LMpḠ0S# 0S 0R Up(KPDKD@K f00h! 80 1 P b/ 80 1 0S b7 p-LM`P8  @T \Q Q 0 S 8Kp`|bat -pPL` 80 1 @T  9d 0Qb `xc` -pPL` 80 1 @T  d 0b `Vc` p-P L`80 1 @T  c0 a `5cp`p80 P/0S/0S/P/P" -L@P P*0Ss0 S4P: P0-LP@0P QT 4Q R0S0T0SR\ 0l0 -LPpU`@T * \4@0 t t5/p?@ 5/10UDUDUD4VDPVDhVDYDYDYDYD$ZDVDVDVDWDtWDHXDxXDXDXDYDXD`YD -L1p` Q PQA @@A00 P1D00  0t%DTZD+tZD -L1  `0S 8% Dh&h"PDhZD Q-LM`  pR KPP VU 0 @@cV@1`d q0V 0 pP ZDZDZDZD D0- 00@ 1L0L0@0 -L`@Q d0d0d `1 P 011 H0S L DP3/1 P 01$\ D21C c,% [D 0-L1@00! B!1P  8v01NU1:11X"t$ p-@PLp0`PP@pf p-L@,`P@pf 0-L@P@0SU 00  00 0PP 1  `0SE 0 SP00 -@L`pTP@P t0  101D0 001q 0z0@0ft$X" -L@Ppp`Q H1W P5T' 21CX" cPPD) W 70 1D  0 1 LP \`XpHd@`@P @ T0 @0@Z % 0@f,%0[D -`LP@1N \pP7 R'0d00 0!00*1! $ DD1D d` 01 ``1 @ 0 ,@1 0 [17D 4P@m 7fX[D -@L`pTPh!@P \0  1010 q 100ft$X" -LM@PP pQ` ` R*`pbV1g3Z P !0j0= DD@LQ00`!1``` 01d`d0 0 p0 P  PP&0!0e00,0 PZ 0j0 0 PP&,00 f -LϠ MϜ4 0 Q44  10 K0PpP X0,0 ,@K0sDD@0PQ00`!1```` 0dp1d`00X  n000 SR0p00 XFWB @ P`? Y& 00 0bX1! ' 0S  ;$ .X1! 0  00b^! 0 4 Pt0X00 tX,(K,t fʚ;[D[D[D[D -LMS -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V ʲ! 0P0 000000f0ePP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8`W 0 0g 0 1000P% 1 A @AQ PPQA@AA00D00 0g0` ` p&`[D0 0 ʚ** -L@P   -LL@L`N^Hp P <0E@0T0h),%(F,+t$ -L M0SB@  0@90pL< 0@뼐张`0@ @P#5  0@PPT`&VpLL I(Ko4+<\Dt$C,F,%D\D$* 0FL\D*d 4 \D P-LMp,  ,  0Q`%,` P`U0@Tpc>P 0@PV Us1V  P P@U`0X/@gT@!  0X# PU X`p0S P P0gX@cRTPP PpP X XPp , 1 0Y0 &17, 717 -L`RPp*Q+U! 0Q*U 0ScPPVU 0@`T@! 7/P`dVP |\D\DT\Dh\D R-LMp`@0,0 PP V@`;,K⼠,0S {PP3 젠 jR",0S W gpZ @1@! @`d VPx0Z0 c; 1,, 1:1,* -L1`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4`X  `V00S 0 X@1@!  d 00dS 0000 X  V00SR`` pP T)1  A @AQ PPQA@AAD00X@@X 0Xpc`0 1002 02/2/RP/0S/0S/P/00/// -L@Q 00Q02$* -L @R00 0S00 4 R0 0 Rq02$* 0-@QLP 4T R$sPP@00o$*\D  0-@LPP ٿ0 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , K @P P P `0PTP0 ,RX \ 0`h 0%`hW00S Z0 ,00(KW#VgXg0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0, 4 0 0f 0 00 00 0;00P0@,0 0 14 @jPP  -P0 XU( ,0S 00S |VU 0S:0f 0,0  00f 0@,P V0 g1e 00 = 00 0? @H]D -LM`XP@@ 0 p@ Kf -LM@0`P-P  Kp0P h 0PP 0S000VT 0V`H 0V003 `f d,h, -LMP\`@L0h0p  @Kf p-LM@p`09@P 0%@ 0 <0h0 @Kpf -LM@0`P-@  K耀0p 0  8@P00Ph 0 @f 0S R$  /0S$ / p-P!80Lr$ rp0`P0P0<0<0H@,  3,P03p0`<04,D,fT, p-@80Ld`$P R00 0S00  0S<0<pf0-80$ @P @$P0  191# 0/#R 00 40Q 0 ?SRP p-@80Ld`$P R00 0S00  0S?0?pf@-8 $3O 0$@P/ -@L<@ D0h -LM^P` 0S \  0 !Z -@LT 1S 3/ -L 0Pb0c0 UP[R<  W0@ 5(@/0:0 0? ͍~ 0 Q P:0O0@/Tʭ t$hD0S, K8  ,@T 젠PW0f0 X00Sh ; 1` 00S ,0S  V@KdD {D  @80P, 000@P`pVY4 R000T3WPD3 h<0 S@0  , 09h8 -@L060800*h) 2-LM R, ,L H32C0bP (K#0a R , ,P 0 0 CO@00 0<0<00D D03  A Qaq@3, ,@P,00< `Z`  <  , 0 P@h!   0,PZ , ,6p0 00 8劻 傻)|FC,%Q* 0-L0P@; 00U0 P6G0h A{60h -RLpP` 10^ V@ @@ 0R 0 `0aR \^ P 0 0 岯T`V`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ $_D$10/ -LM @S 1 !@ PK  0-P0@L$1S0S T P 0$A00`P 0 -L@<P  0S 0&  0 0 S-P;0SpL`p3*jV@ ; 1.7p ` pP U@0S0#S0` -LMp`$ K@P$0$P 0S  00CS 0$<9@ K(K ߽@P $  00CS 0 1  0@P(0B@$k< -LMp`$ KbPP  K(K 㥽PP $  00CS 0 X $0$@ 0PP(0P$-< 0p-L M`@ K 0 #PP* 0S* $K fPP0$ 0K"PP Q $ R 0S R $ ̽PP   00CS 0 P UKp$P ;$K 㳽P -LMp@ KPP%0 SP 0S` _0S`V  PP!0 0  0$P  00CS 0  ;7P; u1V 7P  00CS 0 p-LM`@ KPP p0$  00CS 0Pz;p -L@M\ `, K4 0 nPp0@  P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@pPH0t 0c0Qp 0Pp8  08 R !pPJ80X0 8K pP@Q& X" 4PU  0X!05  0305 ̼P0U @@X00 P0SpU0 cW, ,00@,00@ ,0DO DH p,  00CS 0 0P 4P (K\,:H0S wW #W -L(M`0pS @K P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp ӻ@P8 P(@P`K0P,0  000 0 0000008 $ <048@0 PP$0S DK 㘺PP, (00(0, 00CS 0& 0 (00(00 00CS 0 V84PP @s809080 Dk8,9040 08,8T) 0-LMp@$ K(0 PP$ $`0A?AS  00CS 0$w8%P K (K0PP 000$  00CS 0 (P uP({PP0A?AS$  00CS 0 ($P$F8$B8`@06F@ 0\PP U0S3f4_D -LMp0`S@   0KfPP,K PP (K,,08 $@ .  9 3S PG0,"V 4 K>P,UU<w< 3S9., V47,N8,U0P18 00CS 073SP 0 0F6l!DPP 55 #0P36  PC   A,0 ,0 ,0<, $PP  R 00<VPP ,U4E7,7,U< #P5P, (00(0, 00CS 0 @ 400,^7 #f<_DT)D_D p-LM`@ KPPP p0$  00CS 0P;7p p-LM`@ K2PP Kp K0:PP   00CS 070  $P _ -@PLQ 1S 0 Sh0 R0S0 0C#qW P`Z0 ` 08/WP@TP/ s4P/( /0S00(0   (/+P/ 0  0C0 00C027+ -L R r R0@0T  (0 (@T@T (e (00C0( 0(0RI @T@T1 &P R`3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P >@TZ@WP6@TPZ&R00$Q d0 R0 D*@ R 0R@+˚+˚,`s4P 0S  0_ Zp, -L MP4 `0S t2R P(K \ 00^<2< L 42,B/@!bQP0p1`k [P @'; 1^ ` R  @n@ T 0X0 P 0 0@Cp0PK 0sD 0sA 0SSB , pX 0@D0 0,000  0  04E5 \,K, ` PW,pK‡@ ̧, `FV 00C 0,00C0  B sPqQ7Pl` PPg`P$F+gfff Q-LM<  4 0" 0C#q 0Ah#Wk1 80 O40 00  ,0 0S Wj4@PW P@0S$00Sx S  hAPp W ,[SWO40P@`  0`W1@M 8P @VJ0 1P54@TZY(PM ,S,2SU @, 0@0, .W,S00S 4Q(K4 , , SW0(P00 (P0 , S8 ,08 P 04 0<  0X W  B 00C0 ,RP 6P +00S S/P/P/+ -L@T000S S S!00h0S00 S  R  R 0S00  000 ;L_D 0-L@P0S000>0hP -@0 LR )  0S S S 4}00w\_D -LLMpP0S/@ (K iQ0@0jQ@h 5P 0D H0 D 0 BpKp@ h0 l @P r@P\`00S&@  '@00 >@PxX 0R)@ 0 2 0=@P  t P  000 0 $ 0 0(0 00 0,$0t  $0  Z@ʚ; -L @R 0x00>(0S 6/P) 0040 R tOhhO+ -LM0S@80Cq hR3PU/`,☦hP`* j0 p 0 0lK00@0 l0CdP h0 l DP < `PX@T TDK>TP O&'0`$K`'@KJ 00 0T XKˠD Kˠ =`PX0px00 P P0$00(00@ P,@> -L0@S 0S0S S S pƺl0l PD iMP7@8I$0$ P l_D,,,, Q-LM@p`6 PXP Q00S0v03Q0SQ=44؄4h44H4444Ѕ4444\44|4H4$44t4 0S -X Z s- 0Sp fJ D V8[TPC PA 00 0 3@P  80@ 0$@( 80<@,00@@ 4 00 @5U6 Rg R7 R5 t0S( S S Tyw R 00T0P 4 0 a00400 0l 0[̹PV00,0 0"PJ UpJRO   40 0c c 0PXP0 40 b0b0 0 0Y0( %W 0S80 P@Q 0P7W  PXP0Y0P90 P, }n _D+_D_Dx_Dp, -L` M:/Hp`@000p:/p@0h\0P:/@0@0P:/ @0($0P:/$K+_D_D_D `D,`D,1 -L R ) 0S, 40 <0`pP`C6OPU` pP``pd  Q$0$0$00 $0 $ p0<@0A/@TP@PH 0S 0S ,$0\)FC++T`D+ p-L40@!`40 P0l |40  40  40<40p40 p8Pp 0f`Dt%Dh`Dr`D -LM`T@PKL@ HP p`K@P 40 @ Kf\0 -L @R<40 4040040hvj)FC`D\0 -L @R<i40 4040040hZN)FC`D40040< X-L MLHH2@2Q 00 ZQQyB6L6c `pO`VpR @_d ,0}0S00P0OW  1ZVA1&Od 0PalqP?ڀ!00T!T?2cdS0d008a&@0,S((100R 5 0.@峰宰0 @@0 R00C1/0 @L0 Kd 0044 d0  T0E4F 0OP`V0S` 2pW% P`0OV 00U@/R v,d0UQt0S<0p RP`P`l,+f+8F++0- S-L M40 0 I $ , `P 4T@ PK? H(, 圀4p@0P  +P|倠tx0&00`Pp@P R00X3 `4 P,#(K2#P`0PU`/R, /t0S22 R/4>0Ÿ#6Po ?Q$! t0ShŸ0 ?Q[XBP"00w, "pa $-v22 RPq@T (P `H!0OQP@T1!h0\ p1 \ dALuP!0v,0pt40P;400W )^], pXQjP `0p RcH0p Rv,0p?0 Lft,,%!Ce,++,-8F+T, bD0-+ 0p,4-bDbD -L@ 0P  -LMp` 40 , 0 0PP KTp P ` ]PP 40 40 8400 [vt0@T P(KP @00@@0D@4 4 Ta f8bD+ -LMp40  Z00Sx0LP Z p0 0@p0t@$K0 0@0@4 \) 4 (08P0`@ (0,@8< }6 h000+ -LMP @Pp, Z `@p`P P U (Ko2,1 -LM@h -L0Z (K  004KP L0 T0PK,@K@5PI,04 @r,@ T> A P< hDPH <PP3J`H1pPUpG*JPK0OT U00P< @T H1P @40;40G<THFP0H0< H@0TD0 R01@P BH 8 P`(080@ (0,@8< DP/40l@090\@ XP 40D0 Poh40K  | \K0P`8  8 <@<0R0@@L0 h0lPp`DPPt0 S !1t00s]@@x0LSDT 0S)D0DP4 40K)D |0@4 H0P0(P`80P `0@D80<@(P,`H5P h000  06+t%Dh`D@bDԛ4 \bD `0p-LX` T0@PT0 Q00cR0bcr00cUppl,8FP,0 -L PRL 40R040TxQ@p0X0X X0 X T0T0X0pP`Hp0P` ppPt`HpL) GC+X- -LMLPhUPYS \1 RL<0hPl@0C6 ?S0@ ,P lp*p0K6@ d P" 00S$0000pP`@ P`P `<0C6 ?S (KRRTTT T0冰@@H H0偰,,< <0|J/,0w)FC+t%DlbD1bD2bD'bDbD >0-LMX4h0S6L0S80 R0  RڼP 0(6@0@0 @ h1@P X 0@!0 R [00 (0 0@(0,@ ) L ^-0600 9 0>  0@P  .t0 @P p'X}\40 @P $  –, ...,GC p-L@`TP@P  R0T 0@ PPPv@p0@0@@P1 -pLQ`P0Sȸ帡 0R1P W0pH0@40H0 9,0(`8倓|0S: |P 0m(1PW, W  @0@00 00S 0Rؼ0Pml8 RR:0.S 0  $0@E TpT  @000R 90.S,.F.h-.4dD. -L M0 0@0a0 +,0 G;Z 000 P`,0  p @0 00Pp@`Z !0,0 0(K M-LM0L00 , 400S 0P`p <0@P`pG P Y W 004  ZW,\ (KoW(K, 00f4 (Ko(Ko 0@dD -L\MP T tp\ X0  L 0@ 0@0 @0@T \ P` 0P`Ud `0 P0@0h0 P @ h LPL04l Yl\@, 1h\ 0OS"U`U P ,K|L 0+PPP@|0sI ,T\ :PrT0p PPT|00@(KT h0O4 0 T@S*!0`4D0 @@ \D 00bUH0 N h D0L@PH@@p PP@h TpPMXV0sP,TP P|0p 0@VP@@@h@ uP0P@0h0 0|h$ɯ QfP0 SbT  0O 0 @U? PX0V4@K0@PT<@ 8P UH\TP L 00C!`LPg+P6 @UU+;TP0H@t p @ @<@K0Lt0@ PpP|V 0Lh PP `d0K0@d0 `@ T@0 0dKT 0@U:U*+d;<KT  PP|00@$@- R00 RP00//// 10S0<0/, 00//@Q@- 0@ 0$@/!001 -L 0; S 兜. D!-L0hqI @00S5 40 $  \k4P$V x 0P P x 0S00 T00Q0S4PkV<40)<40X 0jxP PU  0P ;& > |dDhdD tp-P MLdd 0 P PH0H `VPP@P U$@Kp.(dD,, -@ LP( Q,0,0,0,0$00( 0, h P P-LM,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W0 t 0gR XY V0 qrruuXuVzrQdD p-L MPK0@0% `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0?0 0C0hԚP/ 0-L@P>UT004ћ0P0T 00   R0P/, -0LS 0R& 0 8 `pP/ 0 0@P Q $  (0S 0 0@ 0R0 @  -L MP0@T$pK `K$0   0`w@P Y0DS 444|4P4 0 0 @K 0 @ 0@ 0$0 @ 0$  0@Q  0S v 0  0$  ? 0R 0 0@ -L MP0SIJ@PQ g @ 0@ 3 cPQ l0S\  0@  0S ` K  `V" $(0(,@<#P$00g0S` ( P,0,,0,$0( 0, V 00C` pK@'`(K 0P (`P H4h4h4444#``T $0`P(  0Sa 0`0T$0 `P 0(0@(r0SO P ( R,0,0,0,0$0 $0 ,0( P((0$0 PT) $ 0P( $0  m@ 0R=  0R) (=`X`0P@(0   ($ -@~(0$ (0S (0S 0R$0@P 0( '`!,- -LM0 40 1Ph1,0 080 GPC`VB p pppV4X 0 P; ,Y0 = @PMP$ 8 ` p4@00 00$ 8 0C ,0 00Y40' Y Y PP P(K`P`(KoY0P1, 0  P PU 8-L M((@ 8 0@_KP/dD( -LM@P0p,0 80, `&0 Rd 0 c o$P00S 0P0CS,0 &U! 0 , &0SEx 000@ ?YL0$   YL0$  0  R 0  U L0$  , % eDdDdDdD -LM`,( 0 080 R0 0(40 S P< 00  , c&<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  &0Sy 0Sv 40 ,  00,P #@PD R,Z ,0 jb, D@0,SɌ,P00S x@T%  # P, #%,K0 pW^,P,P00S SJh30 S ( @<@<@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP,  (00CSP  }40S,u @Q p!0.SM0.Sʌ,HIS,hR 8 @0 "  RQ T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@ ?@p y$p0S=t,@0 R1L0$ ,  0p ]$[ , x~00S L0$ 4 Rp L0$ l p@0 0 jȌp,0 @pjL/@ dD -L(Mp0(0 Q4 Z (0 ,0 P 0S 8+0x`V R ,0 80CQ0S/SL Q0/S l0` 0 80$0 R 3  0/S dq Pt8 `^ P8L0S < P`Py,0r 0"| Rb $0S0$0s0S8D0`0K0@4 PP PK4` H0 D@ 8 8寕8000 8P0/S``8埕00(K@㤖0S8Z8+0`Y0$S7 8兕`哟 Y#Px8 ;,08pm`>`8|gC  00 RHZ `?`4d0b00PSJ8RL/. eD`eD8eDp@-`@\( 0S% ^P) ^ R R@ 0 0 R0 00 S0  0S\ 0 0p0@ 0 0  R \,  R/ 0^ 00 S 0  0S0S0P@ 0 S@@ 0 @0@ 0 0 0S00S0@ 0^@@ P@0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -L`@V3 ^=0S`PVPU p` 0S`` T PR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0-t@0t S0/ UTR p-L@PT `P`@@T@p 0-L@PT P@@T0 p-L@`TP@P  R0T 0 PPP@p0@ 0@@P0 /L0P/P 0S 0R/P/0 -LM` 0p00Ġ R 00@4h 04 0Q$0 $PK @$00$0 0s0P@$00Ke`00 l 0 $ \` P0T0L0DH @08< 40,0 X0(000 00/L0S X \\0\0\0X \ QL/0SX0 X0\0\/@0D  D R80SPQT0T0T T0 T P<0 T0P P T0 D 0D0/0 0 -L@p`\L0S XP7/PU L0S \ 0-L M   K0 P KP 5-2L?0Q Q x 0S00S0x0S /40  0 R  R x 0\0 00R0S R/ 0-P$@ L0R 0100S P 0$0 0$0@-P @Q -0E0@0@P/ -L M@40tP`|p,0 H08,t 0 \9/(P`LPp儀<8` p9/9/(KeDeDtfDfD -L M`0Pp0L ^x@00P1 @5/Dl@8 <0@5/WK5/d@T t5/ @TT5/h@T 85/ @T- gD|-gDDgDgDgDgD  - Lts,0 S0 h@0`0h p x`<@@PD H00,T0X@d\L`PpZ ㈅BZ ヅYNZ  el nz -L M @$ `R0( P4"49/ 09/8000 ,@ @@0H`04 0,@00 `p@9/X``@0P00p9/@0 009/x@0hx0P9/@0p\0P9/YϊB?0 89/49/@TP P1ł"!10C cP X0S) RP9/X@T9/(^$K9/@T X0S, 10Cc\tP9/X@TP9/T9/H9/gDgDHhD|hDhDhDiD@iDdiDiDiDiDpEiDiDiDdOD -Lp@T P` 0 `@S PQ 00 R 0 QR0,, p-L0`S"0@T  P @T  PpL@0Q @`0(0Sp3/p ,,iDH1 p-L @RP$ R R000  40@ d` h0S% 0S0 00@`p@0h`00S S 0 p 0?x0 R L0L Cp0Q@0t0 t0t0p t )DGC!Ce-VUUU0 0-L @RPh0S @000CS0x0H0 H d0S0d 00dP@0w)lGCjD -LD R @0 BD R80SPQP0T0T T0 T P80 T0P P T0 K 00jD0 -L @RJP!  R R000  @  h0S 00hp0Q@0t0 t0t0p t )dGC!Ce,jD -L8 R 00S080\jDC40 GX0[SK0SN X 0RIK0@ XK,寀4  @ XK娀4  @ XK塀4   @ XK嚀4   XK@ 㓀@0 XK@ ㌀@0 XK@ ㅀ@0 XK@ ~40  XKp@ wX0[S \WK☔0SH哔@ j–XKDGCjDiDkDkDkDkD$kD,kD8kDHkDXkDdkDpE@K  Q2 0 :#:00   Q  Q@00 0TXKD K}@ 00 -LM @ -LMc@ -L$Mp0P$0 fP $ 0R* K@@K }P0PF 08KD K PD0L@H,` 0P$048,0/~X–GC -LM̀p0`$0 &@P $ 0R$ K@PK f}@P0PF@ 08KD K @PPK D@DTl }@DX–GC -LM0P ,   p PP  00 ` L P0, 0R(K0,00  LKT KzPPL@  T 000H@K }PP L0S Tv L!PP g0P 0@KP K PPP P00S-P  SP{20S P00SP  0PPP PP  @KP@P 0@ P PP P 0cPPP <00<0L0 0 L08!L0 L0P$% 0@ d0 `@ l0 h@  0%K5K P @0@UKl0KPL @)P0PP0 | PuL (00(0 PLT  (00(0L  00CS 0p LlFP](\W 0-PPU|–.GC -LhMp`0@$0 PP $ 0R* K0D cKP `P \  0 X@ GPPt@@K SmL8K0 <0 @ L0 $PU |PW–GC p-LMP@P `K )m\ ||P Kp/t|\ o|Pdd.i| -LMPp$ K@P $ $0L`V  00CS 0$@,0 $  00CS 0@ T$048,0 @$b @0-LHMp P80 dK0C\ `0 d < 4P P KP0L@,`0 P$048,0 r -LMp, @X,K0 K`P*00 P0 000@0" d0 A0C` 匐 吠 <0h` `p K0"0 K`P V v`0,n(K, <`| ,00,0, $/ 0@ @0 <@ H0 D@  0#K3K @0@cKb , H0K@@P 0,9`0[ , (00(0Y$ ,0  ` L0$ `00S< `PAOK, 0 0 0 `P   ,00  (00(0,  00CS 0,x< Rv00`Pn, 000o` . -LM  @#K -LM c K -LMpP  0$S00PS   y0@0 KP x@ T P(K0 `V(P x@T P ` $1-LM, 0 p宣@T1$048,0, "`P+[@U PWPW X*Y,`, 0P C@UW X00`(K00`0k:00 -L PU  PW  0pP$`@0$00@0 @$0@0$00 -LM`80S x K0 P00PUp p@0S 0S PU@0S W @@T W  0p 0  0p0  0p0PךL/\oD -P$0L@0$0p`P T00$0 0@0 @P7 0@TT  $00#X00S'Q00 0 0  P  0x0 00C0@T e. <0poD D0-LHM p<0 hK0C` d0 h @ 8p +@P0TP L`0P @P$0  @ K40  "P@ 0_@ H5-LM45Qp , `PPK Z 0zPP , 0RV(KD00  0CKP 0 p PP̠ 40C gP0 UK0 PP10 H1S QPP%LP  0L `$0`0 0 PP 00S 3P0x`o (|pSL@ X $\  -P P0 P  PPP  \!``uPP$8$$$"2 0$0K px@ UX 000P  0@@+  =$0 !, 0 0PP *P 00<@K0 yPPZ10SX1 bX! RX! ] XPiPx0S`1  mPP @X  0$ 48$ \i`!$\! 0 S.–GC^$%0, -LM ,00S- K3/ -L M ,0  <0S- K3/ K -LM ,  0 $0S- K3/ K -LM ,  0 @0S- K3/ K -LM ,  0 D0S- K3/ K -LM ,  0 0S- K3/ K -LM ,  0 0S- K3/ K -LM ,  0 ,0S- K3/ K -LM ,  0 |0S- K3/ K -LM ,  0 T0S- K3/ K -LM ,  0 0S- K3/ K -LM, 0  0$  0  40S- $K3/ K -L M ,0  L0S- K3/ K -LM ,0 0S- K3/ K -LM ,0 p0S- K3/ K -LM ,  0 (0S- K3/ K -L M ,0  h0S- K3/ K -L M ,0  80S- K3/ K -LM, 0  0$  0  l0S- $K3/ K -LM ,  0 t0S- K3/ K -L M ,0  x0S- K3/ K -LM,0 0   0 0S- K3/ K -LM ,  0 X0S- K3/ K -L M ,0  \0S- K3/ K -LM ,0 0S- K3/ K -LM ,0 00S- K3/ K -LM ,0 d0S- K3/ K -L M ,0  0S- K3/ K -L M ,0  0S- K3/ K -LM,   0  0$ 0  0S- $K3/ K -LM ,0P0S- K3/ 0A-L MS~5|~5<~5<~5<~5<~5<~5h~5<~5h~5<~5<~5<~5<~5<~5h~5,0   H0S- K3/00 K<0;0 -LM,0 0   0 0S- K3/ K -LM ,0 `0S- K3/ K -LM 0, 0S- K3/ -LM 0, 0S- K3/40040/ - M@L̠ 0 @PK$R @p-PL@` P4D 8? 4  0PppoD$! -L|M@$`p0\)  0@ PP00W00S 0 ! @`#T   \ Q T00S PP$K K PP x00b0at f@ 0-LM KP rPX l eK00 000CSJ85P5X5`5h5p5x5X0KdpK0 @ @D0@ 0 h@\0@ 0 P@t0@ 0 H@L0@ 0 @0K|KpPK`4;DL0P@@@0DH 0 P$`@,p0(@0400K80<@@@@0T0@X@0\0 (K  $ -p$`LP00S3 @@L0S $0 0  p 0 4 @00c@  %  0S@ @ -L M$40 00p0  S, !P`Q VP! , 0 @0 RP 40  P000c@ , (KUP -L(M0`0 p0KH@ DP P L @0 < P,0 8p 4 @( W0 PK{X@ Y@00 (K0 PK}X@ Y@00@0 S T R@ I -@<0L0C<0P`p :0 @ -LM`(0$p @PK 80K0@ ,P 8@ 4P K 0 K -@0L00Q00\0S  1 S ppW P`V  'RU0 ` b 0a0 -LL0$  0 R40 02&40 WP -LtM@0p`0 a 20 S] ,< D00( ,0PP100S-PK S>PH K ` 00SP< PP8 0ZPP1  00Sb  0,PP%40 H<00<0(K  0,0@0,0(zPP0S (e0P#  00l PPSPPK 㜀 00@ ( 000 0PPk { 0PP@;40  00 e @KP@ 0|@ xP PP -LMPhp, @P t 000(K` H000 / k@P00H00\ 00 @P 00, @  S-LM 1 P   K00 `P0@ L 0Cr 40 0΁pW000P @ `0|Pdr7 Q  0PP   B ఀ0000>~* R3 `1C"A c3  1C X0 ` 00@ 0nj11HCnmGCQQFqD0@- $@ 2 001PQ   R 0\$0^0T00S 00"011Q/ 0R 00/ -LS0@hx0 0-LP R@ 80S' P 0 0=z0 p-qD -LMp0@L$ P PK0`Ku00 004 0 0 00  S 0000S K$ Kl PPH$ 8U$P 3US $0 $0 $0T $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ ``0$ #40S$0 d  S0$ 0d0#4s00S0$ 0d0#8s00S0$ 0g004 $x0s0`0#8s004 $x0scW YPm0z T0XV 0s0^\ S0 0S0e U0Zz0 -LM@0 p4SP4` x0s $ h *iP(K  d0WlW;`0 00 , `pdX01oYdp0$00W 0, r 00KPPX0 G,2#tp 0Q= x0000s7 PdX0A1 A,0K?PPdX0A1)\0080 Y `0X,  c BHd04K 孷PP 4` XPPX `d07 `40dL80cT 4却4RqD 0-LM PRp@ 80SH0S` 00S`y 2H0S DLL $00  0H0`p-$rD -LMP@404 x0s` S0p`d R#*d0X  B0C2!03r T0Q` 0`P0dP$00i!d 0p iHrD -L MxppPQ(Ph"@ @D0 @P< `<0#0 0AT@T 0S$0W0V00S  PD0`@(K`#00K`P'= o0<#`@<00@0 ` `8`0 P0$p@ 0)O`P 0V2hD 004 0U 00b x0s\ ,K 40KP`,H R,P R,0 S ,0 T ,0 4 %,0 4 %,0 4 %,0 4 %,0 4 %,0 4`, 040 0 0d04 x0sA 4S0' 0 000`Q% "D @b@0Sw0 40040S x0s``1D @0`0d0!55T000 0 x80KPP P X g`0,0 $ (` X 802d0 110drDlrD40  -;L0P0F11 -@LplP`?0p8< U##00V 0aS0!40Xl@-P`@p h\00|0S 1Ph 0\ RP00  h0Q0h0p0Q0p0x0S0#x0%/ -L MßD D@ 0 `0<` 4Pp `\0 o ^( Kd0000K`",nQ4 |T#000W{x00 00 s@0É8K4 K@0Kr4Q <P 40PQP2|0s L@LZ0D0PF0sub,t 40h@Pp0, Qg p@ X,0K@P4 Op W0@|0@4 , 4@ BrDX2,sD2 -LMpP @ 02$p  0 !P  0P:0RT0T$pL 0X!^4E  T0 #T1 01$pP0S6:0zlPi`P00W0S W ᵪ( K,0K($K ,0PP$px~L 040 0  $pᎪP K$刪 -LM`4pP4K(K 05@P$,K4K(0嶯P,(0L R:S 0S Q0SY$KUPR,L -LM@Q`PdX 0`32aD6"\\050@0 0PvpPX 0\ L `X H0@ a 0P_pP 00 0-LM$4   0-LM`4<0  <0DPD p,K8 K0PP40K8K,0(PP.0, L0P*0@SL0 @0S0S 0 uKP 0,  @L00Sṩpᵩ(KUP0孩<\PP0奩<00<0 -LM4p8K,K 0P@P80K8K,0ѮP30P,L0P *@,0PL0 @0S\ 0` \ KP d KP 0b^pZ(KT0Q@sDLsD -LMp( 004P @4K,K0C00X @D4 0`P1(K4K,0w`P-(\0L0 R (0S  @000 A @D\0 0S (]`P 0\ 00T00S$K( -L M, ( S0 S0 p>_(0S h$K``0\p \K 404`VWx0sA ,K` X0H0bLd0 pPA,L0 @ 3  nJP,0x q4P0 40X`0S) U% q@0S (0%,塨 (0K,p pP(S0 `@0\p,p\ ረW,,p_sDLsDXsD -L(MP(dp^L 4:dX0  a <à 0, `PX0,d (#d X4K>< K,0K`P,0( SH \00K H 40<K刭`P00(\ L @H IP IS 0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS00d0#4s00S00d0#8s00S00g0040x r0`0#8s0040x r0c00,0SK7D  @  D 0 @ P9 ,0 @D0CS,03(0\ C(0< K`P0 (4K A(X>t`P0K<K40`P00\ (L @d 0(K0嘧0`PL R S0 `, x0s P0H0  H L0,`@0P,` H 4)-LhM0 ,0  H x @6| T0 0|0d 4 ` S0t , 0tR/(K@ 0Pt | Pt @40p@ * 7K0P Pb P t \ X  `\ 00R   S R\ q T `m 0Y 0R S .SY B0pl0 h0 D0 @KdhP K<0KPB`HK@0PK6@P4@PHHPL @0 s 3S00S9 \0S`lp R PP pϦh00h0 +X \ V\`lp  V 0fl2l Q 0\0"'t V |  ῴ0t0 N\` 0\\`S  P X0S@H` 0 0  H@7K 0HPd(pd 0,0`0 x 4r` <0SPZ VPR<` Hc v 3`x0s00@`Qw T00P00SS  Q u  0Pt d`0S  Z R t ` <D0KnPt p0|SD0 0;0x t21}0X0 \ d\(p\0A,00.S  R R0.St`R <` T d`0S  Z R=  |0  |  T   u ~ 0wPt |d`0S  Z Rr |m0 @40hQ`K0t0 aH嵥t@ ]P t Y` <D0KPhp R T0 x 060D0| T   d00S  0,Pt 1\d0@,0l ( p0\;0t #tx 06t 0x }0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt D0p R |0 x tU060x Pt@ 0t@ 60x P060 D0t –KC/ 00 00$  / 0-L`P @gP 0 40 00 -LM0K@`:P000   "-LM0K@`)P0   -LM``B0$0 ,` (  h0PSp 0S\, K⾿U   0 P$ $K\5sD p-L00PS@  0< 0S  `P  0 Pph0S 0S p-``P,0dSd L L0@ 0@T  T0@0 @0@ ,00@$( Z ,FBZ 'F e| #F t Fp -L  p[`P`R 0x`@0Q `<;$0 :$0`" -L8MPx0p Y@P (KPڈ7 U@  `0 ``m @T$0040  0w@P(KH H@, :H 2@P" x0, P  4 0R f  V P <;`,; 40k040,L@ 0 `4 < !0 p4 L 8 !L0 \P4 "0 4 "0 4080 0$02 0$02 4$ 2@SQT  0 40 00,0 0 $8  0 PP $TQ80S 0 40S"x 0/"0 0 4(00080 0$ 00020<0St 80L pL Pm:0@j0 Rg 8^d 4@,0@ x|D 0 ,@ q8 <0 P 2@?0!4 H @D000H0`|80D4\t0 LP 3R#0D  0 D0x02t\8Ll00 0l0|0P S@C,YP@l0 4p0D0$0B\0d @`Dd 0@XR O@@0 T400,0Q,嶢0,0 |QIP00B a|P< P P@P$00104P00h010 0`b删 x0e"0# $4!X0 @0(.XH0 00@0&0%40| g0  x0y4; , @0Wd0X@P lp@ lP L \8BAQU<&`d0 ` ` P6,@K.QdT0@K @姝P,KP8 K0<PP`0K8K,0彝PpPUX^OTL0$  P 000FaD ,-L^M 0 , x 0|1 S 4 !  QKF :x1xq01 `\ha dq | 0@vx|A1` 2R1 dAT@@pq ` \ x\ |Ahaqd0gaZ_K`.K XPU`X\00d 1 ՟pa50 ` 2 P V1Q0 W p!t! p1 0l1 |V/KS?KROK@P KVKH16P PX! H!D0 cQ!L! 0S> PR Z?K `p`p Q  ha dq t p! l! L!A0 P0S 0 @`pR Rh d ha dq t p l !LA0 P0S ᙗxa\{ |!ahAd0faZ_K`.K XPU`X\0d pa50 ` 2 PV1Q W p!yp!rx1^K`PX`!xA 00b0ZKx! |Ad0PQڜq0 0, 0R!(Kx0s `p `a \q 0x p40 40Ȍ; \ p@0D @ 021KlPQ  KK81Kp44 (@K x0C` @ < X8 0n9^ ^SZn<ZRQVp l0 T 0\0 4 ^d0 ` R)LDd0S*d0 \ R X0P H` \0b@  0l \5 Qh0 |tTl0pP` P `5>VNP1hV0R3Q ʧ Ld0 0SXU H Pd0pppv0 @L600Dp0|P`t0Sm |0s] THP`\0d iZ!L / d0Rp:LdP P)00 T L8Q\ ,H0d 0S* 0ȖL\0P00T \c H0XORH 0Kd0P P\ 0喔T0LQ0ؖ0冓@U]:0s\0STT\ 1x0SH `0X| c a51 Q0V 1`V@ `V; D1, R@T@T 0SPU 0 pR*0 0# 0 0# WY } P P P㨑 1 -LP0@S iPP $V 0 Pahxԁ6FQ -L0pS 00Cs0 SP@ 00 CSr  RQP@T`U 0S U0S; 0`V`V "P "P0gS"\ 00Ls0 S0gP ^0P@@00L\s0 SL0!lr/0A!b0RPXP0S 1gfff -L@pPl`P R-62/0P@ 2/f p-LMK`f@PP DPP pPP7P  -LxM\`XV, P@ <<V 4<Vc (<0SpP <V pp, 0R(K;VM 0VR ;VK Pp &;V H;V P0CV0CV*0CV 0V# 0CV \  @0  p6 0#<0S Z@ 1pPpppppd:V} *N0CV[ 0CV 0Vj 0CV0pp 1<ph06 Y@  9V5 ?0CV 0V: 0CV1pp 0l9V 90CV  0V 0CV{TpPHPp ʕpA 9V\ 0VH 70CVf?pP31Si  3/00 pd8VS 8VO@1pp 0X8V 0CVCpP pP  p @(8V 80S*pPLPK 0K0pP 00 't0pp 0"p0pp 0p@pP1S  3/p0Tp F pP6"  'q< 0 \&    pP  gpP pPPK@ 0K/pPRO@ _@ p pP0p t0  :pP pp &!-pS@ Eqh X y6 h FqqR@ ?6 `R@ 6d2VR 5VNL2VP D2VL82V@KR@ X@ 0K/ p01h h s[p5Q@ q \Ah0 h P pWHh  `@h0 h P pW0h bOp la`P2@P m  p –i$ii$zi i$xi Jii fi 8LCi i i i$i i$~i ?qi i Fi@6i(Kii p!-Lhahh0@0S000 PT 1S 1 RP= T &0S T$0@(0$@0Q!R<10 R m T00PP  DpP ! p a3111 DP"vD -L@2000  0@:Uh1 -L@00S0 0000@hr1@1 p-L PR 4\1!S0#R:6 h0 R0 0 00  h  h ph0p 0 h00 @0tP@:d0@P `KT0S ph)T000 0@@0\)`LC1(3$3 -LapV4P @)0(2f -PLr6 ";6!1!1!`4CỀ=\ R1 0 00  h  Qd10 0 0    @T 1S 0 0@T$Q  $Q1@ @A,040@T 0 R 010,Q 2/@TD0 01f6Dq6Lq65zh11P"1 -LMp(2S G8 Im00S P, h0C00 (s0,0  ,0 (@`(000 0|Pm0 U060l00@0a0 p@(B  @0PU0doz46 L-L M<@< 0 P*  uKh/l2t(vDh6 -L0@S St PT0S h<0SQ0S 0S  P (C p-L4M`00 PP% @ P' P% 0 80@T P%00t 80@TPP@ 0R KpJ K.0$n0|1–DD@LCHH-0#" A0:  A0  AQ0A0ALC0@-PR@00\  1!2# #!0LC@-pR` @P@@^ 0,>#! """!1# lLCLC   -L"@R\0700}"R p-L@`PT6 T T/p gT cTp0S 0S0S @T  QT MTp3000   00;Tp@T  l2Td .Tp@0^  0@0X B0000Tp1111 -L M@,.PK4pK `P:BT/@T,  P P00CS0"Q4`00 000720C2 P 20C2 `(K f -L M@ᔡp.K4K `8PP .0[ P(K40[ BT@T  pP  jP0007 @P"  {S wS00 p2 S0"04P0/B 2 02NP2027Pf -\ \:6S0d0\-P@1P0p040\0\ i2i 1i i i -L@  `Z 4   P0 3RQZA@@@ R+,66ط66666666666666666666666666666ж6( 6@P 804 0C`808,/@4K @Q@.K  9Q@ LUpP7@ ` @ +QZv 4K %Q@b㲡Q< kq@PJ 1 01q 0.K )PA@d.K  0xP 1  6  ?@TH @ $@0D!P`2 4 R!1R.@10!Rq@p10q! !0/0@ 0@ 0 0@0@ @ PA@ Q7@H 0TP@e  0 =@]4vD$%|vDfʚ;Q0\0/ᨁ0 Q-L`p0CQ:x0Q %0CQ\P6@06@W$000p02i i f6 -LpP LP 6EUp 4 20S30@ P` 0OP`P` R R 8+1Q/Q@ᜡ@ D0RH00H0Q 7TQ@Q40 3A0 @  100S၁@10@ 0 @ 30P@ `M0S M0@ P` 0 OP`P`000 0PP0VA,|vDhfz(3$3vD40 -@ LPj 3 p-L`@ξPP p 08*0 p0&0 1!0 Tl0n m L 0Ap,@PvD6t6 3 -L@h1- 0 `0S S 0R 0 R/21C 0/1 p-L `\Pp0#U Tpu@^ 00000   Tp -L P@  @P 00 ST@P0 #>*vD -P`QppW@L hTf 1R' 1RP  0SZ0PS000000P 0S 0S 0S @P @P P4   R01 Pp`PP`p \ P1P!ʽp PU00@  01 PU@PP ヿ @P0PP!$$P5i 6i( -L@`p  PᕽP 0` pP0  0*vD 0-L @P6P 0  T)0P 'P 0 P*wDDwD -pRL`@PPU@ - L]U0P*6$3XwD p-L|`@TpP @T D1P t  @Tpph(3-0S  0 00Sp@-0 @PbUe\5* 0`  0`R Q T 0SQ 0S p?^00S eR 0SP 0S p~3p@-0\Π@    @ @0 -`PLp  0  0S0 @Q<* 0 RQ 1  \0R 000Q ^f 2 @ 0 @ PP0S:  0   @ 0 PP00 -`L0pS0S 0@T  0 0S@0SP U 0Pl 8/PU 0 p -L@`0 R@P0Pp@ @ 0 0D0 80\ 00 00 0( (0p 06`6(6`6L6 0-@0LSP0p 0P000h -L M 0P!0 R (0Q0 R0S Kh( 㱻0P h0 l0d P*00PDP K,(((03xwDP"3wD,3wDwD -LMⰒ`0P@@PRPU%U〢xx2 E>L e9LQk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  P@TX00S0 'P@ 0p K(1, K0j,0S@2\P P Q0g 100 0  d 0 00`0 R 0g1000<(㭼0LS3\4,3MCwD -LMp` P@ 0  @@0S  edPrWP~V UV PU Rm Qj 0]0R. ' Q pRy U 000Sp` 0 @ 0S@@0 @@ 00 0 00CS 000 ^)0S  \ R0S Q Q  0Sj'  P0S `V 0FS 0  PP  0Su PU{ P R 0S; ='Pm@ T0@S@@Q 0S,0S   0S@W`   pp0`V`  ppt0pS  W0@ 0 CT@ Q T00S 0S ` 00CS 0000R 0XX @&H&P080 $0LxDxD$xDpxDxDwD03 -L M` @  0  @@0SPU 00 Q *0 R  0R  Q 0P(K0S@0"0S  0S BfU10040 PPU  0U 04 RPU10,0 @PUk04QkPUd 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "00 p 0 0# ^P 0R !P0  0R01p Wx0  "0 0 0#\d TP`P^ Q0-L@P0h'0 70P0 @P00T00S0P00T0P0 -LM< P`Q@ 8 4` 0` 0<, K,0S@ Pp+ p@0pS @dP Q  V Q y0R nP  0R:P T00S p 0S < 0 0V 4 ` 00 , @RT VO 00~SJ@80S  T Rp@T& |p@T 0X0P  ,0SP 0U P  0R:Pp PI@P  00 0P0@ (KP0UP0s0S2 R 0xS0S R0 0QL80 9P4 ` 0s000 QS 0p00S  XUl Q  0R  R x0R0SX 0 SU PR 0S 00 0  00 0@P@]P PEUp@d@n@Q ^#3p0pS; 00 S R Z+Z  Rp$\l$Xh$Rp pP 00 P0000pp(N$pZ t$03yD00K0t4zD43t7dzD0 -L @R  ㊰P\ 0@ 0 0S0 00 sPt43 -L@LM`pKPD`,< 00 \\0 X T   @0L0 H 4 0` K 0-LTMP,0 p1ppKDt @lP 0P @P 0 @T`!` 00 0 0S D  0lP z t0,(K,@ 40 800800 S 8 ,0Kp`P ,@ 80080,P 40   vf4 -LM,0 PQ0A00S0C0`00`S 0S0C000S:*  p徯@P @0 @W  @}`P 80S0C80"0`040,2 LP` X00\ R \R\𯝉  0R@ -Lp`P @T 0 R P@h@Pb@@P P 804 0C80 0 R @@T 0-L80@SP 4P 8 R 0800P 0SZP 080P P4P 8Q 44P30Q  R 004PPP 00 q4 r -LLMT`d , @P` @P/ \  000 0ZS Z Z+ \ F`, 0\R(KU P 40  @0NK R4 @040  <0804 ,(0 00 00 N,4Y@\@ / $ pP7\  d00Q40 10s0d0 0h0d n 0Po 70\0   @PN UP d PD @0  @P; 40 ; 0`P 80S0C80}0`0d R800C80 d +P'40@ 0R40 0S 3/$U0000\0 @g80Sb0806\P ^@\@ [0\0 X  `P P40740 @RT@ g P1,P  0 Z0 0@ 0<08 n0 T0 0 @Pe PI0S 3/Up8008040 O ^ 007 P `P 㖯\ l @ 0So l@HH8@p@ l@n@h@ pl @8@h0n0d T q>  P d@P P4040774040nT 9PX  z40 dP `P  Bx\ +P\ 4P40 n0 T0 0 @X 80S0CX806T[ @0S 3/@70@ 0<00 S l u 3/0l0 o o00Cs0S640040n 400,40,n –f43MCzDzD 1-LLMp l1`1X PU 0 `/ W X 0p|(KV Q 0 0 0 Q 000 00 ` V 6/l0S0C0Tl@KD|0 h $n ,%f34zD -LHMpPU)  Q 0 0 0 Q 000 0 0X00 `V 6/0S0C0PUQ00 0004 Kd@KD&0 ` $n b4{D 2-LxMP 0T0 , D1`s00 Qpd @KD0W0h0 唀 dP 0NK0  b?Y l 00 T0K-W`0 WV%T@T" 80@ 0CR80 h@0S 3/@@P 0<0 0 S  3/ T00, 0RE(KP T@T 0 80S1Z =WV Y%0S" >P7` @ P tP800C80 @0S} PZ =Y3`A`080z–0{D(MC -LPM`PKpDd _d@d0K \  T 0X 4 0 n <`p0 0p@@Td 80SK080d| -L<0S 4@P # -L40 d0S  -L @R <0S 40  -L @R <0S 40 T0 0-L @RP0}AP0P0 Q0)` 0 Z0 PD 0`@PD 0 10 0BR0U `  P=@ TXU00  S@6 ,0S3 00S 0.0S+ 0T0 S, ! 4  R R000 վR000 Z0 P P 9P 0 S@, 00PUP U 000004 @ (K 0 -LHMlKP D1pWX6R pWR  R@T 0 X P[0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P;0S` P 0S 0 60$00l P 000@TT@ L@ `@ pW(K 6l 0D10s9l0 0 P0 001 -L(MP@P`0AS`(KHK `G 0`T<0 H D 4 @ [ pP 1H0vP0CL S77077(7D@PFL`1``H1L0<0@ X < = 400hS `301  40`L@`U @%T  0P U`P  `h0h!$qBK  ,0KK21C0b ?A1c0wf47 gfff -LpMl`0Q@(0 1 PKD< 00 P0   @0|0 x 60p0 JK0 `d /0Sp PU 0S ( 0R!$K 404 H n0(0 080@0< 0帠 0P00000o–XMC 0@-L M0 S7777@`P,P 9P00S?X/ , @@  ;,Pp @Z `Q 0 70 0BR0` 0=PP+p W@00P0, 0 0(KP,P l9@P00S ; 91@ 9P@,P P@,P 9 0-L40@0PP X 0NP 8808 a0h%400400h_C4Fgfff R-L@`pP TU 8@@TS S *@90@ 08 T@S# S U *@890 00 U 0S @0`v SP@ @8`U 0S @000 -LM`@pTPR T= T  0(p (K <zpQp@ fh1S p@ pP;h1 Q$180@ Q0001 0  N0@004 0 a `R \0p40 pU =P Plh00C0 00C 0 ,00C0000f 7|54 --LM0,0 pR \d2@TX P@T3 0 !0R1S R SP  P P  P` R5 0Q 02 0BSM!7!7!7!7"7"7U 0 `0aR  R  400407(K 0 MP  B78p240`U  0}:P0  0 `0aR  R0 0 qMP AP8 r 0Rz 40040Q0N7Po 0Pk3ʚ;t0 -L PRp`P@8V P$p  0h5|544x4 -LPxM@ \ , `, 0Rp(KPpp YKD YR00S p|p  X0  K0 t wP B 6Y0$00  0 0D! Q00 S! T*  00 pNK 0 p Kh OP  &0 4 00n 0  0 0 0D! W< 8 0p,0( (0Y|5–44x4lMC0 p-L PRp`Pp@6l 0D60h,Pq5  0ph|544x4 -| LP \@P@0Z0 `p04 0尦T 0 @0 0mW|544x4 --LM∩P@ 0U, X0 T@ @  0S4;PP 1 0S`V p6, 0R(KQ+p_V V(p -P7p  0`5ȟ᠀ hP`0 `000V]PTp0<(1 RM P hᓬP p PpJ0SC `pX W p0@000S 7 V 0@@7 R@TX 09P_0Sa㝥U  ' 7T~7p|-pu poJpPC 00&s@ 08 @0T0 ) ?TKDi 00 K0Pl0 #Q R 0#S0S0@S,7L+7*7*7*7*7*7*70S@@ @8@I5P`scM3P `/pg  %`PI 0 `p[ KT0K_pPT`80080 NK 000  00 0 p 00 <Q 0 @0 60|0 @0 |  0 K0P  @P7p  3@  K0@l4 0 (0,@n H(  N0 0R K T0KpPT R} H ($ T`800C80T n00 0T <060T 400P80080Q 0 0s03R0#SQn QKpPQ 0P pQ   0PEpP_ @P@ \ 0S0 X P_ .@T @P P 0S 3/@@@ 00 00 <0P 4 00 040H $(<060n   400@0S 0S 3/p@T $0X 00X0n8 $ 0X0 M@ P @P P R 4 0@P@T` n00T 80p080$#P Q  `V<pQ 0SS0S– 4|54x4|MCt{D 0P 0CP>@t 0C!/` @#2// 40P 0CP$0PN=@ 0C!/ ̇ P P10/"10/4/ P PP10N / 0\30S?000S \/ -L9@S0CS9 06 9S06p@-@P`0#U@Tpb0P#U0p0#^ # 0S0R  ^P0,0,P#8OCP P0Q00P0S/>S/ / /-R3784704737847D\ 1 R\NC 0 p-L0 8@S`) 8PS @57L5747x574747574747:0 00CS575747470:0p080p080p080p8S 000;0ȖX0 \<0<0x8 8"R -01 \ QMC Q-pL QQ/0@S67676767676767677P  PP nPP,`0$ lH {D Q-L QQV$P7PP: P6 0@*S08787P87878787878787X8787878787878787878787`87878787878787878787878787878787878787878787H87HP 0P `PlP`@ 7n^ {D -LHM@ğ~0@P p`,0 z. 0g<K p h h0S]h  h "-0S: 3"-B 0;|8 Z ?0 l  R@l @0Sl 0P P 0 |8~ o<[\u;0[Sp< K0 R  P(K 0 C< K0pQp <0[S%@<0[@S0Q0bC{D{D "--L0p`S1o Qo1_PA 00S   R` V0 00S   00S 7 17 ^ V 00S  ^Q 1GT@# P 1'R! 1?0Q x1GsT@l4 )(0`K $OC{D{D 0-L8P # 0sQQ B0S10s Q "-0S1pT0Q@@S0a)00@ G0 -@XLQS QN Q` Q`  V`"-0S6  4pP VJ  9z  P<+ P PP81 R P48 S84ĨSUX 0%0Sx8<x8 K4``V"= Q2 RPx8<x8"-0S8X p ``PJ -@LKK?6,"R2 22 h 1-LMp 6.$2i 10v U"-P0`00` VP O0S NP? 0 `8`  V P\A"= R!  0 Rd  d 10b 00 R" ->2pm,;Js01 f71f7 = S"-000 0S"-000 0S"-000 >S"-000P.8f|D50<|D0 0000  /0@- @81T^* T- 1T^  T00S00 000008S  0S00 000S8 0C8 @ R 00 T00S00 0S0 :[0(0CR 0 8080 0 T00S0̫|>0  /? 0 ? 0/? 0/? 0 2"/V7V7@P&G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7G7/ // //x8 01S^/="!B10b>0/0 0 >= p-LOPT`@@T 0R!  PV Pp -LdMP(!@0|  ,0 p` P-xK  , rK, P%lK , LK,0XXL00 0C 0 t )0C|,#NK 8K9,   00–OC -LMPᜑab0Q,0 d@c* Q, 0RR(KVpfI@"0t@0 G1@D@t`OK   !0h0s0_ #" ab01p +   Br@ 00s0S0 LPK +OK <K + G 0c pb –OC -LMP U, @ p& 0`K0KoPU0[ p00K    K U@@KS +, 0R(K~–OC -LM 0`  4R$ pP# R R $ 0R, KOK  QOK WQOK ?8PK 9Q 0+4–OC  -LMtQ@04`KPp$0 + H $ 0PR K–PC PP-LNMP `$ pVOK  L HDPK CA *$ 0R KVOK  P DPK  *–\|D4PC -LM`OPTp@@T 0S PP *008S  1>H ὙP @ P*0@0/@D ?@1.0o@ -LRM`h V, l p!  p1 0K(K!H@^K  `V# 0 ps@hl!0(K@ p   YK VL@K .*, 0R(K ,–LPC p-Lx8`P@9 0K 0 9 r 0R>:0 "#A10a>0 00CS/U7T7T7T7T7T7T7T7T7T7T7T7T7T7U7T7T7T7T7T7T7T7T7T7T7T7T7T7T7T7T70 0  )R B0RLS0S *p1S^/phphphph  0As0S"!B10b>0 0 0C-LSV7U7V7U7U7U7V7U7U7U7U7U7U7U7V7U7U7U7U7U7U7U7U7U7U7U7U7U7U7U7U7*hPhph h -L0@0CS V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7V7h, ^ 00CSW7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7W7/ > -LO`T @ \D0D0D0?D0@H@ D OT^PpvWP 21CQ! c. p@  `WP hX -LPTMld 0` ,0  \ 0  0)S0Cd0`pt` pp  0@ `$@ptKl` hp 0@p#D< | x  0@|pK!(#Lp4Pp=* @4K (  XK0VKD@K80W0Ky(  PKu( JKq(\ڿ\XK ~  B\y\ٿ  Pm'dp唀@, 0R(K `@ P>0>O)d 0S:``P>0>B),>(( $0 0–\PCt%Dh|D|D|D -L(M$`0p,0 @ Pt0 @00PK0NK80O0K (  HK ( BK( n PK   B 'P F L0P 0 L0C0 `<@K"4 0040 "880 "4<0    ޿ > ' 0 0  00 0@0@t,  0R (K)P P400c ,0l> 0>(–pPCt%Dh|D|D -L@P ㊘00 0- LP㮖@P 0ӿ@0 -LXMP` h d0   P, 0 WKp W0Kl 0 SV K UK @U' OKQ' IKM'0 0S 0C KB0KApK~ 0 S 0 0S00000p 09K 8K90K)'d0dWK#4x0 h0l#|ဠ 0 t*h#h l*XhXL*4dYK 0>& $ 0S0 10PP ;&1P0 0@00S000010PP 0S:>0>N&L& @>0>C&A& <& 7&@ 2@>0>-&–PC -L@P 00 z0- LP>@P 0 +@0 -LtM  0 ,0 00 A'P   %P 0 0 R @ 0S p<0 $P`0P`@P` `0P "4 <003 00 "8 80 040PP "40 LK jP\K0>$$ >0>$–PCG-p#00`$M 400400   Q     @ "$""4r 0 04 4!~ 0 $ ""4r 0 04 4!| 0 $ ""4r 0  04 4!~ 0 $ ""4r 0 04 4!| 04 0##$s0 00  4,4!pX$ЍPCG-Ms000  Q0  r @P0!0# "#4 "0r `04 4!p|0 庀$ _ " 00"40r 04 4!@t@@ 040##$s0 0 $ $!PuPP 040##$s0 0 $ $!`v`` 0v40##$s0 0 $ $!pwpp 040##$s0 0 $ $!tx満 0uw@40# 07~ 040# 07xp 07q 07| 07@t@ 07@   000 4#0#00ЍPC -LM`x8p8 Pܐ 0А 3 `1C cR0堏?XU Ux85x8| O?,@:0,: 0 }DʚFps7 0-LM@8PS08 R 1S000 00hX -L(M@`p00STu7,u7u7t78K00S0,0K00S00,0KPPK0+0K)0K*0KC*  ۸0  g@ Ѹ@T (K8K  !2K !8K  !2K !8K  !2K  !8K -LTMt x &p h 0,0 x00l0 t@T  0RbhT0 @a h00S   | D)L 4P`0@ H#H8p,xP!$0@`P @ 4p0$ P@Sd@ `P *t#PX . t h!PXX@0 0 BjR X 0S XhT 2!X0@00l!!R |x d0` #H0"HT.X# lx Eo⠠0`!1 0 BV[P@K  u0l シXT0nZGt @P\  0@a0h T@! l0፷\ ! dZ\ .P@ 0X 0U` p#P`t jZ RPPpp B;C"1P  t\ @PK 0 ! 0l I\ 80PYl4@KT!0X P[x |d@K00 @PlP!!t!, X0Ra(KB pPt >0>}!X h 00S0h@00d `0"HHI ;X!1XPP0 0pt>0>Y!XW!X U/l0x@Eo`⠠5p t>0>F!XD!0X0 0S:t;!X9!p>0>dKX ,!PXP t'!X@ "pt>0>!–PC -L@P  00 0-LP@I-P 0 8S00110  !!0 -L,MpP T L ,"0PH0  T PH0 0 gR H 0S T) H < < P` P`%4P`H<<s0_  0 03 00 "880 040 @ 40L !R^ P`P 0@0PLCoS 8@K9 N LT< 0bY[H@0`pD @0 D@b@ 00gT@! D  d0@   LY@`p @D 0WpD  0VP!Pg PgY P P U`` P   P L0PCo"88 ^L0 1; 1PP PH0@0  P_!P3 0 0L 0P!P0<T @< 0@L坵 0@P 0$$$$ P @  L0㋵H 0 0 0 TH(KP T>0>H0H0 ;HV H1H P0 0PT>0> -L,MT pPP P0,0 L  T0 0R`<@K  9K  LT  0PD0 T PD0 0 BjR vD 0S D  yD0 @  fZPTITD@PH  0@a0h T@! L0H dZH +P@ 0X 0U` p P`? jZ RPPpp B;1P  H P@@K 0 0L ἴ@0S"T, D0R,(K ;DD1D P0 0zPT>0>DD PT>0>TD P T>0>–RC -L@P Վ00 -B@LP 00 -L(MP `P 0L ,0 0H0 PD P PDD0 0 iR D 0S P@ D P H0\ 3\H0<@K1D0, ,400 30y 9Ku  HP0eZHD@`P @  0@a0fT@! @ d0@   HZ/P`@ 0V 0`Up PpM iZ RPP  B;1P  Dp @ P%@@ 0 ##Ƞ#\0PH0㮳D 0 0 0 P , D0R2(K00 Šh>P0p 0LP>0>DD ;DfD1D P0 01]@L P>0> –RC -L0/0R  @?0#200   N000N "" N04\0Nx8 2S 3/0 SH> 0H>/0 SH> 0H>/ 0-LMP8@S0P0 0 0S00 0? Č 00 p-LȐ@\Pp|8 p8Sp 0S >0 >p` '%P>0>p 0Qp 00Sp8` BV  10Rx 0| 0  0 B C  R  0 00@00! 8Sh@`! h\80\8p0d  0-LM@KP P P P K0@K \ P00CS,747 7 777(0H>/ B^0 RH>(0H>/R 0-LTP@0 0 0S0 ? 04P00;00 -L 0 S`𯝘00 $p"!@21C0d!P2S2S? t02023S  3/Q o5 p-PL,`@00pf -L 0pS𩝘00 $k"&( bSf@5S 3S 3/V ㈅h5S@h5@P Z0f T0@f@hJ0h521C0bAP2S3S 3/bif -@Lh*D -L 0PS@𨝘 x>0Qp`x> Q8S6ha !*48 $}D -L 0PS@𨝘 t>0Qp`t> Q8S6h6 !48 aX}D -L,MPQ 4>04>(K8S \ 0P $0 L } p8 0Y`40 : 0Y:0D < H @ 0 S@`  Sz `pY: 0Y*H>0H>H0S 0SD0H  p>0p>LP804@$<0<2 @0^?n @Pi "0002 R 3 x87x8 x87x81Q3#551 RY x86x8 !000 o6 T1QLA@Q 00848 S808`>0`>WH` 2SD` ~ S{RH>0H>v+@K   PkPi0Sf0< S < `<P bP D 000t0x86x80D < H @ Od5EE}DSC -LM@PQ 8Sp 0 `P:0P:0S` 1:2S P*V 0S𯝉X 0 S𯝉S : R X>0X>H>V0H>;nP0Sx88S 0 0  000P  pePPPP p-PLP`@ P p  Op 0@S G -LXMpȐx \|0  (K8S @P0"0S 'Pd>0d> Pt 0Q"PX0 0 P `\ \ VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SRH>0H>+@K  P0`S` 0l0 d0 p0 h0 `0 H>0H>lQ 0Sp R 0 S: R X>0X>|p0;PPx(0BS @P! P 0h>0h>`R6 X0t dl> 0l>00x0\ xIPl h0xpx86x0= d\ ?` R ?F(Bx0 :H xP 0x L KaPx0d04[SC +x0K =x S8D"x0<0| PT0x  0|0x  c(xp0\ p06L K!Px`000x0\ x0 8p>0p>nȗH0  4[S *d@0 <0Q)[A?0@#[ #[  0@S  ^ H!80Sx8 ^( Q& x ]fP7xH @0 0RR00[A?!!20[0P0Cs0S20K}  xP@Pg20[.SC -LM `QP@p \>(0R\> Kć*60 B8 #8 8  -LlM(0 RR8S  #R(K8 p !0&`$P0 " T #0P0 X :% p\ 0X%p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*H>0H>xQ 0S| R 0p S`1'R!L>0L> 8S `\ QP>0P>0`/ @  |0PP `P 8P TS 4  p R  CHT 0S :Q ;@:0 |0  '@0 0  -?00$#ḃp0X tt0x @!8S  UR: 2S7  3/2R ` d0S hP ` *S\R 0X0 W2S tP S SPRH>0H>J+@K Pv OP?0S dP ; R8S60lSl 0|8 WO x t ` | p l h d X '8S x8 hP ?TdQ ?000^8SN8SKt0XS 41 R7 x86x88Xt30( 9 0 Q(511l0S8  4 `P P L KP0d0]PH00@  <008 A?!#[ x86x8 hL KPh@ 6SC}DSC -LMp( WF`(K(0S(  Q 0 0 0@`W1(PU @P,  PfjU; 71P (0S 000C `b 0@P  P (( -LMpxP,  2S  \2R >0>oj00( @R0@ `W L0P0V0S5x8 1R2  oY 1R 0@) -P 8SW `pQ# k4P1 00 @0@ a, o* 0`P+ 1<1!1R*@10!Ra@`10a! !W 0 0@0@0/0@0@,00 @0@~ꈎʚ; -@L 04"4s`V1ھ 0R p + PP# 3g@ 0S@P0>00>0S0S `F0>00>mꪪ -LM` 0PSp :@00S ܮ77787{PP0>00>"2K ,1R0S<  F fr 04"42Kf  O00 iPP  $K2K  <,K  82K2K  /,K +2K  %,K !0SFK+ꪪ -LM`8 p1N#2,0 @P0L(K2?=Q 0, S PU @0@  `00 S0 00#  P00  P4 U 8 000 @4``@T 0S000R@P o$0,? ޟl `  -L0 \ 0S00 RSS \  0Jt%D}D~D -LMP p@@T0 T*   ᗁP 0 $a燽8@pP>@80| `PA @ X 0P(K(KoA8S8S UC`UC~D7 -LM@RP` 8S 0S >0 > V( P  g(Kop0>0>  X8   i 0P >0 > 0 0@V0@(K0, 0SY4 0  00S00040 000 R 8S Y10 . #0"=00 0 0S>0> 8S 0 0 08 8S7 80X F XR XR>0>8S>0> 8S 6  XX X 6P  ާ1s 0(Ko|8  8S0  u0Sd u 0008>08> PO PD ?8S;ض77X7ض7X7X77R >0>.R8S ' %P >0>R8S ' P 00#  4 `0`S x8  4 0@% $>0$>  3x8q 0@m0@(>0(>  `P,>0,> P  >H3 "% 40 ,0(Ko^XPX4>04>800@  `Pp4u0Su Ÿ00C00S  0QM0Cs B@00! 8S@10 \( \(0S8S ' rPY8S] 10SV0 0 >0 >  06 B 0? 1 NP>0>I 5 10Rx |   00C00 32C0%R 0 &80 0L 'P  ,0(Koo 00&A P @& P 00 0wPt%D}DH~Dd1 r - iL M!s04 00 00 Y0c, : #:SZ `pY^h@, p00\ h%02@0 W/,000b0400iY.h0 20Q 0, 4 iY΀ht@"0h00s "00Q40 i  Y.000C:0(K -r`LBM dsp5PS &80 00  A?   - 00c:#: Sʲ00g:#: S>0>d@V 4 00g:#: S 0iJ0 -` Lp  \𨝘0 4#&  10\80BsPU@ 0$ 4"0E@sPU0 4#2h -LM⼢`p . 0 S+  0T0 00 %1!2 c@80 4 5Sj x8  A?   %80 040 1(K!0S81  &8 $8 0a1Q 0҄%5V8 %S @bV>V. 00  h,0 0Es0SYN0P0ā04 0C0 :0 !40 0 }Ph PP3S  3/P(8 0a0%,=0V 60 A?   t 400a:#: S 40(Koe<0Q5Ťhu%8hUy<'}8 0S/00S S/0S0S */S/sS/-P\2 ڰ\- ʀ\# \ |>0|> \ 0\ @\^\ \\ \0U$0Fr -LM0 S2<0 8P 0c!@V> 0, "4 塺 0 0c! QKʲ 0j:#: S8 0bY.:#:SY`pY^h@, p00\ h%02@0 W/,000b08 <0cY.0 !0c0ಠ:#: c0!<8P0lYNh00"R , 000,@0@(Ko0 "40  4Ph500 h5"Q 0 ,N8< aY΀hx@"0h00s "0Q80\ ]>\) >\ >\  0,`, 0R(K>\z x>\ 0\J >\|8@ p>`㳀ᴁ`>\1 ET>\ L>\ D>\>h`P >PX  P1'R!| 1?008X98S8SK 8p R 4`=\ 0\ =\H=h`P80 _T=\| L=\E D=\<hɃ`P> RV |8: x8 ;4`x8{<\ <\ <\l+v`k<\ <\ <\\M@K! 8S#49 LKM0K ! X`MD< @R`pF`D;h}`P>xȘ  0S774`4`x8x82t;hk`P,@ Px8;x88S 8Six8   ' rP4`:hI`P |8 0Sx8 <4`x8x8@<000=^000S l:h)`P0SS`002 1Cc `PZ@P`x8  :00?00? 000?00?000?000?000?S S S S00 0?00?000?0`0`  `8S'  `x8`900zx8`#500.00q8S48SX(`e@8h垂`P_8S\ 6A0AS2`Wp( 8 p( Sp(  88,(20C `=7hv`P7MK! `P1M0[ SN@ M [LK4) 4`!. 0ᦻ`7hR`P|8@ 20s0S4`6`6h@`P!8S x84`20x8|6h-`P0S x85x8  e 4`06h`P|8 W 0Sx864`x85h`P@@P 8T` 8S SX S` 0d5h`P+`8xS` >15hԁ`P8SK @ P{ PX x0 `~(R  x8KU   `q4\) 0\cPPZ@P 0{S`̠K|P 000@PS 0|PSO:|`E  | N`P BP  `98p(LK;:0 M0K `,x85x8 4`" `00CSN @P`  R4 0S1 R b0a ! c. Q 0S0000G0ac 00 p`P `P P R @ x8 B<4`x8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?x84`6x8  `yx8;x8 M1`kX0Qg 8p Q4`b0` 8i–i 6i(i8i4 i i8i$i4i i5i iiiiii|i0p0 -L&@  0S 00PSC 0-L3P@   Q" 0As0S0|8x0 0l Q 0As0S00x8|(6 x87x808S !~D~D 0-P3L@ 00s0S0 |P`(0R00x86x83 x87x80( 0000|8 {! -L 0`p0C000 x 00Cs0S0 X@PP0A?0 0R00P^/! p-LP`h%R @0@S h% Tu0h500Ps`Vp 0-@LQPe1 R>C80u0SQ 0S 3x8B\1 RM P1  >2S 3/ ȕ9S00!0 0!0080 Rx |   000C0C00i 10xP RZ•\ l0  a0<>[r@ p-L8`SPJ ,1 R|z1H9S 0<!0 !'80C8 R  0P0Cs B–\ t0 I0>Z @, X(8R/0W 0SphV  v30 8S" 6V K!ʭ8 -h&0X0"! 8 S 8 ,0(KX 8S S 8;SR 8S S Q 8S S 8S 8;SfDDD -L(8@RV(8R p-L`PP H0H@p0000$0d X #=C0p fD -PLXpN@`PQhf -L@Q 08P s80P s . + h'$ -Lt`Pp@@D@T8S zf -@LP! 02 8  PP Hެ@p`808l8L8f p-L@`:PPT>0T>   ''8p p p p-L@`!PPT>0T>  p 0-@PLC#-t0t1tP0]0h#  p 0p-L@8<18!841(8,!,1Q( ( 1@(0 1Q0` 0>BspPP" |8 p0`B cp0P0P2  J  pE  `ph?XXPLDP@707x775($78d888DSCD 0-LH/P00000000/  x8 00000S /000000001|( 0A? ` 00000000 P  S 0<0 p-L`pPp1GX)1RT@@$@ p0R@8SFF x(x10S: :  4)@R :0RE @x 7$ /0/0@@ @@)@@0SS S S@@/0A?@@  1 S@@|8   P@@p @@@@@ 0'  "P @xx;P@ -LM\0p-4K , 80 &4PK`Y @'0' <0 P/ T [P , 0Ra(KX@8KP*x80x8  %[@TN 8KzP/08 48KlP T1@!P@T P08Pc<8@ Z  0`T! N'8 F<ݪA!تx<Xh @ P\孰8K+P <Ū8 4(–EDD4DXDD!DDD`SCpD -L6P@hx80x8p@` 1N'p[t08 !n j8Sx8 m'00'049@ :0;Y @@- >0303x8 03x8      ?/A ?0/ ?0/@!|8  00x800N@p }H=(:00:, + 4Y? |8  r0 00ƫ8q  N@0> >t<!0x,|<*? D -L$M␃6p $  x8tt# l8Ot8^PSx80x8-8S@~ P`GS08>U@ 8SPPV 0RU`@V(  Hpl2x8 0108(R7   /8Sx8  49S&BPp(0S  ⣝0p80Cp8✝t80t8b$ 0RV K p8  DKa`P pg 0KpQ$@Ua0 B$@E\`P\   7S1 0K $0RS1\ s}?\ 1 'R! P:–ȀDLDЀDxSC -v^8LppPpWp1GT@ x8 0  8p RiAg0X <007pp -L@ hj -LPtp`@P 0S8;S08P@ hGf -Lp(@8 Sp(x8>00.x8>6 . x8TT  L8%(0(,0 $00t8hfȀDLDD -L0(P @RppT`N TC T 00S!X$B0000PS S R  'PaRd ꠁ p@PU 00000S񟗸8888W 0S00PX 4PPX Z '[[ 082S  3/R RR 'p3} 8 Pu 'p3nfSC1 -L8`Sp 0 X@000輀@zPU 0008SS@@PP [[ bH2S  3/fQ0׈8S/P/ 0.R/P P P/P/ 0.R/ 0.R/ 0.R/TC R% 0S / 048< ,$!$#<#Q#:sQ/@Q/`Q/ Q/0 0@S /Q/Q/Q/ȑ\ \ x p0  ˌ,40/x00S 0 0 / 0-000> h0" 0 0220 0\020  0#40SC*0080  x R 0s   /.00 .0C 0/80@-"\030Cp0"h"D@P` 0-L8PS@A|8 +  0 0S$0 R s>  0S%@00! |0SxP@P! |P000@0u0S 0 0S0 RH0  000/0 0dt%DD[~D -0p-`P 0 0@L0 0A0"$  \\00 "$ 0#<0 "( 0#40A=    p<>8 0-L0S @200 P@PEP 0  0t%DD D,1 p-L R@> 0C0S0S2Q` R 0S0qS R0 Pf000  v@ @ 0SX0 R00H0@ p`0` (40,$ 00-P 0@PLT@#@ k0 00-@L0@ P^0 p-L`qP@P   ;0 B 0P1 Ep -Lpr`PP @  K0 B  0`,  ( -Lr@xP 0 0 K -Lr@gP 0 0 K -Lrps`UPP0 &D'  @`p -LMSPp" +@K\ 0 0  00CS 88888888888888 8.@K 700P@ `6?I&40`P0`R[Z&40`0yA&40`  0 "#400<0P0^|8 O(K00P @`  r00@`  g00 @r`  [ 0r`0@&40`P0`  J00`P  ? 00r`P00P00P~ -? S0C0P 0 0S  P  00r`P{  0 00Pr`nSCSCDD`D "0-L@M+pK`0P 8 00  0d0C0SC 000-@P0L00C0d0C00 p-@ TL`$PP T000p; H1ph7뀁D p-LPr` @Pp00`  0#40 b p p-LrP s@`Pp6  Ts +@"4& 0` 00b0 0p -Lr` sp@PP 0$$00CT0p@ @p t0 #0   00b0 0AY.03s00#40% 5C40 -Lr@ [pPafdP0 0 /@0 300s00#40" 2C40  0#40 b r Rs0 R /S *| S =SL4| ,Ƞs0QL4| ,Ƞs0n R-L[x8p p\L@`:W 0<S 2 PP^J 0 F ;0\ 1 #      pP2 x8P S|8!40  Z 0#40L : ;[P-[0S>x8%1 -x8 0  00c0 00  p0   O0  \0  p0  g 'J  -L`pP#?0̀4)p0 \ࠓL+ \ 000 V@P 4)0S 0  00c0 0)0     p-P=00 8`Lp9@0 0000p -rp!P[@0T``DLW ;40T 1 #    `P(  W'4[@0p 0 000#40<[0S @W003 00c0 0p@ W003 /   k{ d 0-@L0p0 "-PxL[:0`8SppQ@@\L&# 0< 7R 0  440\ 1 #       fpP GpP @00 岀#1 '  㶁F#" 3 #4!0x8-  [@ 8S*0 R5 [0S*x( 0 00`0c0 0;: o x( x(x(!1 |"-Px8L[S``: Px@@\LT 0<P 7PI 0 E 4 40\      `P1 @ ᲼( 3 [0ȕ3#4 08;:   8SA 01 RD [0S5x!* 0 0c0 0(0 Fx &6(0 Tx gx @S 0 R ~ -LMQp`y PX $P @ @PP`!P 0001 ' |8  VV@0C 0@0068S? @00! 7Sȧ@10̧(0 6($K8S  PR 0"apPp@x@ 08Ad@7V 6 @0 @   *P f UC`UCDD -LMP 1P 0iSS3 0 SPP>0>" 6K  n pP>0> x8" 2S"[3R>0> U ]W [0P0(K00So,8,8,8,808x(D@0@0 H0`U  ```"[  =PP>0> @0@S00`2 < r"0< S2 < 21C0b10"R`< 0<<0021  02  "[2R @ @ < 1 "!8S񟗁-8D-8|*8-8|*8|*8,8px`,pPK 08pz`00  ' 0K x8  $1  0@008S pY00' 0K    00  0K  '  P1p2x\@000Wᘞ8 $>0>ꈎff؁D -@L`AAQPp T ]2P PW 0iSSSpW!0 |8  0S L㲁Q kPP 1 018P!1R2@ P10QA@ @! A1010/0@ 0@ 0 0@0@6   0o07PfD -LMpQP` @0>V  V 0Vx @P V6 VH(x0r @P> @0>V @P  0t@PX>@Px0((y@P 8S x ]@P 6 !⒝08 tx :@P 6 !”08 0@P f,DXDD -LM8SS5p1S7 0@P40 0@  0@,H`40K  p 0@P pD` 0@ #D<P`0@!(#Ll!p4R: >0>(Kh1S* 0$ , >0> 8 8P  0@pP,H` 0@  pD` 0@P #D p<P`0@!(#L 4,@p 0hl!p1 8 R 1S>P0>F E0@Ap $@`D0@C p#D<P`B0@!(p#L4 (Ko) -LM8SS0S (K0@ P00 ,@  0@,H`00K  p 0@ P pD` 0@ #D<P`0@!(#Lp\!4pR >0>`1SP>0>s 000 | 00Cs0S0 \ 0 000& !M ,80 DD -L,M8S8 $K@ <  0@8,H` 0@P@KDp0P`p 0@  L #D <P`0@(!(D`!#Lp4R: >0>8 \1S*80 H HP>0>8@ H NP4 H(  04Pa b04P04 , B@@10`D0 >0000 ɷD, @dI8 @0lIh9H0l9F E0@Ap$@`D0@4P#DpC <P`B0@4 4@!(#Lp4 D0tx)(@ pIc( H _ 80 HPE,  8SY8 |20s0S|2R  0@p8,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#Lp4 \`!6 80 $Kk4 48 0  8!&@8 0,80@ BH H긂DD -LHM8SL (KT P  0@,H` 0@PTKDp0  P`p 0@  L#D<P`(0@!(pLPD#L`!4RpL*L` {P>0> 0$ H L  )Pa b0cPep4X:d d`0X8 %< % *0PpX+: `0X&:0SR+@K r KP0S0>v\1S:<Qo L "<04  0Rf00X @0 iX` dIL lh)00l9F E0@Ap$@`D0@PpLC #D<P`B0@(!(D#Lp4 X0tx)4@ pI0000  0dIL |p!l9h)8 8 ` \  0@$@D``0KP8P 0@D@#D<P`  0@D D@!( #L4P` p)8` L0 PH  8SBL|20s0S|2;  0@p,H` 0@PpDP0p` @P  h@ dP  ,hP$$0@`P H#H8$!,pL`@0\1`A& d0 L,haL 0 2% !a$8 0TCDD -LM`8PSS0S KpP>0>G1 S p ^O :|  P' 0008S|20s0S|2 6 0S00Kha02! L80<ap 0KhĂDD -LMT 0P,0 4J, 0R(Kd1S<  0 0  0@,H`0KPp 0@PD0`p 0@  L #D <P`0@(!(D#L`!p4Rp: @>0>\1S*9   @C DP`!PΆ1>  lpKKP p P@'P >0>T@ P G a b0cPep4X:d d`0X: S 0PpX+: `0X&:00S0SP QP Ro@K  P0SP  Sp7 P d RC 0S @T=  Q 1S @1 tQ  0R  00 0   ⬳PP  KP 0S  0S8[S ? !  0@p,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#Lp4 0\`!d10& 埗@Hş8 04 PPk 9  04P#  | P r@K R +P0S0SP PPUPUP `` KPUp F E0@Ap P$@`D0@pC #D<P`B0@!(p#L4p^O C1q匁|1`a    Pd3x#  \Z ʾ  0R@ @@ `>00 0  0dI l9h)@00l9F E0@Ap$@`D0@PpLC #D<P`B0@(!(Dp#L4 Ptx)` pi   P>PU 0S70 D0Ds0S/2P1Cqpc>00 0 岲0dI!l9h)` |  0@p$@` 0@PL#D <P`  0@(!(D #L4P` p)`L  P@h 000  L0  Q|20s0S|2v02p–TCTCĂDDTC -LPMtP`PP, @p00CS, 0R2(K!00 0CτlK1.KP5˿`P>0>"00`@ tQ 0 R 00 0-`ۛ ⮱P6s $8 0K–TCĂDD -LM4  0@  4H,` 0@P p D 0P  `p  ,0@)$ P` H#H8$p!,\1S 0  0>0>(K`1Sa b0cPep4`V7:d d0V ! *0S 0PpV : 0V:00S0PpV*Z 0 4  0,R+@K L8 D 8P0S0 4 TC -L\MHt 0P,0 x (ß, 0R(Kd1Sma b0cPep4Y:d d`0Y# *0PpY: `0Y:0SRo@K  ѰP0S0PpY*X 0Sx0SSiX  txP x Ko xt C_0N @<0  *x0t!p1>l`K PPt6Etx 0   0@px,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#L`!p4R`: t>0>Px0tKo  nᑔt H80 4y\1S@:`–TCĂDDTC -P`0OpL0  0 0@0@Uh<D0bS 0bS;0S>0>0S: S<  040\a0b $c Q00\0S 0D 0Bs0S0SS"R 0Q& 3&  3 7  +cPP>0>0S0S1S 0SRPP   0S   {   } y u "0-L@M'pK P0 ` 0 00  UC p-@ TL`PP T0 00p; 1pĥD -LMp01 `"0#PK 0 @ B] Y 00 0C 0 "40040 "880 "4<0 !D  8 0UCt%DDD -LMp0" `"  0'PK00@& p 00 @  1S0000   0UCt%DD8D -L`p P PX @`2 01P! 0  00S00 00$SS  1St 0S p "4r0 0@ CCq0Cr B#4Ac B a0b " 6|1=Q/ kJPP10 /0@ 0@A 10S0 0@#40\0S  0 400 0  !1R w7P101d@ P10Q㬁@ ! ఁ101 ꈎf M-LM0, rP 40 0@ P( X c @ c;@#$  0,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@& ,(?$Kk400$D#\#<@ pT l<[#4@<8@ FEpDPCB040[A0! 8 n $K\D -LM` @pPJ Pc c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!⿑ T80D 0#40  002"!BbP "4F0E04D0 "88C0 "4S1DD -LMPpP> `c ˬc1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Kit!␐ @800 K/@40ĂDD  -LM0 0S0z0Sc S0 0S0Ÿ   P0 p 0c p^1CSb?r? ,0 %W_` P`&<\Q`a 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D ӷc p 0S6  (,0g,$ 00 0& 0?(Ko"!B10b>0!8 0[@ 0@ (K ( "4F0E0 4D0 "88C0 "4S  P21C! c.  P^08S S S o0S/o,o0S/  -L@ R' '  880C0C88 10P RZ 10P  R(  (  \8\80C0C\8\8 RZ -LM8  8s8p妰 4 8 [`?0 0 , pZVr Vo PX0\0  X@0^  V~ 80( 0, 0\ , F PX 0\;  0\5 P08 8S= 00 S0 0Fs0Z[0s` Y0[`0 0 V0A 0Z\04 0R00 R0S, 0r0300 (K\ Q 0S\P0P  P\ 5S40040 0 p- Q` `VLP0 0Cs0^S@0 0Cs0^S@Tt夽T`PP\䜽UDph藽V 8哽Vp@@$䌽Tp@긃DCDD#E -LM`X@Up弈 TC\u8u8|u8 v8Xt8U U:[0(Rm6+ (5R'E@ 8U0W:;8p0\@d5 0 PEx8HH% 05008x8 090ESv8v8x8Pv80ESw8hx8hx8w8x80x8 ! 'pf [|p4  Ux8x8w8w8w8U U 0w# P P w P PsP@P 00 0@PP 0 9 R' '  880C0C881 10P RZ 10P+  R(  (  \8\80C0C\8\8W_ Wd00 0[6\!P808tK RZ0 0:W800 0/sx8* 00@ "8SX1Q / x00 0l000 08'‹8 %p@PP 0 R 00 000 0@@ DDE(D@DDD`DDhD|D1dfDDtUC -LMp@Q`PḀ *8US1 >0>Q8US8SS 000 64088USx8X 6/8S808`>0`>  Ȑ000(8d^/  !Ȗ0\8 0{ 80ts p`P  ''0 0  8p p @`PDaDD̄D -LMs@Pp480 0X 3S  3/0@d 2i׋ 3S  3/cR@eV@ ∅Njh5S @h5@P 0e T0@e@hP0h5 -LM@PTp`V>0@c80$'  0|f -LM@P|` 0S0C 0p S ?8 0c ' |0rf. -spLAgM@Ē 0`_ 2t0P r2 X;/0:O000 ᰠ؋p 8Qh~8 0-LMT0@P+;:00"0 7 0h阋 -@LdpP20S2`< 0;:0f -p=LS`2 1CA@cPdi8 Ll)h {@p |8  >SP2 1CA@c LdY(@1 h9l)p0   hH8 p-L`4P@ ph2f p-L8@S`p0Sp0P000P 000000p -LM@8Sx8 8S 3`P XU0S 2P EpP 0 pt KS  0<0hp@-P` \S0/ S0, S(p$ 00S 10 00P@J0Q@A0S PLZpV \0R*@p0 p-@ 0!0000 0!0LT LH0PP@`8000BaPobTLPP`p耖C@B5010/000[ Q/!0S S010 0 0% !!/00 @p-L0`00@LPPp0S S 0 [0Qp(0 QpR2 0a0#20p R-L pP@pPT @ t&9/ EP` @-LM4@ t K 0@ @ PKUCL8 <-L M0@ J K0 @PKD]C@8Dp tQ 0 S"0!B //UC-8JQ !0 S0D]C0@-@pqP 0l S 1\0}>EN-E Bs0Sr 00R 2 1C00 2 1C00ZCGDp tQ 0 S"0!B //UC P/0 g|D p-`PL @H^TP4X@T(phS QPphL갉D`$E!DDD -@PL@@4<(8$0 h0급DĉDЉD܉D -LM#H`P@048 00 p  0<p<Q 8\@T@`D @D$K(D DDDLDTD\DhDxDDpD -L@0޷T   Է蜊D`8D -LM0,0 QP3 p0@ 00@ :K=2K00<0<Po:00 P4K  0 < K;0K1< K<1 0, 0R(K–1_C -LM@ $, D P6 p  D1@(0@̢ :K0P2K`<0: P`4K  @ D }0 < K;0K1< K<1 0, 0R(K n–1_C -LXM4PK`p@ ᆢ@T@0 40K0` BK3K/PP 408 0B S800 RD W$KQ x@KD ] 0 t0 0 p 0l n a  p-PL0`Ppl0@T@T D1S 00 ١Ppp1 0-LHM@T$ 80S0Q 0S XPKD  0T0  L <0n SD0K0   40040IȊD -LTM`0,0 04"4s0 CRl0 , 0R(K 0h TK d0 PKd P TQG 0 R<0@\ ` \ <@ X@ aP 0X0SF PPSE X T@(R@@9 0 pPF ZC 0PU@  R<0 S L@KPK 0` 0$0; 0 x0P7 00 R+@T+ @T( 0 R(0S0`4S2 $`&0(`(0S3@$@0 `0(@0(0$0%000,0 R 6gfff60S S / P// 00 BQ0S 0`00//0 RP/0S1 Q/ -L$M`0@0C S 0 0R&KZpPP 0 ,0 0 K/K@ Kh`p Q000 0 0 006 D #–2i f_C -L$Mh`0QP$0  Q 0 R 0@SQ0001S@$ 0R1 K06 BpP  00 0C0604KD K|@PhP0S 0  0 0 00p` ă6C@–1i f`C -L@uL0Q 0Q 0D!P,0( 0S4z -P0L 6p`<0\`L0@T, D0@T' 6<0\LD1 S^V0W  H0 00  =P000W  20004z 0-@<0\PL  0LP 0D0P D1^6 L0R0 0\<00 R U 0P P00004z0 0-L @R P|p0QX0404 40 400 h0 P4  0h00 00h)<`C4z -LPT @0ST -L Mp`"H0 0,0 P`H0SD g ,"000040`8@Pe30 Sa8@ 0S -LMp@r`PU0 @ "< 4!4"<, ,& p0001P0@ U@#PU l0  3S3S, P0S 0S$0S(0Sχ, RD0 ݒP 0  " <4!4"<,00 0 1@PU 1 R:(K3S PU l0  3S,0 㯒P0S 0S$0S(0S則, R0S  Q000 0S00PP@  5<5$D -LM`@rP, aT,K02,,K0  00  < 4 4"<%t0 001@Tp @T l0 3S3S80S(0S.X2 @ T00R> D1 <4!4"<00 0 1@T+@T( l0 3S3S08 0R(0SX0S  Q000 0S00@@L0 R(K,0   #嚦 Dv<5LD -LM@Pr`p00 Æ'q, 0  "< 4&.4"? 40 ^E 0PS5岐0S P 0 i Y0801 0 4)4 S*@Pn1S@40 ;P @0 00 080ᾓ$(K04  00#0l0E  ?P=XBXϠ, `PUPE+10Cs0S1t, Sq: 0AP044$ 80P P0S P10  `1`!尀 , ,XI,@^6PUPE10s0X1*, R': 0AP044$ 80Pw@ 0RPY @0!QT 0k긁! 긁(Ko808 尀 , @Xs n4zDv0545(5,5 -L MP@` 0 \G l0 J 0S&0S/"\! `1Q 0S<00 s 0&,80S/  p80@0@P0 K180S Q0h!1P 0800(0`c+L0S0h帣@@0 KH@cpP 80S 0 P1 4z D @3-LM RC^  ㄚP7 2 @ h!0$2, R000 03 $#$ r 1S0!0 0 0 0@D!D t@0 0(P1 cp匂 $<&$ 4!4% 0xs 04"400 1D 0NS6: 0 0N 00 0Q 000A 04!400 0 >0>00>0EL 000Nx ;!3B媝娝wDD -LM@P  >Ph# --L\Mtp0@,0  0p0 04"4s0PdU 8&000, 0R(K 0$U$Q  0OP %000pP%0000(S(e10  @AQ8,88L8L88L8L8888L8L8L8X85 R 5 R1  0004 R U0000x0 14 R 4 R TD#U  10UR \PKLK⪇@l`K ᤇ ᠇0 HKK0Kk0K[0Kl@K\@KL@Ke XKa  hK]x0K0`(LK 0rxP 3 Ri~LK㴽T@ڴ000TH8H8H8H8@8H8P88888P888P888888888T@1O#U0 0U R 00S 0)SCU00Us000T@x2 R1 Y0013000tK 000Pt @@@@1 (0}xPpU500 5<@K 0 ;0K< K0s S80  080 Q ucP 00\  0S 062 LP0  0pP000  001V 8@"Tf SV 0Sk @!T$T;#T S0@ 0 T+F0 D 0!R񟗃,292929|29l29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29$29\29L29D29429$292919T-@ӆ 0@ 0 {$T5TVs 0S0 PR @ 0$1S S\@{nPP@ 0D !S񟗖3939p39H39 393939393939393939393939393939393939393939393929292949393939hl050@+l0#5ql04l0#3l03l0#1l00l0x *@P&0BS@ Ǖ@R@l0l0@0@0@l0l0R@l0l000@l0l0 R@l0l000@l0l0R@l0l000@l0l0R@l0l000@l0l00BS@x Ǖ@@q @R@l0l0;;@l0l0R@l0l0;;@l0l0R@l0l0<<@l0l0 T T=TV 0S0PT PX P@l0@00l0X1T0@ 0 z 0S@ 0q  0@xiVf 0S @000 @y TTd0 0l 00@B h_l0@ 00l0Zl0@0 0l0T ! -p0L01@CT`Q QP0 T# R00R0SRPP0@eT`Qh00 ;xp彍@D -L Mp @4 D00 4"4s0SF*0S010D jP>*sP6 @,@ A@ P`PE`A P0 0 `0 p,   wp@00 w4 ,00 04"4 0s0 $#$ (K 0 0  0  ԰@,@ * -LM< Pp001 cX80 ȱ((K 804"4, s0P@4 0 W0 408`04"4:1s 0 :004  $#$r Q0Ա40:0ı0c4z0 $#$ 0 ᑴP 00< 0R $!$  <0 P0S> !x000x0x4H00H04 04"4s0S+@ᩱ`PI 1`80 @@S00!1(,01(  0 @100 0202, c7,p0 $#$<0 S  <0 PP 8x00x0VxD\ <00<0 00pW75 <00<0202+ ?@4 0 8 G7^400q x0  0 Y Y \0P0x 0 0@ () *04 0 80 +,", nr 04"4 0!MqY }< 0S;0H P*49 77 -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 o < 4!4"<0 o <4!4"<0 / 6S,t0 c a?0@X1A P N먀p0P0Pd @0 0@0d (Kg2"(0K!Q|1H0 0P ( 0 P  |xpPz X k t k0 QZ 娀00e  *1Yl!0l l|S0SD0Dž p0P0P!= S@ `0`S$ 00s  t@P sd @0 0@0d !0@Pc !q0[ 0 "r0 00| 0 Q0\000:0:TP!X{ ᚥW$J(9Hl, -L|`娒P@GP |! @D`t`x2 20S? S A !0S01S 1 g\P W 6?R2 RT  R; 0j Cx@ |1Sp06 0jC0@P10%Tt h1l1 S 1% A5g 1 R0! S 1 !g0 RV (>P p00j C PN.j2 2:20Sp pS:0S0 Q020Sp  p S:0S S:00j C 920997 -L|0W`@pP@T:Dp0 Q!P𨝘@80 Q!h|PP𨝘l, -LMT` 0, K@#pP 0 0R & (K 0aS0BD 0a0bS㼹P 0@l l0<0 l0w0w0000S S,0S H000 0yPP 0 0 !jP Pp :0D@D0t t 0S "2S1 `0t0 R!:t0=t0KPx T0X1P pbT!0hR0 0010P2 84!0,"?02O000g:Sp: S 7 100! 00&?0OD R1 0cS!`S? 0@L1PA"AP ģ 0(@0 @ 墣Z 0@P_ |!0 80P00? H@l0 PJ 7 jfF$J499 -L6| PS@p@T  0S 0 (G0 + GtV(  @0S"1 0`V 0000 0U00 | R l0  HP Էt04t0嚭t04t0Z -LM`0 xuP P  00lSڽ 00lSpWP, $ 0! lPU0U40 P` 0O0@0@Ң 7tP0֠00e0     0/8 4 0 W ! 1QV P嬢 \00H000  tU p0 0lQ0P,@ P尀T㲁 ,00S,   0R (KQ0` 0R(Ko0 Y  0R; m0!0000Y 0a1 ]0P,@ P尀T㲁,  0@_8@ 4P @P@P0,0 p 0@_8@ 4P @P@Pp # Q00000  0Q Z$J --LhMdx  0 x , p0 K 1 0#2S S7 , 0R(KZ 0R p *:W 0@`jTh` TPP P  2 )@1@0T1 T ( h0v@T 000'Z   t0KP t 0R:0p 0h#21S  S R0 000P`eUh` ` ` P ,  PP8 0 ,l$PH<4$4%$,,.̃0`` `@.#` @ PU U > 00"!^00 ^ 1P01<  FP @ "`h`h``h` 0   (0 'B  R 0S0s7 0S0S 0s- R  0S0S0S! 0S 9`` 0S ( P - 000  0O0@0@ jh`0`j 00 h` 0S T10cS`!0bSڰ   `1R 0R 0R6 S&02 ' =06 00 0 PU |0@  |1SF Sp: wh@@yp 0R0%p :W N ^  `` 0S   t9R    0  @ <4!4"<0  <4!4"<|0 PP 0` 0(0OP @ `VXDP|0VO R 0Sl:U Q @ P1  #  0Q 6 S4!ʼQ 0K0( 0 5PjP |Q 0HX!0 b0b S0| |0 fV  @1 la0dR ?S0 0,1(1 V V Vz Q T!R 00bS/0c\0^   QL0A" 1ǁ h0\  0O 0@ 0@0` 0 `` 0h `lh` 1\0lࠣ ̣ 1DZǡ0h` 6h`VS00c 0a0Z0Z000/  0S  0R   r 0S ၟt00t0`  00cS%10cS!^ V = P 0(HKHedKEe\ \ 1P01|GO  h0f@$80 ?0~J70 S@ 00S1Q T1 0bS00dS&ڜ@+lK 1990l0 U @0 `V101 00cS10cS  t0K9P t 0R0%p P* ez t0@@@ th 0O 0@ 0@ @`` t0E0@ @KGKH@K庝0d@K@\K 4Kc@K尝K0 P Q P ( d d 0#  RK0A2@TJ HKdK 0hHKdK 0PP 3 pC 0DP, P=0H0KGK D d0KcKK0`0 &K@1 |` (PP T!00bS @R00^0S Q0 S ,P ( $J–9I9 [aC@DJPPl,I 9I9IL@DXDxDt%D[IH?DF,949|[$J8PO V 00lS*I00[|6 S@7A@ 1t0Vt 0 0bS000ѳ 0 8?0It0`0`SS1R!P1Q!k81S !c' 10 1   h0@S0B0 ` @T2  P 6 Sʬ!00S !0h` 00 V ᘝ0? Q< Q+0AS6`99T99999Ty 0bS R 0bSQ0`Vh0S 0R H0^0t0 Ń Hᅅt2P3CH0 |1Sn S@h~ 3t 30SK gH pv=|3P3CtHj`f@F 0 ( 0 &\ 000PD4DD `BPQ 00cS h`h`c& Re0@S0S'  h0K t0tV6S 0 S.0lS[ڸ$6S$! 1S !10cS000Żl 0O0@ R0@ |0Sh8\  <10cSx5l 1SS 40^ A$1TቚP1&#Q  !U | R l0  HP 0 f@ Z0b@? 0t# 0p!0bSth1Zh0 0bS6 0CS񟗧h9 99 99 Kb( Gb@0 = Q p7@T 0R `#3R{ʸ p HKKdK 0`pp3i06\@ a00 f cgR0TT10\13t0t0006 #EJ PIXdp(p8wlx/|8w000(0(8?00Gt0`0`S  00C0P# @hr 9@dd ۙ  K0` 00 @h`  ` hi\!00bSTʠ`h0O 0@ 0@ w R R_0 BkaPX101PK 0P9Fh`V)  0R H1 0c0cS000@3 0@jP `10cS 0\1Հ T!h R 9 00cS0lS" 1S:6S0 0R0 |0S8!R <1 0cSXkba0 `c0O0 @ U0@ | R l0  HP 0 >✭t 0p!0bSth1 Vha 1R 40T,0?0>F= ? 0 t0ătot0t0St0@ 0SES1R!P1Q!s010 Rt = R  Y} 1z 0Sw 6t th0@@h0O| 0@ U `0@| | R l0  HP 0 v>0  ᔚt0ătt0t 00cS@ 00C0b0SH00@00.L10L1h`v0P0  0jh`嗯t 00t0 Q f .cx 0S P*4?tE@0\00  6t/0s06s0S ڰ' 10 1Ph 0RQ  0l aS0 R0000 @@h0O| 0@ U0@| | R l0  HP 0 =t`3 R @ Y8 15 0S2 6/ t`0 @&0S |0S ,!S0b"S":(1h 0(1p ȗ st0ăt:t 20St n ᪙d2tD ,A(A0\000, ភ  IAcO0 GP!gP  @$1D'8a0 !0\0< \` <$!0, 0cS 圀ŠD_Dt0Ńtt0ătңtt 0?0D0P3CDT 069 0P3CpDf T 0  \0 <P0 ?0[D & ,9F|[49[ -L --L0@00qQ/s0A1h1 !S0 Q xQx<0 / %D&r0 S0Һ6 QtBL9FԐD -LdMp|0t @0|0 t tbt` -400aS7!0! 1%|0 d ?t0t !0rRP1P!(-nPx |0 x^jjZ|@W| 0x0U1!Z``` |`` @0 \b0c3QZ\ / Z dP \:|0 t0|1S Si S .t t(K1Sd t0r0SH1Z:S0!0bS\ R Q;!0\` aV0b0bSTt 00aS  0Q ^ 040@ t U-|@x`xVP"P3 ! 13^jjZsUp/C40 @ V\ |d<l  tp  t  p   0SI p(Pr>pl 0JP  aZ0`0 00Ƀ SdZK r0 S Z RY0!0bS-) 0OiHD 0@ D H0L@ `P |ɟ00S; 11 L9 0 P004Z|0 0x 0 0 0|0x@ 0S|0 (l   t00t0З`P ȟ00S|H0 P000 0 xQ p 0`RW]x0 P  @B t0 1R B Z40! <4!4"<0 p Q<4!4"<0, |\0#P7P\ 1Q!0X  a47\2 S 0S0X0 S"r 04"40 00cS0ՠ0 & S 1r 0 4"4 1202r R 40 1 0cS!= |0|0 ( |1S S S!04"40| 0xh0 |0q  | |@% 0H S;0 0@t t`V8l1hPl@0X 0@0t 00 0tR X@ 10cS0`!t``VA 0 S   4TX0l H ,0 $<,Q$$p@T0K.UT`K4,, 0 @p@ ,d00d0tdh00h0t0d t     U t0 t1 0cS 81!S3 <8!0000@M 0RI #0?0A40> _AF:0@(0CPs00#$ 0h0 00|C|@|0H 0PP-t M0 p TK[p 0 #10 " 0t0&AT| x0 PY7t 1 A| F@0S0KT@K^T0K(K p04 40l [@@t ' T#R1!@ <414"ᵕ 00bS`!\Al0p000l0p0$@`p` |  0OTP 0@ P T0X@7V t(P! t  RA0t0  t@2TAT6S ڠ0t``t ppppt0 p0@|t FYt@ 499*$J7 FNDD$DD|[0R1\R!/0  Q/ p-LlM4Q4a0@ S - tPKX $|> |< |1S' |8 |( K 0:0X!0\KphEXPT 00|, x| sDPL–Kx[JaC p-LD@P`P00T00Sp40phO -LD@PpTPg 40 X0 600h.0W0mvP7S @0-M@L0  @ @eK踗Cج9[ -L,M0p\@, ` , 0R(K0S PܒPQ 0@SŸ5P: PŸ0 P- U V)  0 !@ @L p Pm @0@S D^ <  ,$!$0,0cS10cS 01 RV  0 !@ @uPH DY <,$!$0$L0cS10cS`Fl 04"4s0SD0 ~* nh1DQ2*t05t0 p10dSnpA0^/t1000 00cC0 R] 3PAP @PW<@KY PPP D 0Rx$ D0SL T0L@  `0  PLP X0L p` 0 L 0 0 0TPP0 0,PPLs<4 4T$,$P ,%< `X  0Q!1@P3U"R r 04"40| 0(0D Ru R$ <, 0R(KT(p ( WP <@KyW` x t p0X0–f$JNBL9F7zج9[aC 0-LP@@@9T0 p-L|0@@P`ןP 0`VpGPDྋph譟P0 Q`(!10bQ0 0`V`!99l, 0-L|0@@P妟P h0GD 0S00h}00 \ 0! `\!9l, -LMĢp`W, P P0SR@ Q㖟K"! * @P 0S:QR K /kb@PW2[S S+ @, 0Ra(K 1W2[S\ J S  KPP <KL0K6W! X DP @0 5 <K 0 P VKLK0@P @\(1X% @ 0  0X0 T0 \0/ b@ 1T0 @ 1X0  KPP T1\< W[0Q00 Q KP%P0HLK茿X0W 4P745GP4 1 4{ P4 P/ P)P$ ᜿P  P ݾPu40 0 0r 44 0r0P R 0S0S0S 0S R 0S0s Q PP qPU  ڿP:P 0S  PQ ǿPP P ᡿7Pfl,$JF9lD Q0-L M@P K00S S *0 `@PW!^D 40PK0h/ $ 0PK0h& 9[DV p-L`$P@ pf --LMP0,0 @l0  pvX*Yf (08 S0 8` Z (K(`1 4 Q`PQ `P7`9 @ N q0 4!408 x (0#4 4!#00! !xq  RH 202,00,0(@000:  P`A`Y 0080޾4<0(0S9` 4 4  df9[xD Q-Lp@` 0v03Q0S3Q~8999999`99 9 99909 999999999l0   0 o 0 o?ꔝ)`Y OZ K`l0L `-`l0   0oK`VR2Ÿ @`P`P l0L| `L2l0 Pi  H`29`-`scl0 E 0S 0S$0S(0S( 8`l0  0S  0S$0S(0S9` d1l0<,\80@,10`00mQ@`V_ឝ\(0SP@ ` `ᴼ`Ac`< 0ool0 ,0,0  w x )f99[D(C(@7 Q-LM 0S K0S0S P0@ SAP T \ 0 ! HP觻0P @0S   08$8[9 -LpM8@Q, p PU , 0R(K`VX0HSp kXg X 2 R W 0 S| 0x0 t | H KHK LGPKH`K@0K0 P| HK00 _P(p Yi |xP 0R:l@KLd`K0 |x7@\PKL0 c0KdK必| 0L 2PXK [tP&[pHK0P P0p pHPKHKP @PKP  @KHK0P| t m @KHK0P _6HK@Kp  xp tPpHK h0\ PGF[@K&[0,UP–$8HA9[bCC -@@0L@א@hҐ --L‪tMp0t*00`0 ,0 l h 0@#2S S4 2hP ., 0R(K0G0K 0S (:X 0S000 V04"4s0sP 0 dR' U00U0S 0000G0K 0S ` * p0K2P p 0R0% * _abKY00 0S 0S0s 0S R  0Y0 0G0[S0  SH@KK0P HPKG0K0d@K4KK0 dPKc0K06KY 0S V 0S ( PY (@ 0@yPU @0 R0Yh0 l `70S@0   h KHV l (70S@0   hK 00Y l0  h0Sh@K @0S@ )0㦗V l0  h0Sh@K @0S! 0㓗C@HK h0@P& 00 00002_  (0V0(0   0}L0SO 0000S? 0s<Y S00d00dSP$U!X5PU  l0  ?@(?T PUq @0 Yl0 #0RY ,0S00S40S80S0S 0S$0S(0S R@ `$0@P9 Y 0l 440S@0   h K|V 0l 30S@0   hK 0b囂 HKh0@ ◚PᅄhP 00 00h0 @0  P QQ Y 0l (30S@0   h K9V 0l 20S@0    hK0X HKh0@ TP 0@ǎx=4@HK+JH@KGK dK$K 0D0 !J0d@Kc0KK0`0 , IP6T000 IP+#0R'QY  0@华(@ 0l@\Pr> $0Y0"!$00- ( ,葶PUc000! 000Y' 0 8 R 0R( R 0R0@LF( pPP Ghhh h0|_K00  0  ~x[–@D[ʚ; bCt%DDgxD -LF0D:[Q-@P P*R 000Pn 0\: -LMP)0Kp @Ă)0[ !#R)K R W (0/0(0 (K%aVT l5,  , D001S %1S ,5,  , 40701S1S1S ,1S Q ( -Ph$700001S41S81S 0SK S} 0SA S00S S000(1S 1S  P @00@0s  #04!40庐(1 0 ! j0 4 40)[Z Z Ƃ\#/(00(0n00S 00S0 0 0``000Ÿ(0CIs0 # 0p @@B 0 )@[T T` ፂx"/(00(05 00S S{) +0K݁@0+ K*K*0K*[ 048( <"4!<0#,##8 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(㌁00,<4) #:+0K 0(0C@   00Kt00,<4) #:+0K 嶐0+ K*K*0K*0[0 +0K]0  W0049C40\7 -LM|4 8 +0K `>+ ["2S S (00(0Ё(K( 0P "2S S <] 0P†`P + ["2S04 * K0S000姁 0 48<,<4#:4*0K0SY )Y( 0S:Y )Y p 0S 653 R1 (7<3PU0 )PU& D10 R@T@T W 0S 0R Z 0S %GP$00$0Iw040`O0@Y0@ )YuPB8 R LP  0r@ D0R@  10t0Sa@`10`@  @ c@2@P `}0Sw } 1 q*K 04 8<< 4) K#:)0KRP> 0 p$(,:0 ###̠ ) [*!4"<0##$#8 0Hp*K 0)0K 'P  )0[R 0 0Q0ẅ`P&000 00 0娀GP|@dH00H0嗀 0 0 0000 @@΅}\đD:1hf(3$3zd0 -LQ1  0 ($ 00 0f :\ -`0-LM R1   00  0 _ K 00 0D:\G-0P` 0 8<0#40 0  (, "$ 0 8<0#DVM @' s`FP0$$$Ġ0 A 0# !0# 0#$0# 0# # ,` (V@  Ѝ0 8<0#40 0(, "ĂV-00r`F0 0! #0 P0 ,,0 ,ĠA 0# !0# $0#0#0# #  `" V0  0 8<0#40 0(, " V$$q00 14!0#  0#(0# 0# # , 0 0!!(!Ġ0 P  0A  1 ! 4 (  0 .,00!8`0!$S!L  [,C,C -L\M@\0 2 00 0 0 0 L0 0 ^ 0 @0P8 , 0 @#\4@ @, 7> G,0!pc?WP -L,MT  1>?0@0c80 X1" 0@ D <0 08T#8^H L0 !\0!pT..l<, 8 D[#4@ <8 -K2KL[T30K801PK CP4K .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q X^=, 0R(K'–:TC08 @-@ 0@$ $0 0 00 /É#EgvT2ܺ @ -LaM 0lK,0 =l0hc$c<( !@ pd$ aPnn!  |?ga jj|`0tPϟ|p0 & "p h =iieQ0.t.&|c͌p 0p 0#  0\X`(jj lq- fP0X PaĠ0a0T*d=-L@ H!  d\dL P D-L@il (@ DbaDpXQ  8a cQi<=唐 ,%0  08 L@@gĠ*gl0,nq=d8 l< `@ !' iiL 8@ ,@jj\ -` cabQ8&H @M|Q %HQ<,840iĠ i 0 |q0d =jĠ@ j@ 0@$ !@cQ` -h 0%h $,$aH @,|0 0#0bq 0# +1 0 O A  A0'na $hAʟ. ! P!0&`A-0.Q0#0_dQ  Q1$ d#d1bQ1͌ !  q0p' q  dqH1 #1 *0% 1   a0 `&a a. o` ` lq)Xa@,`.0'0 0#pɟ0@ 0-*a@.o!1 ` aP$0&$0`0 bA (Xq`"_0$Q `&0#a p a(1͌`Q &p ` p&a0% 0#1 d1oTa la!T1 0&@p 0#,-,pnAT0, 'HqP,p.0$0#1 P0 bǟ #P1 a P"P%Q p `p0.`Q0#''p `   HAp&a0%0#oa 1 `0͌aAH#1a 0$Dq `! 0#-lq `&D1 ' q0.o ` 0#DabQT!)Ɵp )"d!` 0%0#*`A&p* ` x&tꯠ韠p&`堀 0$͌0# adQ &`!,&` 0.lQq 0#p- &0%菠@`,` 0#p&aş`1 bA  &`"p &Dq`0$`a0#'qp%0 p 菠ᜀ 0& P 0#͌aq (0T$!0'_P 0#-lQ@ 0吀 )O0% @ 0#0`,尀bA *Tqo a "na $,t4  "& p0!菠P 0ਁP" aq (. Q0`!!ğP"! '`Q=!.菠ጀ ͌c@ 0#1  P1  !a1O@ DA`0  x@#0 1 0`!0q&a-l! ba 3O !  0p!0!Q01 D1 P'@ %pP0B @ P'q@=@n P%@ cqM%@Q0X" 1 0 菠! 1 $R0 @ #P0`1P!-,dAP1 !韠Pba],  0菠  )t t0 ଠ0., *`  . .p? 0?Spp0L`@  go]7@@pb W7 ?0YP@p ?0Y@P 0 -L MP0p0K`(0   ! b62 R1<0Q0^ ~?@ Q R W 1  !1P6( 0R$K !–DpCtCG-!' ([?P`p  Wq Y@AB p Cp@SQ?p0)*0! "<P`0#@$1Ap0)@*j耡U?訁嬑j|0@ 1AN0‡0[_`ZStQxaYW_`TXQO/ O!Q/ !1S?1AWO0AQY_`Qa[oaq`!1Qaaq圁堑夡!p|  ⼡PqL*w8p *i 帑唠$ 8aP_ Ɋ帡夐P`#ό弑$P(`**iYቛV dž儐ࠍPaQᬑɠP _)nƌἑ娡婔*ሐ †XP`ؐ P% `&P`P` P% `&P`n_`謡3P`tPx`a<&Πr_`C!p$P`"#P` А)*Ȑ̠t0#@$|0@>  lpAQ$AT@0aR)*cLP尐崠H`nf_`> P `j 0 @ \0`@b? 0 @0@00 |0#@$0@\0 p l! ")* b_`AdhL TP`CD@ P% `&0訐 0 @0 @d0)Dp*@&0%8ap. @0 0఑崡!110~PSq́fnb_`j/ ,1,A 0 P`p<@( 4 800,08  0. j? bP`p < 0< @0n?4 48 f/ ,0,00@ 0@,1,!8<P `p<0,Q 0$@4`,(`,p,,04vߍC -pRLP`@D1>0A cWP2016:P 2@1@ T@D > `phW@;@ RpG@D  Q*H0 0@H0L@W`WP 2@1 0S@DR𭝘H0 0@H0L@SH0 0@H0L@ -RLM @D1>?0A @c YP20 1):Pp , 2,@P`1@P`@PD` l?Y {@<@ @I?Y@D @Y P e2@1@ @D 0-PPL00@ S2PM2@0@0D@H0L@0耊C -LM< < @D @ H0R8 4 b4 8 8Kp1A ` P 80KС̑ @ 0!D#L"$4d't%l|(0 , @T0K0plqd`Q\a `P00K!h@0H)#H 8%hXp"(* 0D @@< @pDH0L@# < 0pPP0P<0PP <~1<`@H0 0@(KoPPp`1<@pPP10P0< `PP1 0-L@MP4 8 00 ,@ 2 V8@0@P`0 , 0K言p 00K$!,0@#4<$DtPh` @  0 !H#H"(`4@8P0^``8(Ko0 0-L@MP4 8 00 ,@ 2 8@0@P`0 , 0K言p 00K$!,0@#4<$DtPh` @  0 !H#H"(`4@8P@^``8(Ko0 0-PPL00@ 1P1@0@0D@H0L@0@C P-L M( pV @0D A1aQp @0!D#L"$pQla4h0@\q @0!H#H"(`@@8PA0@ D0.0 D@? A,@ @PD`*  08PP0+?PP@- 8P0@0 0@ 0c8( 4<"$$ (@  Q $Kk00PP800P0PP8`0P@@`0 0-PPL0( 0P@0@0@0D@0耎C -L` 0   RpP @0 Prp00@Fh Up000@-pS`P@0 0s0s0 r   00 p0000  " @Tp@-`RPp@0 0s0s0 r   00 p0000  @Tp0@-PQ0@ PUr r0 0s00 0@ 0 0p@-`RPp 0!0S@0  "@  80#440# @># b1#  0^ p  0-@PLX 0#40 "( 00  0#40 "( 000蠎C0 -84 0<00 0( $ ,  / - @Lz/02  -LMP4PK0`p$0 / n4[  Z R0300%0[0%0K–\@ 4[  X R0300%0[0%0K 0Q1 0Q11 P0#1@1!@T0#1 z!.$ 0R2 K1 P0#1  R0300%0[x 0s00#%0K  R0300%0[x 0s00#%0K–C -pLP`@~Vz_1 P0#1`F V@  gb0`R1!~ g20VS  2𭝘1!P0#1z_ `h@ -LDM⬀`0dPK$0 p@.!.@0\0#0@@T n.$ 0R Kx–C @R-LDM؀@0P$0 `(p L 01dPK@M.!L.@060#0@@T -$ 0R Kp2.A9–̎C -LDM⬀`0dPK$0 p@.\ .@0\0#0@@TK  -$ 0R K–C} @R-LDM؀@0P$0 `(%\p k00dPK@- -@060#0@@T  QV-$ 0R K\p-@–C -LDM⬀`0dPK$0 p@-X -@0\0#0@@T , (e-$ 0R K–C @R-LDM؀@0P$0 `(yXp B00dPK@g- f-@060#0@@T^ ,$ 0R KXpL-@S–C -LDMBl0 l`0h Q@` 4K,0 :f 6fl@D0E@L H P@ T l R L0KX d0 `@ P@\@ 4K DKfdK\`dP[$0@XLd0Kp @0L#D<P`d0K<K@0D#L4pd0K 0@#4<$Dd0K,0@#<4$LP`d0K(@$$4@pd0K@DK$<@P`0!@"\ D0 @@ ehDKD KDK 4Ke<K \ed0K 0@\Pd0 `@ X@PE@TX@ \P l`0FLPK`@PU`P`LP H` T``FvT` tDK&, 4K0#,$, 0PR(K–/C C -L4MX \0  X0H T !H~e< \zeH@P L <@ D @ D@XT @0 0HS< D @0 8K+(K\ 8KZe< 0KVeT8K8 KIPKP[\0@$LP0K`X@0Lp#D<P`P0K @0D#L4pP0K 0@#4<$DP0K,0@#<4$LP`P0K(\@$$4@pP0K@8K$<@P`0!@"8K 80 4@ e0K <dPK0@ D0P L < 0 < D0 |/C! !0p@-r `Pr .`@ 0" 0 @ . .0 0  .p8C 0-L0 10Pץ   0@,00@0$% -LM Y300 R.* 0 01,  s@#X`p  0$0#s@ `V  %ppP ,0 $p ,0S* $% 4-L@a+뀥h -LM,  9/0P`,0S,@p,Q@T@a0 9/p0 P`(K0S,pc@,0S@S0 9/@p0P` G-MP$`Q0l0h 0Q0 1>0   @$T  p00 Rpp 1Tx?>   c0 i  0S0W d@JT 00` 1^Q?>   c0p@ C  0`0CW^ Bb 0  R 01Q0110`1X100a1 $Œ\ !  0S 02S\0 P3Ѝ1>0   q  R 0101 -L$MH L  p ?e`0OO^P`1>PL 00B"aeQH LL08`0?pH>   c 0㠢2!s0+PL0` l2RH LL8`0? !> c 00POP>p@` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  06>|)? ?(KLH,0p S0QK 0H 0 >?U d:DChC(D@DD D -LXMpL@ 5 RD @ 4 `0040 0@@DP(0PpǏtP DPt8@ ?@d_dD< 8 <@`8P a4!, QU1U.Q4P1D 80@Q< 8 @ D0DP @ ?  <@. _@P @ Pc8 Q @< ( D@<8`04 cQ PQC` 0Cc@0 d3R D2@, 0PŜ00 P0 0^= 0wcD 0O L0 H@ 0jcDPL K @_`p 0P* ᖄ@_ p@ lP cDL K `F,PKcDppP l0 .?bP00C0@2 RT@T0,0!00C0D@00@P <K 0(KD ɯ 0t b@ `P D0O  d  %h D0h@| x d < /X T  ?@0XK0@x `0 \@  x |K 0O R" /d@ hP9,`pK@popD @0@P%0 X 00 , 0 P CQ/d0 hP9,XpK@<PU T -LM0 @00_Bd @P R b04Q RPQB K _@P  <L 0S 3SK  U -L M, 4 0 0S}Po0@0<44SP`  t-= 0d3<`&=84S 4K?b, PP, 4K?Bb00L SP`$ T0YP3p0Z/`0 1>0@ 0R!pP`\WWPwP3ᢅ(K \0`R a`05!p, QV1V.Q PpP3PL0S@3C " B " 0S<$%U DDD -L\M` p0S]`/0@0T8Z0LOPo P` 0OVʶ <4 S?a0 @ `40 P8 4(LP 0S>6p\<@<`0?0 0P@`WPo<4$  $ 4 DL0@4 D d6 HP/<`0 800c@ QD0P 0;<@ 6`  QX"<<@_ `00bP"008(Ko=UF`  0s:f;v `@ 0tj:lş0p `*;(K< <@$80`$8D TLÙ@TP D T  n < 0S1P1@\?\0 0 010 0@ 00L40 00 ^$00C00 ,0 08  [W1> 00@ 0000?L000 #40 000800 *89$%U D\DD P4 AO>@ ,@ P L PPK` P`PU`0% 0S 04  \0 p,0  ,0@0S,0 H1@0P@_@PP`@@1 R @`0?,P4 @\H ,0`@0` ZHP% dVp 0@_D0 0T d 8 Q800cOWoU80pV0ۂ  8 8$%U ̔DDD -L0ML `H T P0 L3P0 R00S  L lPD L\U #000S T08UZO 04 R40 p F0SFpW\ T K D@ < 8 Z?\ `p0 , 0 K 1> 0`# 8p^ 2Rψ0K0O` 0@1 >00SC 0@ <0 TZ p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$ Po j$ 4 DHL0S@4 D  j 40Z0C40  j! 4004008@K0L DB@@ 0A R!4E @ < S@ < @K(K80, bYm \^ 1/X`0 0O0@1>0 R!00 \ c! 400C40 i! 40040T0@Tà Y3 1>0 10  $0@0C$0 $0L80  $ 00C \ 0  0 R 0O0` @1 >004߀00 c! 400C400 a! 400C40$%U S-L,M@L0 00T00S`H D  [XLpW@ H  R\ \PLHXPG 0: S t0D 0 ?Sʰ LQ ?HKZ@0,P,X ?pZUL20 Rࠡ02 0 P^W L#0Sࠣ0 PW(KL @10P80 0: SvD0S0X0S<0 @p0O0 , 0, |Tp P p0''<@P O ȟ P T0K/<Y8 4 l` @ ,0O0 |"X^8W[80< 0@ 0 0w t0D 0 ? SʐHR0T R80H RK< @ 0,,@0 0 w@ 0@p 0 0 l 10P0 }W3< 0 .,0 0 VX  045t%DD3 D -LM ,  @_ 0Y 08 Y4  ?n40 0Y, `p ,W84@8 0 @ ,P\ 0T AB4CQLUPB!A0 00, S000 ĘT@!V4 < 尤x<0PQ`004 WP`1`#Z ,WV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YLØ2 08@ T@!@`02 08 \YYPL20 80S@@2 08` BVPZ,(K004`V~ꮘ,@tV, TPL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP0p40 00 `@$4 P @ 03!3p(K XO ,0P>* 00 ,0 V X= H#0S0C0h0 K P 4 L0 0pP+0匠0Q5h@T'dp@l0S 0l0@l0Sl@l00S0l0 00 ,0 H#0S00~ _0 DPa20hp0 0$Y2 L38CDDD:`D(DHD -LM 00 $5Sm  @ @ 0T`t  !0|@d0 l4@ P\S,SQ00P ` VP 0Kt0  S; 2@0Dd^|80 |0 / S@ O0  pc8@ `S_YQY 0W V0  |@4\\WX1 (Kx0S K 0^ 0Pt @`Rx0S0S Q @_@|0 PS _ l2Y4KKx0KPK0@0@8KPo 0KP4 R @K00(00 0Kg80S`2 "K00S*40S2(K 0` `0CR 0K00 n HP P @0(0Ss ,zp0S22 Tß ?<   ^V1ЀK 0^@ d|0 @`>@ PPS SQ00P @0d ` b|0 R!,#Q 4 d03|0, @<0Tx`@`,H 40<40,L ,00P4K40S{<0^Y @,H 40<40, 0L`,00\0R 04.0/<0SDO@$ .0 T 4S P004SPzGPE84S\X/T@0bRD4K_ Fx8@0` .T/4SW:T@/</ؖDDD8C0DDDD؍:ԗDD,DPDDDD M-LM0@0 0R`]`/0@0X0s @Tg 0S < D?`@tÙ n^c&8Q0` ^d tN0 \Q@d 0PT@TPU\ 0 4pǏ,0  0L `P<4@S+&  Q @H ,Q@P<ڜ0,h h 0(K 0..84 S  ?S#3 P 0@ x0.h;.`TP  0 .؍:lDD8C0DDDDD -LM P@8%0  X= Rh10  P 4R00 0a QUUQY00 @0@@ P  b PR0b1rl1eQWWY;0YSڜpK4K 0P 4Q A0! 4 X`V 0  LK0  ` 00,KU|P ,0@L 4 !T@_N R  LET2S85@%0L00@T  T R ( 0@<0K @000@ 0 @_0PIP P0@ c# 0S4!#Q P030 Y@!<0  \(000  MxX,xpup @0a0C @3/  V0 X 10( R" 0P 0 @ 00@ @ bb R3a@`QVRpl ^A 00 {P O uK00P @ @ bb R3a `Q\RH:D 0`( 0<0K 0 @@@_0PiP % P @00 @@ z 00V@`d 80< b201 R2Q0<0d 2|0!<0 (0000S*@5L 0` U 85@@0L 0P@T \ 00 zP  0@@,8uL@KTQs 0 0d0T@# *00P@/00\@^00 T 0  E@0 @I<0K0 0 0O0 @ 0@P <@K0KL@ 00iy, d0 c# 0S4!#Q d03|0, L@,0D,wP H K !X X@@0 00vP VS( 00@ @P 0@<0K0 @_0PP / 2 0@LW @0D@$D/00h00dh0@   m  {tVb2(KP,K00tEyPZ, l0L !: ,vK`t P  000K y@P9 000+00 x0 d0 c# 0S4!#Q d03|0 L@K0` 0g`HK ,:v,7v s00L@00D0t@ Y+ V+ ̘DDD-  M-LdMh p l h0P  ` H `0@t 0H@ Hp0SH \H@  ? PP L `ph0@0 pKDD@ Txd 40}$$h000(80d 0 @(, 80<@4 @<0)Q4 d0| Adr@Pd L|8 `0 0咽`pd@\ L0 \NPt0Q 8100`0t RL0$ @du< \p8p p0K`0 @tX0 T@ H0`@XpK/OpWXp T LR  @ 0Q  ã?  8 AT\ Ry p@<@(KP Q81H0@ ?@@ 4 00 Q0 p ?Wx t0 `@tpxd0,K cS S8RCQQpA0hXK P@<,0@ P< `@xKh00@pDp@p XK4pK`F0OLX T TJʓP Sq < \ Jldq@<@ e P L drp Pd@40;40r`0_Hpd  l\ \4^ ?XQL9O, KH0 PXKh@<,0@ P< W) +HD R-LgM ! `P.00AQS.!@0T% Q(L0( ?S; Qh0Saq (q0@ 0 @ 0  P(K1UP PPiK ᣜ 0@DP<0@@,00@408@!Rl h rn iK茜85 0|1 0iK 0iKP P 0O`0@0@3r b RTQT2 1 g/K  0! 1 0KT1 H D t T@_P`POp@P <` PU`Ġx 8P 4` 1!H@KX0 ORp0t@AqN 0@`^ p1TQ(0a OQ0(01S45AS0:+ iK0p``@,0K0 p` 0PPP0iK  j ,s0 00 P905QS*P3iK0pp@,0K P@00 0PP 0d0 " A `iPP@ 0 A#O 1#  )1 ?p 0 P% JA`-8pP P P 00 /1>0 A! `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p/1>0 AR! "@e00 @0A#O 1#"1?0 @0 P`% !-L M|`@00` ,p `$00KPp0OV V 40P  (0KڨP 0( P `V$K@0S | R$ 4O0@, T|ӎ|@0 0@`@Pd@P00K< @P#,$0 SQ,DD,D -LM 80 4 P0 l1\ \RXlX^QVp00 < #4 0 004,K 000rPP8 ,0R@4,,85L 0 80 (K,@m 00 @@<,^3 . R Q485@ 0L 0 U///// -L[$@D\%P0R /0 R40Rh0 S8P0!R/Tcd:C-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0O/Rs QE.1EPo,`SH@P ``P`P`,L` `0` `@0/@P@ PP`O@D%0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K <@$0#= ,K ,0P@S ե 0A 0P@x@ =S P@(K C 6!:DD p-L00@SP 0h0S  +`P p0    Pܤ܍p -LM, `20\%R64d 00  8@c_Úd t(`p`p<@D_@,E`Vp ` p, , 0C@$0(@[`4P8`,P0`哅 TD -L$0P p`  }@P`@0 S` V@ j@P   0 0劣 @] -LM`b$0p "PUMT500#0=PP00U00S@ $KPH @x0 @ݤ 0@@s 0 Q喢P儋Lƴô$0`B:$0 R-L x 0F S,0 x tp x0@0 ]PZ ^@pt(0 cS S9RCQQ @P0(KX 0 ((0@0/S8P0@R pP0 ,0 0Q00QRW L ,0 0QP @p0p@$ 0 Sʐ U- P ``p pW V   Rڜ@! (0,(0P  | 0 S\ 0d1!0 ,倀K((0Sက | w|@ `PpQm 0^@ h t+ D4D -L M P0  000S Pt K`0` -00P P 0 S0S]]Q/ 0R 00/ -PhpL `@0 0Q   R 0S0S P0P]]0 -Lh||`@p0 0PP 0S0SP PP ]](0 - L0q 0F]]l0 0-L PR 80S @|i 0P }0 ~p-`D \1-LM PRp@ 80S" R 0S` XP 0S0S `0 0d~L $0P 00 00( ᰀ000`  {p-|D -L@MH 0L YDDpKP`1hAL,K 0 @`P+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(KX -L8M0P( @> P@; (p0@ K\09@Pha0 `p徙@P (L0( R-0[.0[S!"[0R4 0R R ~( 4(0KL@ @P ( T (Q ~$K@(@ ..D -LL0(\;; 0P 0LS L tPUc 0 00h X0 `  'P p';;H 8 喓06D 048  ጓ 00K& L@ @PHQ U@ 000jU> < 0PD  ;;StP@0dt00S L0 00KPD 0 o <\k p0\h 00 p\c z D d2@P0 04 0S*0"L (0S0000000@0 @   <  0姑PD 0S D  L0 00KPD @@H00 S 0;0 8 D060 8 㥓P'0D@ 60 v@00H0@@S H8 ؒ060x u@Ps8  ん@P060K 04zD@ fxP `dL 0R L td;;Sd@PPD 0et t0X <@0 @ 0  8/|<1UK L,0 P <<|PMOK  I<8 0cP 㳊 8108–.<P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K P ,  @0 0C"0" 8 4 0$  04S0!0K,K P0  @0"0C0 -L$M`  PZ4 80  t@P,K0pK $ 0@PP @P (K40@$0(0,0l, 00f0eaQ80  ]__T^|` -LMPp L$P  t$0(,@ \`,K 0` `4P #P  (K -LMPQp`, 0^ 0^$:0^!* 00000 0000@P0S @ 0 v$P  K @ @0 @ 0뤣Dt%DDD -R  SL M R40 Pp`z  Xy:#:ST:#:SP:#:SL :#:SG$ :#:SB 0Vd*UAXPPx a@P; $ (0 V6:,00W0K0v#@T+ ( $0 V&:,00W"R 1 S0!,K  $tP X#@ 0TU#RP (K@, U:00U40PX40  LLT T0888H H03$$< <0.U*QPt%DDqLDmDn(DrܤD -LHMpH L0 _`D Z`00`,P(@4 0dP40K40Kࠁ@K`00@KS0%5R 0 0T@%5UP @ P0e S* `0KV (K@j  DH L0P@ P -L4MPpU@80 { 0$%Q01Sr: bU0a,0 50 R 10 O`>0 J`_  80 0P, ```P(Kf4   40 ,80 PP   0 ,80`P P  4800P, zP -L$M`p @ PZg ^ 3: @f p@ P`WK 0-@ MLP  0P 0P 0Pxx 0P` 0TP@zDD0*0<0 K0|`(DD_D_D]DT^_dCP/,,0 S 0 S/P/ 0 S00:S -L$Mp@4 80  00 `0bS1:\W YM0I  :#:S R 10`h Y !3\ 1!0a 0PPPP\: @P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST  1O)$ Y P$( ,0  0 R 1S0!,K0K?P, 40U@:00U8P80 448 80  (0  0 t%DDDB(DDТD -L.^0 !P A1S  0AS 10 ! 10A0 0t%DDrХDDD: #:S-L0 !P0B.0 nt%DDХD0D p-L`!Q@&0 ,P&^  QP# P 0 j `p Q0S 0000 00`p$$$ $0 1/-t%DDLХDTDDtD -$ 0@` cL  P/"6<@SpQP !R00R0S0!P PQ<@T𭝨Q0P P  @TP  00t%DDD 0-L!QP@ 0 D.  R 0!0hE 0t%DD5ХDD -L`@VP`PVp$ 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FU b-@L P0 0 0R000 0: #:Sp-L@`"V  00b0eS 0S 000  p/086t%DDХDD,D -LM@p, ,P0, a@T; 0S"4PU(0 (* 0Ի,P ,P(K ,?0A0C0 ( Q" ?,00,0 PP  0FAPi)N, 눧DDTD: #:S-L@P7j&jV8RPp) $F%6p@ˌ00 @` `` b10Qe^P@  00!Rd R$0$ (0(@@ <0,, ,0{p0aat%DDDD -L0@S0S0b 0@sb,hX$$ 0 00at%DDD D 0-L0@S700$ R(0(0(0  $R( 0 P 0S P 0PS0!P 0S 0CS00PS0000h 0cHDt%DD4D , -LXMTK`P pK, 1@TO 0K( 0@ , (0$Q\ $ \0K((0$0^X0 $p ^0 !0SU000 0R0) P ^0Q $0S Q\ ,0(0,0@\, Q0 X0(00P0X X0S\ X (K\J 0at%DDdD ,0-L4P M@,, 0PdK0h0aD( -L$MpQ@H L  `D@ Չ1P< P 0SC@WeQ0 0a00P 00< @00WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0SPQC0WdP00 `00R04P4 0080P0  'JD 0S U0000PRH @FW(K@Q Q0,,00000DP 0@0 DD -pLAQ@`P Q RU 0S W 0Bs𨝈U  0h<0 00RUh[ 0h+ -P0000L00 0@Sp` 0Cs𨝈  0h 0h  0S 0 -L M $0@pb< :#:S Z%ZU! ,& X0XX (K 00Cs 0@c 0"0Cs@aQeb PT  b Qb @P b㵉0 00X{0 00 0!0c0,0  P4 !,0  P!4 40 4T P !}  @Z1bP10  1` 0bf0Esb`u 0As Z`\100 !1 cttt t0``h h0 j 08  j01   0뫪t%DD"4D#lDsD -L@\`po 0S $ 0Pcz'zWZ@P%iŸ0 p p b10Qe%P 00@P0S X0<00!  R 000 00 000X 0  c!00CS0K 00Cs>D00 D0< @@ R$0(0$ @(S; $ 0n#6S"(,0X0UD*^* ( <0#8(U$ R;$ R*)$  n< &P@D00D0 0$  c<"&0n000$ D  D 00C0o]@o@@@ @0%,,/00 $ $00aat%DDJ4DD/ةD -@LPZ00 p-`L PP P P@Z(P5;pD -L@T 40S 0S (0(400C40 0-L@PT 40S0S# 4 R B004 2 0S#0S%0hK@P0S p0S0Cp0ʀ |0(0 ( 0h]a;<< <0(( ,0y 0}adt%DDHD\DtD4D -LP 0 a 0-@HP ML@@ 0P,0 QAK0h9a(Dd 0s0 0/ Ap-L00@_1 ` P 0S P 0S 0SpPRp 80S00`@ Pp 0Spb M-L(ML H  0D 0A D@0@S{L0H 0!P0 S0!BCB.8 4@ h@ < D <@0aVO 0Z0 Fʒ 4 TBʑ Yz 8 R} 0,0 , Q'10pP / 2B,N D&!*@q9PuT Y0Sr@@0C@@@ 0,PUp0S P00 000;0`V< P0 R< @@TX!p0T@0ap0J(KOW/`pL0OWVL@@ QD 0P6Y@00@0 0OWPVZL 8 R4 R@@,@ {|VYi8Si<<< <0@((0 00;$ $06bdt%DDWD\ DD p-L0P@ R/`p0@S0a!p R P$ 0U10`P V000V000C0S\00 0004($U V/0b@D\Dt%DDD -L@P X M-L M0 0, `p0? 0P`6ɯ & ZY@P ,k8z@P`P (0 0 0CS꠨;;Ĩ;Ĩ;;;,  0SF40S/ Z= (K4G(\!0@TP, 0@P6 @_Z4@ 0P 0@P`ڼ0,06ɯ0Q8I9Y4@YY40S0Q! ,!h}9DܫDD Q-LMp` 0SF_0P/@_T0/P K  0  0t%DDD D -L 0`s0CS 0  Q$0$0$0 $ @T( (00) h!0g@T( @R'R00R @P W !p00Cp0 0Rcij !80XpQU @T 10@P qWH Tp00Cp0@0>TPpW< DdPcb{ 0-L M`PUL@LLT 0 @@4 0(0@PK0$((Db4DPc  -LMpA P #$0Kc㶠P   $0R`0@P@RP0S   @!0 000P0 Rch @Q-LMp@E0A P #C2 S<#S >*c 0Ks`P  L2 S<#S# PQ P000 0S00QL2  S<#SPc 00`p  0  0t%DDDY( 1T(K  00!250 000? 0 Y# ,00O001T  , 0\T000  0  0vd 8DDDPDt%D,D\D -LM!  \  @0xϟ 0 : P L H0 PK@Pr D0 <HQ jT0Q  S DR00 0 001  0P    @  QnX21C RL $0 b0`"vWp!#6 0CPWPS@ Y  <@K a 0<@ X0S00S< Y WP`P @T (040S0Q `VPPV < 40 Va  0O0@@ Y4-54.88!810 00HP,(0~Cx PK 03PK0`PPPY00SV|4(0,4(^@-0 00dCpDDD|D DDtDrDDD\D@DDX\DDt%D,D LD4(0!(24,PK !00x00C;@  0PK:;@7,('긧4 00 0+ 0& ! 1!ᠧ},(0v  !/(0k\```!`1뇧4{<0L< b,Pm Um  PK03g Q-L`pP#*@JV  0rP T    @-6@004@ 5@80<@ 3@ 0$@ 1@( (0,@06@P0T@/d -LM| KkP l0 #Q*XXw/T00Q*b"!B10b 0Lt%DDbD D0 -L@TP" Pp` :S0x Q*Q@T (0" -0St0SP@pTVP0 RZ 0 0m 0`U0PךD=d 0-@L 0P PT*:TQ0(= R-LP@   0m0 0.  . Q/! -L΂n^P`Up(S N@ Pe,T(0 h  hL(=.  . Q :/ -L(M@ .  ^P U< #: (K  P e8 !fV @,pK , 0S0R*@V^ 0 cP  K @TM X18LpP  814@K0@ 4 0@ `.P04Q@ @\J00000  000 84Q8 `V< 0e<@ P (8FD88 O 00 0@E(=Lt%DD$D  R-@`PN`@L@Hf pp .0 h @X (=D 0-LM R' 0+K KD0|*u4(X0@$ H s80@$ H jKd(=!4D -L M@ < pW` 0G#X*qYp1Gp`00W80 M J$J>00>0S`1h# X00 V0nS`7  Vj3W@2 8 ,0K <^ P0d,S1! @ YP 4@K , 04 0@  @ XpiW@(K(=PD -L M0`SpP7 0SB0SS4KP40 0 %*@,Kh P T,.&R*<0R*0a"!Bb 0 00  000 JU * ,0 0S(K0奤@. 0`S00 ⑤ ,$n0 0S LlDe>00   -L΀(M\p@ @4 K00 DL0T40 @ 0 S00R<0 T  R 0S 0<S:R 0  48 0Sa 0S^ "0.00`,K 80, 0 P4@,`T<08 D,:,0 @T @0S8< ,:,0 @T%@0 R\ 0S  YfA~0S 1@ 0S  0S`O4K+4K+(K0C ! S0,  1!h0Q @ T00 ⾣- 0 @S@0 ` R V0 f4K` +PF xxx x0ddl l0PP` `0<</P0 ((D D0 DLee|D t%DD]DDDбDD -LPp<눀@`0K 0R 10 P  )*)(=e -LPM r 0RZf 1    Pq 0R1   hK@h`Kt!p@P *T00 p`P1XP1 Q 0 hK!PR UcZ [U1h K@U@PQ x0* 1(K0@p  P0 Ȥ00 @` P@4Ve(=# eD  0q; D -LġM  Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 0h !Wp$K` 0@P0!&00 `AP?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S,0 q$Ke0$ N@ lT(Kp,K, hh0  P,44/000 LXe't%DD,DPD 0 p-LMx`\h. h0K@P̌.!' 0` PKp 0OLXet%DDM,D 6 0 -LM\00 V> 0(K\~ !p@HPh0 0 wP4$1W, 0( 0cP`(8 0:P@zG`W h 0 (@P0 Dh1S 4WW00S,(K, `J,,  a$$$ $0LXe'(= \Dt%DD,D -L℀Mp@t `6.h (PK  @0(@ $P @B5w/ K茱D -L M8 \ 0 S >8 @0n(K 0`̌@P0!Y# 0&0 PnZp14K ,0 !0aphp 0R40 0 d0  40S_,(K0b&S@@ 0@ (P3,P0U88 0,0Z0S :@p4@Q00000  000  0%(Z8 x,8 TTY/P0 @@D D0,,8 80, ,0L(=dt%DD,DghDLDD 1-LP5P`pW𭝘  $@P (0 (0 K0@P`:P@`XW% %% P, p00Cp0 0<вDdt%DDD >-LM0`~0^@Pp0 0` `P @P 000T 0 00 0P  K0 T@P''DزD%JUpLDP/ 0 S(0$ ,00\/1P/0S,  `0R 1P `0R 1/ -@PL`0P`@T0@-D0DQ 0$ 0PT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R00S0 0-L@PP D0 0U:$0U#300 0 0 P00P0/ Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q ,RT0#03\0S 0-$0(,( Q:,0P3400Q:40P34000/ -LpPU/ 0S,`@T1 T R& @TP @0 0 R0 0` 0S0@  0S@@@`P ~PU 0 00p 0 0  R P< X? P@0T 0` @]0S0P  0SPPP`OP K0SP0D0S0p  0SppP@6P 20Pp0p 0 0 y0S@0"0S0p  0TppPP @p -Lp` R 0SPU 0SZ `0 0R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP @@P Rk Q 0S R 0S 0R 00  S`00S0@  0S@@@`:R 0S0Q 0@ 0S0P  0SPPP@P ~@ 0R 00  S`0p0S0@  0S@@@`bP ^ R0 00 0@ T`@O0S0P  0SPP`PAP =@v R 0S|0P 0@ P*0S0P  0SPPP@P @ \ -LpPW8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@! #3Q0 R  0 S R0P 0 Q@@00 0@0P/  S/P 0S0#03 P/ P 0S/0S/P/0S/0S/0S / 0- LP@P'$ Q00R03SQ #PD0$ T(0, 00\ H00SP 0T00 P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ p-@ P$` UZ3L<Lp000/F0/n -L0@nhn0/n -@0LAnp3P0000/m0/n 0-L0@P!mP 0! 000 00000LC -pL@P 0h!S9@ `T/ STD@T/  HIT>@T` $ 0S X:W  WP 80P L0P V@#P0$ (0,00 S%*LP$$/ 0  0t%DDسD6D M-LM04 40`"P @Yxh 10 Sp!z3S0CD  , K00K0 P, fPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,QP,  ` (K0g00T0@ , K00K0 PP hp 40`@y z&, ,P `$0T* , 꼳Dp p-L0@@, x0|S ! 1QpS1P`#`3P Q#3Q030 "S0aP^ Q0#02SQ#3R0#0 2S%p /01t%DD@D -L$M@0 0 S80 < Q<@ 0Q:$0R , ,(K#|  0PZD0 D0$Z(0, 00Q 0ZU Z , D0@@4@ 4 00 0 R 80S 2 R} $0Q@!@1Z `1`!T<D A lDPP3 pW0 @ 00CSH00 p-@`LP 06/ q6 6/Up6/4PP(  6/@@PP 6/0/B000cSp6/@PPLH0/B000cSp06/p(6/UpDD(D@DVUUU0 dPtu00Le`6T$0 -@@0L\1PU PqDa\@TP# 4 P1\ 0P10\0T10000 P$ 0 R@P \P 0 @Pd0. d0d0S0:!#:SS  R9Q)0P0$  8 < @ D H L  , ( 4 0 `&c@0H00AcP0pphYcP0P8444 40& ( (0!|D_Dt%DDD(D -L`p PPm` 0@ -@QLP`p f@0S@0A0 z0P0@ -LMp ,@P 00` K -L MpPU0@`0 U (0$ ,0 0S PP / $(000 ,,  V  0\0 0@0 U o ?0 , 0 0 (K $ X00R0S@ -LM<0 $`8 ( 4 ,0\p 00 ^ <0@ 0,0 0P408@ DPTP#PH  0,0 00 e`0\=0`KLO0@D@,KX `0 @PH c 0@8K 0D,K@ X`0 @PH Jx V! 3D @ @0F !Q0@ V < 0`K, K0P%8Q `D, K@0 X@?PH  0@d8K 0D8@, K X0`@%PH M4 0<0  @+8K "s c8K 0c` 8 K:T@ .`h@ hdP 8 S  0xd  0s'`00 bp\PD00D0`p|d 0hP/t0T<h h0@(\ \0,P P0) CpDt%DXD(=8DD'DrD,DP/ S/P 0S0#03P/ -0 L@1P  1S/000P (0 -0S"02 000P0,0 0l   `  l0000  c 0(0 $ 0x R010201PךdD= p-L0>005LDOdmZ -LM !Q 0R aR >0. R 0\  0P  0-LMPP *"*R 0^* b^ >0^ 0\.0 H R @ 4d 6R0  0P 00`0S*#0d - L -LQ 0  1` tP00 P00S#-@ !Q 0R aR >0. R 0\ ^p0. R 0Q  0 03-@ !Q 0R aR >0. R 0\  0d -LM0^    ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ !Q 0R @aR >0. R 0T`V0TK p a 0Pdh L$PK0@ $@ P @d/:LD -LM @ 0S0 , pP 0 h d`Vd0`0S0 ] > SZ UX )YQ>0^PUN  i:#:SG0QD0SA3Q>,  F r9@p@  0 0 !h0 6@Q 0S; @@ p1@ `,K0@!@P,000P  0JZ =6 0U@(K 0@pW P 5P @ @0 S  @@T @$ 00SS@@ SP1S``/ 0@ 50 @ @S Sx0 >P: 00 v q  S0`  XʽW@ jK00 ?@P 0L 0S  @ jj 0CZ p@ 5먠 p  R -L,MH T H0 P H :#:SD >0 Z< *2 P08 40 m8 OP L 4 d TD8 0P4 Y PP , KPD ,P <0S{D0ZL%2: <0,$ QS. 0R+:D0<Y!0 0 4 0 0 0sr 00 R* Y0 Y0,P, K <0SGD0UZ*xp p1(P\I/^H T8  040 LMQ4(K@0 Y@0  Y@0Q0 ,0<  a2P 0S000 R 0S,0 @4` @dP P00PdI/ H T8 LD8 営4 (  $0Լ  0ϼLDt%DDhDD -LM@`0S0 pP (K 00Q, K-PP00@0S 0 0K PP000, R 00CS 0,~40,0 00@SP c0 0 00/ M-LM0, Z (KYzpP`, 0P (0 :p@ Q P`ZY, 0P  0F  0At%DDbDD M-LlM0 | 0S@ #fjDvx  KWlKt p 0f0@ ,0 ~0  0 0 0, K0 0tK (0 @ ( , @RRP@Z  000000  ,PQ@, 0O`Vp0 6tKO Wt p 0ʘVHH[ D0岻44\ 40孻p@t0 K@&x(Kt%DDDDp@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0- @0 S0/ UTR p-L@PT `P`@ @T@p 0-L@PT P@ @T0 p-L@`TP@P  R0T 0@ PP P@p0@0@ @P// -LTM@ < `K Kh0p@-P 0U"F#``@ 0P !T01Rb`0^pH= 0-@PL(00\ -@L(0h 0-L00@S(0P PQ00 0  0(00ſ00C0(0 00 0000000Q 000 (  㩿00C0Q$0 0  dXe -L(0@ ,Q: 000 (  〿 00C000S(0  Q00000  00  0@@QH0 0(F$ $00000dXe -L000CS00@0<@0(0 000" 00C 0Xed 0-L@\ $0(P 0h Q(PA (0P(P A000$$ 0$ 0At%D;  40S 0s ,0S+(0S1!hD0Q `P0@K  0 @0 ,@ P P0@T 0S) 8!81偶41 Q @(KRD0Q Po0RO 0@VxUR8 04 (0 V ((($$P P0CD D0>t%DȟX 0R #v @_<0@TPOTKw(00\䁟Qh!D0R A0R ,0S Sh!D0R 0R  (0 0R8|A:#:S l˳h10 ZP*VR4<0A #F@ D80H @0"&@!(Kok 0@ ?SʯR@0D0@T P0U ?@P 0QʛP(KS``` `0ĴLL/P0忴88D D0庴l,+de Xe0PD`Dt%D0n`0gV@P0U,>0 N@ U $`KP% $J TUS垲hh@W0>0>0 0U 兲僲P=LDDD -L−M™0 @0 ,  0 @@^^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:2TF1C! cU`` ƠTʌ0P08@0D0H0L0 R 0S0!% 0%0" 0%^  n2`1Cc i0S 0pePcUg 0, >0>00 00 >000h 0P00C $ (0 0, `\0T(XL(K,ԱXeH=05d8DeL= D -@LPP`p (00 (ܸ00C0, 0 0, U,0( 0 `$p,0P qP (㱸 00044 00۱  0ֱ  0ѱt%DoY R40S 0C40(ڳ(001001z$1 0$1(@`0@ 0Smh0p RIl pSSQL Sj (`ᵳ000Y P R@q ( KY1000w @ XI04 S0K,0 0 Ll  G,10,1}k00 (KR (kn0004AP`tK@, , K00K4A0 P``4@"6 0P/@(`BE0F0T0 XXX!X1g 4K4 kP0 0 @4w 0$#0 !@ } 00(@ 0$#^_00Z 0$#R(@llt l0,XXd d0'DDX X0"00L L0/<0l,+dDt%DDHDDDLDD -LM88c8ß1@_@TP0U10@@ 0dS R101d1 d0SP12d RP@D0 U`t",0 lh0Q| T2PU 0O Q ,R0jaZ``X@@00S T  0PD1V#W Z``X@@P4 ( p 0SM Q40SM 0C40(N(  WK\<1W0J<1 0$ #<P 0(=H( 0(02( HfPwtbPskp0Q  ^ R ezx@Se888 809$$, ,04l,+dheXe`et%DDDDD 0-LMp耟蠟h!L *``V  0o``V 0C0`00d0400< B6C0 P@U`D,0<@Y8lm(D Xedfee 'Depeed $3-LMh!D 3 P1 0KWm @ ,0R0S:mW 0T00000 0Q0dŸ000<00   m<4P0"@8pWn 0 00, 0 } AQ4 z0!@Po?CSD00D0W0 #0/Q R 0O0S@V 0a0c0K-W4, 0ȟ 0X@T@0@PoPU`Q{- 0D0Q Po0RO 0@Vi@iUe@eU\ 0a0c@`0 pn18p0W1<00 ,@ PJ XedfpeVUUU+l,XD,= 00-LMx @hD0QP `\xl0L/LPnn0@孨P0 (妨$0 Q XepeeddDDF( /p@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0@-P@\' 0S$ ^) ^  R  RA 00 R000 S0  0S \ 0000@00 R \- R /  0^00 S 0  0S   0S0P@ 0 S@ @0 @0@000S 00S0@ 0^@ @  @0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/p@-`@<\( @0S%<4 ^P) ^ @ R 4 R@ 80@04 R0<@0<08 S<0 < 40S48<<4\ 0@0p0@@0@0@ 8 R @\, 8 R/ 80^<@0<0 S@ 4<0 < 40S48<880S<<40P<@ <40 S4@8@ 0< 8@0@@0@0@40S<80<0S<0@ <40^4@8@< 4P@40@-4 R @0S8^ @0Sk< 0@0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88 @ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R00@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R08 R @0S8@0T<@0<0 S@ 4@<0P < 40 S488dDZDdDuDtD - V!fLSQ埾_@Pp$ pU 0UV 0V:,Q0000 004 0 ,0 a,$00p@P V0eS𨝘 0\peeeXet%D|DD -`t@L800p<00`4p,`8`6P 0`,](0P@PXeE p-LP`U (@PU (4<S ֛(04<S ||I.x0 t\ dP 08@000Y\$v_phDt%D|D0Dpedd -QLpTP@`&(@ᩣ`㴣V& 808 @#6"STP(4<S 创(4<S  0応 0府ƽ7_8i袽弽P` 08 "6CV@1@! <@p `V000 "!B10bP8 M0P, ,0匜Dt%D|DfD^lDpeddoD -LLMP\ ` d0  \` Q R X T dQ d d0 Bl \Q 0A X0SXQ@@  X8  0L 00 m "10D0 K0dX\00p0 @ p\ Q  @60`V Pp(0S \Q 0Q*` R 0RLD0 H0 h h 8KL0< P0 <H sP, Y da H E,0X R8 "F- \0T@1),l T08 S<0 "F `T@! R 0 b0T@!T. e0`S@0` P 0~U, b Pp  W, K@0pAP`\0` SI:tt/p4岛 0 L0 0 gZ, P<  QP < H0DS00QH0 @ R,Q $ $0S`f,`Vc@0S 0 S  0 T0S 0L @0 <`D \0yXPp@c(00e0SPP,  Pp@(-,(0 $00C$0W (0 000, (,0T, ,,00,0 ,808 #Ơ"Q P@P, 0UZi(K 0b  0S,000,8 00L 00 4 XL L (K4 ! 0h  LRL 0S 0 0S C `0\@A &0P T9 ɻ 8 0L@ 00 4  0ǚ 0š 0彚 0帚  0e\\ 0嬚HH 0姚44/p0墚l!]\ \0嚚peXet%D|DDdlDD DKpG0C0C+ԏ@P+0pD0GKL4  0C@PD p$ t4 xt Hd (@P0d0CS=\======@00S@x0! \ `'PPW  .P@ 0C@@P\ D&\ P&00@00S0x0 0000S2  0\ &$0NP@P 00S/\(\(@Ph\(@8 0 /–`=d䞖@CdD p-`QLPp@@rTp -LMp`?0@,P@fTK$@K0@ $ @ `PV@P$  (ٚ PQ000  0 U00 0pedE -L7hM0#0 )|0 000px  eP I W0$80 S0:S *0 80 S%:S#Q| p Lx R`& ,dPU%0S lK_@ lK fxQ  PW@(K@3#hD0Q|\0Ol#F #J*6x  t^4 434# Ġ`00 L|d```@p6Q@0<0B x RR 2"4hD2\@0"040 F@ Pt  @0` l00l0| R0 p 0 ` Pt@`*L`(VZJs(0Kp# [t p  >40;@@|0S40 =^t W)| `Yj" Q * <0S` 9p\ P 2hf) R tlKm0S Eft, Xe(Ț!Ce8ƚ@ < -L|@M t00t0 q pKL 9pP00P00Sp00p0 0|dt%DDExD00 z -L M 0R d @\0!@@@;~0P  0x@يh d0@ъKhD0P 0,8ƚdDD`DeDD0@- x0S0l061cQ0(0!a"@_400 #U" 0 l0T0 -LMP ` p@P: H1R ᥸@P2 0nt`Q70 a@P$ R, d060>0. V @P b 0 K0 P  ahۏ K fd 00f#&Bd 0S* 0d 0c#&d (D P-0L R.  . hKHLD 00 0/ -L,MP ` Zj @<0"0S0S_ R@@ P  Z00ST K0R00}  0 0TS0 C@ @ء00 KhP  @H` Dp < ,@ L 8 @@ 4 W 0S/0PK 0r0@`/ V @ T00T00S`' T 0 0C0 S/ V(K" R@f0PK 0S0@`h!xX00\0S T0 `Nz0SxeR A`Ph \T {lD -LM< -L M@H \?pP` 0 \p:@P`0s ZP,  (0  X 0  0p\00 0\P P(K(Q,000P0\`p \:@`pPUY   U  R(,  (0 0!,RPU ( ,PP 0 PE R, (PPU ,K 0PPP ,@(,[,000, (0 Q, (,BDxD -L0S0S\寎xpH0 `0@,PXW𩝘D M-LM p0   0 0U@` | x t 0) 0 R_ |t\  l hU`0X 0@P` K@V 0P |` x t ڀ0 |@ 0|tPxPK`,0  0 0  =P ? ( ?   D0(@?( S @2 0QD :P@|0`S8 PU `0S @␀0#000Q0S0 =0(K(  0S@   (0 h#QX3@P`@T  S  0S pK, xK 退K , K00K 0 Pp  єP 0^ ,0Y (04(@ὔ㫔( @ 0Q 0  ^ f,0Y0S@0Y01 YJᐢ0ኢ00P(@ㅔ2U x@R x Qx0KP` CP (e:@ Q P`|@T0\0 t0p.@ >(  sO0< *I((( (0XDD8DtDDt%DDD -LM0`p @0U `p KT0 R 0-LM@01 00H00 0 P=0S P0000 P0S 0Sj00   P$0$0$0 $ 00 K0K0htO奌DD 0-LM@ 0C^ >40 0P40:  0   0 S 0 ' P0"  0 =P0S     Q$0$0$0 $  R0 K0h&K00 K0hO 0呌Dt%DDD p-LMPH"D1Da @ T`@L0S @T U0 0S6 0 0 R(0( 0@ @T@T"m(@T 01 Pp 0S0  Q$0$0$ 0 <0$N(@TKph0" 0 -P0LpW `0V08@ 00 0h!&h!G -LM 00 @"0zO0\{  0SR 0 0 0  0S 0  0$00$<0 P70\0= 1 Kh0  P"pK x D000p Pp0 <0S 0  0$00$<0 S  /N0 0P0(K #N @ 0x  0h!#40   L0 K0 P,0p(P0` @u(x 8 0#40"!B 0SPvD l=Ghd0  B DQ00R 0S-LP P00S00S000PDQ00R 0S-LP00P00S00ӊ(D p-P@L` P?u00Pc` p p-P@L` P&u0,0Pc` gp -L4Mß `X V, p@\ 0S PU0S s 厉`Ÿ, 0R(K0Si iTL HK0FVS  T DXwpX82@0T`P0 L l0P ! T R ,0S00S40SQ 000Y00S @0S p0:0 S:  tP @UtiL\@0S W 3S@0S<0S= ,@K utPX<\`Q P\ 2/`V\\ @Kp,@K VtP 80SH0S 40X FtP `HK @s80S40S 3SX^–PDHA(C$8CLC -LM@`= 0 7, l09 n $P aAq喏`PUPEU10Cs0S1RSP:A 0P04,$D L,0P C4 0,0 l0 1!pᰀW5@X)PUPE 10s0W1X*qA 0P04,$D t,0P UPE1(Kq<000 pᰀ@W 0545(5,5 |2-LMP@`Q< ,0 E 3SD,0SA00S>40S;80S89 0 Pz 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SJ  0 /OP 0 1(K 0 000  0, X,  (Ko04(4 S :0  0P @0 ,00 ,⾃0S0S #P , -L4M⠒ 0 S, P PL "0S/0Sr 0S 0S0si ,0,`Sg HKH@K@KL0K ^P , 0Ri(K 0 H0PK@PpP] H R 40<0L0 L$[w0S00S40S6 @0P@P00S 00S 40S80SQ2 [p@0@p@ Rf100S40s80S pP,<( " p8u\P0S10P0 0h!–H@\C Q- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1\ /\ R 0S0S 00S0 /\ / 0 3  0 2P//0s /0s  /6/A0AS/0-Q"R 6Pp  p P01:0S S*S P P1:0S RࠁQ^$00Q1= -@LpK   h 0- LP  @  P00 00  p-L M`@0P$K0 mT  0R& Kph趆WqT00  \a00 PQ K0 S  0RKpG[E[–ԗCDClC R-L@p`h僆R00Q qP/.00 S0 bS2QSD -L0@S 0P P S T pPP P0P P P8C -@L@Pԑ -L Mp0@@PK$0 Dap8K0 @0K?KhP 4 00S 80S0C80$ 0R K<0S80S0C80ggZ–C 0-L@PT@T Q 0S dpP0 -LIM`0@0C S 0 0R,KAGFPP! KapJKp001K-K/Kh Q000 0 0 006G JZ–f2i C -@LP 65 0-LIM┑ 0@pT, ` @T 0 R BoPPT000:P0P04 86 5P70P0+ @00@P006 0OKS/KP@0S 0  0 0 00pF, 0R(K6P Y–1i fC p-P`L@ 6 0PP700  P{P@ p6P -L4MhP0`q$0 @``GQ410 0 0  Q  0@00h  BRh 00f$ 0R) K_00S 00S40S80S l 7oP 0R K.0H 㤄100S<0SJY–fCDĖC -LMd`0@KPD$0 X 'o <1U  l0 0D X0K`hpP 0R K.0U@ @U p0dU X0S  qU X 800C80$ 0R KX0S @Q f 0X 0 0@`X 80S080Xf qX–(D,D4DԖC0 p-L@`TpP0 nPPUpȘ@TUp 0D!fPp40p<0&p800C80phl -L8M`@0 P 0 *R0 `0SQ \00 000IQ 0RK YjpP000 0N K.0 80p 㾃mX–pDC 0-L 0PD!?f@P 40800C800<0& 800C8000h -@LqP R# 0S 0S RQl0S `t0$0P Z|001S X 3/`P a0S i`P000fl> i 4:-LM :\p0, 0 oWZ 6h0H0SxXSt HPm`Pn,HPKFP-0S x |0S]RuT9 RXU H0S |0SUH|G@[T h0s @0@0@0s @0@0@  ?P 6d00d h(0@0Y@@hG0[S@0[S?0[0S[Q &04"4s0Q ǟ, 0R(KP 7 R00 Y  X  k 0d( ) L'00(00@0@&  `00 |0 0 00 00 %E_S<`= P d0 006SC P d0 -T0@0@f0@0@W-0S S / K.0 -#@Kh lP0 000`$V0 K.0 nKl6$@K` Ġ#Č<9K4K0 4P  K `KKPK0 P 0S0 00 KlğxKPK\K`KdK~lğFdPKc`K$D!dKKL [d@P   LlP 80S0C80EOKD]l(ğDQ dK( K 0 P  eP {  KP 0S0 003 d0KP 0lßFP$D!0dKd0KcKKLP d@P   kPg 80S0C80ŰEOKD ldKDa K Ÿ(P 0P ` Q CeP * K 9PM 0S0 00b02 R L< 2 R  K.080 *)v gP0 1 R 0 K.0 80S0C80ebb80S0C80Ůb(1 R  K.0800   KP 0S0 0010PV 0 R) ׀%bl0 R>  K.0x80 €1&04"43KbK)–ܗClB$%XDCDxCXC@ܚTܚHCD$DDD -LMpS0,0 @ m 8#QP 8Q ^*8T!0CT*8T 0T倀-` 8Q 8QU[  F`, 0Rc(KT8T L8TK 1CTJ 1CTE ,8T\ u4T+ 0CT' 0T$ 0CT! 7T\0CTq:Y 7T0 7T 7T 1S  3/`70S-`X7T[ 0TY !L7R/`U`U  0`|`T6T :60SQ 0S0S 00Sk 6T $0CTd6T0CT*%0CT0CT*!1CTM1CT 6T 6T`V5T~ 0T}U Yq 0s %`V $0s %`V 0s L@0@0@0s $@`0@0@5T Z,0CT34T 1 0CT 0T<0s P`!Q R@ 0A0@0s> PaPU`V@ 0A`0@1`4T 0T @i2.`3T 0T6``p3T*|3T' 0T# !,/`d0lMTC P`VP KlPPip GpP4K K蘐K⬀ 夐 K p@K 嬐0P 0ଐ 0 Q @0[d|0!s @0K x0 K@ KH0 D &WP Z 0S00 h00h0X,!/F@Xi2 Z`;(0`050@`0@/0@0@Q60@0@5U`U`U80@`0@P &04"4s0P R 6R00&04"40K KOZP40Sa~`,.–liHMi iildiH`DNi4WiHeiHii "i %i i i>CIi i Qi $%FiRi Si !i fD -LOMğR  Sd1  0R,0 ` 4Q 1CQ 1CQ -`, 0R(K0  0Sn0Sk1SSg1SSc R`3X_ 1CX\ 1CX0I dP P@QK@`0SF0SCpKh  hK h@T00   1FS0K0K` d1x " p\`K dh\P<0X@P80T@40P00  \P X@ T P ?hP <@KEh0)T2X  \K :hdpWHpWE 0SY L`K &hLP<0H@P80D@40@00 \K LP H@ D @ gP1X3 WOKh  h(SK( hd6 ^K`` g|| g` d1 1!KgT00   cQ^Kg( (gd!6 `F` go00`I}FgpK`g  gK g0–iiii CD -LM@~@0T0 @T 0 R0 KN@T -LM`ptV <3PU,P  0, 00 PUE D1S@T@T@T 0SJ, R 0iSl PJk `2 R ,0 P00^00Sd V50 0 ,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ, g{,` ^RlʗRV 0 0bSPRXWVU P y1L@D -LMqQ@R  R$ ` $ 0R` K\a0S^ .S\ T 0  QO .QM Q0  0 n?R0ns 0tPK0K8g0[ K T At [R A0Bs0S 00 R@KXVfX% K' [4PK'(Ef00 < 0 B 04!40 7f>P0 n0–C -LlMp@K0`X 0 f%h0d 0PK'' f0 000#0 QK P–@ܚTܚC -LM0嬀K8 ,0 e f@\KxPKHpK` p  K`KdKc`KK`K4 0 Hp PL, 0R (K<0 R  0  { O–C8ClB(DC -@LQQ 0S\  R lPpGP P GP P UP#P PUU` qeP  keP U U00 0  0 0 0  0000#0  Ye  CeP== -LMPpPDa0S"$K,1@T T P0-@TP0`0S 8 yz8 sz0S 0 @ P `p pP@ P`p^z8`0S 8800 Rz8 ylB1D|D4DD D "-LM`0FK8 @,0 ! d e&r0P4!01KP T 0R0%p * kr[`0 0?  00@` 0@R 2@0x x| 0x+ 04"4s0Sp0 - +D  h00@` h0l@R 2@0  x@PS04"40e 0 n`0S "*0S"J0t0l:Q`: QT* Rl 7lPl 2 0l@484 <S  ?\P| 9\Pd p@T00Il,0 8  l0p@$,0P4"4ts00i(P=00S0I <0)0Y09, 3Fp R3l0Q.l,h0 00Sh @\\@ X 000   \l @  l0 X@\0D hP  !P  04d 8 <0R 0P4<1  04l 8 <@,<4 ,$#:"*Q | 0q03R0S ql@\  @0T U0SPQJ 0 00dSDl@T  Q000  噕l @Tl@pƟ00 O0@l  0$@Ql@P0000l0 0l@000 0l0b0h&00C0`P " 00@0@  0U0@% 0$@EPt500\XPP -pRL M@kP `VPPyP4 ; 㭒14Q(KX 0W0 0 ` @ X p`垐T  Y* 0.S  \R , vV0 ]* Y 1 1Y*p@0S .S p W@:000Q0D>S@ALaPLq u0RS00Ls0 S0SA Na0Nr s0RS00Ns0 ST0AALaPLu00 LqQSr P`0 R-\QPNN0`@TZ0.S 0 R P :,0 0RmQ 00,0 S 0C`00c 0a0,0 `X -L 1 0( 0*m UP2–P@C Q-LM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P UP,0pcXj Y X`Y@   wUP X0j S -L M(0P (  @$ (,< 4!4"|W`( 0Rn$K1@JU0 10SPDKHU0 C0KD K–@@@@C .0-LMp@`N K | K.0P K.0@ 08 @,i 0RK >–DC '-LMQ 4 R \KL K ' `ix@KS0pK \Kw0KxKS( K`P 0Q @T! 3 R80S0C80u"Kr3 Rn \KL K  /ie\KL K  &i  L SP P3 R E/KL.0 B\KL K@  80 i80S0C80L0[S@G LK\K Sp300H 2 R) \KL K  h JQOK(J( +-P<\' 0 a% m0 00V 2 R E/KLK.0 B\KL KmP@ F 0hK0[0S@@ ` H@!0LK@3H!R;! 0H10SP*PK`K9SpK5S2S0LKK 0KK0K0KKK)S\KK %S K !S(@GKH!0@;PP (0INJ@KS\KK0 0KKSpf80 Rb \KL K X LhY–@x@lBDD@DĘC,DDhDDDDD@d@t=D) /R-LtM%0 0p,0 U 00 S0% :Pe 0 P0 ` 3V *+Vk ,V V& 0R0% :PN 3V`000011PP 0@S0% :P; 0 $Q`P<V 0Z0#X( dKR0 Qd0Kc K \@K dK0L P 4 Rx 0 l0KⳒPp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`P|0S 0S0% :P 0 @2  0 l0KwP l 00R6:0S l0KhP l 0R':0@ l0KYP l 0R:0_ l0KJP l 0R :0=l 00R0% \*og@@KHKQ0 H0KGK HK 00 U@P_ 048 <:R0D0 00 H K\㈠ P x p 匀 p`K 0 21C0 !10\ R dK( 0K(D 0/S0ُPp ( Pw ǟG(0@f_;0[0S1@ @ 孉` 0:0 000@SK26   @@2!<,2!0 @1"P 0S. " 00@0@0S! "A0 0@0@\ H===============================================================================================================================h=0====P====p=0P0S " 00@0@v0Ss " 00@0@h0Se " 00@0@Z0SW " 00@0@L0SI " 00@0@>0S; " B?0@1 A00S- " <0@1A"0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@ R0S " 00@0@BF 9–lBDlD–@@ܚTܚC@D -LM  0`,0  0RPf " 0@Ux-P`>0@ 8$H0S 2  充M,  0R(K 0 S`  K:XY @: 0@ "pP. ̟! !=0@@8DH@T JTe T TLP 2@0  @T^=T=<=H==< R+P`(8,H0@(8,H0S 0KiP  0R0% * ` x;@P $(T5 T :T Tz 0; R 0Ps0Kn00S 2@08 8< @T  8H0@8H\U\ >0@@*084HTW TP 2@0( (, @T\ :T0SP "  00@0@ Z K.0@ƽ0 L_M< 4T)00S 2@0  UxT :0DSdq00S " @00@@0D@0Sv_T:UT 0S 2@0x x| 0(0H@P !A0S6 2@00 04 )00S 2@0` `d @T4UAt'0P  300S 2@0P PT @TU#&0P  ?00S 2@0X X\ @TU&0݆Pt  1d60S U U8&0ʆP P 0@8x 0@ 8$H#lB$DW@D 0-L|P@ R 0S00S0 R  AP @0 S00 0\@@D -L2$0>0 >0@@|@@ Q-LM# @P`p, ( ă@P 5", K  pf`0, K $K -`L/@40!0c480!0c4<0P 0c4D0 0c4C@@D0 00Q@0 00Q DP@10 R h 00 S,H  0L0C#0 O~PpPI~P@ꫪ$% -L, 0PR*0L /Th,  0S*4@pD`@` %~@X4<0,0 H8@G00 Sj,$% -L@(Q/0( ,S  3S001 001 R0P// Q-L M0`H0L,SH> > >(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>T>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>(>t>>q0 py0S` P@: K-`2\0 0`| 0 Ki` 0 KiT`440 P Ki@@f`ApCx -L8MlrP@P$ ` 1$ 0R KQ<R> > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > >> >>> > > > > > >H> > > > > > > > >>0Q:N0K ~VN0[0M0[ 01PڢQ: V0Kv~%[00SVV0[0(Q:L0K( d~VF0[00Q:N0K W~VN0[0M0[ 01Prp. _Z–,C`D p-PSLPKM0C`@0%T  @0FPp@p -LM0p c@$04"4(Ps0(` V `!3T 1T +T (KYP*0V':.0K },0[S! -0[.@[ 01PZ3T0V:*0K }3T*@[)0[)0[0101PP<T000 3R-LM@p 2<R X"0K }3T!0[!0[00QQ@P00U00S ; ~1` T ` `|U * 0} PR +R@~@xD -L,M@0, P ly /  DK)0D bPll 0 R 0 0( T @3T 0T6 T ~PP p3T0000aa 0V 3T T#T00T0 @}}2@P  t, 0R(K<T<T }+T+Tl0 3  l0 2  )0T0P0T0 @}@@K C@0[S` SS ZZ 0SV l0.  )00 ڏPllfP@Kt  ,1̏PW 0DK48<< ̠Č,ʠ= )0D 嶏PllT (@P  00Qwl0 1  )0㝏0S@}l??0[0S SK?0[0S +-–8C -L0P0@S ڀS S }S} 00@0@ 0S 1  |T@P`0`p `p0 -LMPRp"@31:S? S UL*  hp PaU @0SU:0PaU(KU/`V90 <0K B0 0 <4!4"<^00 =SL: 0U R*KB"[04"4s001@P  w|+00h >*0@0 @P0h @P-,0@0 @P0h @P<,0@0 @P0h @P -LM`@p 0)S0(P 0 0Q( Q0%(":P*0@P  (K( ,0KNP , 0R:0( ,0K?P , 0R0% *8lW0 EP00@@D 0-LxM\0 , ! 0S 4/9I 0@/9I0S @ > > #=0@8H0S " 0@.P`0@ 'R!P00`S5 H.P`00@0@0S 2   {, 0R(K (p~P 00@W0@ 2  0l`p10  Pd Q0SW Pl 0Si0Sf0Sc0&d,P`00@0@0S 2  $ 0P l,10@#P (_<,#= 0@ ,8HT,'= 0@+9II+8H 0@+8H> 0S$0S00@0@0Sa 2  $ WQ0Sl ^a P 0Sk Q0Sj 3S. KP' *P`00@0@0S 28 8< 0S 2    0iP 0S0S0S 0S0S 0S$0S@0p0  (00 $04"4s00 P`  (0BSc:(R 0S  0 (000S T  0S 0S0s 0S0S 0s (P00 @WP0T@ 2@ @D 8V X@ 0R0V0Sx8 KK 2 1C 0\ȟ1 0 <8P` 0S @S0 R'P`00@0 @0St 20 04 jQ Q ^ ^ Q Q ^ ^ p6 ^00S *P 00 0@pJ>00@0 D^ f0S 40L&> 0@&pPT 0 @p%l"00@0@ R_ @00@@0D@0S " 800@80<@ |( 0)S(IPX 0`s 1 R@T <>P#0S p!h 0-L sP5 P 0eC1q \0@P*e4P4*0 R0S sPU X L144P:D D0@D @_0hR=N?hD -LtMP  !0 ,0  0S 0S 0S0C00 MRM.8zU 8P 400`m80S0C80Tȟ00LH =04ȟ00$8  vȟ0D0/Z @< T 7`p@@0 @P@D @P<0S 28 8< `7`\7`0O0@V04ǟZpK0 .0 `K.0 0<@8@8 0@RY  0|v6 R0 t6P, 40) 80S0C80tDƟ00 0ST0SQ0SN6Ɵ6@pǏ`0@ pZ@D  vv, 0R&(KY0şZpK 0.0㛯 `K.0 㔯0 @08HQ%Z 40 0S@ 80S0C80ğ0000N.$Z-4@P Y  0jUhH 04 <@0 d0`TU00H &p 0@S S 0S S <-< 2 Rp pR: R. Q,RE*P 0@P  Y( <2 0Sp pS:0S P0  30S 0P &p "` ;P Ÿ0S``"Py 0{PO <0S " X00@X0\@2@P@ @D Y 7^. ^a (^)  0A00Ss000n 00Sd0 0 0_00S S^ 00S SPY Ku(G%z2&P`800@80<@<0S 2H HL W H00@H0L@ Z2X2&p XP <@p&W eYa 0 [–<@$%h@D @D$@TC ) p-L Mq@ 0K`PP 0T Kp00e TpK :TP TP 0S0![ P P!K 0Kx 3-LMP"< 0S2 <Q 0 P0S 2! !202(K < R 0 th20  0 202  :2<2) 00K`0pL<4Z@`,$,$ 4!'<4 80 帀_ ZF 0 000 00 00Q@N Q7 0@ 000 008 p 400p (00s #QA"A"WqK W :W 0S0"kP0S| 00S S00S S *0Kw"P 00S00S$J[C -L 0`(S`=tpPs7A @AQ PPQA@AA00D000 00(@(( ` 9` 00-L@P!vP01 0'S(xP0 0'S! 0S S 0S S  00h0" 00S0 0 00S00S0000hs 00S S00S Sʚ; -@PL Q000 R5hR p-PL`@t U  U U -p0V 0 00p0V 0  Q 60p0V 0 00p00p 0 p,@ p-L@ 90h00d0 p-q``.Q00SLP@ P {00/U00S00=U00S0d00U00S P 80S0C80E0 0P {001U00S 0P {000#U00S 4P {0403U00S 8P {<0P80 80S0C800<02U00Sp`P {0`0p// -L@ `PpM\0DS^\00S #D\0%< R *0D+S6>7>P7>8>T8>L9>6>6>6>6>6>6>6>6>6>6>T8>6>6>6>6>6>6>$7>6>6>6>6>7>P7>8>T8>L9>6>6>6>6>6>6>6>6>6>08>6>U U0S 0S l00l0U0QSh𩝘P U U U0S/R0S 0S S 0S0{ 2P  7/TPU0 S𩝘U0 Sd𩝘P\ U U00⃁U#Tx 2Tt TPn { P\  70S9 U Uz00Uv1{ P0A  7Uq Ub 0U^0S[RY @W0ST3{ P8  7.T$ P PQ{ P  f77l00l080S `P4P0S 0S 0S0S0S PU 0SP 0S0S0S 0S 0'3"1 0S 0S 0S 00S` P  <4!4"<0DD -LM@0pS`P @  @WK{ p0 -@PL{h -`0pLdlSdl {PP" @ 000S { P  600S 0{ 0APX07 0640S 0{ 0APX4  46`0S 0{ 0APX`  `o68P0{ 0APXPP8 8 [6 -PPpQLMP@  K4T<0S @` T P RT:00S000@TP" T `0 R0RS0)S B 0 P000@TP .P 0-LMp@PTh* `U` 0S{PX P0 0  {PP@ {p{ @ P-L@`p Pm 40P480S0C80f00$5D1 00 02\(V A 20Qp  Q Q: 0X p Q* P Z5P\ V<`20^p  p ^*\Q  Q3 33:^*X0 \ 0 X ^ ^:P, -L8M @0p,0 4W`PT@ h 5 dP7& 4p@ 0 0@ 0FSC>C>8D>lD>-0T0 0Sh$0S 0S@T5 @T, 0R(KU R 0T0 U R`K4` 0 Sr 3  U RXK4X0S0ǕU 0S`0S0S0S Q 0SPjP@K$4(0 L0 0H KG0K@K1PP PP0T0 6 PP00S!04"400S2 S: @T@T &0S 4P00T0 P` 0T0 P T KZP 0S0 000000S&04"4000S S– ,@`C #A-L$M̒0D ,0 0L0 QH>H>H>H>H>H>H>8I>H>H>H>I>H>I>J>J>4J>H>H>H>H>H>H>H>H>H>LJ>J>4PIPO 4PL 0P0a V(p oW@V   3, 0Rg(KPpphPLPK``nW@ ; nP PpP`@@K3pP`P PP``PpP 0PP `PP 8PP d0SpdP`pDPK`P l0p0HPK`H0 p0HPK`H0 I–dDpC )R0-L@ P\ Mm@0@0S*@ P00\0S ;mP 0 :RPP`n0 @ 0PP@\ 0S @0@ 0 :RP@  R-L@p`8nPP T V @  2P; dm1l77 )R-L4M`PPP , p@  <@h0 T P, 0R(KX lPT+R< 09R9 3R0R,RE .R *PT*R〠spt 9R 3R0R.R +R *PX RRJX 0SO PlRRB R RR0B<SNP>O>O>O>O>O>O>O>O>O>P>O>O>O>O>O>O>O>O>O>O>O>O>8P>O>O>O>O>O>O>O>O>P>O>O>O>$P>P>O>xP>O>O>O>O>O>O>O>O>O>O>O>O>O>dP>O>PP>O>O>O>O>P>0B P Q񟗯R>R>R>\R>$R>R>l0   P _m0P 0 P00S)R PKl0#90P0 l0#:0P0 l080P0 l0#80P0 l090P0 )00S0P0 l0;0P0 l0#;0P0 l0?P0 l0:0P0 l0P0  00P0 P0 0P0 l040P0 &RZP5 X 0S<0 BP <R<T>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>R>T>R>R>R>R>R>R>R>R>XT>,T>$U>T>PU>T>R>S>R>R>R>S>R>R>R>R>R>R>R>R>R>tS>R>LS>R>R>R>R>$S>PZ l01l0PP 7 7PPl0l0Z l01l0PP77PPl0l0l01l0PP88PPl0l0l01l0PP88PPl0l0l01l0PP66PPl0l0\Pl0l0<< Pl0l0\Pl0l055 Pl0l0l0\55P Pl0l0l00/PK pPW? \Pl0l011 Pl0l0l0|\66P Pl0l0ul0q\88P Pl0l0jl0f\88P Pl0l0_3S[,0SX00SU40SR80SO5 R; \I PH0 SPCAl0>\77P Pl0l07l03\66P Pl0l0,l0(\77P Pl0l0!X#R R R& *P>R=Rl;R <RP>R=Rv;R <Rk 0P 0 kP @ PR BPPEP>O>O>O>tO>O>0T@ 9P TK0H @PP#T0L@KS T 80T000 k 0 /0z R R!Rp$RnRl #R R PXb Q0 PK0P pP Pl0|X0 0S 0 0pPm5RjPi@R 1RM1k0P 0 P00%@R d1RQX 0SY0 @R 0$1S SP$P@IGyPPDX 0S= 00:5R7R1R 0BS")X 0S)0PP P Pl0P00l0l00 0l0l0 00l0P\ P – pCC! (R-LPp( B(0lP @@0S1` jP  0 0 7gP 000 0 0 0 -LM`PUjP1 @0 0P <4!4$K"<=  0 / 000gP @ Z_jpP ; i1i77 0 @ 0 0 000  .0@hPp r -LM@4 8 4@a@DX(@(<4"4 0  00 p4 S@l4p i@PPd P  g@P_1(@ ``g @ 4 ,0K/@PM4,q0 n00 4!4Rs00#$ ,000  g$, "$ N r 04"4 s00#400kP!  R4 000,0)) , )<p00,08 Q h@PP7@(K* -LMXϟ<@KP@ 0 , 0p  <K⨐K 0 @g 6.WD 0Q#  K !;`P 6h4h2hP/h|0K0 +h^ R t, 0R:(K4Q  K !`P8Q  K ! `P`Q  K !`P0Q S @ 0@0@ S 00 S 0@@TP00(@CT0*t 04"4s00#40 R U5 00  0 <000S U$ 0 0 00000S U 0< 0 00000S( U 0+ 0 0  P P0S|K`P Z@ {f " Bq-  L,0S) 0S&0S#0S  -`P|0K0 0@  +|P1 80S0C80,ʃ$*U N`P 0SU ʟX0 0@^|KX0\@   W 80S<  & d^ 04t*8  R    R  *8#4"<0##$#8 00s 0X@KP,0 PKW0Ke0X0K( 0K K0 ( 0`PP: H0 0@H0L@ 0S " P00@P0T@ R 0S W 0S  1<10 SK<0K@K@`P0 S @  W h0S Q  6  R R Q Q R] Rz QQ Qo R 1K@0100 0K ! BP`PE1  @01W l0 0S$20Sp  p S:0Sc RaS:  0+ P`|PꨀP `P``a  7`PPIAV  00@|&0@0S9 "P X00@X0\@0@00 @ 0S\3 0@@ 00S Sk 04#p;Ph  ^0|@K-`P@ P|0S1<<1P " 00@0@6S 0 0 @P0@P3` P3` X0 0 @X0\@400  @P|@K$+@ @ e\A0SQ@ Pe: 0$a 4P0 0S  ,00 0( `P0S " `00@`0d@P00feU t`px00@Px0|@ 2p pt  0 *`XP 0V0 CS0`VD0$E D 0, #5#3 0f0>< 1BMb P-L \  R @T 0 S *01 0 S00@ 0(% O;M;DD -@PL_ 0SZ 0SP ` `1 RLT1` V 0SBP/ Qq 026 1`S0$ V0@ \ :1S 0 R  |:0Sh0`0p(@P0h% ,:$: :lBdBHDXDD4DD -L‡x pp l1d `1P P0 @1TB? U(1\~ 1`^050305:000T @~ 0`^* mT0\ P0 s`pP h H0Q R US0Qzf>$ LB $%B -LMPHpK`, $@K0 H0KGKP| 40 3V1 80S0C80Y| VZ, 0RQ(K y@P KD$0p <0;00 K |0K P|Q D0S "|80 0C80|40  R00 R V 0 R .0v K㾗Z80`0` 9D0S Z @0 R V l–lBDDC 3-LM\, P@ 2\2 0\ 0C\( P, 0R(K2\W 2\2$P xPd2P @`TPqP PUp 0`S# 1P 0@@ 0S TPVP 0@S00S yTPA00S<`K^1 ^;  D1pPP2P @uDQ "0 0(0", 0 0$@c00S3[S&04"43K00S$ liH–Oi Ni4WiHf BęC -L0S/ 0\"\ 0S\0 0 ( "0 , "0 0 " 0 4 " D1oP 00S0 $#$r QB0> CCT -Lpᜠ@T0 `3[0$00O0@(0@u0@ 0@$ (MfF$% -L8Mp0\,0 P@ ?P` 0@H, 0R(K  0@TF 40`0 \V?  = DVZ? "0 000& 2SS Ss P \ 0   `VR @( `P 80< 0CR80A A@X \` P2 Z K.0ʕ 0`@ 70 P  w D1`PϱP`P 40 `40@}00"0 0 @Ba  0`_Q`0( (P`40 `_02l `0 0 2kL7 0C00 <0 2^–pBDFMb`BЙCPB -LP@( 4 00 SDP00S0S2ST0 00S 0 < T0 0hQ  P4 00 ShBF !-LdMP 0,0 `<@KD^ < < PK p ! 2S  V R H!H ɯS"`X<9 1 X `< 0J @KD`}!< 0n |0 t D0`, 0R(K2S < Wae –@fF$%`BܙC p-P\aLP $0@S0SD TP $0@S 0S6 T0P S) T0 R0 R'@0SpSp0QpS P 0 R 0S 6R20Qpp0h0<: @0Sp B@0@pB -L0\@p S Q@0 Qh08 $460 Q=DD2 |0- LP80@ 0P0 0@ܚ  ,Š?0 % :,#3 000uMb 0-L\P@T L0h5D 0<<q 0 ,,00h_BD T |>< 0> -LM@x$0S$7 PU <`V 2D pQ Q~Wy 20Sꨗ>Ԗ>Ԗ>,>>>>t>1 Q>001 1 Ba0 X P 0002>>l>P>0 m P Z K.07@  84@0A4h R T 0S dQ02R~ 2S{ 0 Rw0 Rs qd0S d0Sl  02X Pm 0  m q<Y 0(+4$)4–F`BD@0@C|DD P-L\M⨕`0P,0 0DpBX@\B 3 ClB4DDl0GS S S S /S 5S/80 P/0S/0S/P/H * -L@MH0(0 pPF 0PV`K .0 @%8@ 0.20000 .0 @ 8@ 02 8 2Q00 0  000|L 00C0( 0R$K$1–DDDHXDC -@PL P000h 2 D -@PL vP 0S000h~1@D0 0-L PR0_@P0mQL00 0  000|Y 00C00BH 0- @P Lh0h> -LM  KP$ , )m0dD 00@@  R +{VP 00SD1(0 R @00 0 pp    0: d`K0`000 0HK\PKPHKGKdKcKQR S @,0%K4!45K4T P0 X  TK @0K0@( 0KлP @K(`  Tw0(0@0 T0Sd S{ 0S P 0Sx ˠ@,) )4)( 0@@2K<2 K0@@5Z "P`00@0@"00@0@$2@X\$P PX\$ 80S0C80 , 0Rg(K; U1?vU1 <1 KKȠ ; 00S0 0 0X1 R6P 80S0C80?AU 00S S} m0R 000 R{ m@0 @@0 P0 1 0 m @04$ăc K.0G\0 W0 85 $;/t0–*lBD0C`DD -LMHş PK$, 0 0D!S l m0 e 00@@  R3$UP^ 00S00D!U( 0S @00 0 pp    0: d`K0`00 HK0 UG0KH Kc0Kd K \@K S\+Q R~ 0 (SzPx Ps @@K yS3 RP 80S0C80rTX, 0R(K@@KX(` ZS x0(0     0 NS0S S 0Sa +@"40 @@","0\0K K@@Z "P`00@0@"00@0@02@EP PPT$ 80S0C80šFK 0K ( 0KP @@K1 <10 K0KȠ 1; tT1!Ty P m@0 @@0 P0 1 0 m @04$$ 00Sx0 0 0t& \@K0P 4"45K4,T0 0%KXP P0K 00S S^ K.0H0 .'4 ,;#.$/%–*lBpD@CDHD  -LM0 006 @ 0000 0 -L4MXP0P(0 Upb T`Pb -K 0S> 0RZ0 0S0R0Sb!000S_Q10 0  000|5]|!00C0 .00V KhX P80H1u.( 0RA$K1 R 8 c..00V KH P800U.Q.M.j 0 0 0Ba0V K.0 @8@ H0-.8–flBHD(,DxD @TD1 .00Z K㧋 P801-c0˒0Z K.0 @友8@ 0-.00Z K⃋ P80t0-t-  0D 0 H0BaxB–HD@lBFD(,D`CdD0D DMb -LBMǟ@<K( 0P ,0 Q LKQ& 0Q ! 0%P !:U/ p\K $ P`V0 |V0S0Std6@P  Q4, 0R(K  0KXP  0R0%P *K-5@P $(<0S80S40S00S $[5R xU0S x,\ <KƦPd \0[S S NKH P !R! 011 0SS 0SP0SM0 s 3X RF T0S ,)@K.0LK 㮊 ,d4 R| \K .0㡊` ,r K.0㗊 K.0@㑊8 0,0S] <K K.0り ,PS0SL ,L [ \K ! 哦Pp`P`: lK@/X m0 00S $S0S) \K K.0Qm0A$ ^,<K P Q <0S 80S40S00Si P@K$K( 00KK@P 40  00 Ry R0S (!,[0[0S&04"45K$1 R ,H0SD0S@0[S !<0R  S! P!80S40S00Sl`@@\(2V <K\ K Ġ%ČKpC @1<K @`00S@0`0Q   <Kp0\ K&s<K K.0⡉ +i 9PP 0p a `&–@lB@DDlD(D@DDDDDDpC@DXCD -LM@@P0 ,0 0<K p0 *OLK &O`V' 7 R7@P  Pǟ, 0R(K  K.0J K.0@D 80pQ+ 0R0%P [:Ui \pK N0 \[48\l0 \d &300  L0[Sd @KH ' PnL0[S` PP@ 0PA'0Ph 0? K.0\  + O[0[0S0\&04"45K6 R  K.0ވ *y  0KUP  0R0%P * +5@P $(h[0[0S S@5 RR H*NP5 RG  *C4 R *`<KxP4 R0 *,U m0 00S x4 R  K.0{D m0* D1AP s DQ o 0Xl "30R0 ;0m @R@U@T^ 0m P  0@  " q0S2 400P40 @PT: P 0  0T/N  P*Uc 0SW  U  2S022"0 0,U+P  K.0@ 8h0*U 0m 0 m P7 0 0 02D0"0,R00S4000m hP a @ @<PP% 0U00S 1!0 40  S0" 0 R0 <0< |0 0-X0X 0 "–lBXDDDD@DDDDClDDF`BDf@/`P/0S/0S/P/@-0s l@0@0s H@0@0 @/0@0s0@0 @$%X0 p-L@`TP @T 0S Pp -LHMP0pQ 0S K P40 d@KD`4 0P0@ 4 ` \P X` p -L@`DxhP0Sp 00S 0 4,40f> -LTP Q 0 R  0( q |0@0@@0D@| T 0@0@80<@0@@0D@0@80<@lBD$% #-LMpd@0<K,0 岡  PPc ƠTZ80K1   K0K 0K00K 0 <80 4`0X@  @ ؀ A0 0000 4 0000 8 0000 < 0000 0 0K<K0K0KT0P 0 0B@00 K P ޤ`VW K,1 R`, 0Rc(K0L@K0 0  ݮ<L08H 4P0`D0P@ P`0`@00 0@K 0K<K00K@ T0P 0 R 0  R #310" cb ` p0 R Kz K.0㫅1X` '`8 00' _–flB: QNdD,DCd0 0-L@PT@T 0Sd d0RP 0B -LMԒ\ P0,0  2 R v K.0\d0 l', 0 RT(K`2@T@T T \0 d0d RP ԟpP] HK (@`KHK0@PL A L A GOKD 01 10 0 1 D 0K PP D! \00\0P800C801 R v K.0 K.0$ d@ K.0P8 $!0P &pW 0 R pWD0 R v K.0d08, &a–lBDBC$DD -LMt\0 0, 0 P2 R  K.0㚄d0, &P, 0R(KR0HK0 @>p @Kd`KGpKH@K93PK (\Kd@KcpK/D)H0K0 ` D 0Kf PP%\00P\0 D!<1@T T \0d0d R @T R 80S080:0 R @K K.05d08P B&⯟P `P P0 R  K.08d008` $&–lBDCBDD -L`@T 0 D1P DP 2S@T -L8MDSDs@0T 0  @T X0 P @@2 R T5X0 \0O P\00\0@T 0S00S@T@TX0 \0PUO X06@T 0S00S@TR@T 0@ P P:@T R 0@00 R 0R`KnP\0\00\0 PP T1 R N K.0ad00P p%`P 1 R\0@T 0@ P >P000000@TN K.06d0` E%\0T X0 \00\0@Tk 0S00SB– lB\DĚC -PL@ h0@#10#T`p9 p@T 0 R0@ Md0P 0kP 00Sp`0WV ` h00Ch0OPPh0`0h0EPPh0p0h0f -L0S9l| ٶPP3 l GTP@d`@("0( @0T0@0S0 00PX0X q 00 0( 0R$K y 8@P \0 R V K.0㡁d080@ #\\@–fBlBDC -LM0@,0 $ T|@  1 ;|0 P X0X00X0X0X00X0X0 @@0P08`P0@@DPH0T 8`lBPDDC L-LM0P℠ ,0 F ȀK D HpK$ d`K   PK   @   0 H0KG K0Kd0K Kc KxK@h p P ` @ 08 D0K P 0D! 80S@0$0, 0R(K080 3"–D C,0 -L@T@T T-LMP0HK dK ,0 `KP   pK  D  xK@H@K0GKhP 0 ` @Kd@KKcKĠ 开 `08 D0KP@P 0D! 800C80T0$0, 0R(KM–f C -Lq1QG1 RC @T< `P@T VB $00S0U  RPU00S 0k!@TV; U  D1P DP 2S@TU U T0 R  p0t:! D1P DP 2S``ӭU `V`f@0@ TDlB D1 -L RPb0 R.$0Sp&Q00 0 0 0  @T P @TW S00CS0 |h菵p 8  @0@ BD -`0L0r@PPU BTl *$0*SB ; I@FT< `Q㨑0000 000@T 0P@T )P @ 0``000P00  0`` @ T2S 0 R0R,| 7P  ``2P40 R(0 R Pf `@@0@ -LSM`0K P $04"4d!s0@P@PRL@ HP 4K <(4"4%,LT0T @S0$%h#5$ T%#3 000`1`  0 48  <,$!$ , `PhKPQp% 8`Q 01`P:0SQI x4 R  O8tp4@P $(&HQ 0S X\? 0 A= m0 00T8 3 R <K K.0}m0D  M?KJP 4 0R0% ` %;*:@TD3 R  `83 R @ @ 0<K@ @ 0S~ Sx 0 S Kl 0 GK#1K$KB0 [01 2 K#0 K0r  #30 K00K0  $(,< 4!4"<0  0 @ P $(,< 4!4"<0 P8AK 8; 048< ,$!$#\ U*X1 RO h K.0q| l0D Rp0 p0R@1*T:0PU6 ?4@00S0 R  K.0L| ]80 R h K.0=| @0L@Td @0 R  K.0+| `0;8–0@lBDD$%6MbB@D4CD@DDDHDDDD -LM`Pl?4??>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??T????t?<??>0S " 00@0@ R 0S " 00@0@0 # 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " B?0@1 A0S " <0@1A0S " 00@0@0S " 00@0@t0Sq " 00@0@f0Sc " 00@0@X0SU " 00@0@J0SG " 00@0@<–l TC -LMP`pQ@ (K0SP0@S(P& P 0 R T  0R0V0S  0psP vP YᎯ@@< 0(p` @HAC $8w -L,Mğ堤0@,0 `0Pp`0L0 `0SP  0S 0S0S HKT 0 H0KG KHKT 4PU ` S PUB @0 l0  v0S,0S00ST , P0S 0S$0S T vP0s\ 0 0@0 @P0y 00bA"PJ 00@0@Vo l 20S5P0<@HK L0~TPl>LP h>(0 0@(0,@40S80S @H, 0R(K 0snI>0sbL KV' !0@A@P l 10S[P 8<@HK L05TPI#>LP >(0 0@(0,@0L0 `K(0Sp i0P`0@0@!  00@ 0$@;Y" Pν0S 2( (, 0 0c 㴻l0@PP PT @_H=L K⨿–l ʚ;`C Q-L0Mp, L @Pp`0 s0^\ ? ?| ? ? ? ? ? ? ?( ? ? ?D ? ? ?L ?\ ? ?-0L0 X =L, 0R(KRV P キ00qs 0@S~ 0L0 q90L0 RST 0SHK @G0[SS /0L0 0@S2 R 0Ss 10L0 V 0L0  T+0L0 b2Ÿ pPPL duPL o ͍0 ȗT80L0 HK  0@K G0KHK 0UL p000dt1 R 0SL0K,p 0pH0P= RG0S 0S 0s S0S,20 Pp 0mP0 v@0 P  T)L0S10L0  <"r 0L0 –1Dfp@t@ (ClCDD -LMßS3P@ph0, @0 0 3`K 0P  w<X K^p<, 0R(K`T 0S 00 0S/00 0Sx 0S 0S$0S(@Tq 800 0S 0SW 3,0 0 H?pP700  0 Rr 6(0241"410#010!p0@ 0r  # `#$#8 0HQ 40<( :  :2@02, l0 , 2(0H P q$0S(0S900 g 0Sc100 `HK0[ @KHK @Pg@ ,KHKH0@弡P 3S@Kz aP 7@Kr– [xC/ 0As0/ -L_MP  ứ00S+`0@  @0S00f+cYU ,0K)pW0/Sp k(K\2 ,00PC S/R 0u/S @0 tKL H0  0Cp0 l D t` jvP/00%Y0`, ,0 0@fP?p  P 0p@0H0 0CtKLp l p0 t` D BvP p,0Kp`e\`@ 0LKP 0 p 匠 "vPP 0`K 0 PP 0iK PP !1R!1R!1RP1`/pq -L`pq P@ P! P9 T00PU0S+ Sq P@M00P P PA00W l9`FpGW@ L1@T0gG F`p(&p@ @0DpEDCD-DD p<0/C(b00 (0laP@p _ N An@-@R0 \0#P0S S/S/0S/0S  S 0S//Q/Q/Q/Q/Q!/Q1/Q!/Q1/R q0S  R/@/R  0R\/ P0Qc/-R 0R^ 3! !88#8S    2  0/ᄛCP P  0S / /P P  0S / /-R0 0c BSR48 R p-@P`x BRpR0 BRRR P/0 P 0Qc/ R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@/R P/0Sb/R 0PP  R/0Qc/R/0S0  R/R/ B0 0Q/0 0Q/Q 0S0S Qb//Q- * s0 0 QaR *p0\ 0 S Rb/` `!  0@-RP@# A0La L\s0r  S00`P0S 0zPs R00@P0S ZPq\\ ^0 `0O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  ꔛC Ejk3 X/ -LP ?!?!?!?!? !?(!?0!?8!?@!?H!?P!?X!?`!?h!?p!?<  $(,04@DHD( $0-L0 hYP)?Cp0 -Lh1S P q00P0S p3 p3 L -L@`PPT T pT8@P0TP0@p00(iPPpD <0-0LM0CP@ S <$?`#?`#?`#?`#?`#? $?#?#?h#?h#?41? ?30 000 >0  0   00#2+! Rt$?|$?$?H$?  K000"000A10 00  Kr0 0A100 0L0 DUU33 4-SLM`p3P:W) @P0@0PU (P z(KQ @ < @ x, K00K P , P UJ U @"0C@$;0 3$ 466cR 80 2 8"<08\!0l\<0  0 R00L @U^ U> d" 8T2< R42@:0#::cQ80 0@0 2 @0 !0S 1p!0P1\ 1R 04 K04 1hx!p,0d1 R P!pD1,P01P\ 01R' ,4 K,4 h00@  0 R p00P0P\ 0R 04 Kx04 hpl p`0,PL0\ P0R ,4 K(_,4 0h00IEDL$D D|_? p-Lp P 0 R XL x4tP h@0`00lil00C0L 4褨HD fC 0-PSL@02~s 0H00H00 R-L@. R-L@. R-L@. -L M@4  ,  R uRu B,  tR RQT10PV 400Cs40 @`0 ' U% @ g T:/ g@ :/00 Ep6S :/Q q U6*P400Cs40 (Ku, RPE @`0 4@D 00`:/tU:x:/PP `:/ܧP T1H,P:/8:/0:/ DDpE4D$EiD\DDDDDD Q-LM@|hph`}Px$@sH4,mD hixDD EDDD,DTD/ Q-L AD p-LMPK0@ ` % Pp  09p-? $0-L@P 0hpE-? Q-L AD t0p-LM@ P(`K$0 P0( 0 t 0  P  0Kp8F8DX.? $0-L@P 0hpE.? -L( < <0PP   `0P@ PpAA/ 0a0 +-L208<T d 0-L@!!@ 0`82@\@0  "!  D0 - "L 80!1,<\ D0 - "L 80!1-<\ 0 -LAP (0 -L8@, , 0-L 8@\ l0 -{@P`80L <$U08< 6600s0s0T 0 p-L`4^%@P00 R  0 QPR0S P Q 4@^P40phD2] 4  / -L@0 z `pD -1LPPp`540U208 R  B@P, p P40p!! 00! 0Y000@00 @  gz 0!! e c EDD 000 -L1@ |7h < 0-LPp0P`' 40@0 C@D@2A@ 00PU PP 0@  PUiD0 0@D0H@  0-LA 2-LM@5P 00K,00 P ,0K00*@P,00 D<0@ 4 8P, ,0僒 p4p W?00âZ`BB@,A-0\` -,0\ VWBnK ,0T+@,0TTW00CbV @"B" @!+,0\T1 8W0 0  00\00 @ 0 @E5, 0\0 0\ 0!!(K4U 0S 4DDDl4?3?4? 3?1?5?t4?/?DD -L4P0@ , `, p,V0@@P`0(0 -L04,D 81p-LM` @P{/P**1%! 0c2VU!004 ,`d00  R00C0  R004 ,fU*pd !YUd00  R00C0  R00C0  RDYQ'C0 -L @lp P`"/! ?0d0s2 R0 0c0DfX0 p-L `O00@P @P8<@@PD@HP\pDD0 @0\/00  0,!} DDDMbXD 0-LM@ ` 0000 R .p.0Lp @0`P 0@P8<@@PD@HP\0 08\DFdʚ`ʚDDX=? <2-L M4 p0`S  \0$$ L000# $00DC(D4D D -L,M`$ʟQP 0S @0S @Q%9 (K @2S( %.9!  p@A0Ds0S, +4 3D 4 P0 H9L @)49 < $9$)TH 8 0 @ x #0DWS񟗥J?F?F?F?F?F?F?F?F?F?F?F?F?F?F?dE?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?J?F?J?F? K?F?F?F?F?F?K?F?F?F?J?E?J?pK?F?F?F?pF?\K?|J?F?F?F?F?F?F?F?I?I?I?I?I?H?H?H?F?F?H?G?G?H?G?G?F?F?G?TG?F?E?F?@G?F?F? P0xsA0As0S Q ,Q, 3 <@T J%40S %%vD T  |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%z t%ndi`@pT 04 Z DW p@T w04p@TB >%80!0 H)%t#%\,O8pOS"B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   da]LHXfT\THx<%(`s5e'꬛CCD@D QOo Q#A0L ;5> QOo Q#A0L ;56 QOoOoOo -d Li 0-LT1P@T 4 (8040< 8 H0<0 @ 00S 0 0 t%DDDE Q-LPM@8 P `KP2X00S KTT0 0PL0 0HD00@<008 40$00(,0,0(0$040 80<0D0H0X\08<1 -LMp ! hQ1 T!D1$@L G08 0B`BK 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 0 1"BK P Cp10! 8`HH1<0(K8周PG0! @0T!t1*4 tRt!40L0C0(K (Ț L|>C0^ 00\R 00$0(000/ -LPpᡀX`@  (0@X -LPp!X`@  ,@X -LPpᡀX`@ 0@  XX -LPp!X`@1@  \X -LMp `( (@K0 PP$@ IP4( :8 ^ * 8\030#\03S@ %^ 8 R030#R03S: S@*21C "!B 0:0^ 0 K xEE -LM`@Tp*  R $ PR @0PS L   0 rP  @R(K @ ` M-LpR0`7 0@06:#:S30!Q0 0SK! ^ PU` 0@0 :#:S :#:S0S R^R EEE -LLE -LM@ \ 0P 0 0c80 0圢Xp{ `Z}0 K40K  0 0S 40 Rs @2.! ,  080@ \ @, T>0R:00P^ (K\ 00a, : #::cS1!^, ,8000`\! R P 0pWB21C0,0,0 X 0 `021C@0  R< ^ 8,0 0S< 0 0p  , KV t0,(!(, "*46*80,  ~p Ld H -L$M$( 4 R80 `Y7 080 0 VR"PpPP$8V@1,K040K `V 00pR00SP 00  $00( 0(KtE -LM`p$(!3  0R,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$KE -LM@\P$(`3*KpȌ$  K$K pP$0 0 $P(0`p: #:S-L 0. . hX(=E >0-^0PL@N`P 0Y`p@00T*U 0U  0 J0SjZE Z p (=LE 0-LM(KpR(0 $ '`00^*P0.Ơ\|@ : 0c \A 5110a00:00$00$  $ 0S`V F K -Lʠ,ʠ! Q`PNS$ S S010!p $pU4W@ QH `@H `@P h`bb@ PH `Z( ` Pj 8@L d-0 t%DEE00$0(000 -L@p@  `,PP  `00  000$0(0 0P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0 00 >00 >a 0Q00> 000 -LM< @  @0$ RY 0R:@0@0S 0 Q @ Q\??D?l?@P, 00 p0 X :00j 000 0 X*@TpPd@T0 <0`0V,0  V Q:>0 >0 S00`@ `h V `! 0eV`! Yy P@0,`pPXp e `"*<0@T Tf Q:>0 >0 S00`@@h T @!0T YI @ @,0p80 8 X :8j 8 8 X* Qp@a Q< 8`0VP4  V: U:>0 >0 S00P`@0 `h V `! 0dV`! Y @!0p(K  01, 0 +o4  0$ ,,( EEEE ECDEhE -LM@xPQ $3\ b  S] 2"S0"p1E1@8 1 82XRR0S  Z$ t"10@T \\"$KmP2 RJ D2DD ?8R0 A0B%@ Z$K1    0!h!p?PP{LxZ2 : Z18ln1 0\iT$KmdH1P 1R? 0\1LŠ0aB%@0P @`D1>c;`8]51 $Km+AأCE DdEEEpE CpE>C XCEEEETEEE0E 0EhExEEEEE @00-L8@P 0|1x!0h  -0 .!  !!-0 .!  !!  @@-``6$`t`6 !!@@- - pptp`T! 0 p?`T0 !@Ј!  :P"  Q -<p!W R !P Z4 xW(0  !@Й! p? pG!@- ?r  !iDЍИKReset vector called, LR = 0x%08x-DMO- i@0lP @!1 ! ,OiDЍN  0O   ! -- -i(#80"*^000 -LMP`0 Z*&:0:6h S1SZ F:#U@pT $!000SW-jZ1P@p 0P*0hp0P0@\ R , Kl}, hpH0j8Zx 000bQ00(KLD _? -`LM0:#5 pP6U0000 000 0 0000SY @8@pP\ 0R , KX , hpY <@P*hL`| D _? Q-LM5 1@@h1S 0܁``T* pPV @T 0S 0P` RC WtP, KpP ,*h@pTW!$!$A80!0! 0!000S@8P0 KP(K0*0hp@\pP\ X0R , K$, hp L X|`D_? 0-LM0D @P U`@D i 000 l0SN  1X\ 1h1S 0 XT PUO p@0  000JS$E0`  $1(!X$1$1 00 Y R 0 R @pP\ 0R , K, hp0Sp0X d0h1S 0 XX0(PU(K808@PUL T D _? -~LMpTw: L#eP@X*`1!0S 00000 R8 0S p P\ 0@R , Kx ,+hpp P\ H0R , K , hpL PD_? -LD00 -LD00/00 -Lh!R0 @ 0-L P000/0 0 / 0 0 00<10/p@-PQ@` %ʠ  00S0C 0 ~ ,210P  21C0P: #50 p p !-LMHP Q:0Q*b"!B10b0 @ R  R 0S0U 0`0 0 pK $0K00P`$`  0 R@8Kd@pP\ H0R  $  hpLD _? p-@LP`HTpphT0 R 0S0S R/: #:/ F 0-LM@\* \0 0 >0 0000@S0 lPpP\ P0R  K@[ hp00 D _?L 0p-LM! P @+  0;00 0+ R 00Ppp`pP\ T0R  KD hp 00PptD F _?L0/ X0@-@P R 0S \ R X0@-@P R 0S \ R 1- P1!Q1 0 0+ 0 00 .0U 0 00 0A 0 0 0 0 408 ,0 _? l@`P d T| t?\|?hH  -L0 0s0A P0P 0fA.0 A@ 0! Ⰰ0A` 0 p0@ 0 0@P0?@/0R*@0 0 `@ pd p  |T tP lH 0 R 0a B0/p P-LM@ D 0 S S8 < 4 t3t#0 <0 h34 080 >0>0S00 n  ) ,#0< >0D 00@@02 RxDJD ZQ D @46ZS#PP @): RP 8#8ZS#;)6?>41@D0 pPU@" W,U>000 R bpP\ 1R , K, hPpU@D J(ZD 0(K)6;#;x!1@p1p18  0D00001 RD JD QpP\ 0R , KJ, hpoPpP\ 0R , K3, hpl0l 0 <0 `04 080 1 L D@  P D _?L| l`\E0EE p-LMX`PP @ 0000@PKp -SLP`p@ <yP 0*"5060@0LE !:-LMP@0S PY :h!#Šd1@ R`L 0D!0000S)(q81! 0S7 000 00S ppP\ 0R  K  hppP\ p0R  K`q  hp8 SPD _?LE -L (h -L 0 ,0 R 0 Q 505055/$F(F 0-LM0S | 0@T00 KKhL0.0*@ @@@0@(F(=$F 00-@L  PRt P `00  0@@080) S 0PL  E 3-L☃M`0 0 0, 0` V5 0SpPP F201@T 0 A@ p`P 0 "!B 000 \ P ` VYZ @: JT * P PJwT:@b@rT\$,RB00 "u A0!l 0!d }!0\!0W1@ CD?FD@b0$J|!@$B!PE LP!l0!:41 P0  0 P 0 P 0 P0 PD\(KY 2 1C! c@@? LXEE Xx  E( FEEEE4E -LM@00bs^P `p  0" 0RP &20100CS00|x0 R hpP\ L0R ( K( hpLD _? -LM0 @`VX 1h1Sܑ 0 ZB @>T`< @P:#5p  U6 X1U3 40C4 @!40C4000S ApP\ 1R , K+, hpZ 0(00Z@@ 0(K 00S Z `@P, KP ,*h0@ LD _?AQ???????j/k -!zL'2M1@T$ P `i0 0S 0i0(K  P,    ,x000"00!B,pH P@0S ,L -LMP/00,KQ00 0 0 0  ,0 ( @z:` #! P:0l PA 5110a0000(0T0(0J(  5,0 )"~$K L(= -L0@0CS0h  -L,M@ D "|A< f@$ PPp 4`K8P \@ @  0 @4 0` `@4P$X4`" 8:# p@0 0 S  0 R8ZX`8<@ D00<00(KpP\T0\, K8 , hp(=EEPL D_? -L$ 00$@z -LM@\pP8 \`0`$: R2P0 $6; #;1@00  000 00S PpP\ p0R  K`z  hp<0`0_(\P| D _?L`E@E p-LM`P@0J$E00 P   000 00S@8pl@pP\ P0R  K$* hp LT| D _? !-LM‡們Q80@0h008p0 RL1L!Da04A4Q88$ `pP\0 S , K, hp @00 000 R pP\0\ S , KL, hp `D| _?L 0-LM@0 8 0 0 000SP@8 0hPpP\ P0R  K@z hp|`D _?L -@ 0TaL0h!R?= ?0R Pp 00#! \@R00 0  "!0S f 0-LM@P:\ #!Q090Q0)n"!B10b0  00 -@!LPMpW$.  240 0i0 R% :#5^ \  \su0 Pz 3 0 Q |3 Q (Kf T3D#0U0S00 83<3`  00RW ! Q:0Q*b"!B10b @QQ 0U0T 0 D00D000 St2 |2d2h2000000P2 RR04  `i02 0 SP "0SX!(1'! Q:0Q*b"!B10b  @Q{Qx 0U0TD00D0 0 , 0\su0 P-] p0P0\ 0R , K, 0h p0p Pp0`\ h0R , K8, hpXCtEET L|Dt _? Q-LM@< v*$:< :6S 1 4 qP8 4@e 40S80 0 L:#5`000  RJ? 4<Ÿ0C4p"pQP:0QM*`"!B10bPE   hP 0 0Rp~!000S2XI !ZX 1h1S 0 ZP 0 J 0 40`S05PQ pP\h5\, KH@e e, hp@T0D6Q0D\4@$؄@:#:S14$$`Q,KL-P p 0},P 80,0 Ld4 \4 ,Š,0  P 0S8* `*:"*#:S+*3#$PQ  0I,P 8000 |3 3 ,Š00  P L#0S8*}#P0`@>$<  PI2#$ Q4 \  0,P 80,0 ",@<@R"<00 4,Š000@0X2 R]<8*<@,"B0S p<P\ 2R <, K<,*hp00"080!Bh0<  !001 0+; !0,K{,Pp0Ku,PippP\ 1`R 0 KP0 hp0pP\ 0R 0 K:0 |0hpppP\ X0R , K4", 0hp4f L tD_? Xe`| P0 )Р)0 ) )0 0-Lp0 40"!B P0P0بP0 R00 0l1R0C00p1@C\PU0T 6 @^@D H0L@0䞖G4F~p@g00^0PP U@`L@ $@K0 0z@$ 00ZUj K#ELE -`1LM0800 0(0K TpP (KKCpP@0(4 P 4 Kp0p , 0 epP0@ @_0  Kp0 epP0 00GHf 0-LM  h Q $ (0 T +  T.@ 0T!.@ T1:40Z 0 T4PL L@E@T1)$ R(0800` E`0$0004 K0t5 l?0 / 0-Lp / -LE -L|E Q0-L@P0`0 0hL(= Q-LM`R>00~D1N@pdSPP B  0d0T09*JWZ3 Z,K00K 00P`0`  0 R pP\x0 \X #, hJpWZ (K (=LD _?!1!01!!!!00 / -@LP 0SL 101000S 0 f -L0S @ 10C1 R0  ftCE -@LP 0S 8 101 0  f0ECOOO0O0O0O 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 R 200 RO 200 RO 200 RO 2 RO 2 RO 2 RO  2P00 RO@A0P0A ROA- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0/R0-@P \< 0L l4 @P0/R0-@P \ 4< 0L lRQ@P0/QP:/// Qp-LM@P` S 0Vp pppS`@rP`&0-@P0/R0-@P \< 0L l4 @P0/R0-@P \4< 0L l51@P0/ Qp-L M@P`S K 0V Kp  Kp K@rPp`(Ƞ"(,Ƞ 8! p@-@PpS`b `c0#3 Q a l.^#(8.(030# 80 (3#0"P@p.8BA Q ! C2 Q-L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP` a@-@ \B/@-@/0@-@QP a0 ^1200 0100 -L\M@P`p H5x^`0p(KSP 0R p#83Kst00 X$rP 8"(KK<K3KsK#KKKSKx p :@K>[X: K0x p0 8@K6[X.[ *2[H%2[ \   p@ xp@ hR6@K80Kx0 p 3[pS20K0KnL0 |  0KL L LJ 0| S  j0R A EJ FK  0SbZ X#P l %*P0 l l0 Sl :\ p L4p Bl /@P@ x0pL0t0 \ ` T h ` h0|P0X0 Ud , HPPt d8RIPP:p^x\p@T0T \  a n @"((b.` P0n`s #Ȱ  pP0x\ pT0^ P000A#Ƞ`0 |0`I00XhFK 0h 峐`0T0Z`0 T ^" lP p ZL0l C0n0l A3><Z0@L0["[[2[x h[[$[3[xhGp@-c@bP`T !L2pQ:P:/// -LM -L MKyK K0-@"P#0/40 $ R/ 8 8#$R/e40 $ R/ 8 8#$R/e 0/e 0-Lg -LM @f 0-Lf 0-Lf0!P!/ 0-L A f0/ @-0@ 0 0@0 fgx0S/l 00X0R 000R000R000R 000 R/$g< 0-Lf 0-Lf 0-Lf 0-Lf 0 /g 0-Lg/$0 -L0S 3/gDE$0 -L0S 3/gtE -LE -LE -LE -LE -L M 0 K@K,00S  P 8E Q-LMP`Oڴq0ST 4KP 0 (S  R04P 0` ,0 G,04@K0@K#@@ `E>E p-PX`L@QTpQp ph 0 T p f 0-Lp@  "!0Sx b1!P@3HT]  01 0!!%0P  "!1!@ 01 0!!0P  "!1!@ 01 0!!0P  "!1!@ 01 0!!0P  "!1!@T @ 0!!,0 0!!(g <f (00-L P@! `A0< -0  "!@ @0  "!0!D < 0-PPL  R*Q U3AA8CS@T@@@@@@0@@ @01P0@ 3   P   @ 1@ 60\0#60 0! #60 lE(EXE<EEE ИN  0O   ! -- -i0 0C*0B(H 0Q,%10`0 5'0 0C*0+ 0܄Q$10`00 0C*00ğ 10b0hpxdd$p`d] 4 T4Q00C0* $Kß #TA! E 2T PS?C E T P3S@+DP^Pp@ 0 p3N=A N@`0e S  D ß:  : ":   :  4 9@{o  P :@@U828Ÿ  0!?? 0S  p   : 0S B   $ 1!TWl!\1L1! |1|!|x1 3l/   !0<~15#4d0\8M)`0@ {0 (K\ZV8FFh)@}XElEĚFph0P l00 S LH?,@,צ0 EEf$lE ,EPEtEE@/ 0-LM@P |)s0`P:叺P0c 0KP$0$r卻XlE4lE -L] 姫 00`DEf 0-LM$PK@`(%o0  H`p咵PP W 40;40 1  $K(P,0KT` 04 ,5A$|0@,0K40 0@ (`4 40@`9040:/1PP4K0$@0+L0e/s4 ,4 409040:/P -LM@pR`P d0  (0 HP(U` 40;40} 0   p-L P@UpP`0Q0 0000`0 000pf p-L`@Pd  R 02 0Qp400Pp 0-@PLd004@@B0 p-LLM`PdD0S U S 0R d@KLӹ0+8H0 0( 4KPDPKpDPd@KL㾹04KHP (P DP -@Ld004400 p-LLM@dPK`|dL㕹8004KX0(0  04K;((0 H  P80D0#80Kp0 p-LLM`dPK@SdLlL0L 0SD0# (0 0H 4KcPD0[#SKp#0 0-LLMP`@K0dLI 0$0 04KFK0 p-LLM@dPK`dL4D 0RH0 704K08H0 ;(0 *PD0  !Kp p-LLM@P`e80d-@Kp@P d@KL0H0 +0( 4K@c -PLT`@00`  `0@0`0 Pp\2fl0S/d 00-LX @RT0 \P0  X0S0 Ep0 -L@\L0 P00R00S 0  hhZF@BE4@E 0-PLvcL@T+  @T 80 [P80 > P \ @TLP P 008004EE -@L@0@S V0`S@!1|t  Q \HphL10`  V$,EDEDpETEEE8 EE p-`L&a0S p C P? @;p -L M` a F#0S (K02*@Rp  Ys p @PP00U0SS U0 !U U pY[P, 0P @X@  0g0!0 0P PP10 U, 0IpYS pPP@PpD@@D@U  0H/y4) p # poE0EEEPE/ -pLl` @TP   @TP400 f00 R/0S/|g -LLM┠` @pP3`T+0+ppK0Π004L @>;40 50@ 5KT@ P@800800 400 0 4 PwP 40  P0  0H Et E/ -LLM@`pPP $KpKLf<180 @p $ 0R" K0p^@K:} 0d VK[K\KZ0K^pK 0@ NKý8 >K :R: #go–!E!EHsDC -`Lp᐀0S | Q00000|| @P@@@|@0|0 `if p-P`L @T | Q00000|0| 0 p -@LPS00 p-P3!@L 4QPp`0 0 ``d d0 U 0@|     |\0ps@Tr@ -PLS@T|p`P PP 4P RR00f -LM`S P P@P LQ Rʨ0  QxpP R~RK0P0: $@K 3sH`DPa0< $ P@ @;!Ev@o@P@!E p-LMP4@0 0P!`0S 0S 0(0Kp (005Sv@v@v@v@v@v@v@v@x@v@x@v@v@v@v@v@v@v@xx@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@w@v@v@x@v@x@v@v@v@v@v@v@v@v@v@v@v@ @K 81R #0C0K##Ƞ#4 KK0K<10K#̠##4KK0K٧50S 08 <0 ă$08 Q 0Q:t0P 0 480R, - 0 L0R s  0 00- $@PT,00 L0P0 P00@T0 0-L$@PT0P0 0@T0 00- $@LTP,00 0P0 0@T0 0-L$@PT0P0 0@T0 -LMQ@ ?.0A""Ȼ Ż "E4"E -PP``L' 0$QpU 80S T W0@T40404 0@0040ㅔTV H0 S偼<"E -LM00`@X 0| pp  0$  0Q"P< $ R 800 QPR 4 P00P0S  Y00S P<0W(K< 4< 8 4 0 @Kd d0, @@ 0 4 *P $0S00$ 0040$0$40HP(00(0 z@(y@d"E p-L(0`pX@X080X0 T0P$4P0T pf -LP00S 0 3@Ń 0S 0 S ?>#R// 0-LX0@  8T0 $4T0 8P$4X0Q;+S  ; S800  ;  S00R@@@X  (RP/H0RA/0R /#R!/&R/ /#X0/0X0l+LT幏 -LX0@ l 0-LX0@ TPN \0 B 6 +  `0   Y f t ?\00L  00hOL (0HL0 &?\0L0 &6\0L0 #,\0L0 ##\0L0"X 0@ X h00<0L0 0 \00LX 0 h0X 0C+ `0  LX 0 h0X 0C+ `0  X 0@ X h00<0L0 0؏`0 z 0-LT,0@ P0 P0 ގo0S|0  oPS  |00PP0S -LTP `00Rp @$<0 T ,00LP@$, \00Q0Sf p-@X0L$!;98T8}PdU 8 T0$4P` L0SpX0 p8;T$8p 0-LX P@+ `0   @  P0T$8 8T$8 <8TGX0700l@X0 8幈}E0\ <C3  `0 + +0T$8 8X0@ `0T*, ,0$8 8T$8 <8| 0X00l 0X}0@}T 8 T0$4@  @00}@F"E 0-LTP 6& 0 08 $4T08 @$4@h d0R 0h Sd0 P0d@Np0 -LT`@0) R421C  P ^{ zY$8 80T$8 8X0@80T$ 8 $84  X0 h QЫC"E"E -@Tp P`0P,@L 8T0$4T0 8P$4 @,00,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T08 P$4X0@@ & 0PVP0P'0S \0P`0  8 T0$4T08 $4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P/ 0-@(0PL 00ES @؋@$@@0& 0 0 L0"S 0 L0"S 8 T0$48T ;$80 L0"Sp p-` @LPh 0?.C""`(0L0 P8 TP00X0T$8 40 \ \0 `0  ph0ph;T0$8 4`"E#EHC#E/000  / 0p-@`L P`@pl@0@- @$T P@  @ 00 0 00bS/- 0$ 400`S -L  $B (0  -L000p0 Q-L÷<#E p-@LMP/0U` U U p1  絢p0 s03R0S0LāS@̐@@@x@ MP pP) @P <1Q Q 0RS 0R S 凢 0 >0 7 0 / 0 ) x@0@0 P0 c0\  0L  08 ԘTCC#E#EX#E#E$E$E$E($EL$E4$E -LM80,Q$ 0 )d$El$E p-L00P0`@qT  0 p0Ds0S3Sp0 ph 0|/t20040365 8<0 <1Q@Ppphŵõ20 @ 幵嶵x岵p寵h嬵20,X姵 L壵20,|$EE$E%E$E8%EhD<%E%E$EpE%E|%Ed%E%E%E$E -L00S S S@ 0T<8 8z@DP 0\%E@B 0-L00P0p0Cs0Sࠃ @^   02020 ^@@@@@ԕ@@(@p@ @@@(@ @4@ 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0!0Q\ 0PP6 04SP0Z00 0>S< P:<00S8  R00 0S 0 48 000S# 0 8<04@(K  0PPP"P0 SP R00 0S 0  4800 R 0 480@C N -LM*Q# QC @Q Q0 8<04@  0(, $  Q (Q Q |F0 8<04@ 040$K0 480 @ P``0S<0Q 0@,0 (@  0@,H`,0KPp0@PD0`p0@ L #D <P`0@(!(D#Lp4  0  8<040'E -LPp`@P P 00$0 0"U0P  0FP@ -L0@S`McPP `H ^00 R00 A ` 00  0#40   0 0`P>00;00`0 P`80:0 0p0 p00( R00 R 0)P :0 0 00 000000C2Cp ]P 0 0  ҧ`P J` -L0PSpG 0SpC`P p>  00 P700;00p0 PpQ0:0 00 @ @[@B Z (0ST@@@@H@@p@0[0 R 07P §p P p 0 00[0$ 00b $0[ | Y 0(Q0[0 Y 0(I0[00[0 LpPħp0E 0-Lh\P T1\ L1\0@!Q*. 1\( 1\" 1\( 噭1\ 00@T  04/02 <008 00  0 000h50h02d 022 022@020202QQQ`C@E Q@/ 0-L P@| 0\ 0| 0\004P/P 0S0S/P/4004/4 R040/ 0S00 /R@-@ R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0Bs0_S Ĕ\00 "#0  0@801000  0  0  @000/00Cs0S0/-A -rPLppq `Q?P@ 0@p0P  -LM< \ 8 40  -(K8K8[\0@$L80K`X@0L p#D<P`80K @0D#L4p80K 0@#4<$D80K,0@#<4$LP`80K( @$$4p80K@ $<(0K @#  @ @<  xB -LM/ A 0` pP 0p(K   0P pP  ͥ0 ,0 >D @sL o k,0s 08xb@m -LMA 0` pP V 㖥(K0 $Pǥ 0 spP8@0dS,K 6*)[ 0b S @/+0[0@ QY,[ 4 00 < 8 YUYp00P P Py408 AQ<0xX Dpm p-LMPx@Tp $p>0 0Q`! 0$ P 0ă \ #\ @ 0S@ S Q PT $phUP P Cm -LMR pO , 4 P`,  VP- 0`S0S78 rP .4 iP%0 0  `84 000 P0R ,P ,(K Q-L hE -LMp< =0@P,0  9`P ppß ^PKD `K=@KL \  0$`@彩2 u 帩#30 宩x@T ^ 0S[ 0CS2@@x@h@H@P20  P X{@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @qx 03 0SP U0S ax 0P@S QQ 0As0_S7Qx P@0S@, 0RJ(K>0P!P0>@0<.0SP$2x P@0S)x %x !x x x ȠAĠ?=꼠;긠9괠7갠5ꬠ3ꨠ1ꤠ/ꠠ-꜠+꘠)s~–EEEÊEEԂEEED ECExEE#EEEEECDtEEEEEEE E0EЁE؁EEDEXEC Q-L@ ̨D -LMp`xPP% [<@P 0 % P4|  (0|P庀`000 0S 3/P V > (K0S 2V02 : ㅣPP 3 < R : :9Z V2 z000 Q 1/<0 @R xRy R  `v`308` PP0S2  xQ xP Q R 0S ! 0,K >0|"0Q^C 202202 202,04PKS!2 022 003S2Ա02ı0 4@ `PX 80S 2 71 - 13b2   f=X1 -^`Rs0So$ ;P 1!2:2C2<2 P 0S:P 000  뼀 :xx尧xP9 70 RfPa< : P Y`@mCC@@@X@BD0@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$@P! 2` ,F`P2 00 0S 3/xP <`l< -PQL`0p$2U!2S 0S @  0@P P00P00S 0S  -L0Pp2S``@ "@P00P00S`R -L MP`0pPP  P 2 L 0S@ 0S 8@P(K>0 !0Q㸡P 0 0P)0 8<041S,0  p @,0@S 0pS Z ] R F ACm' p-L0P`2S@2@Sp -L@YP40S  0嚧t%DE8E 0-L@ P T,P 0h~Q,~0 -0LP 0pS` `@ 000@ P`R -L3PpS` `@ 3@P`S0@-qr@P\^  0@00@0@0 0p-LM` Q08`000 2S020 23 0S0 0ե03S0 @00Hƥw040phE0(P弥幥0ETEmpEtEdE// -RL(M000 `  L0 \㙠pP  7PP L# 000 p 0@T0 8<0 0Y@ H D0  0 8<040+>00H@ R  t0sPUuL  R  QpPm  `Pe  020 a0p 0 P P PP P\s0@,0  Y0 040  8 0<0 P 0  8<040P ܟ 0@,H, P`0@D00P ` 4  p0@ P#D p<P80` !(< 0@p#L4P` P`  㦟@0s H K P`P`(KY0P`0P`፟P`㇟P`ၟ NC 0p-P@k0@`2L  p 0 S :;;S 0S (0@0@p`0cS -L@` ㅟPP p# #@P p 0 0l0 0R0 P0  0 0#40  pW00  #0u -L`Pp@P P 0000P0V0B0 P00%$P00@00p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0P0 -LpP`@P P P 00  00G0P0p`0000dP^ N -Lp`P @  0L 0'̠''D;0(T @0pPA@;@  p-L`P_@P P  0, 0f0C P0`&P p@ - 202 0p0Cs0S.0S 0@ <0= ($R 0A0 0 -Lp@` yPP p @P p  0 0_0C p P0  0 0#40pW 4 0$ R p⾎0u -L@` APP p# @P p" 0 00 0R0 P0  0 0#40pW 0 $ BQ p⇎ם0u -Lp@` PP p @P p  0| 0_0C p P0  03 0 "$ bp\W 姝+N0u -@Lp ѝP @1 oPP @( h$00 0` S#@@@@|@@@@P@@X@@ @[ 0  00 ;0@T0#30a @@\0 @00 30 00 @:0@T00 [0 0030 0 + @T ֍[0 0030 0 + @T 㾍 @\0 @00  30 0⯍0 @:0@T0000[00 0 ""Ġ" 030 0 + @Tr0 3 0,à 0#200ub[0 0030 0 + l@fT000L[00 \0#? 0Z@T> [0 00 ;0K@ET.0#30 !  000  00\00    0 :0(@" 0u -L@PT 㣜`P e A@P \ T0 0t1 0R0 `0  0 0#40  XDP@hp0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 T0T TT(, $ 0T T T T8<040 T0TTT(, $ 0T@T3 0PT0u0SX@\@`@d@h@/ -Lp P`@P P l 00 P `倌 WC00000&4 0`zPt p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K Ǜ pPP% T%J 0S0a0a010 P0 Br R@0Cs R@J 0 P@P\P0EsPU ;@J -LMPp@`$@ 偛P   $0K `@@@@PP $Q 00  00  ' K -L MP $ p2L@1O`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 6@ K0 @ N -L,M@`,@ pPP @I ,KN 0@@@@ p@P7,\:  04 <  @8 0K@@ p@P, R" 00 0 <0,  08,0 0 40 ,0 0Q t 0 @(K@x(0 @l N -L M@`,@ p嗚PP @( 0K ,0K@@@ pe@P,0S@ ,0 ,  ,0  0 R T0 @0(K0 k@ N -`LepPÊ d0( 008,d 040" P T z 00 @t00 '7<{ & @$P0 0bQ 00  0  R10Ιə'88'#  4000i  )00`EDWEV@pE 0-PLH0h#88#! |@P00 @( 40bS@0 000hv m -ML0?6t@@ )-ML026t@@ -L (0`lp,@ S@@@@L@@@@@l@ 0S0C 04 @+0804 D4 $)a0P@hp0 0 00Cs 0 h{@04 $)a0-0K<0ho080@$0D0P8@$0D0f -L(M 4 ,000 0@Pb4@2a 000,0 PV 0@|( D @ $0D@ H0 B@0P "L0 0i@P0Pp@t4@D24  yP6 0W*(( (h(%D P`@ W :;0@!0 L0001@ p0,l 0 0= 0@0 <02 (K (KoH0 } 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T <@[W 000!!0@0,dP 0 C(Ko0ud@ -`LH0#88#!zpP 0@ 08040@ ;40D P@Whu0"080 &zp Chu(P@ mf 8 8-#DL$`zzPP0@ cu0p~ T@T ~Su.0" "2 KmC  2<2 m Q- L Q 0C@000S A  8 8-#DLMP$z`P 0@ up0 ̠9~pP@0T X,@ @@S 2Tp 0, pP202Q ~t2T-0. 2Pp W T .@2 02 .8pP2T02P 2p02 .p0 ' m 0-@PL*b~?0~0 @ 0p-@`` (0,R00Ɓ0L0LPY2  0\ 0Q000CO@T4 )K (k0X00ph4h@CpE@@ ,-LMK0  KC -L Ƞ Ƞ M,dP@, &RypP 0@  Q@72T 0T-  0@' 0 u@p20S @ 0Ph{@P }@[{ $2T 1T 7@ 0@1T 1T@ @ 0@P/0S 0"  04"40  BR !”@ᅔ 0@00 0SJ!0  00002  <4!4"<0^!LZ mc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA (,0(-"!0202Hm 0 R 0S S00" #042/- 022 0p0Cs0S0S0@ <0= ($R 0A0 0 0-LM@d0K0  0S0d0K\m ,-LMK0  K C -L M` P pF 0 (0K pP4(PU7  00480 04H0,0K Č< ČL Č@ ČPČD@ Tpppp,0Sp W ㄓ$Kp}X#\ ,0  0X0 P\ 0 202b -L0p6`P @ 0PS 00h 0C 0J0C p00)*Ġ''D0@ p0@蠆 -P0LSpP)1 H00CXP!08`@P P  00 \0 ) 0 40q0!$#40 0000P蠆 -L M @RbQ_P\1P040 H04`0CVU1 0 H00C^M10,0 H0,`0CVD \0S1=  \0S08 088`8PP @, 40,0p  00 0 \ B0 4@q|~$4!$,T.d@0 P` 0 00 00 00 0I@ C(K@@꠆ -LMp @RAQ>1, H00CP91 H00CY2 X0S1* 088E`P @ ,0P 00 0 ] B0 4q|.4,D!$@0 0 00 0@@@꠆ -LM0@1PH R (K  `{8 `0P08p <0  V 8<0S ,0  Ă0 H 00080 788H `0P0<0 0 HY<  3 " 4  *Y< P@, @0 Z PP@ ,0p00  *04 <@- h@X.\@ @1\ 81\   $1\& 1\% 1\ 1C\3 0  0@H00CQ80040 0\ 0\ 0\@?@D8 400b0H  L00P T00@@f8 400b0HmFc@Hc Dc@Cc EcAcBc 8-LM8 #P30AT/ 0 2 K020-sPH0 0 L|0 P  T00 RP  K H0R\80400 202Hmm <0-P00 00(  ,L @A0hpEA@-Q0 0""D0@ 0p@-Q0""H"T *(,d @P` pA-Q0#l#x# 0""H"T 0@P `p0G-,MQL.#L$@( #H#@@. 0@@ "$"h"DLh# `@ #x#T0. 0 @0 @0,ЍR\ \ 0Ls0_S BR00/ 0-PL2 0H@P0 5000 +0C0 P0 000h꠆0 / -LM@TP <0 RU 80Ÿ8 #t'"R00x0!R8 s ` ( , 徸Pr,4 0Ⴛ@ f ,廸 0prp(@@0 4 0 P` 0@4K R<9 Z> 0@@ 0@`p4K`pʌ< @< @T 0X  `p8 Y1#,@ 0PP Q(K 00\m' p-LM@`  PP @  0`@ᘏp p-LMP  `@Ə@P P @ 0PqPP @}p 04<S-P0 8<041 0(, $! -LMP  㒏P=  0@P>`P 0tEZ   {P& 0 @P'`P  30S`W S Q 0 SQP-` ` 0-L@PP0rP00hR -L M0  pL2`P  PP  *@K %0*0K 啸 000 0`X ӎ K0 8<04@0 @1A 0(, $ ! N 0-PLH0h#88#!q@P00 @( 40bS@0 000hkm -L0@0", 0p0Cs0ShO200S70S<0= P$R D0R h=, P Ph -`L4MP e, ~ 1(001,0!Pd088004 0 <00SL H 5@KD WpKL FK0!p#P `x ~ @<'X@o*8 8*#Č,   D@ Č 0P@0, 0R(K$ ah–̆E؆EWEV(AE4C 0-L M`,0 2p[-@ (K0CP@P @D D@ 0K ,0K @PPP@P,P@ 0X!!0 # 0X  㟍\% \00000S, , 00000000S 0` 0 @08 0 @0^mvdud@ N p-LM@P $㟍` ~D v@L q\ l$ 09P  _$Ap  }~$8pE -L Ƞ ȠP,D`$,opP 0@ }j@  2V -2Vh <2Vm 0Vp R @bj2V 2V 2V @ @ 0g@T2V L2VR82V8  2V_ 2V0"0 @1VW 1V e/z@1V! :10S @0 Ls@P  u@Px1V@ ;s  @0S<@2 ev%0@ 1e/8}:'@~ 0#@w QK@p 0 P@i @d%$ 40H F@mrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd(A -ML0)PA(A )-ML0(PA(A -L (0`lp,@ S%A%A$A$A8%A$A%A$A$AX%A 0SK0C 080@S08040D;404 $)a0rQ@hp08 0 00Cs 0 h@@04 $)a0r0I00ha080@$0D0EP8@$0D0|p0 0f -LM8 , 4 0@Pa82` 4  , P0 T 400@|( < $0㽶0H0@<0 N20i@Pp 48024  YH 0@Q `  0 U0(!:0 0 L0000@ 1 p00,l40r4 0 00 40000 (K (Ko4< !;0 0L000@ p0 ,l4 0q2 0@Q  R0S0  /,%P 4O(Ko R 8#8 S  0 =0  "`L$A -`LH0#88#!mmpP 0@ 08040@ ;40D P@WhBh02008080lp qO3h+h(P@mf 8 8-#DL$`#mPP0@ h0p0\ 0\eP00h|{P01S01S00hRC 0-L0MP<0 ,0 00 40 80 pPF0F㖉P Pp`( @@K P 80K @@@P`P @0S 0S 202 /  0 + Pp` -@ 0 0S<0S< 0 Sj c Sg  Sd (KP000HP Pp`<00S S{ <38#0S 00 R-Lp`P@9 %:RJ V D@P   &&Ġ00`p! 0C 000000X: 0h0d00 ' Q'>00J <`000000  Q 000 ³0 `F ?0 4<`0000@@000  000000W *hq 0Sh00h0Wl0s d0hd r 00hl0 d Sl  vP0 -@0L ^`Pp |0^ ^0000 P00V00Sa0 hG00 -LMPp K0`@P00'>00D PP @ D0DW 0 p0@Th@d@0u 0-QLMp@l0`d0h0  K0PP40D@P P 0L 00 p0PWP P 0-PLD@P P U0 0 4 4 0C000  vPp0  -`D@Lp2`(PP `" @P ` p0 00  P0O`IV  04H0 0$( L ㉃0u -`RLpP DZ@P P P00 0C 00 `00 &8&$`0 P0008Q 8 0  0-@LtPPs0p00 s0 00x  R| 0000 -L0M`@,` DPcpP ` $K8K(K0K @ ,0K @-`P  K00S0022002280K($ T0X@` \202 0-L(MP,0 D@$pPY PQ 40 @ۂ؂J2l8K zs00< 8 K 8010K#(#43 K20K 0K ,0K```@P,Q 00S> 0 0b@C Y0`V 000  000 0JD 0 @㍂ @(K00#400 @ 000 @0*LD 0 @0 4 $0b@C 0u -L@(PPp+ 㒂pP P% ; 80 R 00`000Q 0 PP PP V 8 V R`00000+ 0-PLH0@#88#!e_@P0D 000ho_m -ML0xLANA )-ML0xLANA -L (0`lp,@ S`NAtNAMAMANAMAtNAMAMA0NA 0S0C 040@; 8 40DP@hyup0 0 00Cs 0 h f00:00hW080$ D rP8$0D0f -`LH0T#88#!^pP 00  08040@ ;40D Q@BWh^@P  8@ P# h^H PL0S Pl✆080DLP@L0 ⇆080mfE؇E -LM00@ hp`dDP  K@0V -W00;00" "@ -W @  -L Ƞ ȠM,@.`pL^PP@ 0  @38T<( m; S Q Q Q K0<00 PUO W \P\ 0l@L00Tq @ ;P ; S  0 @0Es0 U:S00P 2UP 30Es0S0EsP8UP 00Q10sPQ0 *@K  mQ ;q 0 9c0 0]0 0W0 0Q0 0K0 0E0 0?0 @090 030 <-  0pE p@0Sc00 RLP jYD0WB ;l :0Q? 0Q3>  0p-LM R3 00S 0S, @P`0S0C00 00 ,Ar oR: S>+  R0S0C00K K 4 0 Kpdh0n`l Ƞ00 Ƞ-,1XP m -L0M\@`  #4\ :40S P 3\! 13\f ?3\ 3\ d  0 `P3\ 3\ x3\ d3\@< S\$0< S<1SSP(3\= 2\ 0\s 2\0SIP2\ 0\x 2\2\ 2\N 2\p0P       00  0P0 0tx |0 0d  0`P!0p l @yPPB 3t\ P$010n 0R 1  iyPP,\0P     00 O  0P0  Dd p pPP| 5  \0$\ 0>PP\7W W WW @W W@WWW@ W @$nW WWn -LM\ 0\ 0\ XP*  1 P0\ 0pXQ 00S00XP  1 r 00 Q}f~fvt|f 0-LM@00CS0P0A0@- @.@m Q-L }E 0-L Ƞ Ƞ,A0SX0SD}0400k00CS0Am(E (L0 (-"LX@T 00Xm (-(L" PP0AT PP0SP X`VP 4p0H0PP X`Pm -LX@pT` ^- 0 ! PaU " 10p`EP(0S 0S0 h, 4h~00A0Sh?}\E@EH -L0S 0 000 0$00/0i~dlt%DxEE -Ll0PS t!0S00SX@T( 0S% Hq00CS0`000 R00ʁ0S00S'0 3 1CAP0Q!ڰ 0 S00 S P0 h|0 s,00@,,, ,0}hfF̊Ee@RlsAԊEt%DxE_E -L`p0`S H@ PDh0 p0 0}dt%DxEE -p0Ll0 `R 1\00 \0` \` 0 d0 0 B0h $@ 0CP%\Pp@0S 0 R 0S|`T|thQ| ( \ gD:}@@@ @0},,4 40|}ln$ndh@EpE Et%DxEE E0Q` 0c/p ; S/P/ 00S/8C -L@Q @zAXzAzAzAzA000000<00000000p00s00p000000 <-@00000 L!pW`V0S \ P0 UD*\? VPP/ <@@ ",00 b0t0_ EQ 00h0 }0S"0S(K|0SP @/",000b, S 00`>TP /|`P4@ 0 ",00 b@0Sp0S`/",00 b<0S 0HS ,0S 00H>VPP/@@  ",00 bH0080S 0LS ,0S 00Lq>UPP/  ",00 bL00d@404$ ,0Sz,0Sv @c0@S0pc000K>UP0/P  0 ",00 b0,0SV @02>UP  P @/",000b, S 0 0>T :@/",000b, S< 00l  >TPP/ D@ ",00 b0l00 (Ko',P 00p  =U``/ @@@ ",00 b0p06P/",00 b80SPx0S ,P 00x  =UPP/  ",00 b0x0P F00 :P/",00 bB$(Kow  0RxEt%D$EHE -LX@PT( 0S% 0q00CS0`000 R00{0S00S'0 3 1C;P0Q!ژ 0 S00 S P0 Pv0 e&00y:fFXEe@RЅA`E/ 8D8 #Q 01S 00="R//q/ p-L0@p`0SP *Q, 000 0 0S 0 5:pS 00S0 pQD0  Q(0  0  f p-L<2S 00pdBP `ዘ0S phi000 0@@0 X-@ 0LR01S0 10<P V q x0-@ 0LR001S00 10<P0 <PP0 g0hd q@ 0R/0!R/00 10<P/ q Q-L u茌E -L@PPp0 `  R |05:Rt0 0P0R \s9H0  @@ 0$c9f0QD@2/L Qp-L@P Q phM00U= L0S XP 0S `@]MX00@P`Sp00`8p`p 00 -L M0P=2S @2* `2S1 R8Ls$K0K=0`Kh0(p `VpQ*J0P0O8T ?N3cQa 0P80T 0 @2 `2S M0 @20@2, 0S0C00=@`p Mb p-L0@SpH`0SP 0  90SpfE -L ğlM@.` 0=rW@ 3Q 3Qy 3QG 3Qb @(K3Q 1Q 0B~S1 0< RM L@K\` XpKlPKX3Tp `0 008008 PU 00 00K0 @0^!0 @ 0 K tp p0 , | xp &@  0B~S1 0< R 2@0 4p q<` 8pK00L@K8008e1S@ 0B~S1 0<P  @ǘ  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp T0S@0P? 0<1 P@ 0Z Q T0Sl K&@U>ό@9 0B~S41 0< R 0@0 4p p<` 8pK00L@K80080S @ l K%@P0qUUUUU@hAXAБA 0-L@P60h  0-P00L="0 80S @0S 4 0 8L\ 0CQ 0dP A0 0d20 0 @]7[7q -L`pP@T! @T- R00000      GP 00S0,7@T P0  8fE -LaqP@T! @T- Q00000 0 00 0P 00S06@T P, @T0  7fE H-L< <0P, ,,0P ssAqE|qA،EEE -LM|rP`Vh 0d000DR0 }?3H2`BrT4r0 0=2$KTKr p`0S0 <20<20 @20@20@1\PX0`pd`00 `d0d2SO 4 0@ P=@T0SO 008 R 0 @0 <20C<200="Rh:00`"R!000zJ008$KmT0 @0 @``` Wr00=r0S Nr00=r00T 800T=r$Km>rqEhq$EpEEAEAxE8EXE0S/0="R/00/ 00 0/\/40  /40/@-@00H 0000  8@ 0H@ 0-@L P 000  P , UH08P0H000@-H@Q @  8Q H@40 0Q0-0R00\00^008/0q R2 1C/ -L,0L0S00/L0Sq/0S"4000/- 04 P#*0 \*0S \0S / -L 00Q -L  <2<200C<2<2 <2S00-q0^  0S 0S  ^ 0@-@QPs  ^ 0S0\\0^0 -L0S *@T 0S04qP q qEԍEE -@PL Pp4E -@PL ,0S 0S P 3/P(p0 0hp hpꠎEtETE 0p-L( @RP lp@p\0\`(00L0 L0@0 P0@ 0@YSUBEUQNOf P-L P 00pE p-@PL d`0 $0 PP ,0P0 0pphypfE -@PL np0E -@PL Lbp\E -L@ 04\;qH00Kp< 00H0@ꈏE -LH0@0 <0 00 2p-L( @RP ph&pU 0 0 p-L< H0@0`P@0 ;PH0@ 0H0D 0poꄐE -L`@P P8$ pWP3H @2X0#  0P\  0 PPH  H 10#  0,0 000S< ,0PPH01 U 0 H00H01Āp$0S#0 <2S#! s3PP $0SU0000@0D  (nP ofEEԐE -LM@pPAP@ 0`L @0 `^P@@ / KDA p-LM@,0`P0  K 0KPKPK0  KPKKPKPKKp -L M@sp`X2S XDn@(KPP @P@  0Č TP3 0R0P@ p} 02K*K2K1PK0PK/PK.PK-PK,pK+PKp pPP*0[  D01K p2pK0K/K.K-K,K+KE -LM@0K p-LM@0SP Kp `PPV e<PTmP0 0K K0C0KK KPKPKK0KP E p-LM@,0`P0  K 0KPKPK0  KPKKPKPKKp p-L 0@Sp,` P  3 1C<2 0SpFDE qp-LM`0@rP^ 0S 0S 0 S 0S P Kp  0SK0P 0R 0 00  @00 q-LMpr` 0K P@P KPP@   0` @ 0  P 0$ 00P` @ 0$@@  q-LMr ~00/0<0 -L( @ 3 1C1P hlFLETE 0-LM@ 0K0KK0K@K@K@K@K@KK p-L@BdM ~0AT 0KK0 K0KKPK`KK@KKp #0-L@MpBTAd $K$0K#K!PK`K"K pK@K@KK #0-L@MpBTAd $K$0K#K!PK`K"K pK@K@KK 00-L@MAT K0KKPKK@K@K@K@KK0 00-L@MAT K0KKPKK@K@K@K@KkK0 \0-LM@A0KKa0K0KKKKK@KVK 0-LM@A K0KKK@KKKKKAK  -LM@_0K0KK@K@K@K@K@K@K-K  -LM@0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L Mp`@oPP   K !0' K(0K&`K%pK (K$K#K"K!KK -L Mp`@MPP  (K^0 00K/ K.`K-pKJ_0 (0K,K+0K)K*K$K -L Mp`@*PP  (K!0 00K/ K.`K-pKJ!0C (0K,K+0K)K*K$K p-L MP@ `P  KE !0# K!K$0K"PK $K KKKK~Kp p-L M`@PP  Kc@ ^0# K$0K"@K!@K  K$K@KK@K^Kp 0-LM@PP0KC  04R:Q0 Q05:0!S0 S0 -LM@P$K`pP@ P @ 0 P@ 0 $2@Pk00 -L Mp`@qPP  (K!0 00K/ K.`K-pKJ!0C (0K,K+0K)K*K=$K 0-@LHP<0S(0 (0,0$ @,0000fqq  0-L$0S 0h0HP@  ,0S0 0 0@ 0fq 0-LM@P(\0   00Xe?X0I 0X0 R0X0R \0 S08 40 L0   P 0L A@P \\e EPX| \X0 AX\!m\ `0XegUe@Ta r@PeUAA̒E -LMPI0`S@)pK (0[S$0[S I0@S   0pWP K ) #0-LMAD(0K0CP(K #@K'K&0K%K$K"K!K`M@P  K p2 @P0 0pW@W  @ #0-LM`AD$0K0CP$K #K"0K@K!K `KKKpP K @2 P0 0@TT -LM< @P0 `e u`PPv ,0 00-0 3,  0 P0? @./12 00 `Q 0XS b 0S^  R00 08 1 8 04 #PP98pd@ 0pP5 2@RT0 1 00, K+@D 0pqP 2@;TP@D1P0@, K}. 0pXPP  (KX! 90S)  {PT0 ^0 0 S  Q 0 S |3d P?0@S d0+d@0?0Pe80S?000C41048 0PPPP0P  6 P 0  1 0<`48 0PPP0  0`"R 0d 0!< 00PP ,@K  |@CEPE(E B4-LM$ @cpT TD逓E P-L 00 sctC`$E -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KP=P(0S @ 0DĠ)K*@K-P (00$K -LBM`QP@PpP(K!rJKI7 ,K 0P,0`W`?0@CT  R JK 0$   00X00S"4?000T00P0#SV00JKI,K  0tP,0S'![(1[41s Ს -L@PP@@Qp`U V 0S(A @0 4 bXW 0SC B0 4p obF 0i`OG 0bpH oN NX舓EE -LMp0`@D“0  @E0D  !A@0!40CB0 B40ED0 40<=01> ! 01 R011 01XQY QP@S G N0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0 0S  04 \\T 01[OM H0KhP!  -LCMXJOKP@D`K p0,P 0  !@a2NW p@ = p<0d a$N@;0E:PD`d T daN @d"Nx Pea N @dN 0@ `a, 0R(KP7–EEEȓE̓EdC  -LPp i;` W @T, aQq \aq LaW ,aqaADEEؓE|tD0@- @ 0 XPX ăP \0S $0R Q0 0CX@CR R/04 -L00T`V+ 44 pW0P0@0 RP 0W@P f8P f0P ff0 0T0 Q-L00T X Zp`000 PU XP P @8X0@PpZ` -LMpT 4 000 P50 @0S0 0S-,4  0S'`T 00@C P P0 DPZ P T0S 4 ` 0S(K ! 0S 0   M Kv UP> JP 04  0 00 0 `PP6 T0S  !0S00 0  ,  p`0S00, xg`0 l a`00 P[`00 <U`~00 (O` E4EEXEEE -LLMt`0,0 P 0P P< 0S?_0`KTpK`0K_K0 ]0KZKYK^K\K[K2R@[P00T00SdPT00TT `8P fwX 0P fpfm0T0, 0RR(K 8_4f P f@ P0\ 2TH0S 00S 0S_X K!PXpP< 00S X_0B 0Q1 0CĠ YKZ0K_5Bf< :P8 <X 40 `MP _w fy_o@00>0S Sf P_ T?p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P v 0l1_0 R 0@0.T 00–E̕EAEEPEDCdAElEĖE -@LV0S 0 S  P/ p-@@PLL`4 R040 0S00  pf@0 ?S $0/R@-@ H@\  *0lO 0$@/D0< 00b0lO 0$@0  !p- D`$20LQ0Pp020!0D0 1s s p P00S S Sd0<0 00SPD0<0@<@00`p0<0qrrfq0  -`, DL$20Q05pP020!0D0@P 0SP^`0SH^``蔐0  RE` R R ` A` @ H0SbA` 0SqEEf q-LM K0sP -LMp@0%K\PP T%0[T0P P$Kt0, KOPP&K, <PP&0[S @D`,&0& [s@R0 3"10 0 0,P! &0[PS , @D`&[q@^0 3à"10 0 0, p , R-LM4 pE ,0K @0HS=:0  080 0 @T D P `@@`U@1 @0D 0S@0<0Pd@0U`00080X00 0 4t44 00b(K,0QD @T d <0%H@0 H0%0 0 A R-LM@ R R K0K \< 3} 00a0 0 -LpPD`@00@ P jT^ U` 00CS0PND3@1D Th0Q\ \0 S 00 S P0 fDe@RB Q-L0 -AMLM$P00@,0 PvTP 3"  D ` R \P, 0Re(K0Sb 0L 0R  S0$ 1 SP08PL  0DT@!TE B~KpGpG oPPL0 0  PV G@P TP TPK0C0C @K  PP4W&"|0[P#P#PPBTP TP P@ @$K3"  D   0PL0 0 @L00a 0, KPsP @4T. R4T 4T0 @P |@W 3"  D  0S P @ 0 000@ 0 0 0@P 0s p P@0 e@pp @3T1 3T$ 3T0 Z@P 0s p  0P  z|x@app 00K0FP @O0  R Rh 2Re  Zb*Z pP 0@80 0PP0 L@ 0 8K <0 TP X @ 4 H Dp i@0SPq XA10 @fPp0Z Q @0Sb Uy @0%KP%0[@000 KPP 00@^ࠁ80K0 X0 0P0 L@ 08 X KT @p <0 4 H Dp } @0 PP  P@0, KP,P 0@0 @ X KK pPX KE prU~fqUhU pUAdU@iU@fU eUkUmU jUoUnUlU p- LMx @.hPA`   0 0 900CS0`KpqD 0-LP@0PP |0 PP0 LV00h40Q P V00hHEE0D0 0$0(0,0004080<0@0/@-`pPW@U#(\0 0!`! T 0' B># g!R p-P`L@ J@d0Pp -L` p$RP |R60h t44P0S* QG \!1  @0!\ B BBHBlB pVP0S: 048T **0NS;TBLB BBB 0T ^񟗾BBBBBB B\BdBtB|BB0 ā0 @T /VP ^;pBBB<B,B4B\B$BTBDBLBVPX0 0C\ X0d z0t4 4S 0t4x4%PtX0 0X0\ Te kz0t4 UP[\0  \8 #8t$,R10 tt$H\0 x40 \8 #80:\0  \8 #84.D,<*@(8&L$P"H d0(l0h hEh @zPp@ p@lPh zlPPlUP8 0 $@\0`/ h x4$S 0|4h 04Q t$R10 tt$P0x4t4 0CQ01|$10t , h yl0d 0 l0d 0,0h yhdl0d@<"tDl xDXETE$EDE4E 0-PpLP d@Tp@0h -LhMr `ePPpK m@P <0S SXp0 S$KD0SlW@P -LhMp t s5`KP@@P @0S<p0St0 SZ80K 0SZ @(K -LhMp sPp`K@P p0S<0SW,4 00*Pkg0P$K,pW ThE -L 0q 0Q 0\00`/ 00-LMPLQ@ @T @ @STD@PK0L -LM@48 400} -LM8 @`R p PP@ 800 x408 40p8@404`-@ -LM8 `pR404pbPP 80 @0tx408 40PMPj 1-QLMP d1Q& 1CQ KD1Q800Q* Q< QD0 0 & 4$K KP 0$ S;#0  0 6xQ Q QD0 0  H0 0  0P H0 0 8@ 0p@T@0 JT` VL0 0 L0 0  xUDUU@ 0-L904@0090l PBUlP0PP 7TP 3LP LLP8P 88PDP0fDP0 -LM`904P@090l  Rl  @KHP f40@ @ DPH80@ @P@0P< @ Xq  q4L0&P@ 0PP 0PTL @8Df90p090PlpP8pLp PpTP TpB p-LMP0`@P Kp  0K% TT Td0DS Q020C0 !1*h0\ 90   @ 8\RꄘE Q-L@ RQ R蠘EE -PLLP L60L08P 8.080\P fd\ p p`@h0!R |+h 01dp@\` Qp-L@` pdQ` `P h0!R Y*P00-P00S`dd QP0<p 0p-LhM d0 @`KPd0T@PKp -AML M`P0004P pB @ X 0S@00SX 0@StgP   00S@ 0@S@0s 2R{ 2R (K$ Kf0( P($\`8 @PaP0x QTd2T`"` Q@PQf Ph~ 0Td@H0}CKpHw0($ PpH0PHWH0PT0H04` 18K!0P -h0P @0!S<  PW u@0 $(0 P$(P0$ (P Q K Q0S S$@0  0$0 $f P( tQ >CRz?C@$0 ehQ$ ueSm0h@$0 WXZQ0T0H0j^@EE ETEpEBBEErRs$ECE4rhE -L@P P T0R 0S-0  >CR0S ^/ p-@@PLL`t R0t0 0S00  pf@0T ?S $0/R (0 (p-L"PA0Pp1s sL0t`<0p@@8@00Pp0t`<0Xslsf|s 0-L Ƞ Ƞ,@Qp0P@ PA @` T0S@pUUXsf -LM⤑@P0`, cpPt1T h1T& `1T<  0p, 0RA(K 1T 1T 1TQ| |P0|00 |P 1 Q0K0P P 8 D0R0 KP-000,%000–}fpUAUvtnU~fdC 0-LM \@.Q@@v00CS0@00Xs p-LP0`PpH0@Tp PPp0P Pp `00-L Ƞ Ƞ,A00000CS0P00Xs -LM℡0@`, p 8 D0PK@R@0 ^PPD P, 0R:(KP T0S0/ T RP0gP(U 000T R@0T0U0S T@#T@!PK To pPP ,$#PP–fEtC `00-L Ƞ Ƞ,A00000CS0P0R0XsL0 ( (0-"LAPToPf|P0Xs 8 80- #PL*0AT 0P P0PPT oHf 0|P00P0Xs 0-@TPL o0 pS|P0 0h00pS|P0 p-L90@0Q$ژ 0 S00 S P0 غpT`00CS0PT}e@RX-Bf 0p-LMP@@0 K40 K0080 ` 0 0 D 0 H H D0L NKp.BE`1S00`/-T1S0T0 0@S<0S=QX0S S 004 D0OPS4< @0HPLX0Sx 0`@0`P? V@X 0BSP2 X R[ .:R,1T0Y 0BS;fBfBfBfBfBt!p!}l!{h!y@!w0Y0Q0Y0M0Y0I0Y0EP@ihi@X@Y@\@`@4w`PY0X0P)=@iOi@ >0S}=y`0T04> H0P ꔝEEtEEEECEEEE EEE؝EC -@L0 04JS00X0ĵX0ĥ -L@4(0S0 0$ R 0R  R0Y00Y0 ?00-L M8P0ED0KKB0 KK@K0KKKKPKK04 p0-LMq3 &C p-@L0`0S00PPpf 0-PL@000fS000(0RR00(0(00 (0SP( P0(0 F0(0 -LM@Q` $pSJjBiBiBjB2 %㼠 +00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko`@0(00(KoS0P0 0!0(00(0 iB@E@0S8@0' -LMP@4`0tP3 pW00 0'0 0! T@  0 P0(Ko 0+ R  RW\j?0(0(Ko脈T@$ 0AP(KiBhE p-L!M`4P00 R  0RKp0 "K@KnV+ PK 1QK1@K L4 >0 ix–EC p- PLT T0@`30201"(08P40`) "`phBhBs p-LM`PK 2@!<202 S*00004  00CS0ppP@ p-LM`0PK22 @< ; 2(*00004  00CS0ppP@ 0-Lkd@P ; d1P 0 d@ -@3LS## 08P EP 27 -@3LS## 0P *P 7 -L(M< 8 Pp0#4 4 P9@ U UU(K PiUn <0$)< 08 8 8 ,0KPV,9b00)#@ , B, *4 \ j1:, epP, 0P`0@0@40 0a  jb  PP @ 4sx0,\ \ 0K0 0@0@ =YpBfE -@LT30CST3h T30T3 Q-L0 -LM0S0 ZP C -@PL0bP0h 0-L@P⁁4300# 0 0-LP,3S (CT 0@T0hA @0p-L M !DP_`$K0 K$0K<0C@K#K0KK"K!K PKe@P  L=Kp谞E 0-@L 0(, B$PP00 A$0h 10-LM@0  P:)L3 LÄ <9s  7L37L3 C L#K0h3S:PL3 PP  0K U 010K0 C ?0-L M!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK@P  < 00KE 4p0-LM@P  KPP1  ((    ;PP0 <0 <0@E E p  4p00 p-LM`p9@p 03$0 S$2 p , KP%460 L#0,@@ &L#00000 0  GP ,@@ p dP  j1 ? (` 00S#0@StHP   0P# P# :A( KP,0(2#̠#!$#4"2"0"@yB`EPBhEfBBE(BxBwB$tBsBsBE -L@0LPchx 0-@L9PY=9? P P3SP P003P P03P _03P 03P _03P0030n 4*:h $:b :EEءE -LMr0qGP: @K:`:0$ z^0 :;~:$0 p^30 ^ 3cHH  P p K303'ЃB 0-LP@40601S k~P0 P 1S k~LP  u6;600 r0C0 BQ  00S: BQ  10R!!  10C1 -L`@P0]PpU UU& 0 0@0@ o9U 9Y;9 ^ P 2S 0 0@0@4xfE -L4PLP P P 00pT30CST3`19@(O \}Q40S 4@C3S l 9T30CST33S3S? f4E -LM@laPteQ7P& h7P) H ?P  8KH :>pP  8883`/ p9?@0;9 fEEXEtEpB -PLd@`pL1T' 0CT0  04 @4T 0T 0T0/ @4T6@ @ @ @60@6 0 R43@@ @=:@fi 5i 6i( -LDS@Up`eE P F%# EEE Ph8h7EТE 0p-LM@0 P`9E P |7[p%#EvE PF K[p 7F KТE E0 00CSxBBBBpBBBB P P@/7P,@/nPX@//l/`/0// /$//H/0AhSwꈍBBBBBBBB|BBBBBB|BBBBBBpBBBBBBBBBBBBpBBBBBBBBBBBBdBBBBBBBBBBBBBBBBBBBBBBBBdBBBBBBBBBBBBBBBBBBBBBBBBdBBBBBBBBBBBBdB0// /0 R// Q Q0-L@P  Zppp0@wZTp `0s00s0@jPjBBBBBBBBBB BBBBBBBBBBBB$BBBBBBBBBBBB,BBBBBBBBBBBB4BBBBBBBBBBBBBBBBBBBBBBBBsƀq0 S '@ { w4A  q0 %k g c   ]0 %W S O  J0 %D QZ~@ 00Cs0S  ZZ ^mSCXC t 0-06L0PS0CS006 0h#(00 0@0@0E -LNMP! 0,0 00H1 0@ HK(  H+P 0 P!\Q 4! 4 \(5` VʨX 41S S8S S@ | D! 4P x0Cr 0C 0 4`V" P0@@$41J͉0px47 P2 Bpr0C t0$ , 0R(K>K 凼01'S0 0@0@0@ T@Ps ; 4T1 1.S1绿 00D! @ H1  D!00H10 04D!8<#8:#:0 0<14!@ 0S( $1 <1H 0IL1 1KKp0p0L10010$ D1  ,1 - "P2U@@PEl2-P `"DU@@ P<2-P 0"U@@2-@ "Tp UN PN@P?N. !PU@1!9!1!10@!0` h4NYh1d!`1#3TT!II  X0818!8 D0C0!<0@D BD0 K Ki) Ki) Ki) Ki) 0OpEBXB>7>h6 Q-L Q G 0-L@lOPPP a6Vt"R0l2ptR00 0-@0L SP 10!0?B3c=Y ]0l”<18p \l2p ,PEP 6u0h} 0FABMbpE -`Lp@P7PS (7s (0U@XYl2 ,P@ <3Pq l2 ,'R:0!  2R 0000l–0 \l2@ ,'R : 2RZ l–0@ \Xl2p ,l–p @88\7pS @TV )6&6@P7PS (p U@ǖ'\7RS\ R S7SL S? SQ 7SH SI SO|'1R R7S S=l– 0\00 S1@D0!0?BCcl2 ,@D 5tl– H0\=  74pP'FMb -LM`0Pl2 h"0lB `2t" $0(,8"'΅Q0("74' 0 0P hL 0lB̅ 0PS 7S lB<0 00P x. l2 l•pt"0t24 47S 3/@Pl2p $l•p0p xX0 80p4P"  MP 0 h h d 4Fl•0 4 (  x2CEpEN0EAEEE Q-P4`pL8 \0 R @@80 T0   0T贀 0p-LMP4 @`0`0 0P <<ph O5 80 4plF ED\00 -LPp@@00 4,0 4@ <\LT0040 ,040 `%0@0\06`V00A@@4 ,04 0\7 `)(E 00-LM4@P0@ P XX0h HC4004 $    0P0hED'E`) 7긎 7OpenBSD5.5RAMDISK-OMAP#8 @(#)OpenBSD 5.5 (RAMDISK-OMAP) #8: Sat Mar 8 16:28:49 EST 2014 OpenBSD 5.5 (RAMDISK-OMAP) #8: Sat Mar 8 16:28:49 EST 2014 nick@bbb1.openbsd.org:/usr/src/sys/arch/armv7/compile/RAMDISK-OMAP comstartehci_root_ctrl_starthotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdchacha_encrypt_bytesextract_entropy_rs_stirrandomreadexpand 32-byte kexpand 16-byte k n;AvXaM ְdx coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2014 OpenBSD. All rights reserved. http://www.OpenBSD.org ;1h;18191$91@91p;1`;1X:1:1$;1@;1xo1Xo1?? $$<7DD6E;DD7DL7DT7D\7Dsched_chooseprocremrunqueuesetrunqueuesched_idlecoredump_tradcoredumpsysctl_diskinitkern_sysctlsleep_finishsysctl_tc_choicesysctl_tc_hardwarex(resetprioritysetrunnablemi_switchupdatepriconfig_detachdisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freeextent_alloc_subregion_with_descrextent_alloc_subregionextent_do_allocextent_alloc_regionextent_destroyextent_createextent_registerdb_show_all_poolspool_do_putkprintflogpriassertwaitokttwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ttyunblockttypendttnreadsoabortsofreesbwaitsonewconnbiodonebuf_undirtybuf_dirtybuf_putbremfreebuf_free_pagesbuf_alloc_pagesbuf_unmapbuf_dealloc_membuf_releasebuf_mapbuf_acquire_nomapbuf_acquirecache_lookupvprintreassignbufbuf_replacevnodebrelvpbgetvpvwakeupvwaitforiolnDtnD|nDnDnDnDnDnDnDsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount685`55q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPieee80211_recv_probe_respPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_free_nodeieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PPD DD$D4D@DLDXDdDlDtDDD@9DDDDDDąD̅DЅD؅D܅DDDieee80211_newstateEDE3D0 DG(D9$D!D08D0dD40 D`DRDDULDpDT D|$D D5SDX(DR,D0D4D78D6@AE7P\D7Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_Initaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mount:2;:2;2;:::l:p:\::3; ufs_makeinodeufs_readdirufs_mkdirufs_linkufs_rename;y;PD;c;c;y;d;\D;y;hDz;r;tDx;q;\q;y;D w;q;p;y;(n;D~;y;Duaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insert(=!,=EEE,=euvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3uvm_unmap_removeuvm_mapent_freeuvm_mapent_allocuvm_map\uvm_aio_aiodoneuvm_aio_biodonesys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_unlink_ifain6_ifloop_requestin6_purgeaddrin6_update_ifain6_controlin6_lifaddr_ioctlin6_update_ifain6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_ifdetachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_diagicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputicmp6_inputip6_nexthdrip6_savecontrolip6_inputip6_forwardip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputmld6_checktimerfill_prlistnd6_lookupnd6_ioctlnd6_outputnd6_freend6_storelladdrnd6_cache_lladdrnd6_rtrequestnd6_dad_duplicatednd6_na_outputnd6_ns_outputnd6_dad_timernd6_dad_startnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkpfxlist_onlink_checkprelist_removend6_prelist_addprelist_updatedefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output ?t ?k3M?M?k3D7DD7DD7DD@D ]D]D D]D D$D ,D0D8D@DHD@DPD@DXD@Dp `DhDp 0lDhDp `tDhDp p|DhD@DE`DEP DhDP DhDP @DhDP PDhD DDDDDDDDD@AED@AED@AED@AED@AED@AE  0E1D0E1DDD@DDDD DE DE DE DE DE  DE DD DD/D]Do D$D0/D]Dp (DD t(E0D 8D0D @E 0>E\>E>E>E>E?E$?EL?Ep?E?E?E?E?E @E,@EH@Ep@Eh@E@E@E@E@EAE $AE DAE pAE AE AE AE AE $BE TBE xBE BE BE BE!CE!VE>VE>VE>WE>(WE?TWE?WE?WE?WE?WE?WE? XE?4XE?PXE? lXE? |XE? XE? XE? XE?XE?YE?YE?(YE?LYE?dYE?YE@YEAYEBYEC[EDZEDq0ZEEPZEFlZEGZEGZEGZEGZEG[EGD[EG`[EG[EH[EI[EJ[EK\EK\EKH\EK\\EKl\EK|\EK\EK\EL\EN\EP]EP]EP4]EQX]EQh]ER]ES]ES]ES]ES]ES,^ESP^ESl^ES^ES^ET^EU^EU^EU_EU4_EUL_EUp_EU_EU_EU_EU _EU $`EU @`EWd`EX`EY`EZ`EZ`EZaEZ$aE[DaE[TaE[laE[aE\aE\aE\aE]aE]bE]@$@c@c@eaQ@X@W@@0@ w@Q2@U@4@F s%^^uhub_attachDAAA`Augen_do_writeugen_do_readLA BAAugen_set_configp%B!B<B B uu ; u%5E u%5E     uu%5E )u&5F 2 5u&6F 0 1 3 4u0uhid_do_ioctluhid_do_read%BX/B.B=CRRC C] CCCI:CCJCRpC7C C C C CKCC@#CCCCCC CCH@C NC _tC2CC\,C C C CEC CmCKCA$C[C\C0zC CCjCC?CnnC JCJ^CCabcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    ;B<;B(;BKVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 "3 f`&3 g`*3 h`.3 i`$3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3                    " f`& g`* h`. i`$ f`( h`, i`0 j`4 k`8 l`< n`@ o`d h l p t x |           # $ Zp [ \( #"<$<-.q2q"<<<4E@ELEXEdExEEEE?E̹EEعEEE E E4E@@ELE procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolregistersuvmexpwatchescrashdumphaltrebootpoweroffmachineprintexaminesearchwritedeletebreakdwatchwatchstepcontinueuntilmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. cnopen: recursive/mnt/etc/firmware/%swarning: no entropy supplied by boot loader %s@%dOpenBSDcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldexec: a VTEXT vnode has writecount != 0#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dexec_process_vmcmds: RELATIVE no basevmcmdset_extend: not necessarydiagnostic ../../../../kern/exec_subr.cocnt > 0/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfd_unused: fd_lastfile inconsistentfdrop: count (%ld) != 0closef: count (%ld) < 2fdlockfileplfdescpldup2: fdalloc../../../../kern/kern_event.ckn->kn_status & KN_QUEUED(kn->kn_status & KN_QUEUED) == 0kqreadkqueueplknoteplexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i../../../../kern/kern_exit.cpr->ps_refcnt == 1TAILQ_EMPTY(&pr->ps_threads)waitinit died (signal %d, exit %d)thrdeathpr->ps_refcnt > 0cpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d ../../../../kern/kern_lock.c!((flags & (LK_SHARED|LK_EXCLUSIVE)) == (LK_SHARED|LK_EXCLUSIVE))!((flags & (LK_CANRECURSE|LK_RECURSEFAIL)) == (LK_CANRECURSE|LK_RECURSEFAIL))(flags & LK_RELEASE) || (flags & (LK_SHARED|LK_EXCLUSIVE|LK_DRAIN))flags == 0No KMEMSTATS compiled in ../../../../kern/kern_malloc.cflags & (M_WAITOK | M_NOWAIT)malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_map???%s %zd of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %zd of object %p size 0x%lx %s %s (0x%x != 0x%x) %d,%s,free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freedevbufdebugpcbroutetblfragtblifaddrsooptssysctlioctlopsiovNFS reqNFS mountnamecacheUFS quotaUFS mountshmVM mapsemdirhashACPIVM pmapfile descsubprocVFS clusterMFS nodeExport HostNFS srvsockNFS daemonip_moptionsin_multiether_multimrtISOFS mountISOFS nodeMSDOSFS mountMSDOSFS fatMSDOSFS nodettysmiscfs mountfusefs mountpfkey datatdbxform_datapagedepinodedepnewblkindirdepVM swapUVM amapUVM aobjUSBUSB deviceUSB HCmemdesccrypto dataIPsec credsemuldataip6_optionsNDPtempNTFS mountNTFS nodeNTFS fnodeNTFS dirNTFS hashNTFS attrNTFS dataNTFS decompNTFS vrunkqueuebluetoothbwmeterUDF mountUDF file entryUDF file idBluetooth HIDAGP MemoryDRMsysctlklk%s: lock held%s: lock not shared%s: lock not held%s: lock not held by this process../../../../kern/kern_rwlock.crrwl->rrwl_wcnt > 0rw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%xtodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenmawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags process=%b proc=%b CONTROLTEXECINEXECEXITINGSUGIDSUGIDEXECPPWAITISPWAIT PROFIL TRACED WAITED COREDUMP SINGLEEXITSINGLEUNWINDNOZOMBIE8STOPPEDINKTRPROFPENDALRMPENDSIGSUSPENDSELECTSINTR SYSTEM TIMEOUTWEXITOWEUPCSUSPSINGLESYSTRACECONTINUEDTHREADSUSPSIGSOFTDEPCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%u, sys=%u, intr=%u enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession but not curprocchgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlestopzombiedeadonprocplimitpl../../../../kern/kern_sched.cp->p_wchan == NULLp->p_stat == SRUNcpu_switchto returnedci == curcpu()curproc == spc->spc_idleprocfork idleidle%dsensor_task_register: period is 0sensorssensorsensordev../../../../kern/kern_sig.cpr->ps_single == psuspendpausesingle_thread_mode = %dsigwaiterror != 0p->p_sigwait != 0usersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.corepostsigpostsig actionProcess (pid %d) got signal %d issignal psignal signal numbersigaplhashinit: bad cntureadc: zero residureadc: non-positive iovcntuiomove: modeuiomove: proc%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlktsleep: no identtsleep: not SONPROCwakeup: p_stat is %dsleep_finish !SONPROC../../../../kern/kern_synch.c(priority & ~(PRIMASK | PCATCH)) == 0thrsleep(priority & ~(PRIMASK | PCATCH | PNORELOCK)) == 0mtx != NULL%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2td/%-4td %p %s ticks now: %d ticks wheel arg func timeout_add: not initializedtimeout_add: to_ticks (%d) < 0boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsmashed stack in %ssetrunnable../../../../kern/sched_bsd.cp->p_stat != SONPROCp->p_cpu == curcpu()preempt: cpu_preempt not yet implementedphzconfig_activate_children: device %s failed %d failing resume cannot be handled resume %s config_pending_decr: config_pending == 0config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureautoconfconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: %s attached at %s config_detach: detached device (%s) has children%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe ../../../../kern/subr_autoconf.ccd->cd_devs != NULLdev->dv_unit < cd->cd_ndevscd->cd_devs[dev->dv_unit] == NULL%s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)%s%d%croot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 ../../../../kern/subr_disk.cpart >= 0 && part < MAXPARTITIONSdisk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: extent `%s', start 0x%lx, size 0x%lx %s: extent `%s', region not within extent%s: overflow%s: start 0x%lx, end 0x%lx %s: region not found%s: NULL region descriptor%s: NULL result pointer%s: extent `%s', ex_start 0x%lx, ex_end 0x%lx %s: substart 0x%lx, subend 0x%lx %s: bad subregion%s: extent `%s', size 0x%lx %s: bad size%s: bad alignment%s: extent `%s', size 0x%lx, boundary 0x%lx %s: bad boundary%s: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx %s: overflow after alignment%s: EX_NOCOALESCE not set%s: can't allocate region descriptor %s: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusive%s: extent `%s' (0x%lx - 0x%lx) %s: region lies outside extent%s: name == NULL%s: extent `%s', start 0x%lx, end 0x%lx %s: end < start%s: fixed extent, bad storagesize 0x%lx%s: storage provided for non-fixedextentpl%s: already registeredklog page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%zx=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu ../../../../kern/subr_pool.c((((vaddr_t)pi) + ioff) & (align - 1)) == 0pool_put of NULLpool %s: putting with none out pool_do_putph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpool_do_put: %s: page header missingdouble pool_put: %ppr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentph->ph_nmissing == 0destroyed pool not on listpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)flags & (PR_WAITOK | PR_NOWAIT)pool_do_get: %s: crossed hard limitpool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%zx=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentinit pool already on listpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %dassertwaitok: non-zero mutex count: %dpollselectpipeplpipelkpipeclpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrttrstrtttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d ttyfree: tty_count < 0b_to_q: required clalloc putc: required clalloc mbuf %p m_type: %hi m_flags: %hb M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_COMPM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_ptkhdr.rcvif: %p m_pkthdr.len: %i m_ptkhdr.tags: %p m_pkthdr.tagsset: %hb IPSEC_IN_DONEIPSEC_OUT_DONEIPSEC_IN_CRYPTO_DONEIPSEC_OUT_CRYPTO_NEEDEDIPSEC_PENDING_TDBBRIDGEGIFGRE DLT PF_DIVERT PIPEX PF_REASSEMBLED SRCROUTETUNNELm_pkthdr.csum_flags: %hb IPV4_CSUM_OUTTCP_CSUM_OUTUDP_CSUM_OUTIPV4_CSUM_IN_OKIPV4_CSUM_IN_BADTCP_CSUM_IN_OKTCP_CSUM_IN_BADUDP_CSUM_IN_OK UDP_CSUM_IN_BAD ICMP_CSUM_OUT ICMP_CSUM_IN_OK ICMP_CSUM_IN_BADm_pkthdr.ether_vtag: %hu m_ptkhdr.rdomain: %u m_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.inp %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.flags: %hhb GENERATEDTRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETREROUTEREFRAGMENTEDPROCESSEDm_pkthdr.pf.routed: %hhu m_pkthdr.pf.prio: %hhu m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRm_zero: M_READONLYm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_clget: request for %u byte clusterm_defrag: no packet hdr or not a chainm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLm_copym0 overrunmbuf prepend length too bigmbinit: the largest cluster size != MAXMCLBYTESmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFreceive 1../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1areceive 3so->so_rcv.sb_mb == mnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsoqinsque../../../../kern/uipc_socket2.c(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsemi-panic: sbcompresssb->sb_mb == sb->sb_lastrecordnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tail../../../../kern/vfs_bio.c!(bp->b_flags & B_ASYNC)biowaitTrying to undirty buffer on freelist!Trying to dirty buffer on freelist!bufcachepercent <= 90bufcachepercent >= 5bufpages < dmapagesbufplbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybiodone alreadyClean buffer on BQ_DIRTYneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbp->b_lblkno == blkno + 1bp->b_vp == vp../../../../kern/vfs_biomem.cbp->b_data == NULLuobj != NULLpg != NULLpg->wire_count == 1size == round_page(size)bp->b_pobj == NULLbuf_page_offset > 0(bp->b_flags & B_BUSY) == 0bp->b_data != NULLbp->b_flags & B_BUSYbuf_needvabufinit: can't reserve VM for buffersnchplcache_revlookup: found entry for .cache_revlookup: found entry for ..../../../../kern/vfs_cache.cvp->v_type == VDIR || TAILQ_EMPTY(&vp->v_cache_dst)wtf? leak?cluster_wbuild: size %ld != filesize %uvop_generic_revokevop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotleaf should be emptyrelookup: symlink found.namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiops vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %lb AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%llx data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%llx syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,vfs_register called with vfc_refcount > 0 bgetvp: not freevdrop: zero holdcntbrelvp: NULLvref used where vget requiredvref on a VNON vnodevinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s)vflushbuf: not dirtyvflushbufvflushbuf: dirtyUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockvgetfree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSTMPFSsyncer vnode mounted on: %s sched_sync: fsync failedsyncermount: lost mountunmount: dangling vnodevn_lockgetcwd: oops, forgot to null lvpgetcwd: oops, went back too farspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode fifo_badop called, fifo with %ld readers and %ld writerstag VT_NONfifo_write modefifo_read modefiforfifowdos2unixtime(): month value out of range (%u) msdosfs_reclaim(): pushing activedetrunc(): can't truncate root directory, clust %u, offset %u msdosfs_inactive(): pushing activedeextend: file too largedenodedeget(): pcbmap returned %d fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_create: no namemsdosfs_mkdir: no namemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritem%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d looutput: no header mbuflo%difmedia_match: multiple match for 0x%x/0x%x, selected instance %d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLMask for route not entered Non-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rtflushclone: called with a non-cloning routertflushclone: no rnh_walktreeifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u wlanPairwise key expansionPMK Name../../../../net80211/ieee80211_crypto_bip.c(wh->i_fc[0] & IEEE80211_FC0_TYPE_MASK) == IEEE80211_FC0_TYPE_MGTm0->m_len >= sizeof(*wh) + IEEE80211_MMIE_LEN%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: impossible operating mode../../../../net80211/ieee80211_input.cieee80211_has_seq(wh)%s: received %s from %s rssi %d mode %s ni != NULL80211scan../../../../net80211/ieee80211_node.cic->ic_opmode == IEEE80211_M_HOSTAPbogus long slot station count %dbogus non-ERP station count %dnot in ap mode, mode %ufreeing bss node%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss passive%s: end %s scan %s: begin %s scan ../../../../net80211/ieee80211_output.crs->rs_nrates > IEEE80211_RATE_SIZEinvalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u../../../../net80211/ieee80211_pae_output.ck->k_flags & IEEE80211_KEY_IGTKk->k_flags & IEEE80211_KEY_GROUP%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshort protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturboaeamaratauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifofrgrgthkhnhrhuiqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamcmkmomxmyninlnzompaphpkprqarorusasgsisvtntttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][, ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%lld rtableid=%u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpintrarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlin6_pcblookup_listen: laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in6_pcbhashlookup: faddr= fport=%d laddr=in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d IPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipintr no HDRipqeplipqplip_initaeshmac-sha1deflatemalformed IPv4 option passed to ip_optcopyip_output no HDRrip_attachrip_detachrip_usrreqtcp_pulloutofbandsynplinvalid sc_tp in syn_cache_cleanupsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossiblem_pulldown malfunction../../../../netinet/tcp_input.csotoinpcb(inp->inp_socket) == inpintotcpcb(inp)->t_inpcb == inptcp_input: TCPS_LISTENtcp_output REXMTtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcpcbpltcpqepltcp_inittcp_usrreqIPv6 inpcb to udp_outputudp_usrreq../../../../netinet/udp_usrreq.cipip_input: should never reach herestart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block../../../../ufs/ffs/ffs_alloc.cindx <= 0 || bap != NULLmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_update: bad link cntDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlapsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluinodeupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsroot_deviceffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_read: modeffs_read: short symlinkffs_read: type %dufs_getlbns: Invalid indirect block %lld specifiedufs_getlbns: indirect block %lld not foundufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_reclaim: pushing activeufs_inactive: pushing activecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_makeinode: no nametag VT_UFS, ino %u, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_strategy: specufs_mkdir: no nameufs_link: no nameufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quota- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p interting %p, colliding with %p%s: duplicate insertion: state %p inserting entry %p which collides with %p../../../../uvm/uvm_addr.cp->entry == NULLuaddr == (struct uvm_addr_state*)&uaddr_kbootstrapuaddr_hint_pool.pr_size == sizeof(*ua_hint)offset < align || (align == 0 && offset == 0)(align & (align - 1)) == 0(offset & PAGE_MASK) == 0minaddr < maxaddruaddr_pivot_newpivot: cannot grant random pivot in area less than 2 pages (size = 0x%lx)align >= PAGE_SIZE && (align & (align - 1)) == 0*entry_out != NULLuvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxentry_out != NULL && addr_out != NULLdirection == -1 || direction == 1(hint & PAGE_MASK) == 0 && (high & PAGE_MASK) == 0 && (low & PAGE_MASK) == 0 && (before_gap & PAGE_MASK) == 0 && (after_gap & PAGE_MASK) == 0high + sz > highuaddruaddrhintuaddrbestuaddrpivotuaddrrnd(map->flags & VM_MAP_ISVMSPACE) != 0uaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrk../../../../uvm/uvm_amap.c((offset) & (PAGE_SIZE - 1)) == 0amap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use(((entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpage((sz) & (PAGE_SIZE - 1)) == 0((padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0amap->am_ref == 0amap_wipeout: corrupt amapLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference count((entry->end - entry->start) & (PAGE_SIZE - 1)) == 0((addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(entry)->end + (entry)->fspace > (startva)(entry)->start < (endva)anon_pagein: uvmfault_anonget -> %d../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anonpl../../../../uvm/uvm_aobj.cuvm_pagelookup(&aobj->u_obj, (UAO_SWHASH_ELT_PAGEIDX_BASE(elt) + j) << PAGE_SHIFT) == NULLelt->count > 0uvmexp.swpgonly >= swpgonlydeltauao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectslot == 0uao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsstartpg < endpguobj->uo_refs == 1uao_detuaoeltplaobjplUAO_SWHASH_BUCKETS(aobj->u_pages) < UAO_SWHASH_BUCKETS(pages)aobj->u_pages > UAO_SWHASH_THRESHOLDaobj->u_pages <= UAO_SWHASH_THRESHOLDpages > aobj->u_pagespages < aobj->u_pagesuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_fault../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_attach../../../../uvm/uvm_fault.cp != NULL && &p->p_vmspace->vm_map == map(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startnext != NULL && next->start <= entry->endanonget1anonget2flt_noram1result != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)fltamapcopyuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2../../../../uvm/uvm_glue.crvva == sva + szuvm_init: page size not set../../../../uvm/uvm_io.ckm_free: unmanaged page 0x%lx ../../../../uvm/uvm_km.csz == round_page(sz)kp->kp_object!kv->kv_singlepagekp->kp_object == NULLsz == PAGE_SIZEkm_allocvakmallockmthreadvm_map_pmap(map) == pmap_kernel()vallocwaitkm_alloc1w!(flags & UVM_KMF_VALLOC) || !(flags & UVM_KMF_ZERO)TAILQ_EMPTY(&pgl)uobj->pgops == &aobj_pagerkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no page../../../../uvm/uvm_map.c*start_ptr == uvm_map_entrybyaddr(atree, addr)*end_ptr == uvm_map_entrybyaddr(atree, addr + sz - 1)map->flags & VM_MAP_ISVMSPACE(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)pg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_pageable_wire: stale mapmap->flags & VM_MAP_PAGEABLEuvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries sel_min: 0x%lx, but should be at least 0x%lx sel_max: 0x%lx, but should be at most 0x%lx sel_min: 0x%lx, not aligned to 0x%lx sel_max: 0x%lx, not aligned to 0x%lx sel_min: 0x%lx, aligned to 0x%lx, expected 0x%lx sel_max: 0x%lx, aligned to 0x%lx, expected 0x%lx uvm_map_sel_limits(sz = %lu, guardpg = %c, align = 0x%lx, pmap_align = 0x%lx, pmap_off = 0x%lx, bias = %d, FREE_START(sel) = 0x%lx, FREE_END(sel) = 0x%lx)uvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)(entry->etype & UVM_ET_FREEMAPPED) != 0 || uaddr == NULLuvm_map_uaddr_e(map, entry) == uaddr(entry->etype & UVM_ET_FREEMAPPED) == 0entry == NULL || (entry->etype & UVM_ET_FREEMAPPED) == 0uvm_map_vmspace_update: vmspace %p invalid bounds: b=0x%lx-0x%lx s=0x%lx-0x%lx(map->flags & VM_MAP_ISVMSPACE) == 0(min & (vaddr_t)PAGE_MASK) == 0(max & (vaddr_t)PAGE_MASK) == 0 || (max & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASKvmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapuvm_map_splitentry: split address 0x%lx not on page boundary!orig->start < split && VMMAP_FREE_END(orig) > splitentry->start < addr && VMMAP_FREE_END(entry) > addr(entry)->end + (entry)->fspace > (start)(entry)->start < (end)last != first(first)->end + (first)->fspace > (start)(last)->start < (end)(iter)->end + (iter)->fspace > (start)(iter)->start < (end)RB_EMPTY(&map->addr)which != NULL(void*)map <= (void*)(which) && (void*)(which) < (void*)(map + 1)fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free map(start & (vaddr_t)PAGE_MASK) == 0(end & (vaddr_t)PAGE_MASK) == 0 || (end & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASK(start & (vaddr_t)PAGE_MASK) == 0 && (end & (vaddr_t)PAGE_MASK) == 0(sz & (vaddr_t)PAGE_MASK) == 0uobj == NULL && (flags & UVM_FLAG_FIXED) && (flags & (UVM_FLAG_OVERLAY | UVM_FLAG_COPYONW)) == 0(*addr & PAGE_MASK) == 0(map->flags & VM_MAP_ISVMSPACE) == VM_MAP_ISVMSPACE || uvm_maxkaddr >= *addr + szUVM_OBJ_IS_KERN_OBJECT(uobj)../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)../../../../uvm/uvm_object.c!(pg->pg_flags & PG_RELEASED)pgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0dupe == NULLpg->wire_count == 0(pg->pg_flags & PG_DEV) == 0pg->pg_flags & PG_TABLEDsaved_loan_count == 0obj == NULL || anon == NULLoff == trunc_page(off)pg != NULL && TAILQ_NEXT(pg, pageq) == NULLuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of two(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)uvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. size 0 uvm_pagereallocuvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init../../../../uvm/uvm_pager.cpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)npages <= MAXPHYS >> PAGE_SHIFTswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0pseg->start == 0pseg->use == 0pagersegsize <= MAXBSIZEpppp->pg_flags & PG_BUSY../../../../uvm/uvm_pdaemon.cp->loan_count > 0anon->an_swslot != 0uvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx ../../../../uvm/uvm_pmemrange.cpg_prev != NULL && pg_next != NULLpg_i->pg_flags & PQ_FREEstart == 0 || atop(VM_PAGE_TO_PHYS(found)) + found->fpgsz > start!TAILQ_EMPTY(pgl)pmr != NULL && pg != NULLsz >= 1nw != NULLpmr->high > pagenouvm_pmr_split: lost one pmr drain->nsegs == 0prev == NULL || atop(VM_PAGE_TO_PHYS(prev)) < pagenobefore > 0after > 0sz >= high - lowFlags: 0x%x, will panic now. (pg->pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg->pg_flags)atop(VM_PAGE_TO_PHYS(&pg[i])) == atop(VM_PAGE_TO_PHYS(pg)) + i(pg[i].pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg[i].pg_flags)pmr != NULLstart == 0 || end == 0 || start < endalign >= 1powerof2(align)maxseg > 0boundary == 0 || powerof2(boundary)boundary == 0 || maxseg * boundary >= countTAILQ_EMPTY(result)flags & UVM_PLA_FAILOKpmemrange allocation error: allocated %ld pages in %d segments, but request was %ld pages in %d segmentsCurrent UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p ../../../../uvm/uvm_swap.cuvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost vnx->vx_pending == 0swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xswapctl: copystrflags & PGO_SYNCIOuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of range../../../../uvm/uvm_vnode.cuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressHuh? Thought in6_pcbnotify() never got called with mapped! in6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia6 == NULL in in6_ifattach_linklocalin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6%s:%d: ip6q lock not held ../../../../netinet6/frag6.cip6q lock check%s:%d: ip6q already locked ip6q_lockicmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_pullexthdr: invalid nxt=%d ip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_setpktopt: impossible case ip6_getpcbopt: unexpected optionassumption failed: hdr not splitscope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p dr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq db_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscortexampintc irq %dampintc_intr_establish: bogus irqnumber %d: %sintr_establish: can't malloc handler infoampintc_attach: ICP bus_space_map failed!ampintc_attach: ICD bus_space_map failed!irq1023/spur nirq %d ampintcamptimer0: adjusting clock: new tick rate %d KHz tickamptimer_attach: bus_space_map global timer failed!amptimer_attach: bus_space_map priv timer failed!: tick rate %d KHz amptimercpu, rrx, %s r%d, %s #%d%s%s#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernel../../../../arch/arm/arm/process_machdep.ctf != NULLprocess_read_regs: Interrupts blocked in user process../../../../arch/arm/arm/syscall.cnargs <= MAXARGSUndefined instruction in kernel ../../../../arch/arm/arm/undefined.ccoproc >= 0 && coproc < MAX_COPROCShandler != NULLreal mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock uvm_pglistalloc returned non-sensical address 0x%lx _bus_dmamem_alloc_range_bus_dmamem_mmap: offset unaligned_bus_dmamem_mmap: segment unaligned_bus_dmamem_mmap: segment size not multiple of page size_bus_dmamap_load_raw: not implemented_bus_dmamap_load_uio: USERSPACE but no proc_bus_dmamap_load_mbuf: no packet header_bus_dmamem_unmap_bus_dmamem_map: size botch../../../../arch/arm/arm/bus_dma.c(va & PAGE_MASK) == (pa & PAGE_MASK)_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: bad offset %lu (map size is %lu)_bus_dmamap_sync: bad length%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Non-emulated prefetch abort with intr_depth > 0 UVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x V7 fault 00000Alignment Fault 1Debug EventAccess Flag Fault (S)External Linefetch Abort (S)Translation Fault (S)Access Flag Fault (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)V7 fault 01010Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)V7 fault 10000V7 fault 10001V7 fault 10010V7 fault 10011LockdownV7 fault 10101Asynchronous External AbortV7 fault 10111Memory Asynchronous Parity ErrorMemory Synchronous Parity ErrorCoprocessor AbortV7 fault 11011V7 fault 11101V7 fault 11111mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplalloc_l1_vaalloc_l1_pgpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lx%s: va %08x ftype %x %c pte %08x fault on exec pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufarmv7_io_bs_free(): not implementedarmv7_io_bs_alloc(): not implementedmutex %p not held in %smutex %p held in %sarm_clock_func.setstatclockrate not intializedinitclocks function not initialized yetarm_dflt_intr_string calledarm_dflt_intr_disestablish calledarm_dflt_intr_establish calledarm_dflt_intr() calledresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! atag core flags %x pagesize %x rootdev %x atag mem start 0x%08x size 0x%x atag cmdline [%s] atag serial 0x%08x:%08x atag revision %08x uboot tag unknown 0x%08x size %d softintr_establish: unknown soft IPL %d%s: armv7_devs == NULL: PhyFLEX-i.MX6 : i.MX6 SABRE Lite : i.MX6 Wandboard : BeagleBoard : BeagleBone : Gumstix Overo : PandaBoard : A1X : A20 %s: board type 0x%x unknownsunxi_attach: bus_space_map failed!%s: device %s unit %d not found %s: device %s unit %d not configured imxccmimxiomuxcimxdogimxocotpimxuartimxgpioimxesdhcimxenetahciprcmintcgptimeromdogomgpioommmcsitaracmedmadmtimercpswomapidsxipiosxiccmua1xintcsxitimersxidogsxirtcsxiuartsxiekernel does not support -c; continuing.. bootfile: %s bootargs: %s unknown option `%c' cpu not recognized! %s booting ... arg0 %p arg1 %p arg2 %p Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables undefined page pmap boot: howto=%08x curproc=%p The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... boot device: lookup '%s' failed. boot device: %s wdsdcdraidmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions %s: init failed mmctsk%s: can't create task thread sdmmcSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: wireless network adapterunknown (%d)%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short ../../../../dev/sdmmc/sdmmc_io.cTAILQ_EMPTY(&sc->sc_intrq)%s(manufacturer 0x%x%sproduct 0x%x%sat %s function %d "scsibus%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus OUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmediamii_phy_setmedia: MASTER on wrong media: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphyunexpected opening returnedDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Setoff INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %uscsi_ioh_del: unexpected state %uscsi_iopool_destroy: scsi_iohandler on poolscsi_ioh_add: unexpected state %uxs->cookie != NULL in scsi_xs_syncxs->done != NULL in scsi_xs_syncsyncxsscsi_link_shutdown: scsi_xshandler on linkscsi_link_shutdown: scsi_xshandler on poolpendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn.~ offline../../../../scsi/scsiconf.cSLIST_EMPTY(&sb->sc_link): %d targets, initiator %d, WWPN %016llx, WWNN %016llxPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SPECTRA90000200SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook %s: bad residual %d out of %d %s: block wrong size, %d blocks residual %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: cannot set selected mode TANDBERG TDC 3600 TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s ????TEAC MT-2ST/N50 wsevent_readwsevent_fini: already invoked wsevent_init: already initialized wskbd at %swskbdread: evp == NULL wskbd_input: evar->q=NULL %s: event queue overflow ../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach !wskbd_console_inittedcannot load keymapwskbd_console_device == NULL: console keyboardwskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %swsmouseread: evp == NULL wsmouse_input: evar->q=NULL ../../../../dev/wscons/wsmouse.cev->value >= 0wsmdetwsmouse_detach: %s didn't detach wsmouseusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_get_quirks: dev == NULL usbd_start_next: pipe == NULL usbd_start_next: pipe=%p no start method usbd_start_next: error=%d usb_insert_transfer: xfer=%p not busy 0x%08x usbd_endpoint_count: NULL pointer usbd_abort_pipe: pipe==NULL usbd_get_interface_descriptor: dev == NULL usbd_get_config_descriptor: dev == NULL usbd_free_buffer: no buffer usb_transfer_complete: xfer=%p not busy 0x%08x usb_transfer_complete: pipe==0, xfer=%p usb_transfer_complete: actlen > len %d > %d usb_transfer_complete: bad dequeue %p != %p usbd_close_pipe: pipe==NULL usbd_alloc_buffer: xfer already has a buffer usbd_transfer: has old buffer! usbd_transfer: not doneusbsynusbd_do_request: not in process context usbd_set_interface: NULL pointer usbrefusbdetusb_detach_wait: %s didn't detach usb_block_allocmem: in interrupt context, size=%lu usb_block_allocmem: in interrupt context, failed usb_disconnect_port: no device out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbd_fill_iface_data: bad max packet size usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_new_device: addr=%d bad max packet size %x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubugenpoll: no edesc ugenpoll: no pipe ugenwrite: no edesc ugenwrite: no pipe ugenread: no edesc ugenread: no pipe ugenriugenclose: not open %s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d hid_report_size: lo != 0 uhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard : %d variable keys, %d key codes, country code %dukbd: %d button%s, Z dir, W dir, Z and W dir, tip, barrel, eraser %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: waiting for refcnt Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: usb errors on rx: %s %s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: getting interface handle failed %s: couldn't get ep %d %s: address %s %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: usb error on tx: %s %s: detach has active endpoints %s: rx list init failed %s: tx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smscRT5226RT2527 (MIMO XR)RT2528RT5225 (MIMO XR)%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not multi write MAC register: %s %s: could not allocate beacon frame %s: could not run firmware: %s %s: could not multi read MAC register: %s %s: could not write to RF %s: could not write to BBP %s: could not read EEPROM: %s %s: could not read BBP %s: timeout waiting for BBP %s: device timeout %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer rum-rt2573%s: failed loadfirmware of file %s (error %d) %s: could not load 8051 microcode %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: missing endpoint %s: timeout waiting for chip to settle %s: MAC/BBP RT%04x (rev 0x%05x), RF %s, address %s rumimxiicmemory size derived from u-boot bootconf.mem[%d].address = %08x pages %d/0x%08x board type: beagle board type: beaglebone board type: overo board type: panda board type %x unknownplatform_smc_write: invalid operation %dOpenBSD/omapomusbtllhcintr%s: data not a multiple of %d bytes %s: too much data divisor failure %s: bus_space_map failed!%s: cannot map interrupt invalid capability blocksize in capa %08x, trying 512 %s: can't attach sdmmc can't load rx DMA map %d: %d ../../../../arch/armv7/omap/if_cpsw.cx < CPSW_NRXDESCS%s: invalid ethernet address %s %x FIRE CPSW_CPDMA_DMA_INTSTAT_MASKED %x rxhead %02x CPSW_CPDMA_DMASTATUS %x CPSW_CPDMA_TX0_HDP %x CPSW_CPDMA_TX0_CP %x CPSW_CPDMA_RX0_HDP %x CPSW_CPDMA_RX0_CP %x (val & 0xffff0000UL) == 0%s error rdp->tx_mb[sc->sc_txnext] == NULLx < CPSW_NTXDESCSeopi == TXDESC_PREV(sc->sc_txnext)sc->sc_txrunsc->sc_txhead < CPSW_NTXDESCSpwned %x %x %x sc->sc_rxhead < CPSW_NRXDESCSdm != NULLm != NULLrxeoq can't map registers: %d can't subregion tx ring SRAM: %d can't subregion rx ring SRAM: %d sc->sc_rdp != NULLunable to create tx DMA map: %d unable to create rx DMA map: %d sc->sc_txpad != NULL: version %d.%d (%d), address %s no PHY found! CM_IDLEST_PLL = 0x%08x %s: invalid type %dError: HERE failed to enable module with clock %d Error: 0x%08x => 0x%08x %s: module not found %s: not initialised!%s: invalid clock %dprcm_attach: bus_space_map failed! rev %d.%d output_pullupinputinput_pulldowninput_pullupi2cGPMC_AD0gpmc_ad0mmc1_dat0gpio1_0GPMC_AD1gpmc_ad1mmc1_dat1gpio1_1GPMC_AD2gpmc_ad2mmc1_dat2gpio1_2GPMC_AD3gpmc_ad3mmc1_dat3gpio1_3GPMC_AD4gpmc_ad4mmc1_dat4gpio1_4GPMC_AD5gpmc_ad5mmc1_dat5gpio1_5GPMC_AD6gpmc_ad6mmc1_dat6gpio1_6GPMC_AD7gpmc_ad7mmc1_dat7gpio1_7GPMC_AD8gpmc_ad8lcd_data23mmc2_dat4ehrpwm2Agpio0_22GPMC_AD9gpmc_ad9lcd_data22mmc2_dat5ehrpwm2Bgpio0_23GPMC_AD10gpmc_ad10lcd_data21mmc2_dat6ehrpwm2_tripzone_ingpio0_26GPMC_AD11gpmc_ad11lcd_data20mmc2_dat7ehrpwm0_syncogpio0_27GPMC_AD12gpmc_ad12lcd_data19mmc2_dat0eQEP2A_inpr1_mii0_txd2pr1_pru0_pru_r30_14gpio1_12GPMC_AD13gpmc_ad13lcd_data18mmc2_dat1eQEP2B_inpr1_mii0_txd1pr1_pru0_pru_r30_15gpio1_13GPMC_AD14gpmc_ad14lcd_data17mmc2_dat2eQEP2_indexpr1_mii0_txd0pr1_pru0_pru_r31_14gpio1_14GPMC_AD15gpmc_ad15lcd_data16mmc2_dat3eQEP2_strobepr1_ecap0_ecap_capin_apwm_opr1_pru0_pru_r31_15gpio1_15GPMC_A0gpmc_a0gmii2_txenrgmii2_tctlrmii2_txengpmc_a16pr1_mii_mt1_clkehrpwm1_tripzone_inputgpio1_16GPMC_A1gpmc_a1gmii2_rxdvrgmii2_rctlgpmc_a17pr1_mii1_txd3gpio1_17GPMC_A2gpmc_a2gmii2_txd3rgmii2_td3gpmc_a18pr1_mii1_txd2ehrpwm1Agpio1_18GPMC_A3gpmc_a3gmii2_txd2rgmii2_td2gpmc_a19pr1_mii1_txd1ehrpwm1Bgpio1_19GPMC_A4gpmc_a4gmii2_txd1rgmii2_td1rmii2_tdx1gpmc_a20pr1_mii1_txd0eQEP1A_ingpio1_20GPMC_A5gpmc_a5gmii2_txd0rgmii2_td0rmii2_txd0gpmc_a21pr1_mii1_rxd3eQEP1B_ingpio1_21GPMC_A6gpmc_a6gmii2_txclkrgmii2_tclkgpmc_a22pr1_mii1_rxd2eQEP1_indexgpio1_22GPMC_A7gpmc_a7gmii2_rxclkrgmii2_rclkgpmc_a23pr1_mii1_rxd1eQEP1_strobegpio1_23GPMC_A8gpmc_a8gmii2_rxd3rgmii2_rd3gpmc_a24pr1_mii1_rxd0mcasp0_aclkxgpio1_24GPMC_A9gmpc_a9gmii2_rxd2rgmii2_rd2mmc2_dat7 / rmii2_crs_dvgpmc_a25pr1_mii_mr1_clkmcasp0_fsxgpio1_25GPMC_A10gmpc_a10gmii2_rxd1rgmii2_rd1rmii2_rxd1gpmc_a26pr1_mii1_rxdvmcasp0_arx0gpio1_26GPMC_A11gmpc_a11gmii2_rxd0rgmii2_rd0rmii2_rxd0gpmc_a27pr1_mii1_rxermcasp0_axr1gpio1_27GPMC_WAIT0gpmc_wait0gmii2_crsgpmc_csn4mmc1_sdcdpr1_mii1_coluart4_rxdgpio0_30GPMC_WPngpmc_wpngmii2_rxerrgpmc_csn5rmii2_rxerrmmc2_sdcdpr1_mii1_txenuart4_txdgpio0_31GPMC_BEn1gpmc_be1ngmii2_colgmpc_csn6gpmc_dirpr1_mii1_rxlinkmcasp0_aclkrgpio1_28GPMC_CSn0gpmc_csn0gpio1_29GPMC_CSn1gpmc_csn1gpmc_clkmmc1_clkpr1_edio_data_in6pr1_edio_data_out6pr1_pru1_pru_r30_12pr1_pru1_pru_r31_12gpio1_30GPMC_CSn2gpmc_csn2mmc1_cmdpr1_edio_data_in7pr1_edio_data_out7pr1_pru1_pru_r30_13pr1_pru1_pru_r31_13gpio1_31GPMC_CSn3gpmc_csn3mmc2_cmdpr1_mii0_crspr1_mdio_dataEMU4gpio2_0GPMC_CLKlcd_memory_clkgpmc_wait1mmc2_clkpr1_mii1_crspr1_mdio_mdclkmcasp0_fsrgpio2_1GPMC_ADVn_ALEgpmc_advn_aletimer4gpio2_2GPMC_OEn_REngpmc_oen_rentimer7gpio2_3GPMC_WEngpmc_wentimer6gpio2_4GPMC_BEn0_CLEgpmc_ben0_cletimer5gpio2_5LCD_DATA0lcd_data0pr1_mii_mt0_clkpr1_pru1_pru_r30_0pr1_pru1_pru_r31_0gpio2_6LCD_DATA1lcd_data1pr1_mii0_txenpr1_pru1_pru_r30_1pr1_pru1_pru_r31_1gpio2_7LCD_DATA2lcd_data2pr1_mii0_txd3ehrpwm2_tripzone_inputpr1_pru1_pru_r30_2pr1_pru1_pru_r31_2gpio2_8LCD_DATA3lcd_data3pr1_pru1_pru_r30_3pr1_pru1_pru_r31_3gpio2_9LCD_DATA4lcd_data4pr1_pru1_pru_r30_4pr1_pru1_pru_r31_4gpio2_10LCD_DATA5lcd_data5pr1_pru1_pru_r30_5pr1_pru1_pru_r31_5gpio2_11LCD_DATA6lcd_data6pr1_pru1_pru_r30_6pr1_pru1_pru_r31_6gpio2_12LCD_DATA7lcd_data7pr1_pru1_pru_r30_7pr1_pru1_pru_r31_7gpio2_13LCD_DATA8lcd_data8gpmc_a12uart5_txdpr1_mii0_rxd3uart2_ctsngpio2_14LCD_DATA9lcd_data9gpmc_a13uart5_rxdpr1_mii0_rxd2uart2_rtsngpio2_15LCD_DATA10lcd_data10gpmc_a14mcasp0_axr0pr1_mii0_rxd1uart3_ctsngpio2_16LCD_DATA11lcd_data11gpmc_a15mcasp0_ahclkrmcasp0_axr2pr1_mii0_rxd0uart3_rtsngpio2_17LCD_DATA12lcd_data12pr1_mii0_rxlinkuart4_ctsngpio0_8LCD_DATA13lcd_data13mcasp0_axr3pr1_mii0_rxeruart4_rtsngpio0_9LCD_DATA14lcd_data14pr1_mii_mr0_clkuart5_ctsngpio0_10LCD_DATA15lcd_data15mcasp0_ahclkxpr1_mii0_rxdvuart5_rtsngpio0_11LCD_VSYNClcd_vsyncpr1_edio_data_in2pr1_edio_data_out2pr1_pru1_pru_r30_8pr1_pru1_pru_r31_8gpio2_22LCD_HSYNClcd_hsyncpr1_edio_data_in3pr1_edio_data_out3pr1_pru1_pru_r30_9pr1_pru1_pru_r31_9gpio2_23LCD_PCLKlcd_pclkgpmc_a10pr1_edio_data_in4pr1_edio_data_out4pr1_pru1_pru_r30_10pr1_pru1_pru_r31_10gpio2_24LCD_AC_BIAS_ENlcd_ac_bias_engpmc_a11pr1_edio_data_in5pr1_edio_data_out5pr1_pru1_pru_r30_11pr1_pru1_pru_r31_11gpio2_25MMC0_DAT3mmc0_dat3uart1_dcdnpr1_pru0_pru_r30_8pr1_pru0_pru_r31_8gpio2_26MMC0_DAT2mmc0_dat2uart1_dsrnpr1_pru0_pru_r30_9pr1_pru0_pru_r31_9gpio2_27MMC0_DAT1mmc0_dat1uart3_rxduart1_dtrnpr1_pru0_pru_r30_10pr1_pru0_pru_r31_10gpio2_28MMC0_DAT0mmc0_dat0uart3_txduart1_rinpr1_pru0_pru_r30_11pr1_pru0_pru_r31_11gpio2_29MMC0_CLKmmc0_clkuart2_rxddcan1_txpr1_pru0_pru_r30_12pr1_pru0_pru_r31_12gpio2_30MMC0_CMDmmc0_cmduart2_txddcan1_rxpr1_pru0_pru_r30_13pr1_pru0_pru_r31_13gpio2_31MII1_COLgmii1_colrmii2_refclkspi1_sclkmcasp1_axr2gpio3_0MII1_CRSgmii1_crsrmii1_crs_dvspi1_d0I2C1_SDAmcasp1_aclkxgpio3_1MII1_RX_ERgmii1_rxerrrmii1_rxerrspi1_d1I2C1_SCLmcasp1_fsxgpio3_2MII1_TX_ENgmii1_txenrmii1_txenrgmii1_tctlmcasp1_axr0eQEP0_indexgpio3_3MII1_RX_DVgmii1_rxdvcd_memory_clkrgmii1_rctlgpio3_4MII1_TXD3gmii1_txd3dcan0_txrgmii1_td3gpio0_16MII1_TXD2gmii1_txd2dcan0_rxrgmii1_td2gpio0_17MII1_TXD1gmii1_txd1rmii1_txd1rgmii1_td1mcasp1_fsrmcasp1_axr1eQEP0A_ingpio0_21MII1_TXD0gmii1_txd0rmii1_txd0rgmii1_td0mcasp1_aclkreQEP0B_ingpio0_28MII1_TX_CLKgmii1_txclkrgmii1_tclkmmc0_dat7gpio3_9MII1_RX_CLKgmii1_rxclkrgmii1_rclkmmc0_dat6gpio3_10MII1_RXD3gmii1_rxd3rgmii1_rd3mmc0_dat5gpio2_18MII1_RXD2gmii1_rxd2rgmii1_rd2mmc0_dat4gpio2_19MII1_RXD1gmii1_rxd1rmii1_rxd1rgmii1_rd1mcasp1_axr3eQEP0_strobegpio2_20MII1_RXD0gmii1_rxd0rmii1_rxd0rgmii1_rd0mcasp1_ahclkxmcasp1_ahclkrgpio2_21RMII1_REF_CLKrmii1_refclkxdma_event_intr2spi1_cs0mmc0_powgpio0_29MDIOmmc0_sdcdgpio0_0MDCmdio_clkmmc0_sdwpgpio0_1SPI0_SCLKspi0_sclkI2C2_SDAehrpwm0Apr1_uart0_cts_npr1_edio_sofEMU2gpio0_2SPI0_D0spi0_d0I2C2_SCLehrpwm0Bpr1_uart0_rts_npr1_edio_latch_inEMU3gpio0_3SPIO_D1spi0_d1mmc1_sdwpehrpwm0_tripzone_inputpr1_uart0_rxdpr1_edio_data_in0pr1_edio_data_out0gpio0_4SPI0_CS0spi0_cs0mmc2_sdwpehrpwm0_syncipr1_uart0_txdpr1_edio_data_in1pr1_edio_data_out1gpio0_5SPI0_CS1spi0_cs1eCAP1_in_PWM1_outmcc0_powxdm_event_intr2gpio0_6ECAP0_IN_PWM0_OUTeCAP0_in_PWM0_outspi1_cs1gpio0_7UART0_CTSnuart0_ctsnpr1_edc_sync0_outgpio1_8UART0_RTSnuart0_rtsnpr1_edc_sync1_outgpio1_9UART0_rxdeCAP2_in_PWM2_outpr1_pru1_pru_r30_14pr1_pru1_pru_r31_14gpio1_10UART0_txdpr1_pru1_pru_r30_15pr1_pru1_pru_r31_15gpio1_11UART1_CTSnuart1_ctsntimer6_mux1pr1_edc_latch0_ingpio0_12UART1_RTSnuart1_rtsntimer5_mux1pr1_uart0_rts_n pr1_edc_latch1_ingpio0_13UART1_RXDuart1_rxdpr1_pru1_pru_r31_16gpio0_14UART1_TXDuart1_txdpr1_pru0_pru_r31_16gpio0_15I2C0_SDAgpio3_5I2C0_SCLgpio3_6MCASP0_ACLKXpr1_pru0_pru_r30_0pr1_pru0_pru_r31_0gpio3_14MCASP0_FSXpr1_pru0_pru_r30_1pr1_pru0_pru_r31_1gpio3_15MCASP0_AXR0pr1_pru0_pru_r30_2pr1_pru0_pru_r31_2gpio3_16MCASP0_AHCLKRpr1_pru0_pru_r30_3pr1_pru0_pru_r31_3gpio3_17MCASP0_ACLKRpr1_pru0_pru_r30_4pr1_pru0_pru_r31_4gpio3_18MCASP0_FSRpr1_pru0_pru_r30_5pr1_pru0_pru_r31_5gpio3_19MCASP0_AXR1pr1_pru0_pru_r30_6pr1_pru0_pru_r31_6gpio3_20MCASP0_AHCLKXpr1_pru0_pru_r30_7pr1_pru0_pru_r31_7gpio3_21XDMA_EVENT_INTR0xdma_event_intr0clkout1gpio0_19XDMA_EVENT_INTR1xdma_event_intr1tclkinclkout2gpio0_20EMU0gpio3_7EMU1gpio3_8USB0_DMUSB0_DPUSB0_CEUSB0_IDUSB0_VBUSUSB0_DRVVBUSgpio0_18USB1_DMUSB1_DPUSB1_CEUSB1_IDUSB1_VBUSUSB1_DRVVBUSgpio3_13sitara_cm_attach: already attached%s: bus_space_map failed! sitara_cm_attach: read revision: control module, rev %d.%d %s: Invalid mux mode "%s" %s: Invalid register address: rev %d.%d huh?intc_attach: bus_space_map failed!intc_intr_establish: bogus irqnumber %d: %sgptimer_attach: bus_space_map failed!attaching too many gptimers at 0x%x%s: negative duration! %s: time lost! attaching too many dmtimers at 0x%xomapid: bus_space_map failed!omap4430omap4460PHY reset operation timed out : cannot map mem space : unable to establish interrupt XXX - disable ehci and prcmTI OMAP%s: init failed, error=%d %s: bus_space_map failed usbtll enabling %d sxidmacohciƟd'(3  DDDDDHEDDDDDD  &D$DF<FxDDFXFDDF\FDDF\F E4EFXFllF`Fll FJFllF8F m mFlF4mHmFlFtmmFlFmmFlFmmFlFnmFhFTq@qFpF 8CqFdF 8CqFdF PCqFDF qqF>F CqF>F C rF>F CXs FPFCs FPFCs FPFCsF>F CsF>F @CsF>F }}FXFpFTFFTFԌFTF茖FTF(FTFgZ\7|p*Wp!rbu#1.׽"Oo[H@(K@w[K0q*fȿt3|k(QHf Z(2vg#҉\d%Q  o>oQf.DhsWY˗u0O@"cb"1{O 1C "T<ek>l7. l$˯Ǻ+|e15 Oc:~mv5X$Ra9GBP./#H452;*!0Ok8<S3AA INIU%D&%2$tWs~KU aj,4NCsHa!]БB_IJ$ICy :w R]a_y V+./x)vw`5I;ܡuS_"0A& S*|!YQwm ^I*{pA0sT\#h |K_DT^:GÁrD< Hp bk:2a[eaXRLuFw]Š Gޱ"ӓag H^}/o*i) jׄ>˿bD-s/g]\WßG@x7 %H.Z)Wr-xrT8m0>r"C.V=\+2L NH@^_e"v%}IЭ7iTx[cLz&1;#KKU+Ȉ_d]>FbFWY95{a& YӝQ %o5VU4k*@r ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && ifconfig netboot >/dev/null 2>&1; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs feed_random install_sets finish_up  . .. bin dev etc mntmnt2sbin tmp usrvarinstbin.profile@= install.mdupgradeinstall  install.subELFa(4"4 (iiiiiSS==88pTTTۣeiiiOpenBSD -L0! MP@ -8AL4@ ` \p+  0/R R  /R0S000) \' P00<Q  A \ 00 W U <00S Pػ <, h0-L` 0 R   1S0B@Ct1P @D0t0x(<0< 0 R-L @ R0  0S00꼹H, 3 -x@x @0LS ``00T0H 0S 800S$0h|D,`$  p-L &0P `P dp&P q@POU8 & (4&PP &\d$T\Ti -PLU`p 0S /t0PPQ @Q qP P0 f&iidT\Td Pp-L@P`D ph$ -8 L@,9wPH   edAYY -LlM`KϟP<0: S@  S ,Ჽ@ppPP" @P`T#00D S 00N S0a>C"0@ @00@0 0 S (K@ tzj`T@U 0Dl 4h 0$c 0^$ZHZpcZtZZ -LM4 0 @00 ,K4$, pQ 0SgSQ kQL MbQ: gQB 001GQ< >Q-T0`0& 0"S V f7RF 0FSS4UWU 0 40XZ-* 0U0 4000@ P`BQ`T00# (K0 `KQ `mQ sQMQ 0 `Y0 40<0 כ0 40 қ0TZ[\[,[Z -D@D0L <=% 0(/0  /di[[Vq -;L M p 0 `T P , 0l `+GpT D0@2S2<D4DD(DDDDȑDDDxDD@DDD4DDDDDDDDDDĐDDDDDTDD DpPDHt:t*0S\UL:K 1D @Q00* *pɟ*0@s 0  0dSKAl oZL @] I0S<00S)0SڐL)ypX : 1p2 PXl2S 89,ɟ 0n)9WP \ \P1 &K ᚿpXr 5eP (ȟ0 @S Qc&ڔL 0pVǏV OL ;|p 0OPU`VD 2a,H0SA 0S0k'Q kQʊ :0007崧0ǟS7 R5@P 0!bn@kQʆ kQʄ 00LX Xp㿜\3XY00S 0060 AP06h60 c@P0606l0 AP0<6580+JP0550+JP05P |50 @P0H5uD,0HP00%0@e X4H0 @P0,5S$0 s4 4  IT FD4 K4 h"0SP P4 ΙL/P LxPX ݜp 4 R_LxPKPP L#$h"  nPL0h2 UIJdR?XPd2 BJ` mPr00hr`dRmP mPL#0僙U U0S"Ÿ0@ #"pr2L#00PǛ ᩛ0/m XL'>KTP 0S}H0S<p2( R 7B0SV;K' 0m0@0S, R( #]U[I倛Pr;0qL嗙z#L#qX 0 @ @  Pv10|Px$10wLX!41TlHK<p 4L P5 DL# @L#<L 0mlL#0˘L#+L#'i\+@l\l]Ȭ]8l4ll\\\8 0BP!0104Ÿ,&6 ,00C0  B 4@&(p 0S 4@80!@r8 \8 RP8K`P` 0l$&?=n @ < 06n,&0&@@K02 ,0 2$&?l0pP` 5 P0 @_i00: S 4(0Q(0Ugl d, ) (Ko]PD 480<, p 4@80  @^Y0l^^^ -a,6L R!x  P*c@P ,6& 0T?*0S< 0S RPQ0e Q0<]P 0S1] Q221,&6 ],&H0 0C0,&101 0 0C 0  嚖 _Y -QMLMO0|oP  PK@,0 J\/0@T?P@H0Aϟ0Q: P: PP0S RC.帯 0@0=>  @0A O6F& -_@)np`vig&p R07`Y$ 044| 57 g2 WV1Q5 q@l7g @`D.g-͟0U S 00 80eS05  gPt 0D e gX0S5C %BYࠃ@E00 ؍ 0c0bP 5 f % b  f P u $FDfe<`f< tL<A|<"3tK 0C8t 4 D , uP20-S) [РBKAL L P0 0$RpB.K0 B Bxpppp~0H50<$唋p $压ihiȬii+lhLiiti -LM@pP4 PP 0S nS6 =]`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPr00 ,K, ?R0S@p @ `师0 p00V0"S 0(婈$P 0 0塈L/Hjdjjj,j -LM`PP( @(K,pK 0 g(0@S N$K' -LM0S S SL0 0@0(( Kh0hs|j| -LM0S S SL0 0@0(( Kh0hsj| -0L iidj -Lp,P`ET@P| 0 `$00$ (0@ -L`PVp$T@P[  0}p0  [mTN j -MLM[Pa `P LE@ SP $@TY  h1\P P@ $@TYK(PEPE)0pP00S0#3P PPPUp V V@唐PK 00 0iMVT   $@T(Kn`k k$ks| -L0 K M, 8$0@H @0 000 ?Pe bP@@  H$p#00#< 8 4 D 0a0@SM$TTTTTTTTTTTTTTT 0STcBd[@ P R r@P00SxRbRbRPP,`pWP 0  s00 2U" 0@ 0SZP $@T 0KLLPP4B80P  ! < 10D0 80080 4 H!Rps1 pR18 040DR0Q  R`Z00R00S< R 10S00S41AP P ,@P@@ 0KH<0S 00S  00 $0SVPHPA0pK  0KrP  lP`Fv@TLdU(Ks4kȬ+rLkDkPk+hk؜s inlk -0L cidk -LMP@`0p8h [U@ 0S T ړ 0(({蜹kd p-LP@d`P P@*p P@X@ꌆ -2L`M2\Ÿ\[\ @ll2` y$P 0 06yL/Hjdjjj,j -LM`PkP( @(K,pK 0 g(0@S ?$Ku{ -$0L0S ZEdTtlt -Lp0L0p3 P``0@@ PPkP P sP@ aP P ႗ph00STTT.DO< ,Iit,WgttȬ t -Lxl@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* vx rxvv -LMp@`  $KᏙP0S 0S $0 UR#U 0Nxv -0L idv -MLMp0,0 /ޖpI B0@3S3 p@lH0 T> >~> > .唖p. 0b0CS/[>KQ0C 0C Ap KAzPD?@T 6: S8  S ĘanK`F`F@ KpW@ܭP  KP @TDP w= =(=a\= x=t= l= U,=.T=P=L=|.8= 4C<X.D>=:<,5< .<<,< << < X< << < (< |ʋ  0I &R06 \4VD'D7U v@@^6 %WU  & 僐 b I FF0F@$F@J#&R 036 5%:W!vW pU71C0eP ?F71C0`PF@0F6&C#00R* FP Q F 6 S 6 6S< 6 AF6 S<^:;AFP  0&"1. `` cc  &  &6 R R  &AcF60#r0P`6 1 H$0@T~ ^ P *&R6pp 1H$P`P`V  t u3 R0S3 R  FP3T@1t K@ĕVȨP  XIP p *p R00Y0S 0rS Z ``? V5  U @ 7IP0@X S HP HP 0t Q  Yx^ \ P Q T e/P 00B0R SW 00B0R SQRM  00B SQG `RIpRGqaPB ? R.R<t300 Q &R&  5S 5SMKx Npp u8PU 20 @  V Rt `E6q0#0P` AtPit+xȬyLt0yxx p{$X{(,x0x48xx<@8x,xHl]{ x{z/@{\8]edAyLy${{x|d||} }} }(}@}L}`}h}idxLxD}}XTgfffP}Pt|{xxxxApy}Zyypzzzzd{Dz ztp}L{H|{YY,]{ 0UP &P v S{V&\s6 S F &Ts 6!&a 0 . `& @P 0 2" p0! lJ ^ 2 6S22S \< D2^0B0 D& R 0@, & l& lD6 `@P p! 01J@@T@!^4: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  +6R 00 T@̵6S%%R006  P0xc5 0S 05 Q5 6 % &6H嫵 QXQdl堵Qx%5嗵Q6S%匵劵TDP倵Q{ $PU , 0RS(K r (r]K@@d5E K@@5 E i#>pP9 &R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&p  6PX&  \ 6S X*cQPCP60U&00Q* ^ 000S 0@6 # 06U0$!4060 !40 4 06 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`X(00ST h8 4  (0p8 [NKR@D@D6([E '0S66 { &Sp 6P &}EGX 09Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T SC&U0& U 0A Ah 68&BFP [NK@D@D6p+DGP cs00 5 % \6 S(+h 5S,+` 5S0,X %?RB5( c02?  5 % 7 Q`<Ps 5P n @ S%<T E I @ 6S FpPC&p<Q &Rp5F0%p%r(=R66  Qk T Ujd%ppp |0zp vpsp0oplpipTq 0ap ]p r&0Sp&r LpA YA6(~0#0P`6 S ^ʠ 6p0p5o+pp %prp'D -LM00PKpa@ 00p `KP2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(CP0 0( CP 0`KKPӐ$K 㼥P@$0 R 00(@< ᾐ$幐L9}~ą P-L oot -LM( :CP( (( Q5 (Ki`P0 0S- =|C@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0ShCP0$ 0 Q (Q K( SCP($00JCP($00ACP($0 08CP($00~,CPt .($0$0TCP@ !($0(0b{}Ć̆Ԇ 0-LM 0 P`寱X0Q @0D0 奱 Q}P@  8h蘱܆}$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $",  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P 0 0 $ -LM0@S 0 K0"0H0 00 K0" H0 0`t - LHPpot ( - LHPpnt 4 -LM K00"HPpt@ -LEhհ0$ϰL p-L MP@`0KP U0S00Kp ZpT p-L MP@`0KP 90S00Kp >p\ -0LS@ h?p 0 << 0 -@LU/O0 0 -@LU≭0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P I@P  0SK0 Q0zC$u>  0 ^K0p4'> W ՟ӟ pG\W K˟Kɟ, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$> @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp ;X @ R @; 8  45 02  .st咬@t$+\!"0 04 t  2pPFlPBhP>dP:`P6X:i|Ќqp݉܉$4\%5aٌ%T5EetЉԈ͋(9 }%]݋܋̋,Ĉň-$4`،$U4Dduщ8T`p8H -0L cid -#L`M#0㘣p , 0x0 0S`pAΨP]=UH#嬇p a0@SVVVVVV|V`0`K1`x ` (Pxt KPCP4Kx ICPXqVP?> *Q-L QP!00P,v>P`V'=,$($0St$Kl0ST`h 8PT`P8P@`8`vrdADPedA0sd 0 p-0008L`@P0S pd v8P PUDD m8Pp(pV`WEVgdedA0 p-L`@P}P e/P 0 1V  phjp ]똵 -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SX 0KPl08#HP P0@@4Pa 4B0Q0, @P 0S# , 0S% ,!10!R ,1 RX, 00CS0W, 0 0(K h1,!` 0S Ƞ,Ƞ,8 0 00C3 0 01 0 0 0 00CN. 0P ("8 Ƞ @,HP``pP00@p@P,0`a 0p, (Ko, (KoȵDv - LM,0 3 _ Rp3 !hWd 0 RT 0 MBCD@EPF`Gp@ A0$ P@ P`p= 0 X02 R00CS00  0( ", 0 8 4 G<PP@ 0 T7B0S007"0002"000-PB0S00&{2~T`(@>TV;@TN1 RJ Df@0DS>e/P,`PI N0@PD0@08 D1 R 1Q0DS$@ e/P+/@P @ 00 0T  tp@ l[ \[ȹvȬ+h `d820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  ԛȺ -LM@ p^ 0P`PBT 0@帛 i貛(' -LM, (0 @壛 0p-)t 0喛`P 0p勛,K 0 XXX 傛8S P 0< 8PS$K8HT`  -l@LP20p pppp qPUC 0C`0A 1 A @TA R 0SSr 0P`@@0@0Q a f $0p`p@ p@ pQ  /,  11(x p1v X1l~p ``@PZ (1Hrd0S* 1(i[P0@`@w_K`0@a0@TḀpr?K 0S@ @0P `a K !_0B 0SKe/+S 08. 8giPdTp0T -L*MgKJ0J e/ ,0 0: P P P ; KAA  R PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K e/K y:K@0@: J :   ᦛP $@P |$PuQUQ 0ApS4LdTH8(xHC 0`p: J@P 0STHK@ @H qdp 4܃PP  0 ሃ    Ke/pPA ?P< NKKAe/ 37 RR .x@      P  ǟ, 0R(KT4 47 Re , JP7ǟ e/NNK@D e/K e/e/K~ x l wUR l@Pl  0FG `@0p`p @TP0,,@ P0 0  0nU @@ 0 c5 R  [ ]WU $0N YK0 $[E PB > =: 7 3ğ$00s03S0勅' Ke/P NNK@De/ Ke/ e/K B ? <1Y@B P K 4 NP0s0 !40 @_ 0n m4 0K0, 0 K+P_s ,04  ,0 `0WPV(Kvv$vTvmDp 0-0L@T 500S ͖Pڼ 0P0# ;;S 0@ ḖPp0 @ L0P@TPs0D >4 03@0vvvxv 0-T0L?M0S@00S ?KK0P@D?+ざP 0K0vvv -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0"!Q8pPď AP01@P1+r0S! r0S r0ESPr0 SD{3 $1 xr0S tr0S pr0S  0@TT0 0 00TSPP T0 L3Lr|00t 3 l00Q PL63813vvvv8dvx -t0 0LSd0 \@ 0  R@P r$ G3vvv,-0 CR 0R0 S;00 p-43LM0S 3 3 330S 30S20S 20S  B2 R0S p2B*AP 0: SH0D@@h2@\20SP20S D2P}18@$2PK æ10S 10SA31 1 0Sx1 p1 RT 1 0SP1 P1 !000<1 RD 410S (1(0S V 0 1PU  1@ 0~0P `P 0 l0 B00 @00@X0  080] 0 Kpvv,x`Lv x0v|xvU p-LMP K`@CPlJ0P? T C ??T  CCh@}CzCL@ p?n? 0P ?Kpvĺ -L M0U@pS? 5 005 5 5 5 5 4 Qdt\TT$4@  $Pp0$1h4pG 4Q !AT2   Q @ Kl2P Q   0opqo0S  2 2P1  1X $2 21 2dPX L L D L ?+RX1 R1 1T1 AR;;S1 1* X P?+d1 X1 4X@1@T  ?D1@1@" !?;`00D@00p Vp ?lFʴ0 + X0 0?;0,0 X0 Kvxxvv(0LXtv m @v p-LMM@K <P=o#x0L 0P1od#l0X30SL30S @30S434@P D03@yPY tPT 20SP SN S" +0 %0#02NK0@D0CS0dblR@D0000|W0Pl@P8,[R <[SYR SR sR yR  Pe//1/NK@DpQ@D//0PP 1 1@@/x1  4<[S` PL/7 P8P($Q0S 0>00 x0P0 0 @0 0@@\//Kpv`U4L(vvdx,T| L<\lJv,v-0 CR 0R0 Sh00 -L%MMLEK@0@8%,0 < Pp0[/S !nK`F`F0ZD/S/0000Kp+gKP<%m0$$/#0: S .q%PP %P\40S M%P %\KΎK(PEH0PE H0,0 !`P 0S40SB :K<5@/Q  K<P .K @K1P`(6|#0S p30S  h0R,l0R830S ,\0R ,`0 ,h0Rʩ,l0R&PYPnK A #Pg0S20S& K91P!p"0S d20S  h0R l0R,\0R ,`0 m h0Rh l0Rd0S 1#1 00 R!0 I2P4ڠ<S S 0CSFP$#!(  .P, l0!(=6.#(V@P,`K  ,kc  0S 00S 00S  l0 (P d " (KD ,Lt<4x,$ -LMS 0,0 @Y`4$P^PV0,P#0 00R@0  $PZb}Xp,K< 8 P4#0S0,0  &P Y %P"0 SS SR P, Sl0"-;P,K> "h"0S , P. "n0S S 0<K1 !000@0P,K R0S 10S 10S  3d1  24 K,P 0S 10S 10S  0 U4KQPPQPP`!PB V <004X H00S!(Kx<4Tx, -bMLMP00S %P ;P ,00<Pb K @@ K4x -LM , 3S 0,Q, 0 SPWhPTp`P O, PPU@$P= P:W0S9 D,P p3S P 0!0# @ 1S#Wh0S X,pPEUH Oe,, wx|xx} -L M 0(K *P1`E 0 p @4 @0P 00p3P_PT+MV p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SP }~P`K 0Ui0S iKp蔻 -LTMpGPa=0`P`VUTSd@`@a pPK 0@<0PpK0@K* 0K-0 CR 0R0 S00 -LlMDŸ@Ÿ^ \P`p^q 1ip28KX*a=0  RQTSAAa  0@xKp1PxK0C@t1P[ 0P8 KP P8100CS (1 ,8,$8 #4a=0 xKh00S y V0 0BSRh  h00S [ 8@$K ,04 p-4L0S$1`@ PP>000-S 00 00 00S  phB 0P0P! P P00:U0S ll00:SLQ10 0 $(0z?Pp+Ȭd  P00x 0P-L 0S pPАРP(x,`P=@P  P|f2@P0VPPS0    Up 0S<xxP| -L g݊d -L gӊd -LlM@P㐀K/pJc@X`0@zP W0pSP  P 0: S 0( CVp$K@ -LM K` 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@ἫPP00S0#3 kVPp0@ 00S S00 0P@80     B@0 0 C8蔻 -LM8 8 4 /㷉/P800O0P|op , 00@JSrrrrrrrrrrrrrrrrrrrqrrrrqqrrPrr\r(qhrrrrrrrrtrrrrrrrrrr|pprpprPrr qrrqrtp0qDqPqXqpqPqxqqqrqp^NP 040 = ? = 0-S0S, n 0,0 h= 0m= ph-00|-Px=  @=cPYW H-00?<= -00-7 =0F,0 00=< Z  @P \Gp< I00< 00 < < x 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\ppx,=x0x -L@p  Q.SW}p 0S0C +WP `Pm 0##!>C=S0Hcp0H S^,ę,,T,$,ܘ 0 <#d !>Cv.B B 0@<#!>C0   0##@!.CDR  k?C0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0pq -pPL 0Sd&/~`P00  S,UXB .UQ  a w PR00EU0@PS ZV 0SP00MR CR cR mR00000X5 $0` Rr9 0S P 000X% 0S" P  #000  0R  0R 0p \0P P0@@@@, <Xtxx 0-@PLD 0SA Q0SrP4 0#S \S0#S@᥹P@   # :8@$| p0Q0 R 0S  #P 00@ 00  0x=0 0-@PLD 0SA Q0S P4 0#S \S0#S@#P@  b # 7@ጹ|p0Q0 R 0S  P 00@ 00 = 0x=T -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0 c -h LM0S T`p0PU 0 P` V$Kx -LM0S. 0p0`C 0PS1S x `F0S0S  0pGw ~0 (Kxxxx -L@`Tp# PU 0S 0S0S 0 PS 000 0HFx= -` L0S `Lp0PU p@-+TP` V y' -0LpW- 00S)00S% S# S! ; 0`@T h0S 0S 0R 0@S 00i y(  -(1LM0S`@ 10S 0/S BKA{_P` ! 0@0Q P00P  000p0 d0@傜PP T 01,0 0 0@嶡000$Kxxx -L@L0S < @00_P x  -@@L0S 0HP x=P -@@L0S 01P x= -@@L0S 0Pl y -@@L0S 0PU  y  -L M, P@`T 4 00 0 qP 0S 0S0 S $@P ,śP P `4 K  080 0 0@(Ko (Kx= -0L@pT` [QP 0SW u@P@00 0` 00@x=L -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 P2 0@ 000 0 xP 00 P oP@00S0x@0SP +0 080( TQ(Kxxl -0L:P -1L@`Tp1 Q@@T PPP' ḚP  @P ᬚP ᧚P @0 00@$y ( -x0L@`TPp X AT DP  P:0E0@y -1L@`T_ 10S] 10SY; 0h P @U, L0S 0S 0R 0@PS  ! 0  S;00 S00000CS000SQPP P t0+0 00 @L00040 00P2(a y(  P -MLM1@Tw pP!@T; nK`F⼑`F0S!0  0S0S 1F|!  iP  #FH!^FP @T a= 0R0S:41`P% @ 0~Q  P a=0l0 00`E\ EL < (KyGyp 0-@LPU 0dPld0d@` :iP0PE08 0\0yGH@0y@ 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP P p-L`\ P0  @P@E"600pphN  Qp-LPY1S0S  D `P  Q@2TppP -L$M P 0'e,78 `0`0gSxS  |( @PT< Y pǏWX<@PP; 0@0 0 d0@000C Sl;A0,K ,0P0` SA0"S0A0U@tsVUVU 0f,0 @=l P 00000 0S S T<00xQC T4 P48<% ,P4@% pWXW  P*0S YP@ V/ 08s808@  /00@8 0K0C0S dd8d$ 0<S 0KS LS  d  $0  da4  | a=0 Qa- 1@a=0a= 08 0H1p30SJ0BPt -830(1$30SB,Pl 2b 0@ 2@@4^3^$*1^t:C6^ :K0NSmSt"`0:0 =0TC 0 /SP2) p0C `` @t4^  2** R @ 40@44!0`0R2^x!`0 :0 t1 GTh1   p0` ;@Qa=`00@ Q b͊K^1    `"a=0PHp D ` <@0S@pb0 @P  0HK``(KHp ldh0,4(  Q0-LP0S  P P  C@$T0 00P -LMpP# Q3  `0C`0K0C0Sd@"0@ "0@  d2   l2 tt2  |Ia=0 BQa- 1@a=0a͊b 0[  08P 0F5^9 1^ 2^.K0NS*1  *px1 )p0C CTQa=0`b 0 @Q K^1    *0< <0/S 0 ) p0C  Pa=0`@ <0S@pb-0 @ T0   0/S  00C0( dh,0 -LP4P -LP0P -騠娀Lp PP`P  0hdd T000CSH 0pu@Pxx --LP0M0 |0  t00S h@0S \0* P͔00D0D 4应 $ 㿔K(,xd` --LM(@ P  Ky -0- LP0M0 0  0P0S @0S |0 p劔00d0d TwH Uo8 $k tK0(,xd`` -D0L @R ,bP  嬕0 0 y 0-L@PpۖlPP \ԖX0P • <00S , K00؜y`y<(_M 0P Q0A000  B@ Ѝ 0-P`L p 0D  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S -L NzqDd -l1LM0l  y 0D8$  YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pPPp e @ 1Q0^l0  L00@ @Ll4L@T $%(KtL4@ -|0LM0 K 㢠@PPD0@ @W@G0 MKLl-0 CR 0R0 S䉓00 0-LM@P0>0 !PAL));L 06L 1LPhQ(LUTPE@H00S< K0h( K0h0H@  -@L0 0Q 0 $0Q0 $ hK -L@Q񟗤|x$LxLWQ6 (08@HPX`hYWUS0SO #SHFDB@><:864;0Q xtKlhd|KLT!PhZ=HX=0 $#$(,"(hhK Q Q  C=0STKhC <8#"h;K(4Pp$4\$HXl|$Hh,8H\p -3LM,MQ (K@ 30S  ld K(@T*GT IK@3(@D8#0 K(@*8K(HJK0#(@Db*)0"* 20S "*P% `V"4@P0 06 L2 0T 0("z KK(@(A* K*(@1 Ra 10S] 1K@1@P 0p` 06(J@P/1)K0 B0/0z9K00C/0=/0l/01/0 `/ 0 %K0L/0S)K0 B0/K 80  K(@ *JK(@D (K HxTP,Y@PHyPy8y@yd -@LT  p3p3znT -L$M@H <KL %H001@0 0T 070  L $(@PH @e0SD@ &0 S6 0 S pO 0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P @@$4 pWş` P`^`0S%0S0S*0#|5 l R0 T,0 0 B0 00 0406  pL` 04!48#8D:IH 6I40S /0B/@P0 t"IZlID0dD C0RX5I;T4p0 S A$ I@PR I HPD` T#*0T@:D Q* Q:\30  0DP010UPL`LD lH H\@`Q p1:Q2 Q(HP@U@pA*A 0@$4,<4("4H! HPEU pGlWQ "0S3 㲏0 @R !@0PRpCV 0U T8 ᕦP 0{H00@pc@'U` PmH@*A 0@$4,<4("4[H! pUHPUh pG WdLHH!0S, ]4?H@p(;H0@PD Cpb@pG@p @@P^`0000S  ;C00  (KLT@B8yHyPy@yyP$y y y 4TXlt  -MLMR`p2pp ("(082800310 01!00010S 8K#80@,̠<Ȍ8(2Ȍ18.̌$< ,K, (0 41@PJ 10  P8#8 A$#$ :`00 /P00S` R@IJK$@D0@D0 `T H00PT   000$K yxyyL|hH%y -L78@:28@ 0-L,8PS0 R 00S* =00S0@  0;@P@\0t X00 c0BQ T T0 0 S@  7P0xT4y@y@B(yL@ -L@eM0   )0K4@ *@KZ(]P P  _p<|0lDK 1   /D0@3S*<<<<<$<<<<<<<|<<<<<<<<<<<<`<<`<<@<<0<1 $D ;R 0}0 ;! 0@00090: PW00d 00@KP P ,0 0<IPʟ@P 00?xP*:lsP  :3xP P h hJ 0#xP00X: *K  P g,  1夊D R k 0I00000 ]00z0 0w00t9 偊D |9RG 0lˌ 0mD )KR4 0$ 0]D H R0|(H0Kyp0<11 >D 8R 0|h(!p\8 0hSHXg s0@ 0@ 08 㖿Nw@a 00@P7`PP  0fOK00 ,qh7@6 0ST   D#F0S47 0080 P F x60! 0 Q:+<60  6 60<2S<&000 FP ,50000 0P BPD'E0@ 5 40K0 T5 40K   50<2S\%;0000U B>BS3  % 4E 40K00@000 ' 0)[R00@ 0  0 00  0400T40 ! 40<2S@K(P #K K0 KPRPtNF30 3@ *0K@@P030 X3@ )0K@0Pp30 3 00K P}BP@KP#<0K@P Po< 80Rd#80KPPTa0;CS08XTb,CP$#0PP 3QՀ"q"ۘ"`R0S@ 0D D@p a0 pA0 02qbPPHpKPKL`KD0 @0`0 \@ 2 X0 0    `K0"PT TK8 0z@P40S ~E:  P0  @ P R ,0S:V$h|pX y+L{Gz? 8,yAT?ly!4yȬ.AhH@TxX 4TpXy ( l?'@ TO -<<0SL`p@V( = T 001`P,*X# L0S'0S 0 T$0/S \0S /S   0S /S  \ 0S* 0` 0S3P)t" - @L R000#) -LM )AL0&`S B0 P!09 `0004 L0S, |1` t1&  Pp(0@S, , ,0 0!U A, 00C0S 0000V q0p    , 00 0S Z1014q0, p 000t"|y)) M-L SQ7JKII  3,p&0BO?  D80 hSRQ Xp<  0R0 80 S p tB, 0R(K| BnK`F`F@0 040($P@b&1C1/)1p@Y XP Pq\&T 21COP  pǏ R380S00  BnK`F`F@00 $0PP) P 6 #1@p$Q  $  R  $41 ~ x;PGvlV@;dt`Pp (($0P`it"|)x  -L0P"Sn@400!0002  0b1  44d1 RPe 1P1YKAh2@000 00] |&t&l|& dy&\N Ts&Lp&zDm&84041(a]&(?K P j i)Ȭ`@),)t"(4H)4)P)) H<"P))))))@D)L)+`ypX:8)8*X)xX wn\ -@L`pPXPU#!1S<000!0,!,0PU0,0 @W gP ,0PU0,0T!0>D!0 S00EYP7 @Q 001 R 0S R0S0 0S 0 0 S00ڄn x0 R l%\p XPHH D)4)|)()@)8| - LTM6S `R0,2$0T9(&Rژy,1 01`9(&R,6T K0CD0C4 4 < @$01 $0Y44Kh$ W*(0* RWQUPt60CO fN^KPEPE 4I( K@(4(0 g0d4 `D 0\4 XD V XpX `@0  ( ,0  Ti rk  m`ß  @$P  PpXBn, 0R(K"72V@(0,@ P|(~BnK`F`F@0 00Bv 6t( D0SkV(0EOo 0 5" @(0,@ R ` PkG(IcU rs   ~pE P 0!000p0C0@0 @$P0PX[{40$ P/  0:P ec P ! 0  0p0CX0)I P||=xNi)< D"L"0C It"!0СP`(0K\ XP T` 0AS<WWWWWW!0QMt R PP R 0S0S00  0P @`R*$K&   0h 0@ 0 P0SR@0 R*AL4 Q)`U))<"< xLl -QLp `<*P@@(*T` |X -LzMf0,0 KPHP00UQ     6Yf(pQ ,6& } P ,6 0&s &˻&ǻ Kû( 0R01K1Kl1Kf   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p :*JKJH$ 0 ,6 1RK K P$0Sh# 0 &+PM0S{ 0# 2&P`1!0  1 +d3 0ASdZZ]]]Z ?,1   1pG1[0S1 S,6!0  ,6!  iK ?P l2&1-001&LJP,B H4 iKP 1& 00&ᤇPA{ s"mo,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1R) 0`S KP h, 0R(K! |@1! 0 w000SL_HIit"),)<)L(4X)` 00 yyy0y0y -LmP  Q-L@ ްP T P-L LP  0-/LPM@P 00+8/00,+ +00 p-LlM/PL@P KB=P0: S Kp0`rS@; Ẇ P0-L@P0 R 0 R 0(0h;8t0 R0h0lx( H0 R <0<m(808i(L0c(yyyi --LM0 0 L --LM0 0 K --LM0 0 K -L@I h -LQMH0@K0<PP`pK<<P0: S V@@ S00S F`P<P$KDP T P`0 R000 ZK@w<P h1: S 8'(('y@L,< --LM0 0 從ALd@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% t"p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0t" -T L@HP4T I f edAl -L`p@gPP  Ua0B0S U00@ S0a>C"PP R R4144!!0 00B S c. P 00C %`f;P0Fx3 @O&6F n  P' @06   )?P00`C ذ P-L@ 00 R$hk&@) -LM0 Z3 ?᪷3s ;@P (K謓k  `#3R 0X 0@cX, 40 弴"8 @0E8  OƉ 6F&V婴3 ($6壴 0( ૴"00ᥴ80S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+܃P 0 R04 0 / d0\%d0L `P@ 0R@X  aA% T8))H"X)t"SP"T",)h$4 -,LkM0 '@,0 7@'0PKAP6 ` :P6: S 0WPU 뼖P)0S 6 Rr 0|SPX%0Sr t&tPpvp0@P PPPP宮 㫮0SM PK P(0&&<0000PFU0S 0Se.K B BPT, 0R4(Kx5x@l5 RdU.3S0 ( @@%@Q$e $R3  !4P0S m$4 RxT$T0S|lF p$0S DP, 6S!@Ƒ` 6S3Ɠ,6@ \   0P VS`zP ` 00B10@3P TPCd3P H3P ,3P 6cS00 ,20!6 S 2" ثBӫ0"SZ PX %# F t6$hdP@6嬻L"L2?뻹g@@*1 Ra^p1OZP @0S@@0@S H6<4"D0# \P @0T!1##e1d#P#HC@#0$@# 1R  uiP")<),H"@)L)x))X)T"0))8),)t")P)p`h))())D"8"L"@"L,`?Hd < |@-0 @BTx00 Q< 1P 0<000  ))4) -L;@1@ 0-LMMpPANK@D0@D\ 0 Ҵ 80 ǻ 0RK0 Ci`*  -L@MR@  V0 0  $(K!PU1  00C0S  W0S 1< dK J0PX,0K 0d0 h T P @1TK `0 \ X T` Pp 0 dK:"0V0/ h ?00bh h  a0YV$ 0 `0 0 \` Xp dKx0 Eh P`  E0h R/  E:\`KW W 00@y)lJ -L=d+ -40L0S$00S  0 L282 0-L M@P 00S00S 0 QP K<] RP P *@KD ᒗ80 0QK#p$5 K0L282\,P2<2it, -L M K,0 AP\$0`Sp 0X000 P00RPPU@  S N  @A0SS c020 Kz, p-L MK,` 0 AP\0S M0V000 P00 R0S P0   PBL0S S c020Kpz, -0L(M08@K( p d0 \偯P0S@o( 80 000$  K,2P2<26i(,0, -L M0p$0 00|t0$K @.\$0PS` 840  0 . K,2,,0- -`L MPp@Kp P$卖1 @P\ 0S 0,0 $P#K/P2(-<2i 4- -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X pPPJY t H0 0D 0s 0D0 V Y ^P8Z P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S '0PP0,0 @cT d@(Kht@-X-t- -QL(M5K ! ܧ00 0K  # eP D@0@ 50K̕00 (50K0\PnK/P2<2i - -QLM@ K 㯧 xPP K&@K4 ៕(0 1pC K-P2<2i- -|0L0@S h ? R00S L00  ϥ,0T, @00 0 0 002@242/y -\1LKMp@DK QZ0W@0 < /|P RoK`F!KAP /m000@pD K$0KpP  0Y$0 R  Q{0S 00S Q  R ("(04"40$] Kzypc--0 CR 0R0 S]00 Q-L X6 p`@ -0CU3@% R 0S,,\0SR00ӑR00Hӑ\@ 4 R @0 S0S蔻h  -@RLP 0S 0 TC 1@0S<p `(<\0C3@ R 0S,x ,~\0So|u\@ l R @0 S0S400S(>hT>hZ\--  p-LM*@KxPx` Gh @ڬpP  :0 01K̬p Kp/<2i -i - -L M K0, @Y$0 x\p  0806@K|P`x  `d @嗬pL  @rKᎬp0 K(z-$z/<2i -i - -LM"@K ܥTT0 L@mp [Q"0[S "0[ S K/<2i . . -LM0@KQ ᶥ!Ქ  P 宓0 @P Q- 0`p@P0S {0  v 0S-|-[0lS v P|[PU@K<+P2<2i,.@.T.\.d.p..  -81LM@8Kq`P  VV@! V/u8P  0㡳p@ 'PK 0P !400`wPh@P 0 y aeP  >$Kz.- p-L M.@K `P0 @啫p'  00SA[T[0K aX0SK XT001K,0H mp4^Kp/<2i -$z.(zi - -L M K@,0 0X$`\p  0 0@0P0S phϤP\0@Px`h@lP @äP,0@Pp@tP|` K@B.42./d2 // / p-x0LP5 @O T 10S T pZZh<vX7x0v</S`RV( ?@Ƈ묪d0SB0S 0B00S  Z5P "X00SL  8 Zx07D ph p/ /(/4/H/B@/P/\/`// ->ML@M|10ld@K PۣL ؑ 8kpP 0S=:>[KD@K$PE@PE >k ὣ ,P 0` 帑 KP \40S >KK$@D`@@DPq*0tS  XYP|@40HUZ<M$KH21<2P2i 0i|00D0 L0P0 -LPp`@P0 S@ZP 0S@ 0-@PL0 p0 }0yX0 -L`Ld00XoTp@Pp 4d 00 0  2 ,2t000 0-@PL0 p0 C0L&0 p-PPL@0S000p d00X L'<8@P`RPPPp2,200(10 -@pL`@1PYP@T* p-L$M@`P x <@K$ dP¢` ῐT RP@ 4` IP$:KpX1<2P2i$@+i$T+ -Lp V`PP h#d p0 @80 0P(@P|1D)1L/ -L@rD008 ,$00,21100 -L@UD008 ,s$00,21$20`2 p-L$MUPP& ˮ`@ C0P Q `Ὦ@T ѧBOK`4 3 0 |çt@K   %H " H嵧F@K    姧\@K    噧@K   勧@K $ l  t}pwp3`v`3   2"RS XZ 2SP=$$NW @[H T KNZ[Q 4Q.@K 㶠X7LPK mP0 4 4KK^rOK| ᠠ{K h,( ᙎ4 H+P[P Q[U$ @2+dVZ 01SW]K-K0  0S X3 Xph>,AT 1S1S1S(Q$!000C S0:S Q $ )WP$`T 0S,+,1VQV@P T "R0S x@0S,PK 2S*0S' ,0  {0 s0 l0dQh_L"Rd0S`2S |[`1P|!A t0l \P01S H10S  U|0 10S  xU00S 00S `p@Y(K/<2P2i i8i4iiiii$2 222i|2B23 33$3(3432L/@3H3p2T3`3p3333i 3L282 -ML MPDDpC<5< 850%,5Q$6 5Q15Q ,50S 6 KBr OK.ᅛ` ႉK,2L PB01S ,42Q 42M 42I 42E 42A 42@= 429 Z 5 10ST OK.D\ AK(1 p͡P01S: T7,"(2 4"02 / 3@ P K0 UTP|   K0 UTPf   g$K<2pX87H2P2"i D7X7%i `7t7Ii 777777777yQi 88(8080 0-LM 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K B@ Bp0RX C@0 R0 R ` 0BO? l 姃@P 0P 0@kX B00^$ 0@@0jDz2 X3343TA -0L PB idA p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@mBQpp0R0 SwBꔻt03  -pL@P`nP`  p00pT@P a@Tl0 P @ \P@0㕓#PU`pW*d3Ad bȬLzh3 0-LM@P  K0K PP}p (00S K0d3A -L MP@ `$K 0PP\p $.pP 0 PPOp ,00S   Kd3A @0P0 R0 RP: -L,bM00  Cr r r07~0 Cr P .~1 @,K@<P3,PU 0 @  0 R% PUQ EPE <14101 R Q @00@S,^<(KJ00PY& }P @ T0 Rq P` \0@>AP 0004峹 $容嫹zzzCCC|1 -p-M L M0` R P  0 R 0RKp  \pT @ANK@D@D08 尊 $zizdCTB -LM0 0PT0<0@0D0Rp0!K800 S80[T<`p0Q80<`@pA(K(K<` 0D81 PHL P0@ =9@HL =CP00 R0 w40S)`p<`@p90Ϡ Al $!B30b ` 0<`@p@DTQ 0H` UX0 R0T0 `p<`@p`p<`@p\BC?BzD@BCDz -Lp`PW PPJh㘂@PV h ?` [D`P/ `冂PL z0Vd0PPPPPPP$0 ( (0S<0 0P000 P0000/ 0S0@ 0m0 |0dh PX |0$8 w|u|:|BDpB`D4DDD -@PL 0S@R 80PI.D0PdS J 0 DITEdE -L,M`@VPp 0S0((H0  vpH 10@<S<0&################## &#&##########################&##%#%######% -p'0cP1@ QP'W0S7  0S '0S  )K :G )C\7P 0Sq PZPL 0L <0 0D 4KP0Sz&0TP@ P"P㸖4KPU  `T0SH40KP Q ʶ  Rk 8&0S0<<&000SU&((\(\( 6 +%00'%00#00 %00%00 H lP) P* :P, )Ps P$5Pqn@@T 0$q0004 RT0SHV] P X0\Y 0SR`pPUoVz 4KQ R0KH 0S| 80@  S0S00$ 1H R; P R 00S \0S3 R(KP F-P000 P000040SV000PW0Q0QP ,0R  P  > RN$/L#b DKPEھ3[ L4KPU`|"QkP0 S00k,0@ cW P0@=9 =0v"00040A Q> $0< 0bS$080$00/RR,0Z00R|0S x`L0x!/P  {10SU0@lO0PdS 尐0H0 0:P)PD 0p VX P@ J(t DEzȬzzzzB|F:BFzFFl3HGMb4GG`GEEEF\FDFF -LLMsC0 0 "Pp Q20S/  0)SP`02 000 R%U ^ PO0PU3 ^ K.040K@0"@ 0RK"S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.030K@0!@0!u0!V- 0S% ^ K.030K@]0@T!^ K.0 30K@M0!@y!t 00S@P ^ K.03 00 ]\00 0R\0m04000gx.^ K.08k30K@0@ @UiT99BGxG(HGlG9THHGHBH -L(M⼁A0@K$0 `q@0KP0d@0(P D0 `0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ BWP0 00 P`0P 02S 0TX 40$040 Q K00 R izp9BH:IzB -"L,M0P Sz 0Sd "P@PPP PPPP@tq8P`\: TPqpDD"P0KpBP_(@K`$)$ 0p8PU0)% p,` /P`@ : L0K0P < LP HP DP @P 8P 4P ppW t!10@Pp!0|1 0t1@0 `P `(K0}P,,!6p!0/p0}0P~ #p0 0 pp0 H0\ {{zXI:!p99x3T999B8I`IIxIKII0 0 :90S GS  -L$M,  (K  K0K,@K$ @(  SPK -L M@   (K K0K$ @(  @;PK 0-LMPK5PP@@T ۄP 0S|0P @ 55@8 -@@0LS  GS ,, i@0 h͂CI -LPM☡0H@Kp⌁P `(0 HP DP @P |P00 p 4Ο1 1 0`KKIIT] " 0@D j=P0 R== `0Q  Prl0 4S- M.K B B@@@@@F>K@0C @"0C D ;=Pp$0S ̟0 M 00 )pPps*,0 ̟ 0S  )d+0 R 0,00$- ANkP | ̟0Tt+00B0S |X[T+0 00000000`@o`@ T @D0XD @0˟@ 0\$ SE>K0C0C 5  \ )* 5\ pA M.K B B0% L* R44:0  4 4 ɟ: 5Pt0 ʟ$0R pspW@$R$ 4S #P P0s 00) /0:   ,)00P@@X04 .PH{ 00) 30 ) B0w{pP UFnK`Ft `FP@  0K<Pzp4 RzPwPp)U@ȟ0) h$R ɟ0RFNK@DP((0PkP7|x)0PbPǟ@)$ 5\ @VP[7)% 5@MPO#(@! @H4t~.`Q @y%@Tzzǟ0@r |g00 wlKIGK I0JPUW@T0S,0 p6@6x (K @hP KAPP(6P\Ɵ 04 H0K4 4KL 4 D Д -P %5 R `Ɵ0RP&p6 0 aBQ6 50S'PU p5 %0:;:0%0<0%0:;705EKAA P6Pş0 R `4 R$Ph%000`ş|5   W$080R$ $ N P,%EKAA P7ş0 R2 `4 R. 7$EKAA4`p0SN `4 RJ 3Pnt0P@0w 0Y 3ZHSU@t3Pڨ#000 DEKA A3@ R `4 R0 S 啝4#0:;80SEKL L @0$d$l R4"F>K0C0C"~ptԟK.K B B@@@@@@2Q@ N"0 :P0 }o02 ' "090C!070L2 0*4 !080!050!0@00zaEKAL L0 P k$d$0Ri 0Q0EK0AA `4 1@h 0S 0 R `4h$TQJ it[;;VȬ[X[ !;|[;YY4; x[4{@dU ;?.A'T!|UT d[[VU'l\[8;`[YYYl[;xWd{;WB8{p[<[D['uxX0{XX[x`U0VVDWLX$X+UUTYpYpX@UTULV`VW(WVWXWYXlXWXXY XW@Y({Yt[V1 *++ 0S @A0C2SFꀉlXD0lXD0kP "0P00L@"060104 0S"0<0"0:0"0;0"0:0"0;0"0900S3 3 0 4.0@>@$ 4 %FnKT2`F`F@P)' 0pD Pi}P2)( 0P`}P A30%P b ϛ3P-4@( 3P!(0  8uZ0S P3}Q0S p*|4p3M>K0C0C 5 ko$1 0`PAy?$4 ZPd ,$)+ 5\ |p4֝h$E>Kt 0C| 00) 0p   0,0Q @@$ yg5P @p5F>K0C0C@)& pD |P 嚝vIKK,6NLN L |X6 Rwu'$0p4 C@P6| 4 &S00  4). }|P ^0 Ps `) 0`l|P0s 0) `a|P TBQ 0)3 P|P 1p$啕PF.K B B Pz 巚忻 寚嬚 崻p$E.K B B % ) 5|pTCw\ 㒚}/t博|劚 党 做 }؜՜00k0g 00a w \ Yw$0S(P0屜8宜@嫜H娜P奜X墜`埜h8p噜x喜/$+匜)0 S -ˤ9ɠE>K@)0CX @{4x 0-8P8@L4 #an  0#Cdi4ZZ - LhZ -BMLMpP<|>8E04`00 ,0 6rP dP jP5`- aP* uP zP# tP#P, 000O}4 p 000C Sԁ0 L$Tp00S84@,0S 0KПP Zwpq 1 dR 0+S 3L4  L$ H@TPp00F S.VWppP`V@6JW0P 0p `mP_ 0RR!>C 2#=S0Vm@ PR긕ܕܕ`ܕ ܕܕ@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0Hx1@PQ0GT1pW*@10S HK⦷pLJ 1HPK`<K0S@<0 8@ 4p up( <K<@ 8P 40 P/ P %㛺HQ 0+SL HXä Y ` PzIP|㦘MK@D0L$TZA+[[[ZZZZȬZrZ[8[X[LN`[p[[C0 S S  -`0@P@@T0 LV <00S 000S.99[t{Ԅ -Lb@PD/@] p-L@lP `Zp p-2 B 0L`@0PP 0S00X/|2P $ -8L2@yl0P/S @P,"lP$2 B v30S ,,,, 1R_P @lP`F +V 0+S-S0SP*PM*P *_L10S I*PT1  @` PP_$P`T@D00S4PMP P100S 00St0Q. !')9s8P)PQ@pЄX]ԄLUtd]h]l]ĺp]Xfx]|{ȅ|] 000p` 00@`{ 0-L@PU0 0 hX`R -|@L0p0h  h0\0L h0D00 g0,0 g00{8`RP`H`@` -L@`0X gP0@ g<0( g(0 g0@<`RD`L`4`{ -L@$000P h{ 0 0S00gR0`,` 0 g,`R0 0g(`R00S 0 gT`R 0 g `R 0 g`R -D0L0S (0@ThVh{ꄅ{0 0bg`R 0 Zg`R -h@L0S X00SL0L H0Gg@00S40$ 0=g00{``R؅h` - 0 @L0 0)gp`̛ p-0PSL`0S <0 S @Tp{00Sg,l 0-0L0S0 0f|00Sp0` \0f\00SDP@o,0 T@J$0 0؅d`R\`{ - 0 Le hf$`R p-LM`[P& 0S0@ iP& @T P:j@}0\ tiH 00P (@K 0W i'Kp]{]] -L@P h}00Shdl` -L@P 0S0S00Shdl` 0-LP@P00S0hPd0l` -L `pP@P0000P0S00X -ALMP@ # P PP P P P P P (P |Kplhd`\KP 00 0000_]]]]]]]]] -LM K|oP![A[R0 @bP $}x0t8d P00TX0@POP }804%$ PP00Kht@]^4A^ -LMP3LE0PHKP @P@cP00 P00\-5@K 44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppze"0P00IPBYP 0S20 KNP2 PP0PS@  c|"  `U @+h00 0 P"bH2 K@-1 `P0`S@ 2  Bkc!  `U @h00 0 Q >1 @K1 P  `PPPp0P0ASP `100ST1  K^l`ذ^D@^<^ ^( ^, $08$^[`+g\`0``(^d`jh`,`{,^0`l~(`00^$`4`8`4^$}d<`@`8^XD`H`L`P`<^@^T`X`H^D^ _L^`d`8 `dP^`~ -2L,M0P t2pPpLPK `2`bX*0S HB002P2pR nP2 2P+ KP+ P1FP+ PA%P' KP<& P. 1P$ KP2P K P- P# K P' P X1P!              0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L Kї坟0 K{ {_+D -PRLp@Y*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ<U  i p i%)T^h^^^Ļ^0@-T0P?0" 0@0S0S0 R0t`00P $00SCt`Hp@-@00Sp($$,F6PI`pt`P<0 5-=?0S> 06S000{,0 0@S200 t` 0Pt` 0- L0S( 4 @ 0   0*X@0Q@ DLP 4 0T4X0@0h,0t`l{ -0L sp0q 0 -0LPU5 40 0@044D 0S%040P`0$44p Td$T(d,t$0@044D $ 0zspqh;(t`^ -0Lp`PP#[0 4@0$($,T044Dt T$F P 404(0$00 4sil{t`8 p-L@ 00s'0@{^ -4LpMP7 Q $$0R($0R,0Q00$:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 40S 4 3 R 4SZP3 3@ 40 400@000  T3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʡR4S4S 4?  0trp@PqD4'W20dt Ÿ q 00010*b%pl P'71 4D0O4D0P0030d4tp10S) 0S6+K X&\qL10S@1wKNP(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PG*0(Kt`{ H^{(kl{LTX 0-0LPU ,4S0C$(QP40@aP $4(D 0@$4(D0,40h0t` -l@L0Swp D0,$R0,4$4(D 0@$4(D0,4t` -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00t`H -LP l0 P 0R 0R Q0$4(D0,4t` 0-PL@T 4 m 04P X00S Cpq 0hH0 0@ p0t`Hp$ 0 010#tQ0S4:Ss0p 0 00 t p-L 000 x 0Pd `3PP @ r 0 04 (0$ a t ]^x`__00 , (0$0 0 0 b`bbbb0 0 0 bbb` -LMp@P `@_00C0 S%"0 .S0K0 $ K K` p-RL@Py0` AbTUp -LM`p$ @PL0 `p` -L|@||PM$pK(`K  ](0S0C(0 0$ 0b0 0R 0 000 Kbbbb` -LMP@p`a   e0` p-L@LMPK@%a`@@00S x` -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$Kbb4 -H0L0S00@@Y$ 0@00`bbb -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 h00S C$Kb`bbb4 0-P0@LT0 0S0 <@/800 0P0s300b`b -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kb`4bb p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʋ"000 0SKpbb4 - 0L00S Lb p-PL`@Y`0 Rpl00 AP@*D0P0A0Q: gp`b p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphp{bbb`b -LMPl_|||p`,K  ,P }@TP!,0PT@:0S0 0 0 0S{bb0PPb -0LMK0 ! KH _ -LF#P x0pq  T0 hH00S <@ N*.0S.0SPK !>P 5 P H>g P p>0S H P 9D>X P 8^0S= @T3$@%P\T 0S::PP>0S 0S9]>(0P 5A;}>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKF+Po@ @K0@0SP +aGQ0+tx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSh\8@LDtXL,< XX0t,$@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ 0IRQ|80S0SL80S8t  2RQ80S0Sf +0S0S0@W70S 0S0S@7@  B 0S0S0@9 , 0S0S0@)60S'0S!#0S 0S0S0@0S0SnP60S6 $6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ %# k0S0S0@!0S0@40S0dSd0@h4\4p EQP < :{0S0@(4 ; /,m!8 8KT%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@JP iP P !r 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P k{ h00 1! j X0H0p0PN 00PJ 00 PPE PC -Ab܄bbb{bl{|\p_t_bb_HeԅHtth ____b_ ``_ `4dX@,`bb0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000S{ -LMS0P`pYp (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(Kth -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0{ 0{ -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(K 0-LM@PK ^P8WP  0S NP 88 -LM@R,  MP @- R P`Pp WPڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00L` - LPh{P` - LPh{x` -L h{} -LOph+ 0-L MP0S& @Ki 0s0s flP@T T0XP0 JI000 0@$0 0 K0l{T~bLTPN -@LPFl{ -L|MB0PP 0S U N0,K0 K00 `P@@00SpJ@VP82p0,0 A P8  8Km8HX 0 {HE HHZ g 8aP, 8 8K10SP ,"P T8K8` yPYP ,叄pZ(1 w10 @1 P0 , K{P 0K 0 0P@ HPF0 0R0 @yy0Ul00S(8K8` qH(Kl{nP~`p{T~bLTh{t{Ԅ[ 0-LP@6@P \P0h#0 -`LP`pW!&`V@ZP PT 0  0 l{ 0  l{ 0 l{ 0  l{ p-L@P`P U  P V  P php -L@~h P-L 0hl{ -00LP S hP~`nĺ -L@U 0r/S@ R -LlM|K@`P8K 0acK -L0P` -LAMPP2  0Gcpq) NK,ePKp@%`@ 0S PP  z 0S*# P cP` 0S:VK̅ -HHaLp@P#R %RT0TS 0S %R #RP I*UPP@ Rg묐0ਠ`P@#R %RU0US 0S %R #R P ! d}BT@ P R p{l{ 0-D@L0PS0P(000TP0~aa -L M`?, T@pP@0S 0S P W @P RX Y"T@XP@ d \00T @S P  d,B@000S0(K{{,a -LM@pP 0S `PKhFsT@pT@@L0H P`SxF /@rFKdc`ĺ4a -(1LMP, UARͿLpP; AT@>T@,;T~@`PZ0%S00sSZ,  S TS,TP@00@TT:@#FT o荿@a -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP <SP S@S @p`Y0%S 00sS  SS@`00@ST:+PEUV 00S h10S@ @)K P $B)[280P40@p9d0p@d0S 00CS00`Ӥ0  ` V g0H v R @@~EeSp@`000Sp(K褅Lan -L@LS 0 pS` R0S000S0S`PU4SP@000S 00{{ 0-LlMKP P@0: S@@EK0 p-LlM0`0SP R@9 Pl@ KPPl00S0: S R*@ PM@, RPDKp踅~X~<00S,0P 00S00C~x'00Snl 0S00\` -Lp@P`WV 000CW`K@tPuZ 9X`yoQpWZVX (00S@ mU  -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000H -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW uUV iUVP@ x1P @1@T@ ZZP`!hpP`qX9p4q2P P AP!<T 0 0S0uv 0 0S 0S0x  Up 00pWZYT+00 oZ 00Su~Xah`\ -LMp`gP P @;P9  Kihp@P(q&V 0A8P 00S BP@P 0p@Pq Kif 0 KH0PP~0PP~< P000S SP000S0~0~P0000000   -0L`Pp@nPP `VV'(` W  00P`p0@ 0 @ `000pW 000~~ 0-@PL tP 0T T00 00C0 R( 00C0}B0hzB0l{~~ p-L@Pq P`pvp P P@P40`0pi@Pp P P00x{{ -LMpXtWr`#0S PHC0S <#0 QPW 0@PNP B0S "!@ T T "06 P P p/ `B0* P 000 ,0 pu0 , 0KP0K0PK` p@ !0040  6` P P=ڄA0S9x!0S5@D 00< 80  @P(!0S!0S4@ 1@M P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S  000K@P*(K谅~ąd| -LMpwx 0S P#0S t3tC 00S@_ 0hP0p , @P0p P70 K  00 ,0 80K0KI0@K00  i @0P`Pڲɯ`V* @T PXW5p@q P P`pR0gt T"@lTP`80S4!P00PUo-[  ) TPPx1@Tl0ST!0; Pp@@?41P`@ 8 P?P`@0K@PpA00S 000K@P*00SZ 0 P` D@ P P pY(Ko(K谅~Hąd| -L MP`~, )P,0@cT D dqt@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CTy h00SeD0@@\$0 0@@(Kha`X p-L`@PP } P p @P$00S ph꼅 -L`ppq|Ap@PqTh 0:UT0 haah -L MKWK  K p-LP phP`pqP0  Bph4@  B@PQ phpa -LM`pp@Pq AP |00Sh0 W V @P,0 $K!nK輅habP\0 0TSP0 H0 D0 @0 <0 80 40 00 00ህbbbbb`dbb000 @00X\d00S X00S P~0 @P 00 000000b\X0 0 bb -p堀0L@BPP B`PBPhz `K `KP`@~X\ Q-L?P=0@P60 `Cp) PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@P~X p-Lpq0 6PP-p@) 崠`t T 0 }@P00CV]P r@P@P0@`@40W 00 X`@P~X -L0<0  000 $00 00 $8 -L0<0  000 $00 00 0 , Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@p{b\ P-L0JPb P-L@ P0JPc M-LMP0X20 p@ 0(K=P U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4`P`00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  K`̅Xbb4~\ -LM0@oJ`p P@D\0@@0@T 7P \ 0  b{4 -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ 6@ p,0 0l0+ 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `JF`` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(Kbbb\Xb{`bP~T4@̅ -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP #PpP3V!p0x!0S0Wp!0d!ӷ0P#D! 0P(!09!P0W!0P P  P0W !P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kbbb̅X\b -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3bb{bd4bXb0b -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 c$c(| Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@yPE(`@0 /0`p9pq7  0@P Y0$X!VP"`@0 0`ppq 0@P U0T 0/`pc$$0S0  00mꔅhbX 0-T@L0S0dS0 PP(000P>000,|0|b -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0n0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z 蔅c0|,| -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@0 50SD|, -50 S  RD|a0@ S-00LA0@S0G4vyb 0-L MPP @K0 000K0l{ 'Pp-L7 $P'.P ^P"L1L!@00 0%bP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 -P phpl{4|a8|bh -L M@KC0s0s ?00@3KD|l{ -,0L R00@0l@Bh -,0L R00@0p4@B0P 00ԅP Ps 0 b؄ -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 @ K{{bb -PLM@) T TV\Q@p ` "00C0 S10R!@¤0,STT901 0b 00@0PK 0 0Sp` TCcC1` B@0|T @KTCaT B@KLC,0`04 B0$K$@ K~TPcL/cc -@PL ThL0 D6@4<2804.0,,*h@t{,cH4c`ccc dP, P P0ꐅ 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@4.808 0K10 dK0 P-L (0 00Shht@ -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp AwB@P0t @0S  K0 4 CK,0K0 K@dpDd\dtddd -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp hA#B@P0t @0S  K0 4 CK,0K0 KdlddhddeQ PPP0SP 0 ጑ 0P$0$0S0Stt -LMK i K8e -Q0LM00SK0 X KTe -Lp@P000C0 S @ h,,@0`0 C0 ST e>@DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,@0* @pexe -0Lhd -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 8 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0f90S V0V 0 @00SSS 0010,K0,0 AV 0 \0   000CSF4GGGGGGG KeeeeeX -`LPpP`$T X @P$T T T-T00@f y 00P@T -L@0 ?f -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 G1[X!0Sn`z`@YPPT 4@ q,p 000CS9KLLLLLLLLX@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(Khh{t f< S 0 Q $ 0S C x -LxP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRPft`f|f -p@!`PL>PQ > 0> 0> -LM d 0 K p-LMP`d@;002 0@?Kp'@B -LMpA)`>@>@@/0 P`%>pc -LMKg K -锠PLp` 0@SP0000ST0S0#S H؄ -L P P Pp h -0LMo@p@`!0K!PK =; 000eR;@PV-00e + K -QLM@Pp@tPp0%0K%`K 0B00 f=0@PW-00f +$K -QLM@Pp@tPp0%0K%`K 0B00 f=0@PW-00f +$K -\0\0L@S L0 P1KP p> 0 0  t{X 0-L L0PS000@00 R+0 P00 0 ˃ -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  = 06=`P K 0-0L0PS@ t00S P0@0S @00S i$00S0 Z0t{Ԅ4X 0-L@P\D 0 0܄ p-0L0 S P` 00S 00S 60@@ct0P0S h00S ph1XJP0 @@@400T,0 pht{Ԅ,4X -0LM0  l0 `0Pp `K  0T0LPa@PJXp3 -LMP @` <\Q  0R QW@X@T11: \ 40Kp3Q 4 ,0 0 0 00S0!P$K -@LPZ00 -0LM0@SpP <q 0Pn@ @X`P .4@PVZ@@U.pop p p @00C000C 000C?0010@-<0  0{0@P4 p 0q-  + Q 0%P#Op@q 0Q 0r S 000 KP nP808 PHZ0P:j蘄Ѓl{dn(0$0 0b0c0AV4, -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 t4,0& -XLBP@L>D;<8804400,0(0X\\\[[D\@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3舅x{{4 0-L@PF<0  0S0S0 R0  -0L  0SWp3 -L  hĄ-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R "*00 0- LP@* R  0@ 0蠄 4 -@LP)00h.$00S0 0  괄p -@Q 1LMPp@  PP)0T0  `Kp@&7P@ p 000  0S : L0R  @00S 00 0 0 踄tp 0-@LPT 0S$  0 0ĄX -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(K踄4 -L@MP`X T0 c@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hi@L H@D ,LD 00K@aP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @L;(D9(QP 0 `L/(D-(@@(K̅Ą  -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K蠄~ -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 }8 00CXZ (Ko(Kx{{` -0L0@SPTpW"0000S `{pI@tPq AcB`00CV0p` 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K r $0P$K踄oo܅ho -L 0 0S0 h谅 -<L<P(h+ 00s030h긄o 0      ḄĄ 000 000 000 -LM0 $ KK0 0 FP$ K -@PL \TL h,}D}\} -1LX@ @@ 6W㢞~0  @`Pp0S0S 0` 0?0080  W000S iD}X4܄Ѕ -LMLp`KP p@P0[SPKT[  - LE= P00  -0L idq -LMP@P 0S 0S1 S K R3 rP 0B?SP (KdP (0Sp`$K $0(RpQ QP` oWQP00 -L 0KM#++ -L0S #0@S #0P<00"P ~2 0@ R80 4@ 0  0SV 40K,K80 6PU( k@ 0T"D0 @@ 0<0 ``2`@0 DKP00"P P A0T~A0  00 [L0S1 RC x3~DX ,0KPXΠ[0,4"400 0 0D (KQ@P 0 //t!`_P:0@P PPP }}H  0 LP`DA @2@ Tp -@LMh %Too`p20p0`W` KU -LM @`, pm%` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@TUt K@PLL 00npK`2@PΌ  0`0Vp, 0R(K倵it -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0w&X2g0`TX2i=ST0S0@2U܆ D _R 0S2! 0 tĈ0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@PN#@cH#@@cPE@>#@Pc8#PPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PDR00e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00+@P 0@<P 0 , D 800$a(K CA(Ko=|4l M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   PՅ< -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P`| o -L M嘅`Hp  p⩓`W` 2QPY.EEwOE B1 @@P@啓^WP, pl`W` Ktt 0-LM ,P@$P | p0R dKgqp PҐ@P D0D 0}  +88@P؜@| -LM040K00 m,K0 @,P\`  3(K0pP 0 ,Q 0 x "10 0 d @T1"0 0 0@1!T$기̗$ -LQ @  QL -@L K" &> 彄UX -L4M0t(K(0 (0`S $pK0 pQ$@\P  峒 K唄0( p:$0`Sp ( 園P# 2pL`K2A@ @N P0LK000 p기p -L -L!M(1`"( S92RS]2S\@pAP KP :/0p Q 00`( 0R $K@0OQ@iؘ8| 0-PL@V0L -L MP$K@p`0 $0S   K"100!aRRl@0S`VX幃LϑD̑@_ ?0ꐘԈșX -L M`(K@0 @(PpU  `墑$K A2@ @ 1Pꐘ p-`L|yP @ ;`P 4 8$0 $04 @4 4 '4 $ 4!00 4 $0@'P l!P0PP D K<4 ,4@0`pSp@0 @HLD 4@ipP3H 0c40l@8T4T3P)`p@P 0 S 00KPX#0S0#3 K~PP   M'PU<0@S@X00SX00LS  %H20S\"0000SD"0000S 10S`\B\TRD2p` (",0QP "0B1 ,;P ! 30S:S0S6R) 20SQ b 0R20SR |p2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@[ X`X`0K 0C;QPZwP -P PI w嫨0%dD404 oL1 i404 eB.K 1 B B]1 W404 S05 0 L404 HIKAA5p U44 V44 Y40D;0D;4 d0%HC0!8+F ,'FiȬHp0t tDt+Pti -LM@pP4 PP 0S nS6 =`P00QD @ Q? 9P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP w00 ,KWy, ?R0S@p @ `OC0 p00v0"S 0(@C$P 0 08CL/Hjdjjj,j -LM`PmP( @(K,pK 0 g(0@S $KwE p-0LS`p@P  P0P@T@T  TPP0  r 3R p00 R P ei`q 0-LM@PP 0S TU6 80K ycpE4o -PL`p@0   0@ -4LM@4T, 8 <( @  @T  P@C BK3APAD  0`D#D80x3P| T  YゎKH p HPdp4  $>@P 0GUE0S -SF 2 1AP,@Pp!8R00  @2P"< D8W@@T p]BOp@( P" Y @P1 @@, 0R@(K2p`A=P0P0P0, yBY caT p ~KAA@(囄P008#4 P@ N8 bjNK@DQ@D8(FB0S 0 Vᎂ[u0S 8Q0B-BLu0S 88S  XBPBiDnnȠL/0oРԠppcqȁ -L$MDPK`po4P`P <0KD0 @@ 8PAA -0H +0K) K$`p; T0L%S񟗰HHHHHHHHHHHHHHtH,HHHHHH,HHHHxHdHH,#000C+K *KH#_p30V1P@`P@   0] Z P@, XP HP 0P p@`P P P @"000s20K ap `B0 00cX2P R^ :Py 00@Td@Ta  P  C1 ڧ!00070SQQQ4 F 0SC nS 1 4@K t!,h`PPHP 01(D10AD0 @@ <0 8@ 0oS1 4@K 4 | 0PoH0S @H`K0 0 (K PA@B;@|8@ p4@(Ȭ\ei`qq+PidpL/@|@mPmX00 00 -LCP _B Q-L@ P T]NB P-L P AB 0-/LPզ@P 00+8/00,+ +00 p-LlM/Pᶦ@P KP0: S Kp0`rS@ z P0-L@P0 R 0 R 0H0h  t0 R0h0l8 ZH0 R <0<-808)㫦0#i --LM0 0 㒦 --LM0 0 K --LM0 0 K -L@r徣 h -LQMH0@K0nPP`pK<fP0: S V@@ S00S F`PPP$KP T P`0 R000 ZK@7P h1: S 8囁((|s吁@L,< --LM0 0 ~d -LM @Tp`P0S   0P P 000$ -L,MD H &L0 0@  0 40 pP @@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ P0S PUWP80 0 %0 00 ğP0P00 @TT@TQ -P&_P@PX! 4  Y4 @0T l`VR hƀ @T P@T HY`V$`>SVXg 0 0(K4 妀k `00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 YtP^ 0`, ^^  0(4Pp0\/ @T3 0Q  0 P 0@TRf LEPa 0 ||^0 F0 ,$ xtPdd$Ȣ]L0$D -L@ P 6? D -PL` @Pp 0eS P  0<W + P#%?+@ pPt  00  4P H < 8 aP, ePdȨ p-L@lP`P p@> ?p$ $00 >pn g8g -MLM pPNK@D`+H 呓p 8>  0piRI}>$K  P-L   0 d|di0 - M DLM`pP % $% % (nP& cP# VPeP  mPqP pP sP xP  UP 0 5  $% D#Zp830V %0y03R0S P LK@D@D" 5_ P1:;U 5$%RS 5 S  *K>p|  1: Sd  `KWV< ;P@  Ւp c @P`U =ZK* $0%KR  J0P50 `V p5  J 5Z K0K +PL@@@PPtq K  @ u  @q Z0K 0K0 p@x %R  eP  p %=`@`Ta=5i(K+hȬn|Щܩ  <\@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P  10 RK0 p-LMPK`FOK     0RQKp -b 00"00#0\ -LM@K  K00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K  0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0ģ -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@@ģ -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KAD M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(KĤ -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (KĦ -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,*(J>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>@<840,($ $f$(, p-@L M0KP`  @0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0 u.0 -L,M0 K@ 踵 P0U`p@K$ K(0K@< 0@ ,` ( @ 8P 4P PPp Ka A.,D -H@L"0 0 P 0;0).\ -0@LP p`0 A0 S` a0A0SW`AA0A0S7`AQ\ ABABAAA0d0P*P2 -L Ml pR R P- P`@0 (@K@`(\;@^ ^ T$K耠P`0 Q  P ~ R 0p) pi ȭl -LM6 0PD(F p-L M A`*Q4`FEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE<0 0R000Kp,@K0P D0@S 00  Q 0S00000AP0K $@PP 0L@  N0 $, ,Hܖحh0 -LP  0R S S0RS  P0 0訫48+ -L Mq0PQ` 0 4 lP 0RKKD!0@004K0 辳4^:0`\0 0 Q0 B0lP0   0S  0S 0S0S0SlP 00 S 0C$0 00 ,0 (0 (K P,P(ˎ 0(,i<$t -L\MpEp0S, p`( P5G @ Q.dJJXJJXJXJXJXJXJXJXJXJXJXJXJJXJXJXJXJXJXJXJXJXJXJXJXJXJXJXJJ:P$$0000t+p`4  XPPW W , 0R(K @ P0DSLKKKKKKKKKKKKKK MLKKKKKKKKKKKKKKK X+P+^PK2 Y1P/}P00@ L Kd0K | x@ t@ p@ l@ h@ Pfd Rj0Sd0Sc Ss 0S+W  00G}Z00W% @ رP Pr Z0 e$00^\00 0R1PU@ 0C  P P0  8 #"  S7 Kd0K$@ 1P  * 00S0S 8#8 $#$0 0倍 00S SP P 0 R  |* p*  P*@i،@Pxpؖ-P P-L 0K,0, ($? 0ؑԮid$ P-L@ L0VIp el,+$^P~,,d p-L@P`@DT'0-S;@PQPPPQPPPPPPPPPPPPPPPPPPP@DT!`h0h ph`@T ``(0 `~{,8 -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S ᰳ \0 R \ᠳ0R P᮳>h蒳0R>h袳ꔻ -pQL@ᜡ0S:`00CS`0UX0  X0hm}`PUlPP!o0S@0`00CS`0BX0  X0 Q 0 CS  \  XQ BP` X U& tl0 CS @` VP0 %X 8X 4ꔻ pt p-LPL`@LDk8  0k$  pht $ -LM`@ kQ (KoJQ P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R kT B0P0 hkPW 0~Z  @tkX z $mkY @ p  bk @ [kYk!s C, R Mk0@00pD+](8<0 L @L@t @6kd1 R+ 0 (KD+k@!  E41 R-(`00CS`0,X0  X00Sc0S_ (KoVI SI:(Ko)JppW jzP (Ko X (Ko꼙$<8`th İذt دL -L$M@B@0 S$ P Q I$ 0Ry K0A0Sjj0 0CSd[d[ [0Z\Z1j jQQ QR j #C xj 0 dj\X!0S 0`0`p;8 <0 L @L@( @ojq4@Khj3HP `jZj Sjxx m xHjpEjh"iI`Vpꤖi8ı hDP\p -LM@[e&.0aT, P cT , P gT0,0 P t(@4P4 00|4   l4h$d40$` 0 $4 ,`P $40S0C0a P  dP<0S#0 30S0C0@@  )0PSx0 30S0C0@@  0PS(#0 @304S0C0@@  0PS0  20S0C0@@  0PSx"0  20S0C0@@  0PSh80  \20PS0C0@@  0PS@f@2 R 0@fS@ k1 RQ PN, R\A&.}P 0S@ 0Rl!0S|;  7 /(BRbr0S, Ph 0 T 0, P00 R &t&Lܖ<܌,PxPt$,4<DtX -7LM@ T0 P`0gS l7D`wK0C0C@ @p> 1 R1 1R v㦊`9 8  0@p%nK`F`F+zp@V0S p%'E( $ K@ He0%(%i,0PpX -4L0M@PT`4APEU50-S@Ponnooonnonnnnn|onnnnnnnnnn?PU  ,K@?03, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 qP  0@@p^V0 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt .Pi 4x"0SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1`PNP00P0 `1 R0S?0 `7 (d0S0C0dV 00PsV0 Rq dlr$o$]i$"0|!<\Xw"PdY꜖,@p $дسCh -PLM`P0ڐ@#z@p1 T0@"S",u8s8s8s8s8s8s8s8s8s8s8s8s8s8s8su8s8s8s8s8s8s8s8s8s u8s8st8s8st8s@s3 "H@p2pR2A@"P >"P0`gSX@@bP P 2 Ri xIp2p P"0SXb 0E1Sixuuxuuxuuuvuuuluuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuh1 ad1 ]X1 YL1 U@11 MP T  z# 00 Q8.0 0pb#Qx0@ @64 /FX+ ;&@E#,,ȬtH<+40pX$0 R P"!P <0@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0@LPwxwpw`whw ጑- 0`S$1S00CSxx$x$x$x$x$x$x$x$x$x$xxpxyx$yLxP01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $ Pn -LQ 0S 0S S hwh{0 踸P -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@+P;0!`, 0R9(KP` P` P` P`P` P` P`P P PW@`4 `܁i<PԸT  p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,80Kp <4("4!\P@ 00@U \bT!P`UU U&Ƞ& &< PP&Ƞ &<t hPx&<X HPq&Ƞ& @&<, P@ Pc<Pܸ -LM@0DSllllllllllllllllllllllllllll00 0+(hkhhhM P -T0 ML\@4 <@P ,c+K<PT p-PLM@  0 R @,h*`xK +`P @.GPP (NP@T <PP p-L$M|Ÿ|b0 S P? R6 @!T#꼁āPāāāāāāāāāāāāāāā\āāāāāhāāāāāāāāD"RH 90! 0RYKp|,lpA00xP! 00t8@K0 0 80 40 00 ,0 (0 $0 0 S08 K70K ?.P , B00[S S/0[0S S Q"[-K04"48#8 0 .K05/0[0S긎iPP0, 0-L(MtP9@K0l 0 0KS00 R00-` 0RK0i`8 p-L`!\P@ p0R0S 4 L`. 4`$ph`# _pA  p-L\P@` !\ "10Q0S 0S- S ]T)0 R ph_pM 00S S 0004"48#8008 ph_ 00Sph_<pA( p-L@\ `P_TN  00ES؆̆_00CSth\PD$z_w_t_q_n_ R R |phf_d_ Rxph^_p\_hY_`V_XS_PP_HphL_@J_0TDL8@ht`$f 0-QLMP@& 0S S Ux0 R h 0K0h_ U04"48#Ƞ08h_0  _8<Ĺ0@Sd<<<<<<<<<<<<<<<<<<<<<\<<<<<T<<H$^  ^ @Թ -PL$M@C !P- 5T H ldd \\PP L1L ^@1 R;41 R2(`00CS`05X0  X0K  0^@ 0@x^0 R Kh膥||h^X Kh蔥̺Ժܺ4PȺt@HP8< < 0-LM@0PS$ @K RL@@\ H@@X TQP 0v 6K0I000꼎 -L@M0r`@0TP 0   \KP201 0S0C000 R2 R X0 R 0RKP0SaD"0T @ \@T`T C0 <<0 0XS0[  r( @]<Q<a]0S;80`  B LR` BX0X00K @i; @]<1 R 4Q  ]0S `00CS`0,X0  X04P P `s]0S 80 L つy0 R00p0R PT劤X ㆤg@1}i8DL`nhX <@ -RL0(MH0  0CPP`HpK,KD 80 4 @ < 0 P ` 0@@p7N0 S}@ 0@@pm ,QNV V*@0@Y0SZ0 0 R0@Y`ZZ@@ (K,0P 0D < HP @ 4@ 8@ @@ep7 ,PV N V*0PS@ 0PS p01@YdP `0 @@;p,0TELBD?<<|M0*S $52됻ĻسCxl r 0000 W0700c00B0200p  4000 W0700c00Bt -- LM 0P Q KP 0 -0PLM 0F̻ -dL @2P H ,P 4 &P  P$,4< -pPLy`P 0@0P +R %R0s 0D 00s 0D hP P@ Rd t@ 0-@LtP 0000 hP%T r 8000D p 0D00th-0 CR 0R0 SԢ00 -t?LpϟM080 0 P<0  P" <s 8 ㆣP2@p  }P@p  tP"@p`r ,"/P 0S U  T  0  S2  0S` UT@ 9PB B U0P/S4P O4 40S 400ST   0&P00S 2 s 域8 80SV8` P80p 8D P80p @ M9P " " W 0S @90\/S/00L-P 0S00@$@P2 0S/ PP:P   0Sx 9R q*6P\  _ "*0p0 @008:*  0@Sp  "" V < <@t bP02 4<Kp0@0Kl,$<@T 4,@ @0S 4 EB "<0S; qo@ 0D0 H0 P D0SDH0S  H [0D0 @0〛@WP " @\`H :R0O@p@4 HwP P0P0`P0 P Rʼ 0S *0S ʟ0S#g#10`0S0S*/(<nP P H:0S/ :0S+:R&Q$90OTS 90S9#-9#90S9  x9 h9P@T hi@90SDTPS0[S ]}P 0 :SSp`  :}@P00 K7T00 00 7PK0`K 0p70X p@K l'P0` 0P i 87 0P$0oK<0 B 00   0IP,wǟ0S' #< <0s# < ZP0J0S ,J<0@'Jh0@<0  00p@K00@ 0PPU0<0S 0<x6 0S6 џP`@*P@PUmP〕@Pl"P00  0@PUPP8@T 50S58  "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P 7PPd %P@H$0HV#0@X P0$5ß3#.h40ST4 P 5P p@?P " P K(P K0BP0 P R 00 S S  P P,@K mLK> L0SPKPP 2P "0 S00`ڜ6`"0@LKP KP H0BP0 P R 00S S S R  PP@PP0 菜L0 "S5 V2  PP,2 @gPp e@P\ #1PP0S18 \ <0s<Q4 %PrTo@x,$4ļ4\`tL pcذ YpX X0`lܾ ,30x\D0ؿd <x8h DX 4td00 S 4|| x@ @0S 4!t00S0Nl@ 0D0 H0 P D0SDH0S HP0D0 @0a@6P L0\P0 DpǏH B8"b0OPP @ p@4HPP `P`U"0S 0S 0S#8#H"0pÏ0S0S*P0SHn20S/ 20S+2R&Q$20OTS 20S2#3#˝ 30S 3 43 徝D3ŨPQ h`.x3qr P0S0S0S 30S 3X30SDP 40P2 2 4P\ 嶞 <0s <`%2 P 8 (K -LM0T ,0 X \$ t@P 70Sj,0 PH  0 S H$ PD  0SD C.K B B`$ ,0X:UP ,0X$瑚0PP4 DJ @ P P, P Ɵ0PD\$0Xpa^P @PH$R P\$HpNP4/p :`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*3W P$0S,0X pL  L$ 0[S]P P0#03V0S @T 0:S*0p0@T# :/P U P00S P:R V  R0305P1 :P:Pt`PL PW 0S V @@V 0S /yP@@@`@ß0Sk(#U0 @0 K  8K DK0 K40KpK$ P 00Sd40Sa80S^  [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHȵP 7O00S40S80S  t[[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMDV@Po86D@ 00CS, Kq4H K1@JP ,5N-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,40=0S le@T R $ 00 p `'D  PP0S((0K  # iP j `K` |ğt\hğ\p D 8$P,K V 0t0p0S \,0K5PL4ȓ0S S ß,  ,0K!P |, ) ,0KP  0RS 0S Q00-S ? pґ R>`̑X>0S D0S   D,> 04 S< 0@ D00S0H0 #PN0SpNPn 00<0S<w80S8r\= \= *thl0<0 c08 SHPQ 00|SM P>;0S ;0 S  q<C8@h= /n@P000T  T T/00P<0Sp;0 SPL<0S c;0 S (<0S  0S DQ;0S  ;;0S x;P PTD0S ;0 PQ  ` T PvH 0 00S6  R'{P;,0 :)00|S @ G, ,0S  D*0S00<:: 刐, ,0S:8 40 `:0S,0,^KP P0S;0 $j0 SJLP0P0 P0: S H)0S00D9  90S (9L90S 0CS 49 00 @90S,0,^90Q:0h; o0P8`t -2LTM!0p`0UP^1A0 @0s 0 @0s 0 P |1|;000 0000,K0K4K(0Kd@K@$ K$8K 审, l80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 僦pP@uV00S 0| @0@_ V `@T: @P(0tpu0 Kt`0P -0L |:|@lt@ RP T@:L@08@ R f]iddpt -Lp` X@1K#  zPP <j  p 0e0 0`X茆 -MLMB~K`pG, t,$  PPP H? s ` 00 0 +M@P(K茆 -MLMBKp `H, 0  V@1K#, LPP0$  P@ < < p 0`d0 0V(K茆 -LMBNKM@D, p+`Z V@1K#  PP,$8   0p0`e 0V(K茆 0-L4M@4 HKPLp  4P 0w  XH P0RD[P@  P4 00 ( K0茆ELF)\0p -4LM$d嘤D0 P04K0pK 00 40 lP aP` eP oP tP00  nP     #p# P 000 Q7s P pQ x7p{P Q H7|@C0 0cSw 00@ tK3t0 0`4PL,<̠4(ČH" !Č$4@%̌p&< tPK `0 0l d VKU0KX@KWpKg `P  Hi/YpP 0 KKp  tK@ @P V0[PS (`K,<4("4!<0& P P@ P,P P P PtK   0(  0 >V0[Sh00h0 h̠,<4Č("4!ČtPK <.̌@ h0 \ <̠Č8#Č ̌ 0p 4@@ w@P(K2itt+(TpȬ'Vp -LM@Kp4 P1KpU 4PP|K 0pq -([(00   K Ph   @L`K5[d $!0 pq  J PEL0@S8 D0 5[T 70 #1 1`  0S00S 00 00CS000`( (8[\ ,` 5[d !!0 pq LK J P  L R w:Ru 3Rr H\D ` V f 0D`P<0S@Y D@ R3:0R0*H 0Mpq 0@d 0 @Q0  ,KHP 0.pqw < dL 0PH 0pqe < 0P 80<P S l  0HP80@80`  5[\g0`V d 01P[ 0 S( RQS 4 0@  K@ HKHK0   P40`/00CS& 0pq   0 `  0P 00S  0 `P@( 8[T,V  m(K`ۣe -LEM@K  $! @ (1  `Ip @P`KK0^pq !:[31 u !rIP !Hh! GP7[ሐK0O 02pqn hK8 QI8Pfh0S@pKX0KpP7[UG011 0@1 A )Aq@ 0 p0@001 A 00CSp 00@1>AAN1  @@:[^ 0 , 7[ 0Kp 0pq hK8 H8P !h R :R R X0K\ YZ i $(0XK`H0K  v !XpKXI WE0@T?!S<`K0pq A?K0S@0 @ p@ $!(1`0$(!0K$`0K0 @K p0XpPq H@ e $!(1Lp`K0Cpq Hp $!(1I@KH0KQ`R c $(0m`@K   ! @0K  7[@T=0 0@ @1> Aqᄁ Wᣎ X  a$(0C`[ 0 S@ RQu @P@ P @@P@0$(!@ P K@KKKK0$(!@0` F00CS;0pq !(c@p`@ @0 $!(1@ p 0@1>A0 ,! !.pKpW ` $(0p`0@0@@0 @ :[pW0KYZ 0$](K`ۣe -00L((\ 0 0y{WtiYd -5LLM % , 0-S ``P@+Pp00`lp $p d0@ S h;9999999`;9T;9<;4;P$pD4 U @P ZY $vW /p 5 2pL p@H P9Ep p pP   UX@KT00 T0 ,,#32N0S0jl0 `pl}`K N20S `0#40Sj@\K \@ #Z/PS WV  O/p@ @ T  D/p #0S j%6/1pU ^ h d `KN hK0P`@ pT"0-SP MU`@P9 Q 0" l0S$  @="0S ( "  ,^\_\YP 55&ʒP@@S TQhNiitUȬD8X`@E$UU4$pxLNH -L+ 0(Vd -GML1M a |!@0P$4 X![ p oP9 4!R p 0bSQ`A~K pG0pG4 8P3 $$004 4 =K 0C0C P"'"P -P P "S0$toA.Kh0 B B\T0$8`U ,iȬ+sn tDt+0tti -LM@pP4 &yPP 0S nS6 =5`P00QD @ Q? xP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP!00 ,K#, ?R0S@p @ `0 p00!0"S 0($P 0 0L/Hjdjjj,j -LM`PuP( @(K,pK 0 g(0@S $K0h@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# YP ,,P`@PP Q JP 808PS <<P`@ Upp -LMP00K/00BP a@p)T'Q 0,<4("4!| ,K10 `V,0 0,0 %00S , ,#0 `S:(K -\LM`P p 00Q 0 " 0@T K 0-LM@P  $ K@ @  $K300P $0"K0 -LM`0P!PD $opp= %Q hg A $p/ Q Z  4P 115S ;7pD Q0 dE $p DT P 0$4 h<Ph -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0 0`@Tt -L]KCMPE쐟MPE@p ` ݿ+ڭ P:$0 0L0P < 00 8KLp H @` 8P 4 , D plP 8 (KLdl -LAMJ_K, ,KOK᛿vp`P#0S @ [vP @T T } R 0SR( K0ACp <~v`V440 JKp, ⸽(KL<  0-L Pp@P8 pO 0h0 p-`(LPͱ,Pʱ0P Ʊ 80PS< U@ph躱@P -DLP㊵pP`H 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  ]rP( ,P VrP, 0P OrP088OP< <8 @+TP @`8 -LM, P BR00S ,PO0r,BR00S (PB0r(T"P0H<`S 00<S$0 (00S`A<'8< 0V 0Vd18S_\P@OpOOa@80S< 01800Ea@80S<, 0p188дP<B 0!竼0<8 <0q`80S<,0@188岴P<$ <8 叼< 8 0!a@80S1S 800痴P< 0!rPU `X$Y \` -LM@P4K 0S   K p0 0 Xq 0S/ 0S  4@K$ $`K PtP 0S  pt @T `PI4pK@0PS B@ UT $1 1P 6@I`40(K  p (%P`P ( ӽ(.  ͽ (@4pK0S  ½@ T<0 80Q K@8H Xd -L$M@ᘽPPT ppd @@K$ SD P8 p 0S M0`᮳P, ~  pMr,P@QlPUT@D0 PM`X,娯~@0 P,JKi$ D` P-L@`Pp\i.. r 0000SR 0 嗼R``P'R"R $R `R \R `F0 `F P@T:V00xtxXM4 p-0L0S00@T,``0@ p Pp 00\PD8, phpl| C -L Mp@p P lhRp` \2\ D埴@P< ᯰ,R,,Ka( 0,0 0 2KGp 0S L P 2[ pLB`P $0S tA0S H2pL 8&a0S D@KP   0L 04 000  @T00P0#@\0)0@L tH0s T.O$K@(h   < Lh -L M`*夻24 PB2 @Ur P0"0Xp P*J`P$E0"LpP*,0``Sp! `"@pP0*,@P``0 ?pPv*@`P"'pPm*``p(0Sj !pP0`*(@P``ϻ0 pPQ*@`Pl!pP``0p0H:E1=U80 80S ,1 AE0 !pPp``+*P U0 P @`P0 P @`P0 ڨP @`h 庺pP 5:L P(KxVt<4T  p-ML M00@S`0 ZKPE*ǺP * P%*P  K@* P\%*TJK@D( 00.@KpX` p-DAL0S8 {.$1` P@00S 0S 40 P *@T00Q P 0*}h@c{p00S0@ 0>@8PK. 000S0!>ph{xvX$ -LMM@1~K pG`pG@P+PK&_- !1!0x6 p& V !0K @QF t6 l& =8 46 p@ 06S L0 ; ;KSK?; 05%0&$0&6@0 & 0 00& a>0K D -LMMA~K pGPpG0`+0Kʹ_- Ź0Kt6 ,0x6  t1d& 0@h6 0S1!l6 p& 0SS 0 ;0& 6 0ˇ 0S R0 0 PK @@ p@ 06S 0 ; ;KSK?; 05%% 0$ 0CS\0&0 0606 6600 a>0K p -MLMq`KP @@+@@KJ_- E`1V0K,t6  H1d& xF 0Kh6 00+06 k1f 0 AA+ ˁ0SP00 Q K @@p@ 06S X0 ; ;KSK?; 05%0&$0&6D0 & 0 40& a>0K  0-TPT0L@ @04 48#8 0 0hp  p-LM,B0 KP@0Sl0SCh 0R, 0R( e0 R 0R0000 0KQ 0h!0aN00LH\  00 000 00*0 R 000 0 0 0 000 0 Q0|000 00S UPL`PPF00 00<0< 0<,0&Kp,PoLh k -LM(K:x2t2, (0 b0/S0S*L4 80 <0408@ h2 `4@0 0ʼ@P4@8P1AP08 ]=0R40SL0 ]=0 㰼0O?0@@@c00@408@H1@!0 <0,0(`K400@T SP0@48X("(04"4 0 0p0 `020@^04!4 @8 #8P4@00@0 R0, 4v K p `h 0-`PL@س$0 00 00@,0 0@408@0h5 -LM(Ko(`K3,0PPch3@_0,< 0S0S*00 P 0S0S *R 2 L S2 004 80 20<0408@ {2 `4@0 0ݻ@P4@8PXRX208 ]=0R40S_P 4 Ļ0O?0@@@c00@408@10S (`K4@00@PU T0@ Q 48 8K ѶX10SS $0 S (0S 10,< 0S0S*0040 070KC,080K#K0S 0X P 0"P8#8 $#$0|0 l04@J [ @04 48#8@8K C0( 04f K k 0-t@LPʲ$0@ 1S1000p,0$0 @408@ 000h -t0L0PP P P0S 8@8=0 00 00h p-L 0P0 @00S 40` 00phu$08 00@,0 0@408@ph -L@OPPlT"p0S. 8 `0V (2pP y 0 GS R 2 P10 < 80p W@x1xt1  018@T R0 Da1 SL0 0P0$0 10h0S AP@(R*@ h޳( 0@0(W@P(((@1S 10t`00S 㿭P@,X  ⺳, 00 8<$D  ` -LME0P 0@  0@ p50 @`50 0S1@0 @<50 0S0;S<0@0 @š5\ 0 @ 00O?0@@c00@š4\ 0@0pPo?P P` a`P`%1?FA   ,K,Kß000@0 @0(0 S ,0S1@0 @ß,K000@0@0(0 S ,0S1@0@,ß,K000@0@0(0 S ,0S1@0@R0000 @0000@0000@ 0! 0S3@P0 0000000@00 0`0@0p@TP 0X\AqL AL @0SD0``0L0 014S08S 0L4 P0ST0vP 0 L00 <0 0 o0 0L  v@1S00LSP0h@0000@T ᆴ 0i/@ l@0P 00 00 00X0  0, 0 $K<Po 0-l0L0P0SS S S@P40h$00@ 0hg0 -L 10PU R  00 0 S   00`Zq`@TUh1S#P0@իP010@˫P 02} 0@P02p 00h00 00@l,0 0@408@vh.' -x1@L0pSPL` R6PO PU  .PPi+6 P=1S400400 0<40,0`p\0 P + 0S 00P0P0000 000 0P0 PHWVi: i Lz -0L hFFid -L0MDpP T+>6p@0S P0T0S0 0CS`~$XT0 $S )P EPQ P$ d P@0@0 H0`0@0@TP 0 00 00 0 R,pK ,B@K n%T0  Y08 0\S0 $S P P ,K SP$ "P00 2 0 |2@T0S 0PhM 0 (@ H2! fQR,pK $B@K 20  e$0 0\ꔁ 4R@0 ,KN2@K C ` ~@P ` P00P081 50H 0C0S00S H0H0S 00@  0S 0$S ,K 00P 0@T 0 0i/@<p` \, KHp`h<$h -88LMP(8` `ZR H pK⤠ ;iP8 cP dP71 LP.qP㤀 + uP$ lP&0' 00p 0: Sx+d偱\p 0: S 44,'00M'p7p0gSBT㘧솟Pg 吧FP_ 0PP 000P F0 0|PL 6P&]=00$0S0X 0T&pL6 DFR@6  P< 0u000 6`C<0 PL0Lp0L@A  Z 廻pp 0SH mApKp{cAL70\K@0@T-s*d@ U00S^FA0\ 3pQ9A P \0SX0S D P`"` V < 8f f(dq0,$ `0@_S0S*Ľls倃@ 0P.H0 Vڨ  .3p@x xnt媀pPli M w  40K p@0Y4 4X0 0R044rQBPA R0^2.p`@@ .Me2P@@ `BE %@Bp@$ (0K* #P Pdpp@,a0L0 PTpx`@Fp p  px  pd  pL ~@ -0H0S \0 00I(Ki +xlt<XȬd pd PTp|  XHtdH 4(dD`؜xv|@ -LM␀pP(K` P  t@Pdf (0`0 000@0@U,P,P  T4 -LMp 0 ,Kh;PXP; 0P P0pP ,`@0eP @T T00X s R 0SR@  ,PP 2,PP P;U(K<Tl -LMP$@Kp A?@0CS@P@ T ;P% :P0P $` R@X ά  @4;T $ B@ -BMLM`,KL  D4@P P0pP,Pp1@xP p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K{ 3@P Y,Pხ@0 S P4 M D$ {4KP 4K @ TP4:j  }Pl  uP Hp   hP    ^P  ,K( !@P P1pPI ;T] ,PsdP ndP0 00KpddP `_dP  0KD9KP7 9 [9K00B1  H$ H$ H4Q? H$0AS,P H$0AS,P- ]P D4Q`᪥L$P@| CKAA ᢫L4p(K<0D`ػ|b,T p-LM@PK <@0C`SZꔕd|ȕܕ40040BKs 1PP ;U30 )P0 * P(x$P"x,x(xxx x8fx0f ;V xx| -PL# {P@ PL ;T i8`P0 $"㝬40 0 4  0s/ }S X "1R0 Q R$syP " =xp i2h1 P T 0   00$P 0@RXq 00S0` `0`00000S% @0NQP0  0S0`0S0  000  000 0 00`8  , p-LM@{ <@0CP&Sp,xHȚp̙ȜȜԛ H X 3sSnp 0 1Rdp 0 1(RYp 0 1ROp 0 1d2F_K,p ,02 , F_K,py 1 , کnF_K,xpf 1 , x1$`1}PD1,,141<0]0:/+ (`P0@`P0@PƝ0@X0D0P 4 ;U Kp  \`` p-LM@`Ks 0PP 0 ,P d {PP l ;U xP' 0s4~ x}S H x|x 0-l@L\1`@P PP3 0s S ( 0ha0x`  p-aL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @81 , (A 00 0   000   000   y00 0P0 P0   000   00 00 _@P | p #phiapt L`0  0     p-L M` ipP :TR 8@K   (ᕰp@(@jKp Ki -L M@0PSD0 p` `,KZP& ,@"P P 00SP0 0 00 40  Z R4 @T,Z(K -LHM` pP <@K ᜩ ᙗ ,p` H: 2[A0ASp0<Qd@K( ~ { \p 0<0 L0  K i I6i( p-L M` p@ 8PK L I ܯp 92[0 2Kͯp 9\ 2[ 0@2Kᾯp9$ Kp i i T p-@LP`0@P0`p  0-LM@K,K:pP@9 @ t @00@0 ;P <0S @0S , % P [(K0 -LM,KYPD ,`B0Z=(!P P6 @0S!pW/0 4 0P=S=S  P  0=t 080S @P\  剖< 08@`V$080S  ,Y  -xRxxL M{`p0SX0 L@DT@ O0S 0Kg00KRQ0PQ1P/20S qV?!0 H @0 0K80 KKA0S #K HK)p0#S% 0S! 8/4[ R H0S 0s3[ 0S 3[~3[ 100@S 0S 00 $l0s H?;(Kh $< ld h -LMPap@K 0@ 0 2T [P 㼋@ H$H08#8T K#0pL0K0T[K0K0T`KH0 0 S0K0TKK5K4K4KDp @H$H Ġ$Č(0K Ƞ0,ȠKd0;h` 3K0$,$  2K0K2K _^ P  0@K  0 s(0K!0K`d0h@dhPpKP0  /p@K ῦ 0l p hp dP $ p@h7(K p-LMP0     p@cK7` 0K`0pT<7T0L0@ `!pE-7 0$@Kp! -L4MPNpK02 # V`PP $0S 7XP@P08 ެP @6 @0 K lB 8 p-LM pR2XoP|$ @0Rx1 10Wp Q^KPE+ТJ oPKM.\P x6S 6S 0  MP 60h@ Dx6S 0S S SQ``P`P`P PP` <0 S0PP0``B@;t 0$Kcp VKA$ $ NK@D[0S P@T K Py{o&Y -0L0 S 00CS00Ӥ0YY \00! P 0 000p0 T0 p LPQ(0  B000蔻4  ~$  -PQ@`Lp   0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0P~<     $40,(8    -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#圡@8@`"U00ST P@`\U@@ V 0pP0$T2 00d " u 2P"2堂 \00A S-Q5T"d2PP"@C $0CSL @ᙊ$K'h$ H ` x      p@-<@< `P 0000PQAp|  -$0@LP N * h -d@LP NPH Dg0,0 ( 0@ 0  h    -L 0LR RP 0R > $  |00-PPp0Ll Pd'\dp@ LdOH0P 0(,0 , 4 hH  L  -DL@ iP(0( 00000 S贻0    0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00耐4   0-DP@L0000@@0 0 0 04  -`L̎pP{0 SPfu% ࠟ0S @ PY 00000 U`PV p 0@\Jڈ@P`0 @0O`d   t   1 P-L`h 1 @0Q0S 1 00 P\DX` Q0DQD0 Q@L00ΌpP00CS04@0U0, )0@0CSp0@0B0@p00 +LPP n\, 0O00    t ` G-鄠儐Pp0 0S0 0 BS00R \P@`A   -D0D@00  R P     p-P@0|`00t0L@l0@d0@`0@0@0CS0 @@00 ph&p訐      -1q00SL-P`0L00 P100CS0#@00 0@0CS 0`@0x0(000     ` -LMP@0 2!PB ,K A@P zhhhrhb`"PYm 0 P40S0`00B P, 000S SPp PP aP PTAZ,KPPU 1 ,0Q.0 Q@L00h P8H00CS0<0A004 [100CS@ 0@00I,  忒@p0P@ e P P \0P 00S Pp(K$     ` -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  0ip3PPP0T@$  @ ,  -0 CR 0R0 SI00 -@0LP`rPe`Z !`0Vh?`c0SUJ L0SF I0S\\I@U`T xΓP 0`!Sb/*0S@,0@0I0US8080I0US00tI`zUlIPX*\00S` lP ^I U 0@0^S00\P0S蔻 TД    -LLrLLL`~@0S 00CS00PӤ0JJPuG  Q/0 Q@L00 P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 PP {0S0`00D` 0S0`00:V @V00 00 0 <0 `蔻 8 `, 0 $ $  -3LM, 0 0 S@`TA9P, `3@, P00T$0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +t0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ 6t U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TTD;70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020P$ t<@  |d + 0  Ȕ $ ( t 0 ؜,W L x ̔4   $  0 @ @P 00  Q X00S- 0S0!S+q0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 t1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P bu 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+o0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;; ;0S, 4; <; P T;  PPt P -LtM  k5 8Pڜ0000SrSh5hehhhhuhU@sP xP pP00 @ 0  536%^p0 10 00b0 0S 000-S 0@S@ʜ000 00C0 CTP@K⧯P0: S  0㥎040CP ʇ LJćV@P >7*#000S 000S 04P 0oPX30S 000!S 0+Ln0S 8000S  20SsRcT0S 5䒟䢟"P h@PB-"0S& <"0S"pW820S  p2Rlh2 0o5IP20SH"0`0087"0@09"000 S 10S!@0`00@00@P @P  @Pt t t$ @!00,00S  1R 1 050 S 5h00Sc 0R0 04V` h d+ȬĔ        D |(      0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00uPx00CS0-P0/0% 0P0CS0@00\@DP | H0 0`S  0o $  $(`,  p- L P p P 000 S S@0S~ pk`Pp0P 00Sǜ v|0P@pcp\0P@P P?P 8 80اpPpp$  ,(Ȕ`( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00t P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00t P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00st PC00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\009t P g00CS0@00 ,0P0CS 0PP00(0 00@(K` -LM  @$" (2 P  Ld0S  0@_K  0 B qP$" b  ," (2S  S ;#rPU0 U@L00s P; 0ß0CS@ 0 h0KT#00ß0S 0B %{ K 0P 8"RpW$0 W@L00s PX00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 zK`0S 2S ,\    ?KԿPk  "向0pf 0 Q2 /hQ`0 Q@L001s P<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ tz HnzQ"(K, `< -L M0P䑟0C0 4 , 0Q000 400pP^A QPX|0`00pPY`P UDA  MPP!00CS0:A0*02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K @ l  -L0  0%Su0 SqB 0Sp  Q.0 QP\00-r P[0@CT@xR00  0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00qpP00CS0#@0?0 0P0CSp0XP0,0$ H0@00$ 0 `(   -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR0000$ x  -`吀L p Q0@P @lT00Cs0,0 (0000 0804 <@ -2LM0s22080  20s.xB0Sl2  +`"0X0 @0A0 S6`a4 R, D$+0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV ,`v֡ᙣ{`0S 1 ,`v KZPP$1:( SPP~@P0?8 0 K ᵣ. 勂p  0T00(^@PU 2 AP/0'p8 t  00 dPz0?PX \&G T] P( I< 0 00(00 >%P;0075\+] P 3H( 5.:㥛0E,p 00.S.0@0K`8,0 , g bl]0,0 0x 0 0E000 ?H%000!P P D(5Pp@P5@XeP 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;ꔍ\\D\D\\čl30S| 㮿0S.P,  @KoP @KX$#0n P *XH7PH00: S m JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+\!0S  +P10SP妻 @pK !0p0n P: ᘻV`<H!0S t0S<10S # H0t\0l10  P8 P P`0S00S 0S mP |0SԚV`}PPX00S iHL< @4+D0T@Ȭn8<P0 `Phpc|hgd| 0-D0LS@ 0PUPHP)OPP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T hO0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00 $H@L@ -鈁LMPpH,  F@T @ )PD p` p 00;P'  gIp:0P  010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2Wp 2_T@H@P@L@ -`QL MH p0rSwS ?R@@T WG00}bPw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P ^TH0090` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < l 08 0X  DKxyp  05P  KP  0(P(KX@H@P@T@`L@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@Dh00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Plhd@hV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  _h@[hP[ -PpL 0o눀H`$HCh%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0SPL&0 -0L0SL0 -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #L0 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp 0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p gLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4f4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b f (0,00 0e0`U`1`!  fPU 4e f(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ubkf(0,0e cf,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗P<pȫԫ 4PPL̵D(< y< !  ;< 0S  0  Z  0RJv`V0'dP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 SLT 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HLe@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KZ4G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍX` 0`YU[z -0L R0 R P0 |P0 |@||L0S X@` @PQT0D0L <0S 45`Xi\d: $ T  -L M0@SK+1P K0 R 0华  0-L M0@SPK02P K0 R U0k  -L4MP@2'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'p= H0@0S0  H ,&宬p 0P0 0S 10 -R% 0bST0SL  H0SOWppV00Lp L0 `QV< (  8 000C0Sq004K 8@i0S540 R- @ D 0@  T q`pnp`kp`hpW0S `:aP p @ ` D < L`Pp ήPP+ 40C S@\hh@ {p0S Z 0 qP ᒵPPp0S 廏0SH 0!R0S0S Z@Xw hP P R 0S0SH0S[ D@ 崄PP PQ@ -pT RJ 0S0S@000C0SU4K` PPl0S40 R| @ XP D c8K0K, K\Pl0@0 ,00D ,0 TH0 X00X0H, X00X0H XpPL sD@ UP |H0\嶇0P0S0L00@ D0 #@P\ 1 0@0 D0 .`pP@  p D @  @ `?"00|双t8 勌d8 X8 僌 H 8ߎi\d`X Ȭpc@  !Lp@-@P0S@ 4 p0S\ /+0;;0b @ f0S V,0S -P 0 R-P导0S 00f0hH 0Sl0 0 PHh :4"pPeD H 0X   T< p  -LFMM <d;6*D0T0C0 :!6+P( 衟00 PuTuM 0000 *0 00pg!$r2 $XA)000@0S ¡BKJJ`+4KjQt p$  00C0tp \0@ 0R 㠡4s~R iD Pe 0pT T  < XH H t  h    lJ  $! -LAM p`@PBK( H .H ` 0)W   ( 0R $KV 0S: @x*P 0T: SD0P 8 0S: it hD Pe ,! -LM0  -X2LM 040p  4 ;;S  0SSYEPPV 0SJ4 Y, P` ,40+@+PU`RP ` YV4 "P4,/+0;;0b\c/00S@\40 @ + @,0 T0000 00S0SU,0S x* @f40 TP0PPP4@ 040P<  40~p  -LM⸑<0Qp,0 [8P 00 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 04P  KW?K0P  40@ hKV0 0 0<+ 0SP0SPip8!  0   p-d`L0S TPT 0@1@PK0S K K000p  -@LPJ00t M0-LM0@0P0f ş'00CS D,$$'00K0''00l$L  0-|0L @?PYd0 P 0S P 0S0S00S0 $ d  -LR(M00Qp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0W0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @nP SWSH@DPK`0PO` 0 @VU1 R 0 40H<0OQ 0p07 g20@ W,L4 Rw0S04 R# pyğ0 ?MU404\ 1> A0 10408 j  B V V  V p(KI#0S:B# 4 00083@ @U(ß4#0P\Q (pt"0#\Q t0p  0S80Ÿ00"\Q "0"\Q >cxŸ"00K\Q00d0X0lL"0T"\Q00000K 0$@ Ÿ,"0\Q00"0D00"\Q00000K(0,@!0\Q00!0@00!\Q00 000K004@!0\Q00d!$0H0d1\%RB 40O0@41<1\%R404h0 404O0@ 0@n"F60N"00ZE"p00=(00s03ix'(Y0Sz Spg40O0 @btg,p4hpU %T\% 0-PLM@ |U K0T\!0S:N i@Q@<04!\Qp"P# ~ {1 R(0 \Q, n0 \Q0O(0K / ^0 \QpUhRd0 R \J04 \Q0S: hp Tt0  -MLMDEH <\, 0X P( L8 D > L(RH80 )P D, 0R (KX(HH0 B8( 0 ]'48HT00tpǏ Po t Po8"5XHpQ0K@0@ 0T QQTʑ 4 H8 4R 4(R3^z  10 8H^ fHD(g4(Zk >K0S@P8 LH pCt#0\^K  1   RHHL<0S00^3 0 nKH(`F`F@0 00!"PH8B\0"\Q 0K0S@0@X|2@@000QPQ0 ! R H8.K ' 000<0 !?0003Pk4 j4H\la@ 0@  r 3 H"P 0\Q <8! 0@0 00 #0K0S@0 @q0<AHD ip T|X0,@! -LUM,0S 0, ,00806 6\Q 00 @xF0P: S S\ ST6^n 0(ŕ /R \ 6^i  0 RKAAh ,hN($R>Kp l 0 \5 XE 0BOhE?DE SpU\ed ` 8U 4e @E Kp l lBnK`F`F@0 0\0 PL!P,C3\%R 0 L5O0@嵰3 R @U(0/08 20 \P 0 \UXe21COPU`p2TU Pe P`hpǏHe 3 D 0  R/ $2PX0OD%0T%P5 H]aHDH D Pt0r OS(!\1pTP%Q PT P% X0 S R<0PES00T1 0 BnK`F`F@0 00z  P( 0\Q) 0TUPe0S@0@#0 (0TUUh0S*W.K \% X5 m0 L5O0 @MD0TP%0S@0 @ipT|H! -L@M\@KP`@ O 0 0KL @P <` p(t0 p0\Q `,YMpH  0@K FMH pT\P -LpP@T% @0S 夯 0`@P``0 0\Q ,Mc00i*P 0: S`0P\ \ @ L0S 0\pTPeD 8P -`LMXH RS, @4ȟ (0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R n&|0@S K 0S 0S 0S XX 80   O  $ Q ?KP``F0`,_K`P`P`B2 MP`K 0 N2/R 0O? 0@l& @Ācp 0M 0RB K2@ּşu0S %`PU`0P@`P`%`M5 R 50,PO/Q o 5 p@PELş@_@P004@J%8Po% "2"_K`PU`P@`P`D0`ğ0S z|4@T s@T T0S8 th@T `b@T *#0S84Dp {00Dp {00, 0R(K`" (?K 分PS3T@@@@0S3 R2 ,ß 0S. p, R*D0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʰrH"0TBS8000, Rb xb@ 10?Ÿ@ ,0SHR@?@~?@0Ly?v?2s?!0S tA0S 0Sh0S喭Px &K|Pf 0S8 X8T/9x~p{ 0S^\u 0S\HoY@lJ @媚04@0 0T vP W lOL a>0i4p\ %&h d&LP,n@ p xX8&L&P! p-L@M P`K^0S 0S  x -Lb@P00"p~ N0@+S+x \ \ \ \ \ \ \ \ \ \ X \ \ \ \ \ \ \ \    \  \ \ \ \ \ \  x \ l \ \ \ \ \ \ \ \ X 1w!0001m 0>0!Sd00!000|1 c 0|t1PdK@1 T 0bqD1  8嚺0!000 1!0000z0pSP`g S0 RSV 1P@@ 0T0PlR\&i&0+Xpl& &X:(8XdȬ   \ -LM`0 HP0pW-"1> R.#` 0@ 0. 80pW080 0@P`Z  P 80pW080 0!`!0@0@Q ڠ1 R= Ы / OCP1 ``Q 00L1 R R 0S0S R0S 0S0 0S P CPPH0| `Wt 0@0@QTY PW |&08)x -\LM,0SPڼ0@Px@ tP D x 0, xPK`@P`RxP t` 8ڼ0t/x@ 00T 0 PoPpǏ`pT 0/ XP`1> 0P@`UVW4HTLd@GpǏpXʠ @ hK*J=@P-m͟00,0KX 0-0=0, R|ڀ@ |P @0 @ PoP ` 4m|0倠O *Q0   0OP`Ǐ`L 0T<\%R0ɯ \0Sg < Rc l< R\0/ X 0 0@ @1>0P  1  |00@@P$ `h̟0 P,@0[0  0, 0PK`@P`QP |` ʄk00*(K0@0 @ pPK`0@0 0P@`P`ȀgpYZt˟0   ?P 夐 U 8;`  p l JQ K GD Ka0pK@p l K P l  R@ T DR @ӕt0 BR @P  0@!K000S00S  R K00KP!%601@P00 K hKL H0 $,10 404 10 \Ph0O0 /S x1APh00LK 0S 0嵧KP,!0\Q00h0 00O0@FQ pp RPm0Ws0 0@#1?@rp  \1 4T0U '4'\xLL'Pxd'pT(w'L'W\D1> 0P@`UVI K60`0\%RF 40O0@0P0\u Z=0PV='=@Pa V0 8Q`0@0@TAT!0\Q  0  0S2 K00K 0 40O0 @=P 3 U0  aF  `>P K4"00K00Th0S1 Gx |Pw  S -D0 ML8 , 0N$ 0pEPKp' -L@M@ hKE0 00, KX0 0 ,0S+ڸ P`Rp Vp`Ui@P LP H` C0hKS 0 P@`R,0 S 00(Kp3 3  -D0 ML8 , 0N$ 0p5EPKp' -L M0 0Z , :0쐟쀟,0  KP, P U, 0U PU 0S\0 | 0U R 0R Z 0@`p0,0 ,(K|@-0,0,0S@TTS -UMLMP'0,0 00CS񟗎; `5 5 ; ; `5   PP 0:0090J|F>K0C 0C t5 66咛@ tD|0 1p6 bB! dd6 `4 X6X&Z4K0d0`00 0SZ S;;SV~KpGpG,D5)5(K \%5R 0@`5 \E ( R01 0#SP %0\Q,0(0,0p0t@(  R01 0# SP R P(%0(%\Q0X000@\0T4 PD t0L4 HD kZ4$p0Z0 "0`00@0 0S T r  Pğ  @$P%DPpZ#0P1`0U0:0@0PV @ 0S0SPV@, 0R(K`#A< 0 PF $#0\Q: 0@0 @L7 0@h5 dE GB~KpGpG@0 002 RSB 0̠  0SS 0?044 0 R|P p4"04"\Q 0@0@U{ rjsw  h Ÿ Pj /0p00(0!0C0@0 @$P0PsZ1SpA 0̠ xd 0S `5H Dr {P( 3 0Pr  ^ gP  Y0p0CZ0NPQi<  4 = = pTT= P0<(0  `lJ( x`! -LM$$ @0 @BPd( -LM44 0, @BPhdC( -ML M8 `R0,0 (@TR8(04 KK ,.1K-K00-A[S00@`VʆT7(K MK@AP 8 RP0S, 0R(KQ0.S 8 0`80 R`p `(00CSSB 0B C C B B BP0@S &P 0S &00xP8  8 R 0,-1K`0KKL.1K4 E0-1[8 00Rp 000 P8#8E c(K 08  8 0 0C0(K B(K@@@T0W .80 8 Pk 00C0e0Sz*<ş 0$`Y4(K` MKH@80@f 8 00C0 A@P68 58 RFQ 0.SA$PP'TP`& 80S< 00@@[0S ğ0N00PE00C0V 0 080S ß080S-0S`ß \3 RP3 RDß 0t P` S0@ 0: S00S000&<  0 80Sڒ~KpGpG@0 0l0RnKL@`FP `F 0@0B04"092 Re  0`UAPb .8 q)8 lPlDAP<0@ 0$@ Ra !QPV` H@0 0$@0!Tw $ 0(K MK+?lPLAP  @0 0$@iLh|lJ<0p(LPhh!4 -!̑01@!1PL0B-0SC 0HS8000PP4  0 0S 0` @$1 R@ 3P ` 0S  P_0HS 00Q | 0@ 0$@00C000P@00 H $  -LM$$ @0 @?P ( -LM0p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00p2T pW 0@P`0:0 @   0@pW,Q  -L@M@ hK?|"0t",0KX l2l"0, RڸX 剁0S\ڑ pPoV0U.LP H` /00CSQK K lL K K L !QW R P^ R 0S0S001hKp x p0S0@P`!0,!\Q0  000S hKX p0Sʸ0 ,0 S$ڸ 0hK ?hK :AhK 00 0S Q 00(KpH M L< TxLl -80 ML0, 00p0>PK( -MLMXXXO0 KPK(JX!J,0 HK TQ>? R KH!8KX1Lqp Q[ PhKXaXQxKHŵXKXQ$ETnTTʠnxKXqQQ$PPpxKXq`0\3  BqB00B"1K1X0 000SXN0S  KX$@QPPӼhKXa`0^3  BQxKXq0@%0 B 00B!!L0   KH @ 8KX1 LqHKXAt0XK  Ba?0\a/PŔbL8KXQ`AKKT K0dhl!P5K(@KA/@8KD`@KXKpxKp!xxa p+>Kp0Kx@ 0<0|0XK>XQ808t< Po 0c O`VP' (K0X!0,;+HK;XA ,0SxKP`}G4K`tKDKX0XK @OxKDhKXa,HKXA 4 X 0`OPǏ`XKXQ 0 hK5TaH+0S 3S K DKXK0@O8T 0p@W(K4!R7  R\0?00 10  B\ HK8QLAUʠ KX$5S.pPl h0U`0&. VhDhDhD.. VhDhDhDAM335X ahDhDhDBEAGLE hDhDhDPANDA hDhDhD'Vp4Qr64ԀjXU-Boot 2013.04-dirty for am335x ` xV4lElEi 1)  X`OV! d0 P:l\ X00 pW W !   R:/lE$$ //    TOР iHM|! H4P  MOЍHM! H4P  OР iHM<" H4P  tOР iHM" H4P  OР iHM" H4P  4OР iHM\# H4P  OР iHM# H4P  0 /D0P/D/ 00@P/  00@/ @-P@`p00000000 0 0000Vlp@`0t}p@vp@-2\@00  <0 00 P 0PxPb#`0p@lE % 0S \0 +1 D     01    /(%  801     $  (  ,  T /(%000, 01 , /(% L00 (  ,  P \ $ ` ( 4 8 /(%\0 0( 4@Xl pRR/(%0 DH/D@-@P8  800/0P(&'  '(&/D0P &'  ' &/D@-@@ 0sP @0s/@-$@$ 0P $@G@GP/3 8 0s/00@-  @@ P PPP 4P  9904@@000040 0$0  (  ( R/4p@- , @@@l$ @ T\40,000$4 Q  hP @ ```#\` V99;0P@ @h00@000t3\Q  @@@<#p@ T99900002pQ |  R0`  2` Rd  d0S 0 p2 R  0SH 1 42 !R  2 R       R0  1 R R00  p10 R@  @0SH <0 41< R  0S  0 0 R  0S 0 0 R  0S H0 0H R   \0 L  D0L R   R0   Rp&p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pppE,0    0 /pE$0     /pE 0 HpEN-000P :"  BR$@0``v @@  P b@V@T*Q* P@^@T*Q*_0S@-pB@P`  LL@D3@0f@  ,$ 30fP6O@T:YYZ0????////@-@/@-@@-0?????//0 0 "0b0>?0S:0?@-0?????/8@-P@?00 0#0?8@/@-bP/@-"@B@-@@T \ ПP-`0@@ R 8 RP ( 0 /O-p`@0@0@0 //D 0?2/D8@-,0@@@+ P8 <@8H@-;4 <0< S0b0000PH@-,0<  b H@-@d@-/D-`P@ vp S n Ppgp@-P@`       00000000SplПM DИ堀H H4,, P 52:++4`0@lEiIP//@-1pe18Z脀@-  1&@Z@-  @(GZ/////////  800//@-@0   0  lDt@2lp1pdm1m8O:@2>D 4($(\1ALPtE$PZXZ`ZiZ@-N1qZD- (00<0@P p(P@5/P PU8@)  A@b$HH@< @bN@(D B`BpB@` 00P01@ 80 04@Dp@cH@D LZZ@07@-@0`P`0'P  D1K40Gp0Sl 00 5/>ZZZ0 A 0  a/p@-@ M'p0S. Pl 0Idh x00 at0MIPl IPPl;l0PP 0  00<l)=lt0x V;K40MP$P0 0010 0` R R 00 Ps0 10 0 dQ hP Xa 00,@ 00 ЍpZZATxE ATATBTp@-0P@@` nP =pf8pp@-$,0\ $00(00,00(o[0@  /T//@-h;[0@-M@ 00<8 0,0@P0400($ 000 00 00  000z Z c0C0vVUnN/@0TP  @0 1400/Ѝ0d%N[[[[\^ـ'\@-@ /F\@-@ /]\@-@ /q\@-@ /\@-@ /\@-@ /}\@-@ /zu\@-/P l"]//]M00000cSЍ///0//3@?6CD- zP!j@ @T:D@-P`qA$J@ 10# T:@-O:?@-O:?P/@-O@T@ T0?0?O@OO0?@-O@+OP/0 /^@-MP@q `P  .T  +@%P  ..%.|.xp4hH`@XDЍ^^+^7^A^J^R^e^o^w^^^^^^^^^^@-03/Rp@-P@  `8.E @@.@p_;_8@-@/EPE 28@8@-@.]FPPxth. l02/RdEPT EHY.&EP8 4R.8O.8``#`V':`O`g```@-@4% I` @-`@C.\H4/` @-`@6.OH4/`R@-`p@P80@ PP@U$N-0?"0pS p 0 D 0S YP@@; TP/`@ 0PV0@0`% V0@D$@PPP`@4-G 04/ЍZـ)aF-p0,`(@4P0 EZ Z-TT`-- 8 `D000-- 0P -80S G0`00x -dDs-G& T#2P 0Sraa`aaaN-`lC. p5P3V<3@ @mG>ETP@P*EP\E- 22/戰R .-#TGCP$-JGD[ -CPt#- h-8GQ P-1G.G 2R RR R P T0C @ P 2/T ,ꘑ@ 0@D0G P,kGTAT0S|B DPh<0@]0 \  ^ 1L1XDQ S0`#PX`SS SR@d00 h000DP l0 0p0 00EP |, l 0 HP PЍE!b$(bV'=`R`g```Zbybbbbc$cIc/N-R(MP0p`0  00:SS #S  *P{ @T  F0M3 RRO,i ^ T#q? T! T0 T@TF TN T8LSHX00\00]00$0 000^@PX$  aRx0dh 0t0 aD@Pt"x~BlDlp D@ 7/@Pu  \27/@Phj@ 827/@Pc D+m 27/X@z  0oPrAJX0H0\00]000 000Pp pD0S "0S+|+pE  0pY }2A X a]0SY n"P @P0T!(`0F3?3/@!E^ 0[ Y Ph@^B^ x+E  0;/E  0@(ЍEmc%cccccdHddddds@-PT`5"P<a@P000`@B+ 0|dd$d@-&+eD-MPp.`@U00p0 pp P.0 p ct0 0x000BP |000 00ODP T*|It 0  0Fݍ$$cIcF-I딠`*@4 4pD|Pt.I.0O0R .0S0* 0S< *P U *@TSff$󪄀R@-`@*ڴ!P*$ pP jZPV `PZL *P37Z+:gD&Ggug䄀N-hMP )`DU)Dy*DUD @+pyDUp  0VP+0,PjD $0l0 D00 0F*0 `0QB V[R)`p@0`L0'tʟt: R R`!   D  0@ m0 V ]R0]Q jy@``3000Vp@00@hY PJ0@ aP>\ BgSU00@?U0sS옟 p@P)0nS sS9U7Y` D"P0nS` ` S0@nS T@8  P  P@0S0sSg 0$@T`B00vSPP%T4 4.FP T40 pPU \laS4P  sSy04 |4ylS q lSpSRp pU U @ئ@f PPT  0PU`  &@t&F 0@SYEFHFFFFFF> T0 %P0d%\ %@T?%2PDU@7d%U@0  P1x 0PP.T$<d%T$d% b%d%TTP P}P~%4U y@Pq|@Pjd0hSBCL0P1r%045_1 k%01f%0  1a%01\%Y%01T%U01M%U 0 1F%U0$1?%29%|7%t U@P 200 8FpP  @P 02 0|1O .pPO00pS"APp`$$ (0@Px3,0lP$ 0(00 0$UHaS  @P,1 0@P4dS *0@P$$,0cSUU@@UP   P @\`/ 0>/@  @P0R1`ЍFIrgrrr"s%sXsssNFssـ tt-t8 Iꄀt0rZ Lt0䄀Tt[ pt2tvt}tzttt.[sttttuu0uGuUuluuuuuuuuv;vUvtv|s@-@-OR@-@0iS cS9sS tS4```` @P&yWP $V/WWP VP VPWPpP34W 0 $\Wyyy@-$$  `0 0"0 .R00@/R 0S/R@-P@pB, `2"P  0{D{y$\RF-@M8  pPPp  @ E` "0 0 0V PP@(` 0eST $u""ЍJ{{\RF-p@   ` {PP ЍF  zp `f@ @ 0WP ,:"  Q0 Ѝi{RF-`M@,  pCPP  P1#VO  @y` 0uVP !Ѝ {RN- `1@ pP`!  @U  ppPPP`!@ 0@VP ! T1! T!!b<PYP  %T  T0 3?0|0Z @ 0VP T!YPZ0 pP`ЍJ{{{{{{QzR@-V@H! @,~!V@P w!{{{//᠆ 0P/᠆R@-@H`! @,W!@P P!||9|@-@ *R T T T  A0N-p@P`f렑] BPV[ZRVp(0*S u@0*S mPWAYYYYYYp3P P"@W$ Z0Z 2$2000#,  0(2* 0P $ @0, 0@ 0 0P  U UgPtT:d \J,,2SeP p $P 0 UpPȤ0,2"0 $ [ 0 Pd0=Q5  00P0,`00 Pfpn pW 2 R R 0 S3P*'     G P3  L$$0PS D P{ RB` P 0 ``PPPT0 S@P PU0 LC #8,  XuP LO10a 000"  P,PU) 0 p  P W 1W) 0P PPS 8Q0 R RX,000 013@ P @ @0@'P 000 0 @P $ P:  P)%Pp S 0SCލ@KЋ9׋9VvlMҌ=RD-P`M@`P x u r A*`P:g 6$4P Ud@$ Y0 R Rxp d0}\{P 0 H000 0oPU@TS0ScCP P 00 R ßR  3 0EB@<|=x,0*l(0ESlT PP  0P2  RP P PURp OppKppp`Pv`>P`v`?V{tŸQ 0 ` %  Pt@Tq 0` PP 1 Q PP@U@@JPUPPCUP@ 0P:P@`VP5*1 U ` P P  0 0R0  B ` 0 0000V0C0 8 XP |x`ЍaЋi9󍄀@K?[r̎؎掄񎄀#ـCO0@-M@PP"TʈG 0pPd0  00 R <R80 ,0*Ѝ0Ώ@K鏄8@-@PH0 R<80PP8 @82F%N- MP@.p@,`P \ P LP <P 04   `0 0&0`0@vYP 6++7+)P9+) 093?@00+ @@  0UYP 8+P@9:+00 @@K Ѝ軐ŐȐ琄h$RD-MP@4R ``0S 00S& P# 0P000S bLU>ʁ4 0   d!!!  Q4PEs+U%Th,d3P `*P P`p  P` p4H+"5D+U5>+6:+ PHP 0SD67*+0  00Ѝ2F)4K8@-@00$|PdQh \"%PH@80,8@2FhmБݑN- `@P@\ 0p|p3W pYP)  0P"00 R|  0 L 0## UT:0@RP0 @@Ѝ쑄2FF-PMP`0@4p  0 0 ## "p 0P.Y   @0S 00S \ RhFXPD 0## QP06 @Ѝ2F2ZeqN-M `P:Y`0L0P@  @V@<0P (*P  : 0S @vpPY L0S  XLL0Sy 0S (|Pp PL@ 0% x4 1/P < %% 0%%SR: PY `p P l`p`3ppp30 \0 D p P0 TP0 <P300Y-`0 0 jh0L 0X0P7@L p2$ ?%@`'&匰'D0SWO2yPJ- P tE@pU\7\P@TH@ dPY  /pX\ KV6F&p @p p `@VPP 0吰  0c p0` P00L000 01/P 8MK@Kp@'r"Y  0    $ (,0@Zt@4p媡p 0 @ W@@$ PYL P  尰 `4pp@p3Wd ;3.2&@P. PP*h0 0X `0PY T 0S T00S  &R0P P`0I0 h0 0X0P`0TPP0W%P@MP 0HP  CP Upp"U-P@ 00WP0@嬠0P%L1/4U. Eᐰ' I 000W  00L00P1/P  0< < 0 @ PY  1WP! \<10P< <@@-@+hϿPY_ pP@ |0` 1/P  @  Y 孿P@@00<Ѝ荒%Ї2F=ǒђגݒ蒄ޒM (GY㒄Lmܔ2Őᔄ&&9AlF-p$Ml`P@7P  H2U U U PzY1  1 O@@'fP='PPP@6'\Q3'|1P h`1P LD0S 84 R ($1P 1P 0P 0P  R UQ@& <0R&k@PRT&$Ѝ`Z$ AIAI񕄀AI8`I_I @I^AI|`Ix`I$X`I+GDA>R@-@@0P P  0iI2U@-@`0@DfQ`QT\ pP  -Q  (}PP@DTP ,$0@-@P,M0 0 0(0000@ 090SP `9 P@ @0@4兺PP { P& ,Ѝ0,$R@-@  -Q  aR@D0T pP`PP HPD  P(P `V×䗄R@-P@pB, `H P  0 j [ 1dP g 6 d` 0U<  ӽ00S`3 00S/ P $0+SPpp$ R0! RW  RB b00x  QA  nU U68@fdT :T+PEWU`ȀhȀpȀxȀȀȀ @>T t5:PTd`HL8@,ߡGchnwȢ}⢄բ󢄀BF-@PSp` 0(0 PpS$&R 0(P (P0CP0SDY0  C,$W 000` p|pp00p!!0S S  1`0P H00 (0(PHPt6S` (P `6VAYa+ Q@-M ?@0 0K 0P\:% PS DO@M G0S B=p&a` `  /00S S S!000SLp 0W1Z$ЍNxUGـb죄tq鄀ݢ%/=7@-@!P=10s#4 !P ( H0(PHP1S x!Md!P!DC?0B/ s #4>LivǤRD-P M@= µPP"%P  嵵P %,4$ 娵`P4"40S|  p噵`Pd@c$PP $Q : K@ T `P0U@#PP 1S]@ T P᪹pA#@P 0S P Ut41S: @HPm* $@P$U@PW*`P 0S U@  .P iD*0Pz 0S .mTk P&@b0SlgU K p F PA @0* 0`UwL$8@-@QP PP 0/P8`0UA U8\ ,\0(  8\  \ $ \0 88S݀-@-"M/( 夷@c"ލ@Ѝ/P@-01,03/SP@-01(03/SP@- 1 03/SP@- 1$03/S-0@-"M#.@, iP"ލ0@ Ѝ/P/0 cP/0 c R/0 c @-R0 00$03/@|cS-@-"M@T /( *@"ލ@Ѝ/@-0@"M T @"ލ8@-@P@T 80S P P8M 0 /M0/M0  /M-Ѝ/@-@P0 @-@P T P @@-`P@pᨱP 壱P t坱P T :T 4u0j  /@-Q0@QxJpUhDQX?DJD9(0Q0@2@=īS̫髄񫄀p@-n@P0 44 C UP T@TU0ST {xU s4P@0`@ T   p$SX0Pp@- P`@ bDZ $0T: T@ppN 岱Np@-@0```^P^PZE U00Pep 0 cR  a4 p0`e``0 Pe Pp Np@-@Pp0D R `QP 0a   0 4Rp814p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p NrF-5 R0SP @T@~T*@!x51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0    P tPPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~xcQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   0!` 0dSbʬ1 4p4pszpp~p pPK P*h1VFX1 UT!  0 ppp2 pTi  00cPp0g~p~ppp' 0e  0ppVPp Z0  0 J 0Z00 0  ` 08S80< SD <0@00000dS$ 0@@0N @-p0`PWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   L@ D-@QTDIT @Z @pP PGQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000  N-@Q@%TN pPWD`ppVd$0S      S   \4 g00pp\ `0 0 0PS Pel S80[e 0 0  F$RR 00R00@ 00 0$R0 0@00000@0 0      ᫮"0 g @000pp[- 0 0 0 0  F$RR0R00@ 0 0$R 0 0@0000@0000000q `(Y* 0 0  F$RR0R00@ 0 0$R 0 0@0000@0000000 `7B(PP" 0 E00R00`(  F$RR0 0R 0000 0$R  0 0 0000000  @h0g S  p 0p    W  ` 000@ P/0 @/@/P0$ <0  404$0Q0@// NF-PP6 ,`P P. @P P0ᠬ'pV# @P  ᝬ佪PẪpP 9/PP PVP P@:PPF-pR`PU PU 0S- @ậ0P) @ᴬ0 s R @0 S T ,R:S,S: S8 0S ᚭP ᗬT" !* @@T0 S :SP0@0 R \忬PPdwP (g'00/8@-P(@(( GD8\,$4D-(M0(0@0`@@0 @0S V 6P `P` ePʡPP @ TpEW  0 (Ѝ,$85pN-R0@2 Q`P@Z  0KS{dL0  00( 0 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 0\- W  .RR&pW)p0 0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T m ၩP 8 0 (`Ѝـ85 `}  $ /"'N-M⠰@Pp`V018#00xh 1/0P  P2   D1/P0P@U T:UЍ2F@-M|M ȍ(x0`wP &(0"0@?Ppp `0@@WP0 000 Ꮱ|x2=P h&@P PH|Ѝ؍,$X5Ү:Iݮ2FN-@ MT#T018#p0`| P0xd 1/0P     4J>P0`p8 VW:V Ѝ2F@-M@M&?@?@P +b@Ѝ؍ //@-p@]4!4\\0 (!\0 !\0 !\0 !\0 !\0 1\ 0\ 0\ \ $\ (\ ,\ 0\ 4\ 8\ <\ @\ D\ H\ L\ P\ T\ X0\ \0\ `0\ d0\ h0\ l0倀܀݀8݀`݀݀ ݀0Դ0𷃀h(,N-@Pp`P9 @\*0`p ``<Ͽ `0S*0 00ؠ3? R*[Z :`p[Z* PЍ@-PRp`@ 0P 做P003?0T0 tP003?0, @-0fP 0PF-(@ P 0p`P1@0S* ! p `pZ $0J'('D LP@AJ6o ap@-P`@iPp 0%P 0pG-`P $pU@PW  0G 0P@N-` MP8@P:pVVZpp@P  0!SRნp Wp 0f 0TP @"+ 0řP P p6o`'`t 0`呜P @T `@ 0: 停@P  Ѝ8@PcD-Pၗ`Pϝ.ę@P  @P`pP t 0qP P @ 0>`PЯ89௄Z7@-P@*P  0 Ѝ0@ Ѝ0,@-3Ͽ0#ЍN-P@`p(40Y 00  0,0  0P p 0"p@-$>, ( ЍN-`Pp(,Z  0˛ 0P Yp@@-3Ͽ0#ЍN-SpM@`(,  0Pw곖PP mP !NPPc^00!|1偛PPp lNh.`p)0G1 00@1$0000P((1g  0  0L kR, $0 0 0 0C kR0PZ0od 00`2PPP@ ,pЍU`51[e۰簄,@- a  0cN-8Mp (|00040eP8`0 ⮪  0PP T  ϩpT  @0S@PU00 d 0P0P0 D 0 (4`(PF,@P8Ѝw5 .(D-`PM, p 0@ 0UTup W V0 AM1@2/@@N @@c4?00@09PЍ 2/ k8@-P@P8Mޗ 8@ N-PM`pPᚘ@Pd, 00@TpD-@2oP`$0P0 pᐙPP  0 `凙Ѝb\p@-P`ᰖ@P@ Pך ppj0@-@QMP4R-8\ 0 0L@xd h0 T0 0(@Ѝ0脱p@-@`Pၖ 0p@N-0`C9pP"nP  p ` 0&PLx   UT  0jЍ跱󱄀#s@-0d `PP 0S@4O @8 0 P !V|UD-p@W 堧 P囧8 ћ  B`40)W ㈧`脲 000R0/0 R0/0/0/@ 0S/LNꩲRN-`p@P-0A P @"@T|0 PT P[y( @PULN䗄@-Pò@-    N-P@`10 P @\ \ ` `P PpP0p0 00Wp``@TЍ@-DPjò0p@-SP@  R0S 000`0 0   0 p8@-@P0 PP 0P8F-P0@pS0S0S $g0S 0W0 ` V:\R00S`P RPP a 0 !0\R0  Spp 0So R]Hc 0PsT$P/@0     0_S = Sr//NF-@0S`L000pS|| pt0010 pPqp0Zq S(q1S-)p S ܠ yv  P* q 0 ! 0 q 1q0S 1  !`lP``P YP 000S PP 00ᲄQXOLNp@-` @R Pd e PA0S  `0 00ppR8@-@P8@ P \P 8겄8@-PP80`@$SA0 ?S8<4#8͠P8@TLNJ䄀F-0!0U `@P |K=ʠ`1Ppp@AᥠPC @T:Z00S + 0S {&Z0S00Ѡ@̠P0 @ @@TP@@ @ )PP\P NﲄLN2N-@ P` Z pkP  @` V : PpP P000-SP =S P  +SP00 P /P R  5P  0-P X 0 5 1Y P PW:00U 0S pp pU R@   ᢟ᚟`P00 ޟPtU P0 @P ʟPT ЍHp@-`Pp0AសP @Tp\p@}P0S00p@0Q 0S LN2p@-@PM`/ 0S, ㏟P 0S ᕟP7D|00p0P 000 0@ @0@ 000000 0@@Ѝp虳`DN-00MP$ R| `R v  @T<7AQ  R RR  R 6 !`0S0 ,0p0`00$0 0 000CS *PQP@ TppW p @pWpT0q0T p ,Q00Skpqp3jTppWuT~0S Q[00ZU 000 0$$00(0 :g, S) ͞0Pi ՞0 0( m y  သ $!p  00S0 R P 0 0$ 000  00Z $0  @p0 P 0 0  T TQ T 0R000S #SaP [ qPZ2 Wp0p=`=PX0`S00V Kp0P`v >00Z 0 0C 03p p0 Q0P R@ 400P 0R p `(   (0HW`p 婝 ᥝ0Y( pYߝ0  1414c ;ÝP 0 < 1`v 00f`43. 0,043 RT#,  T  V 0SS 0S @ @p @0 @p`0SPPUZ`0ЍLN)}NY[PON-8M@ x pP4$P`Pz(P0P,PLV $< ,P8 $68300` 80 S 0050S[ U` 03/`[ 0KS0S E[PA U[  U0S(0S3&U "U U#U $U,;U 'Us\U |U 0S 0S 03/03/ Pp# v   03/03/`p00 0  03/p0P0_P?P {P$0  ol if 03/]_0  03/U 03/}Pp}PE000S C 03/'Pp20000s030/&V" 03/ |V 03/000Sl  03/Ppq_ 03/pP^1 !O p @w 9 D1`R`'4pw1a,0S 0&0S00 000u  p 03/#,`V,0 P!P,0S 8ЍNLNlӳ@-,00$0000 000 AЍl8@-  ڝp051P0 0 W#S 0 *㬘 *㴘0SG m l L 8mH6UUU갶ض`@-pMPʼn@P` 0ӊP!,  @TЍN-`@P៉P@@<pZP  _0s TS* 6`P >* 0(`$}5?? 0 }? p  ,P PUD@@PƾP9LUη`@-Q p$`@K  @|P P:5;P IP |u0Sp 0Sd@PP L D0 3?TU2/@ ST15:@r^L*W DP( "0S $L 0P @@׈P 02/Rl0@3?0000g`=Y`n踄D9D-p0QP@ S`A00C00 Sʀ0P S0000UU0: 00C000C088/D-@PM0P`0 `@`p0 S S S4 S <S  S7S S2&0@0eJ00F 00C00S0@00S ` 0@0S0 S0S ` 0r@0 Spp Wh0p0000 0 p 0dp000SЍ88 ~Q@-@ 0 S S S !@0S S S001G@T0qp@-`@ vP (00p@PPpD-P@  ̛@Pt`) T Ps@DβPP P@z ²PX0%T00S U T&15`?bR@-`P@pPP4 eP@T䗄@-0M!  AA @ A\PAp`P`V" P@   RL: B q QaA a `W p@ P Q\ B:\:Ѝ@-q( s 0⾄ 7@-P@P , 0=P0/S   0/Pd 0   0$P 80   d >$$P U P e,00}? 006S  0)06,U ,U \L , PUZ0 0 00S 0 0Ѝ-8s@-0% @0`$0S  jS PU0S `SP 0S0SS 1S1S S|„N-MpMGP@?P`` @ 0S  R  p !LMQPZ06,0 3/R 0S0SSJ ό000 儠20@00 00 R0  0 z 0S06 B0S$R"S S W L@ M\d Q p V L@ MK„5Ä@- `@`@Ppz0@002A00D0000 00003/p%N-RMPp` 1p`p@6)/PV 1 \R Ep0㓶&QQ; Q9 <0 0 8< 4 00 8< 4 000 0CS$,4<< a 0 ,0 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKȄȄGɄNɄUɄ^ɄgɄ H- 0` ?0?0@0M?@?@0F0p@-PP P P p@.`@ ?P0?p<ু/00?p px>F.81˄@-\MXP@p,pT%H`᪀P 0p 8<(0:t唀P0 `厀P0003D冀P)0p ̈́ `ƄPpP P bP  0L%080 0<00@0 ?00SS  囄 D唄HL0P0D0T0@0X0000\ЍY˄˄钄˄˄ 9˄dL-$M`@DQ@0p0< أ@P@P$ 0 R0^ pWp"\p  0pP  0pPX P @@H p0R 0c0$Ѝ%2F ̄9Lm㒄"̄0@-P@@ +91˄0@-P@@ A91˄@-DM@P0@,04%XIT`pP000  D@  88@%̄̄@-@PX0"01 R 4!@DO?0N?@%@-@P <0"01 R4!@D4A@%D-`Px0R`@q1 RZ e?>& < 8 1R4!f4a@%̄̄@-oP/@-,@02s0S 2$8@-P O0"0 X0p  pPT @T*0qs80 "8$̄p@-O``0p<0SP PὝPJPP40Q0A0:s0  0 P *0 !0)o䠟*D 0@9s0`V0`j0 uP+0[0wp[0z0)*0 "uU0 "0i00A00蠆@3̈́;̈́ $[̈́p@-`Q0:s0P@7DP0@I0j `0*^P  0 *r  0*(0s0S X0 0" @b@0 0 "p$RN-`p00Sr@j`y`0 0S$ PM Pzh1 jX   PP1  P\ 0  j P    P  q" t0P 0"\  U D @@00TЍÿ́̈́$̈́RF-p`!4@(P0:\ 3tP0q 00j@d00`P   T0ק0ֵ 90@`⸒P@T@7 0 0"@̈́̈́$&΄T΄P@-L@0@  P8 8  @T eu΄$HHD0/$ 0@-R@ 0P0S 3/P@-@0S 3/P 0 R 0S000N-0M 0 0P0@M0p`S( PE \ 0, 0M $ 0 W}00  P  RrP0$S 0^ 0$Ss R , )}U\` 0S PPQ`P 00 \ R^&0 $ ,0 0  R  R0, \$\: B R | r      P8& P  R  Z( ɷ ႑ P  R    R(ɷ PPU 0 Z (RP  R   0 SQPPj Kl9|90@-@T P@@€ 0 000 /7@-P @R|PcP PX0P P*6 40PPa 0P>9%g%@-@P @(:j{PP@-13/@-@`P  |1 3/Ѝp@-@ M|   @P}| Ѝ-4M,0  100000 004Ѝp@- M 0`000PP0O 88 0 P  < S T D00S 8PUJf|@T* Ѝp@΄΄@- M$ 0@000P Ѝ/@-@P 1S 3//4 @-0SP .F΄N-(Mp@PPW P QQF 0 e00$ 0C<0e Y!@0S0B 0 00Q #  $!(`P  0`P   &001000`P HGV  P?P PU:P(Ѝ΄:τN-8Mp@PpQ0 !  $0P`$Q VP1 Z U 001@0 SP0 0 0$0000P P0 U ! $PDPP0`V ᓐ)8ЍLτxττN-PR0M`M @P Q PB0 !   0~Pp$ W1[ 001@0S`00000000bP[ 0100TP <  \0 pW `*0ЍLττ@-@0P 0 0 @@-@P1S 3/8< Q! QH%H5N-ZMMP0hIZ  0 00T0\ X0 PPG p`BzP +Z΍0 T088\00X0PP200`0#888Z T 0X0 8 8\0P U0`d ^h0l`d h0lQ^ |\dlt($ A0A RH@0P D@@Q@ ? #88 R #!  ⯘ T$1#)<00P  S<0+ 000000YO@?@ T7Z΍ 0X0T88\0rP A SB: P0S0 84 0 < *&!:S R00CS`ÁhÁpÁÁxÁÁ864606,6(6000Sh00S%20 9000S 0000P  +0L0Z70p00 0#ptpPZ`?`30tp0px p$ 0$`0,0(0P pW03?X0S Q2/\  $:Q$ $$0 0 L0<L04RH op`Ⱔ?`Z.0 4`0004 40@0@00<080PO03? 03?%pWP00S4Z΍  00D 3D`0@0P00L0H0P*03?4SL0"  L A S:o `?`P  pP  P0S L000L0PPP L000 L0o0`?`0'  bZ΍70 T0 8@X@8\0SPZ0T X@0 0\0FP0 D0@-`@PpP $ 01/@-@4` Pp>ApBJ߄e߄@1 @-@ 0, "` + R!0S   Rե0P0 P00|`0( P: SP00P0d0L0]rd0   1?C0<000800400000,004FlEv߄L=H4>ApB>@-$@` Tp P0000 P T 0 0 0 Ѝ@ Ѝ@-0000@- l 00Ѝ@-@-P@p` 0 00P= @-@MPpQ` 7X 0p0$8 0 $4 00 00 @ЍD-MPp` l00 0+ @Pr@ 0! P0 00 0 0@@ rP:@Ѝ 0D-`p@ovQ0 jvQ+ PP( W 0'0 0 $8 0$400@e@0P0  hP P T:PP PЍN- M @P 0g `P> v p%v 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:``  Ѝ@-M @0P  0 a P}YЍs@-PP@N3 P 0`P%  P@P:7&!  @X)L N@ NQ0S|߄߄߄ )ـD-P`p@P  V(000p00 0dHJI@-@@?@- 0h0 @\ 0 S< 0:0080$0PCP0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p V@T:00Sp0XQd@j P` V@T*@m0Pp4F@-`0P d@p rV@T:00SX1Qd@j`T0 P` _V@T :00S֢ Ӣ4FN-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P姢0@ @P0 ##U 00 00 4F7@-<@ oi 5\P 0P>0D-p0P<@ 00 Sod`P `V :p 0 P$Sm  04FD-M`p@P p0 (0`0# 030 RPUP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ=F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\STH0p".d &.0h  l0SH0, =x SH0p.d .0h  l0SH0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(PUЍ2Tv"3_I ᄀD-p`@%PP{  @P PP^|1 T040Dp@0 00L000H000P00* 0  Z0tR000<@ 00,00$00(0ep/0p`S0,0000Wj`  0@00< ; ;S s04 000M?M @ @ @ @  40,ᄀ@-@p `PP  ᄀ@-00S 3/@-00S 3/@-@-0 0S 3/@-@04 ,?<100rl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`I0`FV 0##0ޚ !"(     "8 \ 0 1#(00 0P1!4P1#000v-㄀N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0僚# py)(  S py)4y)0 p圗)8 0S f-㄀N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Y-㄀㄀p@-@`P9Q" 0!",` !!4!#000f9p4 0 1!41#000p``@@ Pp@fV 0p@T  0p@p///N-p@Pԑ @Dg0Sj``g 0eSc0-S  V0$R0s0) V3!-KP V V0sS J0bSsSE K0P0 C R RnStS5@S/Q,: S'  Q# 000C S O0000S 00V1@S@0000 0R@ @ @D4F0 0C 0 0C R0 /4FRD-p`B@ PU L`e@QgSR@-@  B P P 00000<<0Q@-@ 00000#40P0SC PUP0" P  0`#V? P&`V?#0`r V? pP "$ Qq R00pJ`~Pp1~p# `K0W00 S0r0Q #$0 0CQ1  0 0C \/ 0p@-P(@`4@D$0S 3/<`4@4@D 04 (0R0 0p0@-@@ 0\ P\ S0S0/@-@ 0S 000S3/4F8@-@ 0S(P \000S ,0S 3/4P 04PE4 (0R3/00084F8@-l0@00S 3/ 0S(P 000800S 3/4P 04PE4 (0R4F1S0101/@-@ 003/ 0@ 8@-hrP@0 0S 3/000018 8@-hrP@0 0S 3/000018@-D0D00@-00S 3/x0N-(`&Pedp`=f+? Z18 ?[ paJW0@000@000[ [ 0 0 DJZ 000000 0 0 0 @e+ P Y 000W0@0@0s00#$ 9$0Dp@-@PT `&n/A!Q4S\CpQQ \  V`#tA`Dp@7 p^p@T T䄀䄀D@-@0S00[ Y@V@-`P@p1S"@P3 T0S䁂䁂TܖLHD000@S@00&4F/䄀,䄀2䄀5䄀@-P`p@@0S PPF-pP `V! #0崖M D 0 0`S` 4A3/ Q 0 0`S` 3/0$@Th000S 3/0S ؗ0 03/ї 000}8䄀8D4Fp@-P8ř@PB $0P@$0(0003/P`0 @0 R(  0 @:0`0,000S 3/0 03/`PX0 00S0`0010 `m `p|4FN-`崠Pp@z 00 0 70:00`0`  BR񟗎|ЊDS$$B\ 񟗁괅D䅂DlW@@ "H@ 001000000000R0 0 W@1 @#r0 t@$[| S+[F[1 > T;` 000000000<<00S00 R @Pi>d0? ([  R  l@PU0d44I4 R @fTt00H@D I R@W@1@!(D8 ,AH000P $@ @DP 0(P 0044J4 R @ @D 0S00S RS p40P0$` 0&  0[P&P(@  0NPP4@4@D  0@P 40 S ` `F 0Sp@W@1S 0S T0$7 R J R@-@ 0 4P!  R A \  !<"<  R 01S; qpp+Rp 0 $ Q 0S D/@0SQU 0 UY#P P  0SeXn/\ P0 R1SP 1S01TP1SO !L L! T 090D@ PR? s,200@00) g@Q ,:Q0TP 000P 0;D0@ ! !hT 0001PeQ Ѝ@-@p !@RAPP @` >@00@Q0p@-@`@`YPpP PpD00PP D00TP 0000P 嵌 pp(6F-@MpP婎`Pu 1P010110`R 000 1SL@PSt@ A@(㎎P @I0t0000103/@T#@T 0$4+ H@(Ox@ 4@ P<@P @0T@(0 \@݌P@ HP?0$$!$1*B wq@0t0019 7@51 0` `012/110X `#@P 0 D`0x00t00p00l0(0h00d0$0@)PP  PЍ(64F}䄀ـ䄀a䄀䄀䄀䄀D7T@\~~8@-@0T,0Pᚊ@<P8@B$<P8@+8䄀䄀䄀0/4F8@-@<P tPt\<i<`$Q@P H<P  88@c, ^8䄀4FVD(6儀 儀_D$儀L70L  BR L P    L / 0L 0$0/@- R R@L@@- R R 0L0@-Q 0L0@-@0S S 0L00T0 0L0@- Q Q Q 0L0P 0L0I /H0S0H0/ @- P`@`Pp  0S"$!RV|P P <L `01 0h|5F_I4Ek愀儀@-`T@0S 40S < L400)0I5F_I愀儀>EN-P $0`岠p  R˂˂̂̂̂̂Ȃ̂(˂(ʂD˂0S*0KS,ɂdɂʂ̂̂DɂdɂWx@@ Wd@ @ 80{Hz SP0r0-![0#Z*RZS0S 2 CT02,,0@Pťz @Pt@W@10S0Z :Z@000\P@ Z 00Sc d3/`2@0@0S 3/00C S!1!X010! 0 @㝄C0S0   T RQ RN SL  S 00@@) !R> ;  WZ8S6 1@0 R/ , Z*S( @P#  V700 @TT@0 Vq3 0 0 0003/@P0 0^@@Ѝ 8878T89愀DVz愀愀TE係$@-`Ppd6U@ PPE"P1 700Pp@-,)+  zP z zP z dlA56P \A)8 P )6P 0E)(1<P P402000000S 3/zP Oz (:KPQ` ݃P [)HzQP @0 @4@ppC愀儀愀5F 焀5F焀5F*焀f焀dE8焀焀F-PMx5h5P  ( XQ <4 8,! O$DC`P 4 0>$`-pP p P 0000001#100S30d8t#3/T3 dC-!B6!#!`p5!  / &  0800000 58 6 N0 L:P2 "08 h<0003/P ^ \20X20 P 003/PO@00 0 03/FA 0P001000 0ق8 0͂ 0‚|P^00<08 P/P P墂,9 00噂;!@0` (10 )1%0$10%1]0&1[0'192 TQ00x, 08u ЍM䄀75FqE焀儀&脀5FR脀k脀M6F 脀脀脀脀<‚脀脀鄀TE&鄀-鄀8@- <@<P'001(01$0 1 0$1G85Fb鄀<͂|ȂƂ8@-P@P80000$0< @5#8 8400 87F8@-0<0:08 @T=  00c  @T5 00c 0b' 0S0#' @T0% @T0 @T p2 0S   @320,2 @T 400 @}82@,2S@@ @2@ 0 000000!00S 3/VP[ 0`P B  `` ` ` ``daQ \!QL!B@($ ,   Q/P$ 0!@@ @ P 0"! ($ @ @, < 00S0S: H0 7F E0 R0/7FP0< Ӓ0 00/7FQS P 00$ 0//7FR P0(, //7FP 0 /7F8@-, @P20 0 , 0 $ 0 0 0 0 P8< \0p@-`4P4@ 0S@Pp7FQ <0\0440 \   /0 S//7F@-@P 40< 4#   P7F@- ( $  ,R @ HD @ L@T  ($   ,}2@J@$0  4 4 8 /7F/1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00F8@-A`0= 00s000 0 _00=0-=`0Rs0P RP0S=0=00S 3/`P80@-@ 0S 3/00S3/1D-@`` !v`R  - - !-  r  w?  8 '1PpzP  Zw B C PpUw?`Ppv`P  Vw PpUN-`PMp } PI@Pw >11n?1 1=11= >C= 0]1101 0S{0 X'5}50B0@ Sq 0=0= 0=0!00S: 3/PP71S+ 0 0S 3/R0q<`00P`4uP/ </= 0==03= </=0= <l|/=0= <Pt/<0HH y}0V0=0,T=0 =l}Tg?$| \0  \%40 00V}/@00 0010ĭ= Z =PU`$3r R邀肀肀肀肀肀`LS `8S `0S`(S` SS`r/ } #0㼰 0 STI!~0 {PI= PyY1Z- 0 0l 0C"   | Ա`Q&0!1S# P# C" Y{/ , ̠ p OPP!0s0- RP1  pB# q=R1Q01=0CS0=ą]kPP=0Cs0S 1 T100|P00S 3/P}|}@PЍ}鄀EF鄀鄀鄀鄀鄀鄀鄀WFsƄꄀـƺ*ꄀ2ꄀt9999:9Pꄀ>;hꄀꄀF鄀ꄀꄀ-1 (8 !< //8@-@Q!1+! R 0S 3/$0 1&1 $88킀@-10S 3/p@-!Q0@T88#80w/t000@4`  Va4`S1, @@P@TVp0$0pPQF-4P$ (@U,p0nPP-P` VP> ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH -V<0{,`(P$p.<0@0 0S Z00|0 tD2V   @01P00MZ111400=-^P P0 oń/ـꄀFlF@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp`$0p$p`|@-@@~P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/pFWF/@-0P$30@0P00@7 @ @b///1@-@`  ` 0==S 0S 7 3/=0=8@-@Q-`0Rs0 0`00- 00==0=0 --= ="-8///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# vq00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S@ @ 0SP 0P00 00[u@T @TNRu%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$shSU S  S% S5,0( c Z 1 { QJ0305,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#}sS 1S0 0 0`0(0S B0 !001 00F0T0TG섀*G1섀N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wpjrpp (0 js0 S J , \, ^0s000S 0ss0 \x0305qs0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 L섀>GN-P`0Mp=S =  0 Z  0 `0 000 p0 %002 % &R ( \ - 00'0 00 S4"0 2 R0 R@00\ 0 \0  00S0S030S0#!0=$ 0$6S 0#01 0 0S0S0 $$6S(P 0s0S#$00S rr  R(0 B( \q>{t -?,  9Q $Z2 S/ Q㺢岱k[ Z$ڼ(b#Q lh{? Q $y\YY{ : Z  0, Rp\`9Q=& n?["  R  ! 000` {\@)  K%`$`"4Ct@P S02) \ 0r 0 0Y` 0 #r0Ѝ 0&!&, &/N-@ңP`pB07Fhp@-@h T`PP?SLppP 13/ 06SPUPPp7F{섀@-00 @0 0$6S0X00Ѝ@7F@-@0 0Ѝ@@-0000 0 0|Ѝ8@-@\P8p\0A?3` 0S8` @  X \ T 800Cc00 P  0 P 0 1 >3 0S  00eB1C R@ p  0S0Ps(3 p c0W Nn#@0000}p0 \ pb`0 P 2 0PG `0:0db 0S@0Zp0 [ T2$2 p b0W n1@  =p  0 S 0 p +>Aa00 P 0 uP0 1:0lQDA[ @p  `WV` 1 p `0W @m0@ @ @o =[ p =@`   R >0  .P 0 1 >(00 HAlm8Fw턀h;턀턀턀QJ@-@P Q }00P om0 @P gm00 0`0 T@ P \m0 0 040 (@PQm00 00 8Fh;N-MP, 00 S ` 4P $0KAPy [Rs 0( ~?M 0 3Peڌ@Vo @T\ 0 $00[ 0[S S pSpS pP& 000: S S  Spp0 ,0RS Z P&0 p@& R  $ P4 l W W Wxplhqk` mkl((2[`0Vy:KN-MP@(0 0 P $0 M / 0@ /R R 00 @/fpP0  Cp0 /R $0S |m K$0K`2#Pe pc $0SR! 00 0S dF 0S  @ , n, @T BP@ <R, 0 H0P,0 2l,0@0  1T 0/S)t0`` K$0KqlYW 0S 0( 0$00K8F@-@00X0 P 0LP TPT0S8F0@-  Q   0P  0S 0< 0  P08F8@-WP@mW/@6T&  08P #S?RL0 S50 0P@TXQ P 00@8$Ajk0888F8@-@80P  4000}DP88FN-@ PM`PPE0T U:j^PtQUx Z??  ` 01 HP  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  Q @9F`9Fp@-@P1,``PP p@ePP <0 S" S/08`PPp1\!M 0@Qp8G@8H9N-*Mp P` $ D {P P` 9Rl`T  T D R*h900* R H0P9H@H9p0$,X0k00d,9P@v``m00C#X0 rC)q06X0\0gP@ D0 S*.8(P _ P@@ *>@02DiX0*.PcH86<(*08 0@((^P dL`V| ~ w @u Y'`0 V!#rV> Rj`F v`[:L'@PD0 S?2P@dT 7 '*7 '0@PG7 S 0 R@`Fv`V C`F `F SV K JP0@ 0*.0 !C1S! S01V@ 6*&f0 Fo0@d@5 @0cS0S4 R~P yP 5* @%0 bRd FT!L45*.*0(%PH:$@?P 5@A4P2D0 S$ ?P!+D0@⺡ Sp 1 `P ` aP@;P  { [@-`P$4*$0,D `@\@ @C0@ 00 Q -  0RP $  Q0 Q 0 Q 0q3#  `A`AR  B `A`AR B `A`ARQ { @08b 0B<** i0Re$2 K @D@{0k0@! @!1[@!1** c10RL@@P@`TWc8@ @`P pMc.\1 @D0 SA$8p1 0 0,1@ @0*@P`5c@W`P 0* *0@,`P cP@ldVP@g@dY: c`@ 0@P*ލ8G8F9H9G? @9F`9F@8H_t񄀍񄀦 xH-? ? @@ M0?P?P0P  ;Ph `P 006D PR( P `Kx8F򄀽ȄȄx0 0@-TM P @὎P T H b 0@ @00,@L@0 TЍ08FN-M@(D d ,0P"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  fb@{ S`Gx`  0`G3` x`@0|0eP`  0/S\S@@ '1Sʝ\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8fPH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ʝ\0V0 S! d/ aS H 0aP P\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  _a@kP 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%~P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  D`RW P @ + 4W 0 `4/ `40S 4 0` 4P P @ \( $$$D3(#$0 \:`'PP(`d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 P E`@Q`d@g 3VI `PP@d0 S?2P:* p0@SP/d0 S2 0P)* pPW`:  0oP@`  0fP`@`gP_d0 S2 0P* p`@a pލ8F/ـ9Hbt򄀂9G @9F@-0 04@-pMA0S- _000CS^^^^^__^ t@_0_0 @P l_  P& @+@_pЍ8FDŽ DŽТDŽDŽDŽdфՄ0 @-@`Pp j_00 00 8@- Pp@ P_8/p@-@P`E_ p@8 0P/XGp@-0/S\S10/S\S !f RC 0A/R\R   ``P .Q Q \Q/Q /Q\Q @.T S\Q/Q\  0L/Q\Q  B PR 0T R/    / @ 0Q dQ00Q\ 0\/S\SL /Q\Q/\\\ ps;u;t;8@-0$@2PPR8t;0䄀l 0@-MBtT^/Q\Q 4 0 $"" 2/ۍt;DlLGp@-Pt M0`Bt\^/P\P < 0( ,"" 03?/@-@P`pP03?@„2 3?2/ 0 3?2/ @-1 @b\s@-P4`@ P 0 | D-`@T pPP,0p/S# /; P dP  @P0/S S / $  P@@0jPP0S P8@-P@  8@N-pjPPB[P`@-P:@gr/PJZ@D   PP(  P @/  @ V RT0@D0 ` V  V RvvP PPЍF-p@P#T ` P&0SPQZ0T  Q00Q0Sqq @- 0P p@-P@ Pp B0p@F-Pp(`@P   0P R@0S  N PP0Asp@-P`@P P  -P@@pD-p0t @PP 6 `  P  A P PeP@PT@-Pp`s@P  p P  P@@03?'S0<Ͽ\ : 03? S: 2/00R#3//D-@P(p(1`  3 10  172/p6o$`: 0 3?,#,8$#4 0p@-R @ 4O<Ͽ @ T `PbP6oU a bv pppp@-@P`Pp$ 0e2/ 2/$ 2/03? 0pp@-P`"2@Pp0Pe `R3?6o0P3?5_0 PpN-@:`P@ pl 7 p1y PPg  <Ͽ 01 PP  0 P  3? 0Pg3? 0 U`0( 01` 0 `P( 5_;0$P p@-@PP`6oV $ 2/PV40 P PpN-P(,p P ` 06o`Bo P;9: 7p A-@p`7PP oV 0AOPD-p`P@P `P@     00 @P q F-M`p0P@P&  0 @P  0  0@P05/  t00  0@T  > ЍF-MPp0@O`P'  0P   0 0`P0:  00  0`P  Ѝ@-Pp`@P0 0P@ 0 0 @N-P@`P2 0P*q)p P @Ppp; 0 mP4 0@ p  40p@-P`@  0p@p@-P@ P  P d01p@9pN-Pp@+7`P^V 2/R2$ 2/ `)  0G0 P R`E 0 0P  `P640 0:3?$0. (2/ Z& U*pT*  Qp  0 S P0:0402003?,#,8$#40`Ѝ 8@-@;PP$03? "u 02/3?03?08P p ,0`$0P////dG) 02/R//$0 3?@-<Ͽ @2/ b4O d* Q01$'Q8@-@P  805_P04 P02020088/F-@` $pP$03?S0<ϿP3?U 6o9: 7`5_p P@-0 @-p`P@P P $  ~ @8@-P@PP@408N-@ ppP9 `<Ͽ 6o P fPPi0$ PfPc02/1 Q*  0A 003? 0U  HP 45_0 P7?0 * @-@/PP92P2 40p 01$`2/3?b6o`( 6? 0 P 03?p 0p3? 2/03?0p P0SP 03?`06o`0P @-@0 P 0R@-0^0P # S:7@-@0P0$ 0QS>p@-`P@P  @el3@0P:@p04@- @ #D$@@4$s0RGp@- R 0 R!q ! P`A"!@ 1 p01 #p01 #p01 #p01 #\ 1U0p$P 0S "r ! "pI@-0@-@   0!E 0,Q/M@-  @U&@ZN-`p< &@P0 0 0S 0  KY 0U( &P0` 0 Kcq'& & P` `@@ UV 0T( ЍNTЍO N-XM`xP@@S@3&PUR-&PMX TUp1p! 0T ! T  r  r   T00S  0T0 0 S:PEW0:.  0SX`g DBT0T0TP ꄰ0 0VXЍ{YNN-`@PW 303 :% 0 `V p@PZUT# 2\WV:`Vp 0Pd@` UVN-P0@M`p$00 `(0<0d@P )T0`0d0p Pp  YdT  0rcpd `f`@Ѝ茌%+N@-\    @ Č @T @T\: Sl 0p@-@P`UU 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS: %Q %Q0@0Vpp:I@-@Pd0    `0STTPPp0UT00:ID-P@p`0 0S P 0@@@0 0zPP@0U:0 :IF-@p`g@P0 0S  <P0PPP@P0T:0 :IN- M DP H@p :0 0S*m$0Q `V v  V9P4@\+W) \  L0 Q 0 7@$ pW   0=\C0#{T$Pp Ip Qp R \R Q  R0`S00KT:IN-8MPPp`A 00M080 2   @ R@P2     W 8 0S X0S ` @<` @ P @P R`@0 S S #S `0S`^ S`0S=S S R S S R=S000W0 =8 P7 00 ` 0\R R`  R W ` R0( 000K K,@ (@ Z00@S 8 @ @P | OP<0V*0S `Q8@ P  ^P$$9P`VK:I B@-P`@p  0S@6/P 0T@-@@0/PP@-P@p!`!UQ`g`00  /N@-@(P 0@80S *000C NN-@T PU 0p c` PUVQ V `Q`UpbqPPPaPPPSP`DS*qp⇑qpp pY. p Z )    \0:`'U$T01 3 Q5`F25 5`"'a  %*V0@@Q5 5 !0 pp10/0 0 0 X0\0P T0/0PN-PPp @ ` @cp@H`D@@UV \  \' V`{ `Tp{ pXI     Z:PVPPW T0 bT P0 ecTN>P:0@-0 @ PPQ *T: S0 S1#00N-pP `PGp iq1@T+:S@ Z&* @T@e@e  00P PE i  P@ AT:@e@ Z  T RKpG[Ѝp@-P@`P Nps0@-0P X \@Q:  BQ0 S//s@-@P `PT  TpT @0S@`V5|RQN-P.A@@@T: p``d0 0 ;/ 0Pp W: QV*e@PSR@-0 dP@`0\ S \ pp | 0s0\@R cN 0 R 0/0S/\0/ 0S\0/R@-@@0S0R00@T@0 lR0|/@-0@lT0 S|qR 0R0/0 0Q`/8@-@PuP00C R8T80S `/0\8@-PP@sO@P w8@-0\ @T\  A0@- S@T0SAp@-@P`h0@TP 0P@@S0P P 0S00p:I8@-P@T P  8P/0S 0 CCSQ/0 SR//@- Ąq@00S0@cT  00S00S/Q@-00 0c\0 0@@0SQ/P00S/0b0 R*/0@-0P@0 T0S0 0S/P/D-Pp`P @ @DP T PdP q0\/P/@-}_@H@` p(V  P @B p@-@`TP1P!@Tp耖@-@@DT@-QQb!6 @ @ q$!@ Ua0PQe0PP  l10Q1c0000wN-` fР0! S R: : @P0  n! [[+&0 0+ 0 ᓾk0傱   j 0!a0 b00  ~蟆p@-Q`@`P60  PE0R00SR P0`RpN-XM@Pxp@|` W P R r0`F-`F+`F Y W`F`F 000 W WG r|  A 0 >k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍON-PMpP}%S:@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʚ@ 0 0MS ISo iS mSj@@(0 ,@:0[ R R00F@@06S$ (0 @: 0[, , R R004S@@"($   b00S*[.00[00@@@( 0 v0 @!@` @H 04Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S~ 0bPЍONp@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:PpN@-00@pP`P 0S R 0d0V R@--\`@@-@0 KR GRMR kR iR BR000N-00Q x\@ D 'R $R 【`pꐢ +  @PDS0D D7D{7K_ @UT:N@-@0 KR GRMR kR    iR BR000-@-  @ Ѝ/-@-H H3 0꠆@-p@-0D@P0@@ `0F PPp :IImJN-HM0@ C :S000C0 0,@ 0a8@,BT@0C B D$ @D( <@X@, 0PD4`@D4LpFP8< @@,@ P@0`pD@RP@DB @ @ ꔓP$P@  $@'  PPr%<UP EL8(P  ( k$r , \(0 Ō `0 Ǽ0  k"9j@a@ DajA!H jJ*L0DH,LQ@  C" RB $P Br $@R SV (000S8 R [PPkA`Q <\Q |P P:QpaAl[ 8P PQ,@09[,P PC Q PA Pw@Y㰠0 10pЍM0?`0P0`0 0[ K0ePU 0Sv  &$ 0  < <`&d=`P0`00+ [ K ePU @`R`<` < <`&d=`` 0S P000 % @ [ p1p!W 0S P 0 bQ  b $0    @0 gpg@p@0S0@0000+" [ p pR Q @0 S702@05\ W:0    \ g z 0S 0@0000*" [n p pR $Q @0( S702@05\ W:0    j\ g M 0S$ 00   0[A K0ePU1V:%P` 0S$,  0  ?4[$ K0ePU&,&4,<l0d`4``P 00 0Sp0 p8`l0pL0 0T0T00/>0l0P7*0h000`pd0 p0(0xTpL wpG0S[! 0K ePP[ K ePU:6cPc0hOP [ K ePU:Q6cPc1 0  &a6PE&P [ K ePU:6c  a[ K ePU:6c  cc0P(pQ (5000 hh7 R*h( Q:0S lp/΄S>l0pL0 0 T0T00P4`l08P00X0X00d PX4{00p1[W p $8`mPO!= Sh\l pL@00p0V0S 07[] K0ePU$p0 g0R0000 0S b Y40S&4&,<004 S 1p00$p0WP`$000S 0S 0[ K0ePU0V 10007P`0000pp(0pS p8`00 8@@I8:IAIAIAI@-\@0SI T&3 bRX60X6 S f>0X6@\T@8:IRN-M@` a>k0?s0Sf0?s0 SapW^PU[t0SW   =0 RN0?s0S SG (`u,  0@ 0#      0 H'0 pR"  P0UP  G0 `PP0S "2L0 hp N< `;< R R RYЍ@IcScAI=@IAI@I_I@I AI3N- MaP㨑 P%<@%q+x30@0P 0 a P!p $ ( , P! 0 P! 4 P! 08    0B0 8< p0tp  P0 pC D0PND <0 0 Ѝ@IAIH@I= AIx郀@-,00 S ;@@z@I\v/@-L2H @Q P(PP@^1@Is@-@`PT  pT @0S@PU|@-@[20  0 0 0 0  @-M@ &1Ѝ@-@8Q4 M0    Ѝp@-`P` \\09;XwT0@TP@ DP 4@0Tp}Y@I,0 0R 8Q 40S0/@I00S8/@I@-,M@`P  %P `l P   P <:4:0 :  0  0 0 0 0  00S-0U 1P0  0 0 0 0  d0Up\ 0C8:003/,ЍY%8@-@TP R0@@04Q4@040080008@I@-00S   4Q Q4S4P S 40S00 $0R @I@-@t1@  eTUX+1P L %D1D!S  P0 (!R P ,:`@TP:?>T.P1pA7T80S ::W &P@9 9P 9x8 P h94@P0TN 9@I AI UvB@- @P,03/0  @I,0 @-@P $T`0 @@ 0S$0 T h  \ p@Pp`I[@It=D@ @-l00l0S(2@2}@2`I\Ds@-0AQh010P0p0X00S10S( #, s S4XX2 :`P  PXXx(AXXP`0XPQ0@A 2P 20S 00S  0R n20@X` h2Q b20 40X2}|,0 l\ /T  lЍp@`I AIAI@I)AIAIh_Iـ$DT_I@-O 0 @ID-P`@"2j 0 +0@0 @ppl; 0 c000` a?a1 TD0p@0,0DG0iIAI<:IAI@ID:I@I@IF-p0@`S S,   0 0R0  + P PP P FPQ 0iI@I@Id1s@-PX!00C@SF<<<0PavPoPk  0 P@d;08#$40@<|0<0H@ <\0<0?@@0@0|AI8iI8@-T@TP0 00S<<q08@Z0^0(0S88@8iI=xs@-|A'P  d2`8'TBP  Q*4G0$2/ $R$2$B`0V02 0S( #, s S4h `)0:W`P ` 00lQdAl0h0d 0\0S P1 R 00 S ,/(A /  /Q  /0!4 @/0`P//00 00E0`0E `<0Ѝp@= AIAI8iI@IAIAIh_ID>P00* H 04 RU%H 4 R/PDs@-+cPcP @PPP 0cP pZ/h`0S P 0cPQ 4X/0G/0(  0|蠆T8>U30@-MLP @-4 @ %  %@%Ѝ08>+61s@-`0&46S0S #=yG 焀 @-.// Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/P[Q @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/ 0R b0A1Q A1/ 0R b0AQQ AQ/ 0R bAQ0A/@-mLM DG DGD%pDHHH\\\] ]]]]&]-]4]<]D]L]T]\]d]l]s]z]]]]]]]]]]]]]<%($p$do_dfu}r},}}!}$}(}+}.}2}5}9}raw_accessdo_env_importdo_env_exportU-Boot 2013.04-dirty (Apr 20 2013 - 08:30:43), bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxloadaddr=0x80200000kloadaddr=0x80007fc0fdtaddr=0x80F80000fdt_high=0xffffffffrdaddr=0x81000000bootdir=/bootbootfile=uImagefdtfile=am335x-boneblack.dtbconsole=ttyO0,115200n8optargs=mtdids=nand0=omap2-nand.0mtdparts=mtdparts=omap2-nand.0:128k(SPL),128k(SPL.backup1),128k(SPL.backup2),128k(SPL.backup3),1920k(u-boot),128k(u-boot-env),5m(kernel),-(rootfs)dfu_alt_info_mmc=boot part 0 1;rootfs part 0 2;MLO fat 0 1;MLO.raw mmc 100 100;u-boot.img.raw mmc 300 3C0;u-boot.img fat 0 1;uEnv.txt fat 0 1dfu_alt_info_emmc=rawemmc mmc 0 3751936dfu_alt_info_nand=SPL part 0 1;SPL.backup1 part 0 2;SPL.backup2 part 0 3;SPL.backup3 part 0 4;u-boot part 0 5;kernel part 0 7;rootfs part 0 8mmcdev=0mmcroot=/dev/mmcblk0p2 rommcrootfstype=ext4 rootwaitbootpart=0:2nandroot=ubi0:rootfs rw ubi.mtd=7,2048nandrootfstype=ubifs rootwait=1nandsrcaddr=0x280000nandimgsize=0x500000rootpath=/export/rootfsnfsopts=nolockstatic_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offramroot=/dev/ram0 rw ramdisk_size=65536 initrd=${rdaddr},64Mramrootfstype=ext2mmcargs=setenv bootargs console=${console} ${optargs} root=${mmcroot} rootfstype=${mmcrootfstype}nandargs=setenv bootargs console=${console} ${optargs} root=${nandroot} rootfstype=${nandrootfstype}spiroot=/dev/mtdblock4 rwspirootfstype=jffs2spisrcaddr=0xe0000spiimgsize=0x362000spibusno=0spiargs=setenv bootargs console=${console} ${optargs} root=${spiroot} rootfstype=${spirootfstype}netargs=setenv bootargs console=${console} ${optargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpbootenv=uEnv.txtloadbootenv=load mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeramargs=setenv bootargs console=${console} ${optargs} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${mmcdev} ${rdaddr} ramdisk.gzloaduimage=load mmc ${bootpart} ${kloadaddr} ${bootdir}/${bootfile}loadfdt=load mmc ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}mmcboot=echo Booting from mmc ...; run mmcargs; bootm ${kloadaddr} - ${fdtaddr}nandboot=echo Booting from nand ...; run nandargs; nand read ${loadaddr} ${nandsrcaddr} ${nandimgsize}; bootm ${loadaddr}spiboot=echo Booting from spi ...; run spiargs; sf probe ${spibusno}:0; sf read ${loadaddr} ${spisrcaddr} ${spiimgsize}; bootm ${loadaddr}netboot=echo Booting from network ...; setenv autoload no; dhcp; tftp ${loadaddr} ${bootfile}; tftp ${fdtaddr} ${fdtfile}; run netargs; bootm ${loadaddr} - ${fdtaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootm ${loadaddr} ${rdaddr} ${fdtaddr}findfdt=if test $board_name = A335BONE; then setenv fdtfile am335x-bone.dtb; fi; if test $board_name = A335BNLT; then setenv fdtfile am335x-boneblack.dtb; fi; if test $board_name = A33515BB; then setenv fdtfile am335x-evm.dtb; fi; if test $board_name = A335X_SK; then setenv fdtfile am335x-evmsk.dtb; fiset_default_envenv_importsdxbimaroc8(Hsaveenvfdt_fixup_memory_banksethaddr__of_translate_addressƹ̹ҹٹไ乄󹄀 ــ!'-1;5?D INS^insz ӡ ú ɺѺ޺纄𺄀 ــ $j6GPYary лٻ󻄀 "9Bf[iip{ ــҼ׼缄켄ــ  miiphy_register( w ń0ńCńSń]ńińsńńCźdfu_writedfu_readdfu_fill_entityʄʄʄʄȄʄʄʄmmc_file_opdfu_read_medium_mmcdfu_write_medium_mmcdfu_fill_entity_mmcnand_block_opdfu_write_medium_nanddfu_read_medium_nanddfu_fill_entity_nandg΄l΄j΄i΄1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./ 789-456+1230. #(-27<FP'@Bmmc_set_iosmmc_reset_controller_fsmmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupverify_bbt_descrcreate_bbtԄԄԄԄԄ ԄԄ,ԄԄՄ Մ3@ Մs@6ՄC@MՄS@dՄ5 @zՄu @ՄE @ՄU @Մ6@@Մv@@ՄF@@քV@@քx@ք9@/քy@Fքr@FքI@^քt@^քY@vքq@Մ@Մ@Մ@Մ@Մ@Մ@ք@ք@ք/ք/քFք^քFքքvքքքքքׄׄ2ׄGׄ\ׄrׄׄׄׄׄׄׄ؄؄4؄ I؄ ^؄ t؄ ؄@؄:@؄*@؄J@؄؄<ل,'لL>لTل>jل.لN0ք@UVY ZZ YVUe03f2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $-6?HAZSle~w =4/&QXCJu|gn2; ) zsha^WLE+"90cjqxGNU\dmv@IR[,%>7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy(((((AAAAAABBBBBBEPTGMK0123456789ABCDEF0123456789abcdef #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     ــv7_dcache_inval_rangeext4fs_devreadeth_get_dev_by_nameERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x I2C: %s baudrateNAND: MMC: loadaddrNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: machidUsing machid 0x%lx from environment Starting kernel ... bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled %-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddrethaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as arguments ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! bootcmd## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order initrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartnofilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'bootmboot application image from memoryloadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationdfu_alt_info%s: "dfu_alt_info" env variable not defined! listDevice Firmware Upgrade [list] - device firmware upgrade on a device attached to interface [list] - list available alt settings Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type \cecho args to console[args..] - echo args to console; \c suppresses newline EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... eepromEEPROM sub-systemread devaddr addr off cnt eeprom write devaddr addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'exitexit scriptext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem. All numeric parameters are assumed to be hex.ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4loadload binary file from a Ext4 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystem. All numeric parameters are assumed to be hex.ext4ls ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %ld bytes written usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [] [bytes [pos]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load. All numeric parameters are assumed to be hex.The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. All numeric parameters are assumed to be decimal, unless specified otherwise using a leading "0x".cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pin?alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'Error writing the chip. Error reading the chip. Valid chip addresses: %02X%04x: %02xCRC32 for %08lx ... %08lx ==> Error writing to the chip. %08lx: Error reading the chip, %02lx %04lx %08lx ? Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) i2cI2C sub-systemcrc32devloopmmmwnmprobeUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx Testing %08x ... %08x: Iteration: %6d Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Tested %d iteration(s) with %lu errors. bytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? %08x %04xmtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)OKERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! #part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device erase MMC %s: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesmmcinfodisplay MMC info- display info of the current MMC devicenoronenand%s%dDevice %s not found! invalid partition number %d for device %s%d (%s) %ug%um%ukmtddevnummtddevname%s%d,%dcannot add second partition at offset 0 %s: offset %08x beyond flash size %08x %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect mtdparts=mtdpartsinvalid mtd device '%.*s' partition size too small (%lx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08lx@0x%08lxno partitions for device %s%d (%s) unexpected character '%c' at the end of device incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=omap2-nand.0mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts variable doesn't start with 'mtdparts=' device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions defaultmtdparts=omap2-nand.0:128k(SPL),128k(SPL.backup1),128k(SPL.backup2),128k(SPL.backup3),1920k(u-boot),128k(u-boot-env),5m(kernel),-(rootfs)delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08x 0x%08x %d no partitions defined active partition: %s%d,%d - (%s) 0x%08x @ 0x%08x could not get current partition info defaults: mtdids : %s mtdparts: addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found no partition id specified partition changed to %s%d,%d define flash/nand partitionschpartchange active partitionpart-id - change active partition (e.g. part-id = nand0,1)No such device Device %d: %s... is now current device .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Not a NAND device bootdevice ** No boot device ** ** Device %d not available %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b nand_writesizenand_oobsizenand_erasesizenot a NAND device Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx quietdump no devices available Device %d bad blocks: %08llx scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x OOB: %02x %02x %02x %02x %02x %02x %02x %02x .raw%s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrnbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemgatewayipnetmaskhostnamerootpathserveripdnsipdnsip2domainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment Saving Environment to %s... ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandssaveenvsave environment variables to persistent storagedeleteeditexportimportprintsavemallocFailed to initialize SPI flash at %u:%u No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) Failed to map physical memory Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SPI flash %s failed sfSPI flash sub-systemprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset len - read `len' bytes starting at `offset' to memory at `addr' sf write addr offset len - write `len' bytes from memory at `addr' to flash at `offset' sf erase offset [+]len - erase `len' bytes from `offset' `+len' round up `len' to block size sf update addr offset len - erase and write `len' bytes from memory at `addr' to flash at `offset'Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory-o-a-z-ntruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificusbHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only480 Mb/s1.5 Mb/s12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. treeUSB device tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: usbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' %s arm-angstrom-linux-gnueabi-gcc (Linaro GCC 4.7-2013.02-01) 4.7.3 20130205 (prerelease) GNU ld (GNU Binutils) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacks*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" env_nand.cErasing Nand... Writing to Nand... FAILED! !readenv() failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. CRC32 for %08lx ... %08lx ==> %08lx syntax error ** Abort ERROR : memory not allocated U-Boot# *?[\ERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressed ** Too many args (max. %d) ** verbootdelayHit any key to stop autoboot: %2d %2d NULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialfailed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_get_configuration_no: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d usb_new_device:cannot locate device's port. Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox host** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type %s: Wrong sequence number! [%d] [%d] %s: Wrong size! [%d] [%d] - %d DFU complete CRC32: 0x%08x %s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... ;%s: Device %s not (yet) supported! DFU alt settings list: dev: %s alt: %d name: %s layout: %s eMMCOneNANDRAW_ADDREXT2EXT3EXT4Request would exceed designated area! mmc %s %p %x %xfat%s mmc %d:%d 0x%x %s %lxext4%s mmc %d:%d 0x%x /%s%s: Layout (%s) not (yet) supported! dfu: Read error! dfu: Wrong file size! fatext4%s: could not find mmc device #%d! %s: could not find partition #%d on mmc device #%d! %s: Memory layout (%s) not supported! %s: invalid nand device %s: nand_%s_skip_bad call failed at %llx! using id '%s' Could not locate '%s' ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpU-Boot BUG at %s:%d! mtdcore.cRemoving MTD device #%d (%s) with use count %d nand%d%lu MiB nand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%012llx No space left to write bad block table nand_bbt: Error reading block for writing the bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%012llx, version 0x%02X nand_bbt: Error while writing bad block table %d nand_bbt.ccreate_bbt(): chipnr (%d) > available chips (%d) Bad block table not found for chip %d nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Can't scan flash and build the RAM-based BBT nand_bbt: Out of memory Bad block table at page %d, version 0x%02X nand_create_default_bbt_descr: Out of memory ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMDUnknownNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitAttempt to erase non block-aligned data Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx Timeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters Error: Unrecognized Mode[%d]! ECC: uncorrectable. Error: Ecc is wrong Error: Bad compare! failed Error: Can't switch ecc, no devices available 1-bit hamming HW ECC selected 8-bit BCH HW ECC selected SW ECC selected NAND: Unable to find NAND settings in GPMC Configuration - quitting SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x WARNING in %s line %d f_mass_storage.c | / - \composite.c, H%c=%umusb-hdrccomposite%-8s%-16s%04xUnknown x%02xunable to find file size: %s file too small: %s Linux File-Store GadgetMass Storage FunctionGADGET DRIVER: %s usb_dnl_dfuusb_dnl_ums%s: unknown command: %s %s: failed!, error: %d usb_dnloadDOWNLOAD ... OK Ctrl+C to exit ... ERROR: No memory to alloc RNDIS packet at %s:%d/%s() ether.ctimeout sending packets to usb ethernet ERROR: %s: rndis parse error %d at %s:%d/%s() USB RNDIS network up! ERROR: can't alloc requests at %s:%d/%s() ERROR: received NULL ptr at %s:%d/%s() ERROR: rx submit --> %d at %s:%d/%s() ERROR: dev->rx_req invalid at %s:%d/%s() RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:af:00:00usbnet_devaddrusbnet_hostaddrERROR: Need valid 'usbnet_devaddr' to be set at %s:%d/%s() ERROR: Need valid 'usbnet_hostaddr' to be set at %s:%d/%s() cdc_connect_timeoutERROR: The remote end did not respond in time. at %s:%d/%s() ERROR: can't autoconfigure on %s at %s:%d/%s() ERROR: can't run RNDIS on %s at %s:%d/%s() %02X%02X%02X%02X%02X%02XERROR: can't init RNDIS, %d at %s:%d/%s() using %s, OUT %s IN %s%s%s STATUS HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready ERROR: %s failed, status = %d at %s:%d/%s() RNDIS/%sU-bootERROR: controller '%s' not recognized at %s:%d/%s() usb_etherEthernet DataRNDIS Communications ControlUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d ** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10d %s Failed to mount ext2 filesystem... %s read outside partition %d ** Invalid Block Device Descriptor (NULL) ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! ** Unrecognized filesystem type ** bootfile** No boot file defined ** %d bytes read in %lu ms (compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotateunknownautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx A33515BB1.5Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM Could not get board ID. board_nameboard_rev not set. Validating first E-fuse MAC A335BONEError %d registering CPSW switch A335X_SKError %d registering USB_ETHER raise: Signal # %d caught   D2DD;2tD; DDDDx@0j߀PD^ــfــfــــfــf ــf@ــ_ــ[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OS/ addr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.m|Rــs|\Wــw|Tــ`Pــ||TWــ|Nــ|LWــ|LPــ㒄OــLmSــb_NــMWــcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed@ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)@tــaــc@ــjــoــv<ــ}@ــp@JــTــO@Xــask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] [addr] - run script starting at addr - A valid image header must be presentaddr part [dest] - extract from legacy image at and copy to   ( ( 0 0 8 8 @ @ H H P P X X ` ` h h p p x x !!!!!!!! ! !(!(!0!0!8!8!@!@!H!H!P!P!X!X!`!`!h!h!p!p!x!x!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""" " "("("0"0"8"8"@"@"H"H"P"P"X"X"`"`"h"h"p"p"x"x"""""""""""""""""""""""""""""""""######## # #(#(#0#0#8#8#@#@#H#H#P#P#X#X#`#`#h#h#p#p#x#x#################################$$$$$$0ʄa,8   /   $$D!@#$%^&*()_+ QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>? 789-456+1230. 13457890=    ;'~ <>?789-456+1230.  & & &@&@&Bbt01tbBqq()*+,-./0123456789:;<=>?&0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N  28  !"#$%&'()*+,-./0123456789: ℀,a cx\|4|4,℀X_fx\A℀X_fx\[℀X_fx\eserial0lTnmmllmeserial1l\nmnmtmeserial2`ldnm nm|meserial3@llnmnmmeserial4 ltnmnmmeserial5l|nm$n mm{DD<儀||T} P716C67(6:6nDl7d6t7䙂~ 47|7 L6  77D7 7  Dς,ȂÂp9zEEEEE7E77  p9 p9p9zEEEEE7E77%  09Ethernet Gadget`7F9 5Fl鄀@6F 愀z鄀     @  @  @               @t삀삀L삀p삀/Q_(`d`<"!l",c ddd  JJ  =⚄@t隄KfPl^@!^ـ(鄀L$sfـmfL$sfـf@+f`f͖8e@0>e$P+C1j5D g2gـ`kcom|lۂ䄀@2zgg͖}@5hhƜCi7Ji\i.@ୀ i8iـi8i!jj9jkk09kkl9jk@T€m@:n*nn:n on:jnImH9Rmsm=v[ _@"__yLyziz@MnzzZ|8N^|\be@$ieeԀª|Z||i|LPwsw`o _ .f~`?ow| i$jhLjv`l'6||>>>>A AAhBlBC,D4DEEEEEEEEEEEEEEEEG G$G(G,G0G4G8G >8>P>h>>>>>>>?(?@?X?p??????@@0@H@`@x@@@@@@A A8APAhAAAAAACCCCCCCCCCCCDDDDDDDDDLEPEdFhFlFpFtFxF|FFFFFFFFFFFFFFFFFFFFFFFFLGPGTGhGlGpGtGxGGGGGGGdYhYlYpYtYxY|YYYY8<@Hhlpx $(,<@DTX\lpt8DHLP\`dhtx|  $(48<@LPT$048<HLPT`dhlx|  $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                 !!! !!!!! !$!(!,!0!4!8!,>>>>>>>>>>>>>>>>>>??? ??? ?$?0?4?8?Dž5$Dž